4NQGA

Crystal structure of ca(2+)-regulated photoprotein mitrocomin from jellyfish mitrocoma cellularia at 1.3 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
197
structure length
197
Chain Sequence
b'SMGSRYAVKLDTDFDNPKWIARHKHMFNFLDINSNGQINLNEMVHKASNIICKKLGATEEQTRRHQKCVEDFFGGAGLEYDKDTTWPEYIEGWKRLAKTELERHSKNRVTLIRLWGDALFDIIDKDGNGSVSLDEWIQYTHCAGIQQSRGQCEATFAHCDLDGDGKLDVDEMTRQHLGFWYSVDSTCEGLYGGAVPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitrocomin
publication title Multiple Isospecies of Ca(2+)-regulated Photoprotein Mitrocomin from Jellyfish Mitrocoma cellularia: Cloning, Characterization, and Crystal Structure
rcsb
source organism Mitrocoma cellularia
molecule tags Luminescent protein
total genus 81
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4nqgA00
4PDZA 3KO0A 1ALVA 1DJZA 3VGOA 4CFRA 2LMVA 4YGAA 4DCKA 1H8BA 1S26D 1XA5A 5KU1A 4P5OE 1LINA 3AKBA 5IBWA 4NDCA 3JVTC 5FYXA 1QATA 1NX1A 1EH2A 1TNWA 1DMOA 1CDMA 1CDPA 1GQMA 3D10A 2JC2A 2CNPA 4ZCVA 5TNCA 1IQ3A 4CIDA 4NDBA 1KK8C 5B8IB 4YGCB 1WRKA 5AXIA 2BBMA 1NX0A 2LCPA 1CMGA 4GAOA 4GNKB 1NYAA 3H4SE 5CSIA 1A2XA 2K2FA 4AQIA 2Y5IA 3TDZA 1C7WA 2HF5A 2LANA 4MZLA 2MLEC 1OOJA 1RFJA 1JUOA 4R1EA 3PN7B 1MWNA 2Q91A 2PASA 3LK1A 1CKKA 4JWQA 1QV1A 2LC5A 3FWCA 3EK4A 1IH0A 1E8AA 3DF0A 2BBNA 3EVVA 3HCMA 2KGBC 1DJHA 3A4UB 1CFFA 1J7QA 1AJ5A 1JBAA 1RWYA 2I18A 2JXLA 4M2QA 1F4QA 3GK1A 5KSZA 2M49B 4PE7A 3DVKA 1NCZA 1QIVA 1BODA 3EK8A 3TZ1A 1DJXA 5CSFA 1NWDA 1NX2A 2HETA 2TN4A 5JOLA 2MHHA 4M2PA 2GGZA 2K7BA 3OB2B 3DF0B 1J7PA 3BQ3A 3ICBA 1S6CA 1IJ6A 4WRIA 1PVBA 2H61C 2KI6D 4ORCB 3I5FC 2KBIA 3LLEA 1A4PA 2K8MB 2M7NA 4MSPA 1CNPA 1TNPA 3PATA 1PULA 4IL1A 1FI5A 1QASA 2H2KA 2V53A 2I7AA 3RLZA 1F70A 1W7IB 1DVIA 2LNKA 4U8DA 1K9KA 1FPWA 3CR5X 1YUSA 1L7ZA 3GOFA 1MR8A 4MZJA 3F45A 2MJWB 5D7FA 1OMVA 2WC8A 4I5JA 5AERA 1K2HA 1QLSA 3DVJA 3PSRA 1SR6C 5GQQC 2M1UA 4I5KA 4WQ3A 1XFZO 1ZOTB 1BR4B 3AKAA 3BOWA 4YRUA 4YI8A 2GV5A 1B9AA 1KSOA 1SBJA 4A4BA 2WCBA 1EG3A 1NIWA 1TIZA 2JT3A 1EJ3A 4C0LA 1FF1A 1FI6A 2LP3A 4PHJA 2FOTA 2NZ0A 3I5FB 2M9GA 4MN0A 2OS8C 1MXLC 1Y1XA 4C0JA 1JFKA 2EC6C 1OE9B 2LMUA 2JRFA 4E68A 1J55A 4MRXA 2VRGA 5K89A 2KAYA 2L4IA 2WOSA 3OP0A 4OR9B 2KOTA 2ISDA 5CSNA 2K2AA 5HYDA 1CTRA 1BOCA 1DGUA 2LLUA 2LP2A 3DD4A 1DJWA 1XYDA 4GUKA 1R6PA 4UPGA 2L4HA 3K21A 5KTYA 1M39A 1K94A 1S3PA 3PN7C 2JNXA 1CLBA 2JU0A 1HT9A 2KNEA 2ZN9A 1SNLA 1K8UA 1B7TY 4BY5A 4Q04A 3PALA 2JOJA 3CGAA 4MVFA 3LK0A 4GBAA 1KK7Y 2NCPA 2L51A 4OCIA 2OS8B 2OPOA 4F0ZB 1JC2A 1K90D 2L0PA 1KCYA 3FIAA 1DTLA 2EC6B 3I5IB 2PSRA 3NSOA 1YVLA 1YRUB 1AP4A 1MF8B 1QTXA 2LAPA 3CS1A 3OX5A 2MA2A 1C7VA 1YUTA 5G08A 2KYFA 3SIAA 3EKHA 2KGRA 2JTZA 2WCFA 3M0WA 5DKRA 1XO5A 2B1UA 3NXAA 1AK8A 3TUYB 2F3YA 5BPJA 1XK4C 1YVHA 2BL0C 5HLVA 4ETOA 1AHRA 1OMRA 2JZIA 3OHMB 1KFXL 5ER4X 1BLQA 2ZRTA 3SIBA 3SG7A 3GK4X 4USLA 4QJ4B 3FWBA 4MRYA 1ZMZA 1AJ4A 1EG4A 4QJ5B 1SL9A 1A75A 2K0JA 2KI4C 3FS7A 1S5GY 3CR4X 1AVSA 1S36A 1XK4A 1CFCA 1LKJA 1Y1UA 3C1VA 4JPZB 4YI9A 3CTNA 1G33A 3KF9A 4PHKA 2GGMA 5CPVA 1B8RA 1IJ5A 2KDHA 1NX3A 3EVUA 1K96A 1Q80A 2LMTA 1WDCB 1V1FA 1EL4A 2K7CA 4P2YB 3NSKA 3E3RA 2FCEA 4MLWA 3VROA 1A75B 1SMGA 1TNQA 2PRUA 1QX7A 4XJKA 4ZCUA 5J3XA 2M7LA 4YBHB 2BL0B 2IS9A 5AFPA 1FBVA 1NSHA 1SCMC 1UHNA 3SG5A 3TDIA 1BF5A 2PVBA 1TCFA 2Y1NA 2BE4A 3I5GC 5I8NA 1CFDA 1GJYA 2F8PA 2BCAA 3KHEA 1H4BA 4DRWA 3SG6A 2KI4B 4DS7A 1M46A 1SY9A 1KFUL 4N1FA 1OZOA 1BR1B 1PRWA 2LUXA 3O4YA 4L9MA 4XJKB 4A4CA 1M31A 4BY4A 3WNXB 1G4YR 3AAJA 1DGVA 2G9BA 1PSRA 2I94A 1RJVA 2BCBA 2BE6A 2MBXA 1XFVO 2LHIA 1IGVA 1J7RA 1RECA 1JSAA 4AOMA 1YTZC 1OZSA 3IQQA 1BJFA 4MBEA 3TS5B 1HQVA 1IG5A 2EGDA 4PE1A 2ZNEA 1CLMA 4PALA 1TOPA 3VRRA 1SW8A 2JWWA 1SCMB 3CWGA 5DKNA 1JFJA 2K7DA 3I5GB 1Y0VH 1W7JB 4CPVA 3I5HC 2HQ8A 2M8UA 1UHHA 2JNFA 2BCXA 3BYAA 4PCWA 2SASA 1G8IA 1FW4A 1UHIA 3VRQA 3IQOA 3ZWHA 1ZUZA 4N5XA 5I2QA 4MZKA 1X02A 2BKIB 1LVCD 1TRFA 5HKYA 4DUQA 1TN4A 3I5IC 1WLMA 2M97A 3BOWB 3NSLA 2KSPA 1CDLA 3MSEB 1B4CA 1OQPA 2PMYA 1IQ5A 2JT8A 4WQ2A 1ODBA 3BUMB 1KWOC 1GGZA 3TUYC 3NSIA 3PM8A 3KEVA 1B1GA 1TCOB 2JT0A 2E30A 2R2IA 3BUWB 1SKTA 1Y1AA 3EVRA 1DJYA 2M0RA 2K61A 4CFQA 4NQGA 2Y4QA 3TDUA 1ZACA 3I5HB 3GK2A 3CLNA 4ICBA 1J7OA 1SK6D 1QVIZ 1J1DA 2KHNA 3O78A 1CMFA 2AMIA 4ORAB 1R2UA 1YX8A 1CM1A 4PE0A 2BKHB 2HPSA 1ZFSA 1WDCC 3VRNA 1YRTB 3BUXB 1TTXA 4NDDA 2ZN8A 1LA3A 1JF0A 2KI6C 1CLLA 1NP8A 1XFYO 2A4JA 5DKQA 4GGFA 5PALA 1D1OA 1F55A 2E6WA 4N1GA 2LM5A 1SYMA 2P6BB 3O6BA 3SJSA 3EKJA 2JTTA 4QJ3B 1IKUA 1TNXA 1KWOB 4GGNA 2F2OA 4PHNA 1SCVA 2KYCA 1F71A 1K9PA 2F33A 1B8CA 4I5LB 2NLNA 2PALA 1QX5B 2OTGB 1RTP1 2Y1MA 2WCEA 1QLKA 4HSZA 3BUNB 2CXJA 2JXCA 1BMOA 4C0KA 1B7TZ 4MEWA 1PSBA 4JQ0D 4DIRA 1JWDA 2M1KB 1L2OC 2HQWA 1KQMB 1KK7Z 1KQVA 2L5XB 2D8NA 2K7OA 1S6IA 2WORA 1WRLA 2LUCA 5D69A 2MRDA 3JTDB 1A29A 3SG2A 1OMDA 1S6JA 1JF2A 5F6TA 1YURA 3A8RA 2KBMA 2WNDA 3LCPC 1F54A 1KFXS 1QV0A 1CDNA 3HX4A 3WHTB 1MQ1A 1RK9A 3TS5C 1SRAA 1V1GA 2JULA 2L50A 1QX2A 4OVNF 1MHOA 1BT6A 2RGIA 2KFGA 1NCYA 2CCMA 5HKWA 2BECA 2KFHA 4YGDB 1N65A 2F2PA 1IWQA 1SPYA 2LHLA 3JVTB 3OX6A 2MAZA 1NCXA 2KAVA 3EK7A 4I5NB 2KQ6A 2CBLA 1DJIA 3SG4A 1SL7A 4HRHA 1L2OB 1Y6WA 1KK8B 4YGEB 1F8HA 2L2EA 2I2RE 2LVIA 3LL8B 1AUIB 1S5GZ 5AEQA 4OV2A 1WY9A 3AAKA 3RM1A 3WHUB 1RROA 1M63B 1A03A 1N0YA 1UP5A 2L98A 2O60A 1CM4A 3OB1B 1XVJA 1OSAA 1EXRA 1QXPA 1M45A 3D0YA 1K9UA 1CB1A 3PLFB 2LLSA 2LVKA 2NXQA 4YGBB 4OKHA 1J1EA 1QS7A 3DVEA 3VRPA 2G2BA 4FQOA 3WXAA 1UUSA 3IF7A 4HREE 1F4OA 4PHMA 2CTNA 2LVVA 2H61A 1BU3A 1KFUS 1CFPA 1U5IA 1DT7B 1XFXO 1B47A 2AUCA 5HLOA 3ZNIA 1QIWA 3KPXA 5I2OA 2M29A 3D0YB 1XFUO 4GFTA 1MUXA 3SG3A 1MXEA 2LE9B 1IRJA 2AAOA 4AQJA 2Q4UA 1K95A 2KAXA 2KFFA 1PVAA 2DOQA 2CT9A 2LLTA 3DVMA 4HRGA 3BXKA 1B8LA 2F3ZA 2LV7A 4M2OA 1NPQA 1LXFC 1U5IB 1QVIY 3CZTX 4FTGA 4TNCA 3BUOB 5CSJA 1BG1A 2M3WA 4CLNA 2EHBA 1VRKA 1DJGA 4D1EA 2QACA 1NUBA 1GGWA 2OTGC 1YUUA 5JJGA 2ZRSA 1DF0A 1UHJA 3PFVA 1PK0D 2JQ6A 3CR2A 4XYNA 4ORBB 2MLFC 1UWOA 1SL8A 1KQMC 2JPTA 2KQYA 5HKZA 3O2PA 4GGFC 1YX7A 2QPTA 2ZKMX 1LA0A 2O5GA 2NCOA 5ER5A 2FJUB 3QRXA 1ALWA 1SR6B 2FCDA 1UHKA 1N2DA 2LVJA 2SCPA 1YR5A 1XFWO 1KSMA 1K93D 3JTDC 2ZNDA 5I2LA 1WLZA 2ZFDA 1S1EA 4PE4A 4GPLB 5AANA 1QJTA 1C07A 1PALA 2COLB 1UURA 1WRZA 1DF0B
chains in the Genus database with same CATH superfamily
4PDZA 3KO0A 1ALVA 1DJZA 1OOGA 3VGOA 4CFRA 1DEKA 2LMVA 4YGAA 4DCKA 1H8BA 1S26D 1XA5A 5KU1A 4P5OE 1LINA 3AKBA 5IBWA 4NDCA 3JVTC 3OGNA 5FYXA 1QATA 1NX1A 1EH2A 1TNWA 1DMOA 1CDMA 2QEBA 1CDPA 1GQMA 3D10A 2JC2A 2CNPA 4ZCVA 5TNCA 1IQ3A 4CIDA 4NDBA 1KK8C 5B8IB 1OOFA 4YGCB 1WRKA 5AXIA 2BBMA 1NX0A 2LCPA 1CMGA 4GAOA 4INWA 4GNKB 1NYAA 3H4SE 3UO9A 5CSIA 1A2XA 2K2FA 4AQIA 2Y5IA 3TDZA 1C7WA 2HF5A 2LANA 4MZLA 2MLEC 2WCLA 4IJ7A 1W9ZA 3BFBA 1OOJA 1RFJA 1JUOA 4R1EA 3SS5A 3PN7B 1MWNA 2Q91A 2PASA 3LK1A 1CKKA 4JWQA 1QV1A 2LC5A 3FWCA 3EK4A 1IH0A 1E8AA 3DF0A 2BBNA 3EVVA 3HCMA 2KGBC 1DJHA 3A4UB 1CFFA 4JKTA 1J7QA 1AJ5A 1JBAA 1RWYA 2I18A 2P71A 2JXLA 4M2QA 1F4QA 3GK1A 3SS3A 5KSZA 2M49B 4PE7A 3DVKA 1NCZA 1QIVA 1BODA 3EK8A 3TZ1A 1DJXA 5CSFA 1NWDA 1NX2A 2HETA 2TN4A 5JOLA 3L47A 2MHHA 4M2PA 2GGZA 2K7BA 3OB2B 3DF0B 1J7PA 3BQ3A 3DXLA 3ICBA 1S6CA 1IJ6A 4WRIA 1OW4A 1PVBA 2H61C 5FI7A 2KI6D 2QEVA 4ORCB 3I5FC 2KBIA 3LLEA 1A4PA 2K8MB 2M7NA 4MSPA 1CNPA 1TNPA 3PATA 1PULA 4IL1A 1FI5A 1QASA 2H2KA 2V53A 2I7AA 3RLZA 1F70A 1W7IB 1DVIA 2LNKA 4JD9A 1K9KA 3OBVA 4U8DA 1FPWA 3CR5X 1YUSA 1L7ZA 3GOFA 1MR8A 4MZJA 3F45A 2MJWB 3EG5B 5D7FA 1OMVA 2WC8A 4I5JA 5AERA 1K2HA 1QLSA 3DVJA 3PSRA 1SR6C 5GQQC 2M1UA 2YGUA 4I5KA 4WQ3A 1XFZO 1ZOTB 1BR4B 3PJIA 3AKAA 3BOWA 3BFAA 4YRUA 4YI8A 2GV5A 2WCKA 1B9AA 1KSOA 1SBJA 4A4BA 3S0AA 2WCBA 1EG3A 1NIWA 1TIZA 2JT3A 1EJ3A 4C0LA 1FF1A 1FI6A 2LP3A 4PHJA 2FOTA 2NZ0A 3I5FB 2M9GA 4MN0A 2OS8C 1MXLC 1Y1XA 1T14A 3PM2A 4C0JA 1JFKA 2EC6C 1OE9B 2LMUA 2JRFA 4E68A 1J55A 4MRXA 2VRGA 5K89A 2KAYA 2L4IA 2WOSA 2WC5A 4INXA 3OP0A 4OR9B 2PYQA 2KOTA 2ISDA 5CSNA 2GTEA 2K2AA 5HYDA 1CTRA 1DC1A 1BOCA 1DGUA 2LLUA 2LP2A 3DD4A 1DJWA 1XYDA 4GUKA 1R6PA 4UPGA 2L4HA 3K21A 1TUJA 5KTYA 1M39A 1K94A 1S3PA 3PN7C 3R1PA 2JNXA 1CLBA 2JU0A 3D75A 1HT9A 2KNEA 2ZN9A 1SNLA 1K8UA 3K1EA 1B7TY 4BY5A 4Q04A 3PALA 4FQTA 2JOJA 3CGAA 2L2CA 4MVFA 3LK0A 4GBAA 1KK7Y 2NCPA 2L51A 4OCIA 2OS8B 2OPOA 4F0ZB 1JC2A 1K90D 2L0PA 3CDNA 1KCYA 3FIAA 3B7AA 1DTLA 2EC6B 3I5IB 2PSRA 3NSOA 1YVLA 1IIOA 3S0BA 1YRUB 1AP4A 1MF8B 1QTXA 2ERBA 2LAPA 3CS1A 3OX5A 2MA2A 1C7VA 1YUTA 5G08A 2KYFA 3SIAA 3EKHA 2KGRA 2JTZA 2WCFA 3M0WA 5DKRA 1XO5A 3Q8IA 2B1UA 3NXAA 1AK8A 3TUYB 2F3YA 5BPJA 1XK4C 1YVHA 2BL0C 5HLVA 4ETOA 1AHRA 1OMRA 2JZIA 3OHMB 1KFXL 5ER4X 3DY9A 1BLQA 2ZRTA 3SIBA 3NHIA 3RZSA 3SG7A 3GK4X 4USLA 4QJ4B 2WCHA 3FWBA 4MRYA 1ZMZA 1AJ4A 1EG4A 4QJ5B 1SL9A 1A75A 2K0JA 2KI4C 3DZTA 3FS7A 1S5GY 3CR4X 1AVSA 1S36A 1XK4A 3FE8A 1CFCA 1LKJA 1Y1UA 3C1VA 4JPZB 4YI9A 1LS8A 3CTNA 1G33A 3KF9A 4PHKA 2GGMA 5CPVA 1B8RA 1IJ5A 2KDHA 1NX3A 3DYEA 3EVUA 5FI6A 1GM0A 1K96A 1Q80A 2LMTA 1WDCB 1SSEB 3S0EA 1V1FA 3N7HA 1EL4A 2K7CA 3R1VA 4P2YB 3NSKA 3E3RA 2FCEA 4PT1A 4MLWA 3R72A 3VROA 1A75B 1SMGA 1TNQA 2PRUA 1QX7A 4XJKA 4ZCUA 5J3XA 2M7LA 4YBHB 2BL0B 2IS9A 2KPHA 1OOIX 1FBVA 1NSHA 1SCMC 1UHNA 3SG5A 3TDIA 5AFPA 3NGVA 1BF5A 2PVBA 1TCFA 2Y1NA 2BE4A 3I5GC 5I8NA 1CFDA 1GJYA 2F8PA 2BCAA 3D73A 3KHEA 1H4BA 3VB1A 4DRWA 3SG6A 3SS4A 2KI4B 4DS7A 1Z2CB 1M46A 1SY9A 1KFUL 4N1FA 1OZOA 1BR1B 1PRWA 1TWOA 2LUXA 2PQLA 3O4YA 4L9MA 1M31A 4XJKB 4A4CA 3WNXB 4BY4A 1G4YR 3AAJA 1DGVA 2G9BA 1PSRA 2I94A 1RJVA 2BCBA 2BE6A 2MBXA 5FI2A 1XFVO 2LHIA 1IGVA 1J7RA 1RECA 1JSAA 4AOMA 1YTZC 1OZSA 3IQQA 1BJFA 4MBEA 1XFRA 3TS5B 1HQVA 1IG5A 2EGDA 4PE1A 2ZNEA 1CLMA 1ORGA 1TOPA 4PALA 3VRRA 1SW8A 3CABA 1QWVA 2JWWA 1SCMB 3CWGA 5DKNA 5HL1A 1JFJA 2K7DA 3I5GB 1Y0VH 1W7JB 4CPVA 3I5HC 2HQ8A 2M8UA 1UHHA 2JNFA 2H8VA 2BCXA 3BYAA 4PCWA 2SASA 1G8IA 1FW4A 1UHIA 3VRQA 3IQOA 3S0GA 3ZWHA 1ZUZA 4N5XA 3D76A 5I2QA 4MZKA 1X02A 2BKIB 1LVCD 1TRFA 5HKYA 4DUQA 1TN4A 3I5IC 1WLMA 2M97A 3BOWB 3UNWA 3NSLA 2KSPA 5I94A 1CDLA 3MSEB 1B4CA 1OQPA 2PMYA 1IQ5A 2JT8A 2QEHA 4WQ2A 1ODBA 3BUMB 1KWOC 1GGZA 3TUYC 3NSIA 3BJHA 3PM8A 3KEVA 1B1GA 1TCOB 2JT0A 2E30A 2R2IA 3BUWB 1SKTA 1Y1AA 3EVRA 1DJYA 2M0RA 2K61A 4CFQA 4NQGA 2Y4QA 2QDIA 3CZ1A 3TDUA 1ZACA 3I5HB 3GK2A 3CLNA 4ICBA 1J7OA 1SK6D 1QVIZ 3CYZA 1J1DA 2KHNA 5EL2A 3O78A 1CMFA 1OOHA 2AMIA 4ORAB 1R2UA 1YX8A 1CM1A 4PE0A 2BKHB 2WC6A 2HPSA 1ZFSA 1WDCC 4KYNA 3VRNA 1YRTB 3BUXB 1TTXA 4NDDA 2ZN8A 1LA3A 1JF0A 2BNXA 1CLLA 1NP8A 1XFYO 2A4JA 2KI6C 4GGFA 5DKQA 5PALA 1D1OA 2E6WA 1F55A 4N1GA 2LM5A 1SYMA 2P6BB 3O6BA 3SJSA 3EKJA 2JTTA 4QJ3B 1IKUA 1TNXA 1KWOB 4GGNA 4OZDA 2F2OA 4PHNA 1SCVA 2KYCA 1F71A 1K9PA 2F33A 1B8CA 4I5LB 2NLNA 2PALA 1QX5B 2OTGB 1RTP1 2Y1MA 2WCEA 1QLKA 4HSZA 3R1OA 3D77A 3BUNB 2CXJA 2JXCA 1BMOA 4C0KA 1B7TZ 4MEWA 1PSBA 4JQ0D 4DIRA 1JWDA 2M1KB 1L2OC 2HQWA 1KQMB 1KK7Z 3S0FA 2QEOA 1DELA 2L5XB 2D8NA 2K7OA 1KQVA 1S6IA 2WORA 2K60A 1WRLA 1P28A 2LUCA 5D69A 2MRDA 3JTDB 2JPOA 1A29A 3SG2A 1OMDA 1S6JA 1JF2A 5F6TA 1YURA 3A8RA 3BFHA 2KBMA 2WNDA 3LCPC 1F54A 3B86A 1KFXS 1QV0A 1CDNA 3HX4A 3WHTB 1MQ1A 1RK9A 3TS5C 1SRAA 1V1GA 2JULA 2L50A 1QX2A 3CZ0A 1MHOA 4OVNF 1BT6A 2RGIA 3IVTA 2KFGA 1NCYA 2CCMA 5HKWA 2BECA 1C3YA 2KFHA 4YGDB 1N65A 2F2PA 1IWQA 1SPYA 2LHLA 3JVTB 3OX6A 2MAZA 1NCXA 2KAVA 3EK7A 4I5NB 2KQ6A 2CBLA 1DJIA 3SG4A 1SL7A 4HRHA 1L2OB 1Y6WA 1KK8B 2WCJA 4YGEB 1F8HA 3B87A 2L2EA 2I2RE 2LVIA 3LL8B 1AUIB 1S5GZ 5AEQA 3V2LA 2KLDA 1WY9A 4OV2A 3AAKA 3RM1A 3O4XA 3WHUB 1RROA 1M63B 1A03A 1N0YA 1Z4HA 1UP5A 2L98A 2O60A 1CM4A 3D78A 3OB1B 1XVJA 1OSAA 1EXRA 1QXPA 1M45A 2KLEA 1K9UA 3D0YA 1CB1A 3PLFB 2LLSA 2LVKA 1TUZA 2NXQA 4F7FA 4YGBB 4OKHA 1J1EA 3L4LA 3QMEA 1QS7A 3DVEA 3VRPA 2G2BA 4FQOA 3WXAA 1UUSA 3IF7A 4HREE 1F4OA 4PHMA 2FJYA 2CTNA 2LVVA 2H61A 1BU3A 1KFUS 1CFPA 1U5IA 1DT7B 1XFXO 1B47A 1DQEA 2AUCA 5HLOA 3ZNIA 1QIWA 3KPXA 5I2OA 3S0DA 2M29A 5DICA 2BAPA 3D0YB 1XFUO 4GFTA 1MUXA 3SG3A 1MXEA 2LE9B 1IRJA 2AAOA 4AQJA 2Q4UA 1K95A 2KAXA 2KFFA 1PVAA 2DOQA 2CT9A 2LLTA 3FE9A 5D3OA 3D74A 3DVMA 4HRGA 3BXKA 1B8LA 2F3ZA 2LV7A 3B6XA 4M2OA 1NPQA 1LXFC 1U5IB 1QVIY 3CZTX 4FTGA 4TNCA 3BUOB 5CSJA 1BG1A 2L5YA 2M3WA 4CLNA 2EHBA 1VRKA 1DJGA 4D1EA 2QACA 1NUBA 1GGWA 2OTGC 1YUUA 5JJGA 2ZRSA 1DF0A 1UHJA 3PFVA 1PK0D 2JQ6A 2WCMA 3CR2A 4XYNA 4ORBB 2MLFC 1UWOA 1SL8A 1KQMC 2JPTA 2KQYA 5HKZA 3O2PA 4GGFC 1YX7A 2QPTA 2ZKMX 1LA0A 2O5GA 2NCOA 5ER5A 2FJUB 3QRXA 1ALWA 1SR6B 2FCDA 1UHKA 1N2DA 2LVJA 1C3ZA 2SCPA 1YR5A 1XFWO 1KSMA 1K93D 3JTDC 2ZNDA 5I2LA 1WLZA 2ZFDA 3L4AA 1S1EA 2P70A 4PE4A 4GPLB 3CZ2A 5AANA 1QJTA 3B88A 3FE6A 1C07A 1PALA 3NHTA 2COLB 1UURA 1WRZA 1DF0B
chains in the Genus database with same CATH topology
4PDZA 3KO0A 1ALVA 1DJZA 3VGOA 4CFRA 2LMVA 4YGAA 4DCKA 1H8BA 1S26D 1XA5A 5KU1A 4P5OE 1LINA 3AKBA 5IBWA 4NDCA 3JVTC 5FYXA 1QATA 1NX1A 1EH2A 1TNWA 1DMOA 1CDMA 1CDPA 1GQMA 3D10A 2JC2A 2CNPA 4ZCVA 5TNCA 1IQ3A 4CIDA 4NDBA 1KK8C 5B8IB 4YGCB 1WRKA 5AXIA 2BBMA 1NX0A 2LCPA 1CMGA 4GAOA 4GNKB 1NYAA 3H4SE 5CSIA 1A2XA 2K2FA 4AQIA 2Y5IA 3TDZA 1C7WA 2HF5A 2LANA 4MZLA 2MLEC 1OOJA 1RFJA 1JUOA 4R1EA 3PN7B 1MWNA 2Q91A 2PASA 3LK1A 1CKKA 4JWQA 1QV1A 2LC5A 3FWCA 3EK4A 1IH0A 1E8AA 3DF0A 2BBNA 3EVVA 3HCMA 2KGBC 1DJHA 3A4UB 1CFFA 1J7QA 1AJ5A 1JBAA 1RWYA 2I18A 2JXLA 4M2QA 1F4QA 3GK1A 5KSZA 2M49B 4PE7A 3DVKA 1NCZA 1QIVA 1BODA 3EK8A 3TZ1A 1DJXA 5CSFA 1NWDA 1NX2A 2HETA 2TN4A 5JOLA 2MHHA 4M2PA 2GGZA 2K7BA 3OB2B 3DF0B 1J7PA 3BQ3A 3ICBA 1S6CA 1IJ6A 4WRIA 1PVBA 2H61C 2KI6D 4ORCB 3I5FC 2KBIA 3LLEA 1A4PA 2K8MB 2M7NA 4MSPA 1CNPA 1TNPA 3PATA 1PULA 4IL1A 1FI5A 1QASA 2H2KA 2V53A 2I7AA 3RLZA 1F70A 1W7IB 1DVIA 2LNKA 4U8DA 1K9KA 1FPWA 3CR5X 1YUSA 1L7ZA 3GOFA 1MR8A 4MZJA 3F45A 2MJWB 5D7FA 1OMVA 2WC8A 4I5JA 5AERA 1K2HA 1QLSA 3DVJA 3PSRA 1SR6C 5GQQC 2M1UA 4I5KA 4WQ3A 1XFZO 1ZOTB 1BR4B 3AKAA 3BOWA 4YRUA 4YI8A 2GV5A 1B9AA 1KSOA 1SBJA 4A4BA 2WCBA 1EG3A 1NIWA 1TIZA 2JT3A 1EJ3A 4C0LA 1FF1A 1FI6A 2LP3A 4PHJA 2FOTA 2NZ0A 3I5FB 2M9GA 4MN0A 2OS8C 1MXLC 1Y1XA 4C0JA 1JFKA 2EC6C 1OE9B 2LMUA 2JRFA 4E68A 1J55A 4MRXA 2VRGA 5K89A 2KAYA 2L4IA 2WOSA 3OP0A 4OR9B 2KOTA 2ISDA 5CSNA 2K2AA 5HYDA 1CTRA 1BOCA 1DGUA 2LLUA 2LP2A 3DD4A 1DJWA 1XYDA 4GUKA 1R6PA 4UPGA 2L4HA 3K21A 5KTYA 1M39A 1K94A 1S3PA 3PN7C 2JNXA 1CLBA 2JU0A 1HT9A 2KNEA 2ZN9A 1SNLA 1K8UA 1B7TY 4BY5A 4Q04A 3PALA 2JOJA 3CGAA 4MVFA 3LK0A 4GBAA 1KK7Y 2NCPA 2L51A 4OCIA 2OS8B 2OPOA 4F0ZB 1JC2A 1K90D 2L0PA 1KCYA 3FIAA 1DTLA 2EC6B 3I5IB 2PSRA 3NSOA 1YVLA 1YRUB 1AP4A 1MF8B 1QTXA 2LAPA 3CS1A 3OX5A 2MA2A 1C7VA 1YUTA 5G08A 2KYFA 3SIAA 3EKHA 2KGRA 2JTZA 2WCFA 3M0WA 5DKRA 1XO5A 2B1UA 3NXAA 1AK8A 3TUYB 2F3YA 5BPJA 1XK4C 1YVHA 2BL0C 5HLVA 4ETOA 1AHRA 1OMRA 2JZIA 3OHMB 1KFXL 5ER4X 1BLQA 2ZRTA 3SIBA 3SG7A 3GK4X 4USLA 4QJ4B 3FWBA 4MRYA 1ZMZA 1AJ4A 1EG4A 4QJ5B 1SL9A 1A75A 2K0JA 2KI4C 3FS7A 1S5GY 3CR4X 1AVSA 1S36A 1XK4A 1CFCA 1LKJA 1Y1UA 3C1VA 4JPZB 4YI9A 3CTNA 1G33A 3KF9A 4PHKA 2GGMA 5CPVA 1B8RA 1IJ5A 2KDHA 1NX3A 3EVUA 1K96A 1Q80A 2LMTA 1WDCB 1V1FA 1EL4A 2K7CA 4P2YB 3NSKA 3E3RA 2FCEA 4MLWA 3VROA 1A75B 1SMGA 1TNQA 2PRUA 1QX7A 4XJKA 4ZCUA 5J3XA 2M7LA 4YBHB 2BL0B 2IS9A 5AFPA 1FBVA 1NSHA 1SCMC 1UHNA 3SG5A 3TDIA 1BF5A 2PVBA 1TCFA 2Y1NA 2BE4A 3I5GC 5I8NA 1CFDA 1GJYA 2F8PA 2BCAA 3KHEA 1H4BA 4DRWA 3SG6A 2KI4B 4DS7A 1M46A 1SY9A 1KFUL 4N1FA 1OZOA 1BR1B 1PRWA 2LUXA 3O4YA 4L9MA 4XJKB 4A4CA 1M31A 4BY4A 3WNXB 1G4YR 3AAJA 1DGVA 2G9BA 1PSRA 2I94A 1RJVA 2BCBA 2BE6A 2MBXA 1XFVO 2LHIA 1IGVA 1J7RA 1RECA 1JSAA 4AOMA 1YTZC 1OZSA 3IQQA 1BJFA 4MBEA 3TS5B 1HQVA 1IG5A 2EGDA 4PE1A 2ZNEA 1CLMA 4PALA 1TOPA 3VRRA 1SW8A 2JWWA 1SCMB 3CWGA 5DKNA 1JFJA 2K7DA 3I5GB 1Y0VH 1W7JB 4CPVA 3I5HC 2HQ8A 2M8UA 1UHHA 2JNFA 2BCXA 3BYAA 4PCWA 2SASA 1G8IA 1FW4A 1UHIA 3VRQA 3IQOA 3ZWHA 1ZUZA 4N5XA 5I2QA 4MZKA 1X02A 2BKIB 1LVCD 1TRFA 5HKYA 4DUQA 1TN4A 3I5IC 1WLMA 2M97A 3BOWB 3NSLA 2KSPA 1CDLA 3MSEB 1B4CA 1OQPA 2PMYA 1IQ5A 2JT8A 4WQ2A 1ODBA 3BUMB 1KWOC 1GGZA 3TUYC 3NSIA 3PM8A 3KEVA 1B1GA 1TCOB 2JT0A 2E30A 2R2IA 3BUWB 1SKTA 1Y1AA 3EVRA 1DJYA 2M0RA 2K61A 4CFQA 4NQGA 2Y4QA 3TDUA 1ZACA 3I5HB 3GK2A 3CLNA 4ICBA 1J7OA 1SK6D 1QVIZ 1J1DA 2KHNA 3O78A 1CMFA 2AMIA 4ORAB 1R2UA 1YX8A 1CM1A 4PE0A 2BKHB 2HPSA 1ZFSA 1WDCC 3VRNA 1YRTB 3BUXB 1TTXA 4NDDA 2ZN8A 1LA3A 1JF0A 2KI6C 1CLLA 1NP8A 1XFYO 2A4JA 5DKQA 4GGFA 5PALA 1D1OA 1F55A 2E6WA 4N1GA 2LM5A 1SYMA 2P6BB 3O6BA 3SJSA 3EKJA 2JTTA 4QJ3B 1IKUA 1TNXA 1KWOB 4GGNA 2F2OA 4PHNA 1SCVA 2KYCA 1F71A 1K9PA 2F33A 1B8CA 4I5LB 2NLNA 2PALA 1QX5B 2OTGB 1RTP1 2Y1MA 2WCEA 1QLKA 4HSZA 3BUNB 2CXJA 2JXCA 1BMOA 4C0KA 1B7TZ 4MEWA 1PSBA 4JQ0D 4DIRA 1JWDA 2M1KB 1L2OC 2HQWA 1KQMB 1KK7Z 1KQVA 2L5XB 2D8NA 2K7OA 1S6IA 2WORA 1WRLA 2LUCA 5D69A 2MRDA 3JTDB 1A29A 3SG2A 1OMDA 1S6JA 1JF2A 5F6TA 1YURA 3A8RA 2KBMA 2WNDA 3LCPC 1F54A 1KFXS 1QV0A 1CDNA 3HX4A 3WHTB 1MQ1A 1RK9A 3TS5C 1SRAA 1V1GA 2JULA 2L50A 1QX2A 4OVNF 1MHOA 1BT6A 2RGIA 2KFGA 1NCYA 2CCMA 5HKWA 2BECA 2KFHA 4YGDB 1N65A 2F2PA 1IWQA 1SPYA 2LHLA 3JVTB 3OX6A 2MAZA 1NCXA 2KAVA 3EK7A 4I5NB 2KQ6A 2CBLA 1DJIA 3SG4A 1SL7A 4HRHA 1L2OB 1Y6WA 1KK8B 4YGEB 1F8HA 2L2EA 2I2RE 2LVIA 3LL8B 1AUIB 1S5GZ 5AEQA 4OV2A 1WY9A 3AAKA 3RM1A 3WHUB 1RROA 1M63B 1A03A 1N0YA 1UP5A 2L98A 2O60A 1CM4A 3OB1B 1XVJA 1OSAA 1EXRA 1QXPA 1M45A 3D0YA 1K9UA 1CB1A 3PLFB 2LLSA 2LVKA 2NXQA 4YGBB 4OKHA 1J1EA 1QS7A 3DVEA 3VRPA 2G2BA 4FQOA 3WXAA 1UUSA 3IF7A 4HREE 1F4OA 4PHMA 2CTNA 2LVVA 2H61A 1BU3A 1KFUS 1CFPA 1U5IA 1DT7B 1XFXO 1B47A 2AUCA 5HLOA 3ZNIA 1QIWA 3KPXA 5I2OA 2M29A 3D0YB 1XFUO 4GFTA 1MUXA 3SG3A 1MXEA 2LE9B 1IRJA 2AAOA 4AQJA 2Q4UA 1K95A 2KAXA 2KFFA 1PVAA 2DOQA 2CT9A 2LLTA 3DVMA 4HRGA 3BXKA 1B8LA 2F3ZA 2LV7A 4M2OA 1NPQA 1LXFC 1U5IB 1QVIY 3CZTX 4FTGA 4TNCA 3BUOB 5CSJA 1BG1A 2M3WA 4CLNA 2EHBA 1VRKA 1DJGA 4D1EA 2QACA 1NUBA 1GGWA 2OTGC 1YUUA 5JJGA 2ZRSA 1DF0A 1UHJA 3PFVA 1PK0D 2JQ6A 3CR2A 4XYNA 4ORBB 2MLFC 1UWOA 1SL8A 1KQMC 2JPTA 2KQYA 5HKZA 3O2PA 4GGFC 1YX7A 2QPTA 2ZKMX 1LA0A 2O5GA 2NCOA 5ER5A 2FJUB 3QRXA 1ALWA 1SR6B 2FCDA 1UHKA 1N2DA 2LVJA 2SCPA 1YR5A 1XFWO 1KSMA 1K93D 3JTDC 2ZNDA 5I2LA 1WLZA 2ZFDA 1S1EA 4PE4A 4GPLB 5AANA 1QJTA 1C07A 1PALA 2COLB 1UURA 1WRZA 1DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDZ A;  3KO0 A;  1ALV A;  1DJZ A;  3VGO A;  4CFR A;  2LMV A;  4YGA A;  4DCK A;  1H8B A;  1S26 D;  1XA5 A;  5KU1 A;  4P5O E;  1LIN A;  3AKB A;  5IBW A;  4NDC A;  3JVT C;  5FYX A;  1QAT A;  1NX1 A;  1EH2 A;  1TNW A;  1DMO A;  1CDM A;  1CDP A;  1GQM A;  3D10 A;  2JC2 A;  2CNP A;  4ZCV A;  5TNC A;  1IQ3 A;  4CID A;  4NDB A;  1KK8 C;  5B8I B;  4YGC B;  1WRK A;  5AXI A;  2BBM A;  1NX0 A;  2LCP A;  1CMG A;  4GAO A;  4GNK B;  1NYA A;  3H4S E;  5CSI A;  1A2X A;  2K2F A;  4AQI A;  2Y5I A;  3TDZ A;  1C7W A;  2HF5 A;  2LAN A;  4MZL A;  2MLE C;  1OOJ A;  1RFJ A;  1JUO A;  4R1E A;  3PN7 B;  1MWN A;  2Q91 A;  2PAS A;  3LK1 A;  1CKK A;  4JWQ A;  1QV1 A;  2LC5 A;  3FWC A;  3EK4 A;  1IH0 A;  1E8A A;  3DF0 A;  2BBN A;  3EVV A;  3HCM A;  2KGB C;  1DJH A;  3A4U B;  1CFF A;  1J7Q A;  1AJ5 A;  1JBA A;  1RWY A;  2I18 A;  2JXL A;  4M2Q A;  1F4Q A;  3GK1 A;  5KSZ A;  2M49 B;  4PE7 A;  3DVK A;  1NCZ A;  1QIV A;  1BOD A;  3EK8 A;  3TZ1 A;  1DJX A;  5CSF A;  1NWD A;  1NX2 A;  2HET A;  2TN4 A;  5JOL A;  2MHH A;  4M2P A;  2GGZ A;  2K7B A;  3OB2 B;  3DF0 B;  1J7P A;  3BQ3 A;  3ICB A;  1S6C A;  1IJ6 A;  4WRI A;  1PVB A;  2H61 C;  2KI6 D;  4ORC B;  3I5F C;  2KBI A;  3LLE A;  1A4P A;  2K8M B;  2M7N A;  4MSP A;  1CNP A;  1TNP A;  3PAT A;  1PUL A;  4IL1 A;  1FI5 A;  1QAS A;  2H2K A;  2V53 A;  2I7A A;  3RLZ A;  1F70 A;  1W7I B;  1DVI A;  2LNK A;  4U8D A;  1K9K A;  1FPW A;  3CR5 X;  1YUS A;  1L7Z A;  3GOF A;  1MR8 A;  4MZJ A;  3F45 A;  2MJW B;  5D7F A;  1OMV A;  2WC8 A;  4I5J A;  5AER A;  1K2H A;  1QLS A;  3DVJ A;  3PSR A;  1SR6 C;  5GQQ C;  2M1U A;  4I5K A;  4WQ3 A;  1XFZ O;  1ZOT B;  1BR4 B;  3AKA A;  3BOW A;  4YRU A;  4YI8 A;  2GV5 A;  1B9A A;  1KSO A;  1SBJ A;  4A4B A;  2WCB A;  1EG3 A;  1NIW A;  1TIZ A;  2JT3 A;  1EJ3 A;  4C0L A;  1FF1 A;  1FI6 A;  2LP3 A;  4PHJ A;  2FOT A;  2NZ0 A;  3I5F B;  2M9G A;  4MN0 A;  2OS8 C;  1MXL C;  1Y1X A;  4C0J A;  1JFK A;  2EC6 C;  1OE9 B;  2LMU A;  2JRF A;  4E68 A;  1J55 A;  4MRX A;  2VRG A;  5K89 A;  2KAY A;  2L4I A;  2WOS A;  3OP0 A;  4OR9 B;  2KOT A;  2ISD A;  5CSN A;  2K2A A;  5HYD A;  1CTR A;  1BOC A;  1DGU A;  2LLU A;  2LP2 A;  3DD4 A;  1DJW A;  1XYD A;  4GUK A;  1R6P A;  4UPG A;  2L4H A;  3K21 A;  5KTY A;  1M39 A;  1K94 A;  1S3P A;  3PN7 C;  2JNX A;  1CLB A;  2JU0 A;  1HT9 A;  2KNE A;  2ZN9 A;  1SNL A;  1K8U A;  1B7T Y;  4BY5 A;  4Q04 A;  3PAL A;  2JOJ A;  3CGA A;  4MVF A;  3LK0 A;  4GBA A;  1KK7 Y;  2NCP A;  2L51 A;  4OCI A;  2OS8 B;  2OPO A;  4F0Z B;  1JC2 A;  1K90 D;  2L0P A;  1KCY A;  3FIA A;  1DTL A;  2EC6 B;  3I5I B;  2PSR A;  3NSO A;  1YVL A;  1YRU B;  1AP4 A;  1MF8 B;  1QTX A;  2LAP A;  3CS1 A;  3OX5 A;  2MA2 A;  1C7V A;  1YUT A;  5G08 A;  2KYF A;  3SIA A;  3EKH A;  2KGR A;  2JTZ A;  2WCF A;  3M0W A;  5DKR A;  1XO5 A;  2B1U A;  3NXA A;  1AK8 A;  3TUY B;  2F3Y A;  5BPJ A;  1XK4 C;  1YVH A;  2BL0 C;  5HLV A;  4ETO A;  1AHR A;  1OMR A;  2JZI A;  3OHM B;  1KFX L;  5ER4 X;  1BLQ A;  2ZRT A;  3SIB A;  3SG7 A;  3GK4 X;  4USL A;  4QJ4 B;  3FWB A;  4MRY A;  1ZMZ A;  1AJ4 A;  1EG4 A;  4QJ5 B;  1SL9 A;  1A75 A;  2K0J A;  2KI4 C;  3FS7 A;  1S5G Y;  3CR4 X;  1AVS A;  1S36 A;  1XK4 A;  1CFC A;  1LKJ A;  1Y1U A;  3C1V A;  4JPZ B;  4YI9 A;  3CTN A;  1G33 A;  3KF9 A;  4PHK A;  2GGM A;  5CPV A;  1B8R A;  1IJ5 A;  2KDH A;  1NX3 A;  3EVU A;  1K96 A;  1Q80 A;  2LMT A;  1WDC B;  1V1F A;  1EL4 A;  2K7C A;  4P2Y B;  3NSK A;  3E3R A;  2FCE A;  4MLW A;  3VRO A;  1A75 B;  1SMG A;  1TNQ A;  2PRU A;  1QX7 A;  4XJK A;  4ZCU A;  5J3X A;  2M7L A;  4YBH B;  2BL0 B;  2IS9 A;  5AFP A;  1FBV A;  1NSH A;  1SCM C;  1UHN A;  3SG5 A;  3TDI A;  1BF5 A;  2PVB A;  1TCF A;  2Y1N A;  2BE4 A;  3I5G C;  5I8N A;  1CFD A;  1GJY A;  2F8P A;  2BCA A;  3KHE A;  1H4B A;  4DRW A;  3SG6 A;  2KI4 B;  4DS7 A;  1M46 A;  1SY9 A;  1KFU L;  4N1F A;  1OZO A;  1BR1 B;  1PRW A;  2LUX A;  3O4Y A;  4L9M A;  4XJK B;  4A4C A;  1M31 A;  4BY4 A;  3WNX B;  1G4Y R;  3AAJ A;  1DGV A;  2G9B A;  1PSR A;  2I94 A;  1RJV A;  2BCB A;  2BE6 A;  2MBX A;  1XFV O;  2LHI A;  1IGV A;  1J7R A;  1REC A;  1JSA A;  4AOM A;  1YTZ C;  1OZS A;  3IQQ A;  1BJF A;  4MBE A;  3TS5 B;  1HQV A;  1IG5 A;  2EGD A;  4PE1 A;  2ZNE A;  1CLM A;  4PAL A;  1TOP A;  3VRR A;  1SW8 A;  2JWW A;  1SCM B;  3CWG A;  5DKN A;  1JFJ A;  2K7D A;  3I5G B;  1Y0V H;  1W7J B;  4CPV A;  3I5H C;  2HQ8 A;  2M8U A;  1UHH A;  2JNF A;  2BCX A;  3BYA A;  4PCW A;  2SAS A;  1G8I A;  1FW4 A;  1UHI A;  3VRQ A;  3IQO A;  3ZWH A;  1ZUZ A;  4N5X A;  5I2Q A;  4MZK A;  1X02 A;  2BKI B;  1LVC D;  1TRF A;  5HKY A;  4DUQ A;  1TN4 A;  3I5I C;  1WLM A;  2M97 A;  3BOW B;  3NSL A;  2KSP A;  1CDL A;  3MSE B;  1B4C A;  1OQP A;  2PMY A;  1IQ5 A;  2JT8 A;  4WQ2 A;  1ODB A;  3BUM B;  1KWO C;  1GGZ A;  3TUY C;  3NSI A;  3PM8 A;  3KEV A;  1B1G A;  1TCO B;  2JT0 A;  2E30 A;  2R2I A;  3BUW B;  1SKT A;  1Y1A A;  3EVR A;  1DJY A;  2M0R A;  2K61 A;  4CFQ A;  4NQG A;  2Y4Q A;  3TDU A;  1ZAC A;  3I5H B;  3GK2 A;  3CLN A;  4ICB A;  1J7O A;  1SK6 D;  1QVI Z;  1J1D A;  2KHN A;  3O78 A;  1CMF A;  2AMI A;  4ORA B;  1R2U A;  1YX8 A;  1CM1 A;  4PE0 A;  2BKH B;  2HPS A;  1ZFS A;  1WDC C;  3VRN A;  1YRT B;  3BUX B;  1TTX A;  4NDD A;  2ZN8 A;  1LA3 A;  1JF0 A;  2KI6 C;  1CLL A;  1NP8 A;  1XFY O;  2A4J A;  5DKQ A;  4GGF A;  5PAL A;  1D1O A;  1F55 A;  2E6W A;  4N1G A;  2LM5 A;  1SYM A;  2P6B B;  3O6B A;  3SJS A;  3EKJ A;  2JTT A;  4QJ3 B;  1IKU A;  1TNX A;  1KWO B;  4GGN A;  2F2O A;  4PHN A;  1SCV A;  2KYC A;  1F71 A;  1K9P A;  2F33 A;  1B8C A;  4I5L B;  2NLN A;  2PAL A;  1QX5 B;  2OTG B;  1RTP 1;  2Y1M A;  2WCE A;  1QLK A;  4HSZ A;  3BUN B;  2CXJ A;  2JXC A;  1BMO A;  4C0K A;  1B7T Z;  4MEW A;  1PSB A;  4JQ0 D;  4DIR A;  1JWD A;  2M1K B;  1L2O C;  2HQW A;  1KQM B;  1KK7 Z;  1KQV A;  2L5X B;  2D8N A;  2K7O A;  1S6I A;  2WOR A;  1WRL A;  2LUC A;  5D69 A;  2MRD A;  3JTD B;  1A29 A;  3SG2 A;  1OMD A;  1S6J A;  1JF2 A;  5F6T A;  1YUR A;  3A8R A;  2KBM A;  2WND A;  3LCP C;  1F54 A;  1KFX S;  1QV0 A;  1CDN A;  3HX4 A;  3WHT B;  1MQ1 A;  1RK9 A;  3TS5 C;  1SRA A;  1V1G A;  2JUL A;  2L50 A;  1QX2 A;  4OVN F;  1MHO A;  1BT6 A;  2RGI A;  2KFG A;  1NCY A;  2CCM A;  5HKW A;  2BEC A;  2KFH A;  4YGD B;  1N65 A;  2F2P A;  1IWQ A;  1SPY A;  2LHL A;  3JVT B;  3OX6 A;  2MAZ A;  1NCX A;  2KAV A;  3EK7 A;  4I5N B;  2KQ6 A;  2CBL A;  1DJI A;  3SG4 A;  1SL7 A;  4HRH A;  1L2O B;  1Y6W A;  1KK8 B;  4YGE B;  1F8H A;  2L2E A;  2I2R E;  2LVI A;  3LL8 B;  1AUI B;  1S5G Z;  5AEQ A;  4OV2 A;  1WY9 A;  3AAK A;  3RM1 A;  3WHU B;  1RRO A;  1M63 B;  1A03 A;  1N0Y A;  1UP5 A;  2L98 A;  2O60 A;  1CM4 A;  3OB1 B;  1XVJ A;  1OSA A;  1EXR A;  1QXP A;  1M45 A;  3D0Y A;  1K9U A;  1CB1 A;  3PLF B;  2LLS A;  2LVK A;  2NXQ A;  4YGB B;  4OKH A;  1J1E A;  1QS7 A;  3DVE A;  3VRP A;  2G2B A;  4FQO A;  3WXA A;  1UUS A;  3IF7 A;  4HRE E;  1F4O A;  4PHM A;  2CTN A;  2LVV A;  2H61 A;  1BU3 A;  1KFU S;  1CFP A;  1U5I A;  1DT7 B;  1XFX O;  1B47 A;  2AUC A;  5HLO A;  3ZNI A;  1QIW A;  3KPX A;  5I2O A;  2M29 A;  3D0Y B;  1XFU O;  4GFT A;  1MUX A;  3SG3 A;  1MXE A;  2LE9 B;  1IRJ A;  2AAO A;  4AQJ A;  2Q4U A;  1K95 A;  2KAX A;  2KFF A;  1PVA A;  2DOQ A;  2CT9 A;  2LLT A;  3DVM A;  4HRG A;  3BXK A;  1B8L A;  2F3Z A;  2LV7 A;  4M2O A;  1NPQ A;  1LXF C;  1U5I B;  1QVI Y;  3CZT X;  4FTG A;  4TNC A;  3BUO B;  5CSJ A;  1BG1 A;  2M3W A;  4CLN A;  2EHB A;  1VRK A;  1DJG A;  4D1E A;  2QAC A;  1NUB A;  1GGW A;  2OTG C;  1YUU A;  5JJG A;  2ZRS A;  1DF0 A;  1UHJ A;  3PFV A;  1PK0 D;  2JQ6 A;  3CR2 A;  4XYN A;  4ORB B;  2MLF C;  1UWO A;  1SL8 A;  1KQM C;  2JPT A;  2KQY A;  5HKZ A;  3O2P A;  4GGF C;  1YX7 A;  2QPT A;  2ZKM X;  1LA0 A;  2O5G A;  2NCO A;  5ER5 A;  2FJU B;  3QRX A;  1ALW A;  1SR6 B;  2FCD A;  1UHK A;  1N2D A;  2LVJ A;  2SCP A;  1YR5 A;  1XFW O;  1KSM A;  1K93 D;  3JTD C;  2ZND A;  5I2L A;  1WLZ A;  2ZFD A;  1S1E A;  4PE4 A;  4GPL B;  5AAN A;  1QJT A;  1C07 A;  1PAL A;  2COL B;  1UUR A;  1WRZ A;  1DF0 B; 
#chains in the Genus database with same CATH topology
 4PDZ A;  3KO0 A;  1ALV A;  1DJZ A;  1OOG A;  3VGO A;  4CFR A;  1DEK A;  2LMV A;  4YGA A;  4DCK A;  1H8B A;  1S26 D;  1XA5 A;  5KU1 A;  4P5O E;  1LIN A;  3AKB A;  5IBW A;  4NDC A;  3JVT C;  3OGN A;  5FYX A;  1QAT A;  1NX1 A;  1EH2 A;  1TNW A;  1DMO A;  1CDM A;  2QEB A;  1CDP A;  1GQM A;  3D10 A;  2JC2 A;  2CNP A;  4ZCV A;  5TNC A;  1IQ3 A;  4CID A;  4NDB A;  1KK8 C;  5B8I B;  1OOF A;  4YGC B;  1WRK A;  5AXI A;  2BBM A;  1NX0 A;  2LCP A;  1CMG A;  4GAO A;  4INW A;  4GNK B;  1NYA A;  3H4S E;  3UO9 A;  5CSI A;  1A2X A;  2K2F A;  4AQI A;  2Y5I A;  3TDZ A;  1C7W A;  2HF5 A;  2LAN A;  4MZL A;  2MLE C;  2WCL A;  4IJ7 A;  1W9Z A;  3BFB A;  1OOJ A;  1RFJ A;  1JUO A;  4R1E A;  3SS5 A;  3PN7 B;  1MWN A;  2Q91 A;  2PAS A;  3LK1 A;  1CKK A;  4JWQ A;  1QV1 A;  2LC5 A;  3FWC A;  3EK4 A;  1IH0 A;  1E8A A;  3DF0 A;  2BBN A;  3EVV A;  3HCM A;  2KGB C;  1DJH A;  3A4U B;  1CFF A;  4JKT A;  1J7Q A;  1AJ5 A;  1JBA A;  1RWY A;  2I18 A;  2P71 A;  2JXL A;  4M2Q A;  1F4Q A;  3GK1 A;  3SS3 A;  5KSZ A;  2M49 B;  4PE7 A;  3DVK A;  1NCZ A;  1QIV A;  1BOD A;  3EK8 A;  3TZ1 A;  1DJX A;  5CSF A;  1NWD A;  1NX2 A;  2HET A;  2TN4 A;  5JOL A;  3L47 A;  2MHH A;  4M2P A;  2GGZ A;  2K7B A;  3OB2 B;  3DF0 B;  1J7P A;  3BQ3 A;  3DXL A;  3ICB A;  1S6C A;  1IJ6 A;  4WRI A;  1OW4 A;  1PVB A;  2H61 C;  5FI7 A;  2KI6 D;  2QEV A;  4ORC B;  3I5F C;  2KBI A;  3LLE A;  1A4P A;  2K8M B;  2M7N A;  4MSP A;  1CNP A;  1TNP A;  3PAT A;  1PUL A;  4IL1 A;  1FI5 A;  1QAS A;  2H2K A;  2V53 A;  2I7A A;  3RLZ A;  1F70 A;  1W7I B;  1DVI A;  2LNK A;  4JD9 A;  1K9K A;  3OBV A;  4U8D A;  1FPW A;  3CR5 X;  1YUS A;  1L7Z A;  3GOF A;  1MR8 A;  4MZJ A;  3F45 A;  2MJW B;  3EG5 B;  5D7F A;  1OMV A;  2WC8 A;  4I5J A;  5AER A;  1K2H A;  1QLS A;  3DVJ A;  3PSR A;  1SR6 C;  5GQQ C;  2M1U A;  2YGU A;  4I5K A;  4WQ3 A;  1XFZ O;  1ZOT B;  1BR4 B;  3PJI A;  3AKA A;  3BOW A;  3BFA A;  4YRU A;  4YI8 A;  2GV5 A;  2WCK A;  1B9A A;  1KSO A;  1SBJ A;  4A4B A;  3S0A A;  2WCB A;  1EG3 A;  1NIW A;  1TIZ A;  2JT3 A;  1EJ3 A;  4C0L A;  1FF1 A;  1FI6 A;  2LP3 A;  4PHJ A;  2FOT A;  2NZ0 A;  3I5F B;  2M9G A;  4MN0 A;  2OS8 C;  1MXL C;  1Y1X A;  1T14 A;  3PM2 A;  4C0J A;  1JFK A;  2EC6 C;  1OE9 B;  2LMU A;  2JRF A;  4E68 A;  1J55 A;  4MRX A;  2VRG A;  5K89 A;  2KAY A;  2L4I A;  2WOS A;  2WC5 A;  4INX A;  3OP0 A;  4OR9 B;  2PYQ A;  2KOT A;  2ISD A;  5CSN A;  2GTE A;  2K2A A;  5HYD A;  1CTR A;  1DC1 A;  1BOC A;  1DGU A;  2LLU A;  2LP2 A;  3DD4 A;  1DJW A;  1XYD A;  4GUK A;  1R6P A;  4UPG A;  2L4H A;  3K21 A;  1TUJ A;  5KTY A;  1M39 A;  1K94 A;  1S3P A;  3PN7 C;  3R1P A;  2JNX A;  1CLB A;  2JU0 A;  3D75 A;  1HT9 A;  2KNE A;  2ZN9 A;  1SNL A;  1K8U A;  3K1E A;  1B7T Y;  4BY5 A;  4Q04 A;  3PAL A;  4FQT A;  2JOJ A;  3CGA A;  2L2C A;  4MVF A;  3LK0 A;  4GBA A;  1KK7 Y;  2NCP A;  2L51 A;  4OCI A;  2OS8 B;  2OPO A;  4F0Z B;  1JC2 A;  1K90 D;  2L0P A;  3CDN A;  1KCY A;  3FIA A;  3B7A A;  1DTL A;  2EC6 B;  3I5I B;  2PSR A;  3NSO A;  1YVL A;  1IIO A;  3S0B A;  1YRU B;  1AP4 A;  1MF8 B;  1QTX A;  2ERB A;  2LAP A;  3CS1 A;  3OX5 A;  2MA2 A;  1C7V A;  1YUT A;  5G08 A;  2KYF A;  3SIA A;  3EKH A;  2KGR A;  2JTZ A;  2WCF A;  3M0W A;  5DKR A;  1XO5 A;  3Q8I A;  2B1U A;  3NXA A;  1AK8 A;  3TUY B;  2F3Y A;  5BPJ A;  1XK4 C;  1YVH A;  2BL0 C;  5HLV A;  4ETO A;  1AHR A;  1OMR A;  2JZI A;  3OHM B;  1KFX L;  5ER4 X;  3DY9 A;  1BLQ A;  2ZRT A;  3SIB A;  3NHI A;  3RZS A;  3SG7 A;  3GK4 X;  4USL A;  4QJ4 B;  2WCH A;  3FWB A;  4MRY A;  1ZMZ A;  1AJ4 A;  1EG4 A;  4QJ5 B;  1SL9 A;  1A75 A;  2K0J A;  2KI4 C;  3DZT A;  3FS7 A;  1S5G Y;  3CR4 X;  1AVS A;  1S36 A;  1XK4 A;  3FE8 A;  1CFC A;  1LKJ A;  1Y1U A;  3C1V A;  4JPZ B;  4YI9 A;  1LS8 A;  3CTN A;  1G33 A;  3KF9 A;  4PHK A;  2GGM A;  5CPV A;  1B8R A;  1IJ5 A;  2KDH A;  1NX3 A;  3DYE A;  3EVU A;  5FI6 A;  1GM0 A;  1K96 A;  1Q80 A;  2LMT A;  1WDC B;  1SSE B;  3S0E A;  1V1F A;  3N7H A;  1EL4 A;  2K7C A;  3R1V A;  4P2Y B;  3NSK A;  3E3R A;  2FCE A;  4PT1 A;  4MLW A;  3R72 A;  3VRO A;  1A75 B;  1SMG A;  1TNQ A;  2PRU A;  1QX7 A;  4XJK A;  4ZCU A;  5J3X A;  2M7L A;  4YBH B;  2BL0 B;  2IS9 A;  2KPH A;  1OOI X;  1FBV A;  1NSH A;  1SCM C;  1UHN A;  3SG5 A;  3TDI A;  5AFP A;  3NGV A;  1BF5 A;  2PVB A;  1TCF A;  2Y1N A;  2BE4 A;  3I5G C;  5I8N A;  1CFD A;  1GJY A;  2F8P A;  2BCA A;  3D73 A;  3KHE A;  1H4B A;  3VB1 A;  4DRW A;  3SG6 A;  3SS4 A;  2KI4 B;  4DS7 A;  1Z2C B;  1M46 A;  1SY9 A;  1KFU L;  4N1F A;  1OZO A;  1BR1 B;  1PRW A;  1TWO A;  2LUX A;  2PQL A;  3O4Y A;  4L9M A;  1M31 A;  4XJK B;  4A4C A;  3WNX B;  4BY4 A;  1G4Y R;  3AAJ A;  1DGV A;  2G9B A;  1PSR A;  2I94 A;  1RJV A;  2BCB A;  2BE6 A;  2MBX A;  5FI2 A;  1XFV O;  2LHI A;  1IGV A;  1J7R A;  1REC A;  1JSA A;  4AOM A;  1YTZ C;  1OZS A;  3IQQ A;  1BJF A;  4MBE A;  1XFR A;  3TS5 B;  1HQV A;  1IG5 A;  2EGD A;  4PE1 A;  2ZNE A;  1CLM A;  1ORG A;  1TOP A;  4PAL A;  3VRR A;  1SW8 A;  3CAB A;  1QWV A;  2JWW A;  1SCM B;  3CWG A;  5DKN A;  5HL1 A;  1JFJ A;  2K7D A;  3I5G B;  1Y0V H;  1W7J B;  4CPV A;  3I5H C;  2HQ8 A;  2M8U A;  1UHH A;  2JNF A;  2H8V A;  2BCX A;  3BYA A;  4PCW A;  2SAS A;  1G8I A;  1FW4 A;  1UHI A;  3VRQ A;  3IQO A;  3S0G A;  3ZWH A;  1ZUZ A;  4N5X A;  3D76 A;  5I2Q A;  4MZK A;  1X02 A;  2BKI B;  1LVC D;  1TRF A;  5HKY A;  4DUQ A;  1TN4 A;  3I5I C;  1WLM A;  2M97 A;  3BOW B;  3UNW A;  3NSL A;  2KSP A;  5I94 A;  1CDL A;  3MSE B;  1B4C A;  1OQP A;  2PMY A;  1IQ5 A;  2JT8 A;  2QEH A;  4WQ2 A;  1ODB A;  3BUM B;  1KWO C;  1GGZ A;  3TUY C;  3NSI A;  3BJH A;  3PM8 A;  3KEV A;  1B1G A;  1TCO B;  2JT0 A;  2E30 A;  2R2I A;  3BUW B;  1SKT A;  1Y1A A;  3EVR A;  1DJY A;  2M0R A;  2K61 A;  4CFQ A;  4NQG A;  2Y4Q A;  2QDI A;  3CZ1 A;  3TDU A;  1ZAC A;  3I5H B;  3GK2 A;  3CLN A;  4ICB A;  1J7O A;  1SK6 D;  1QVI Z;  3CYZ A;  1J1D A;  2KHN A;  5EL2 A;  3O78 A;  1CMF A;  1OOH A;  2AMI A;  4ORA B;  1R2U A;  1YX8 A;  1CM1 A;  4PE0 A;  2BKH B;  2WC6 A;  2HPS A;  1ZFS A;  1WDC C;  4KYN A;  3VRN A;  1YRT B;  3BUX B;  1TTX A;  4NDD A;  2ZN8 A;  1LA3 A;  1JF0 A;  2BNX A;  1CLL A;  1NP8 A;  1XFY O;  2A4J A;  2KI6 C;  4GGF A;  5DKQ A;  5PAL A;  1D1O A;  2E6W A;  1F55 A;  4N1G A;  2LM5 A;  1SYM A;  2P6B B;  3O6B A;  3SJS A;  3EKJ A;  2JTT A;  4QJ3 B;  1IKU A;  1TNX A;  1KWO B;  4GGN A;  4OZD A;  2F2O A;  4PHN A;  1SCV A;  2KYC A;  1F71 A;  1K9P A;  2F33 A;  1B8C A;  4I5L B;  2NLN A;  2PAL A;  1QX5 B;  2OTG B;  1RTP 1;  2Y1M A;  2WCE A;  1QLK A;  4HSZ A;  3R1O A;  3D77 A;  3BUN B;  2CXJ A;  2JXC A;  1BMO A;  4C0K A;  1B7T Z;  4MEW A;  1PSB A;  4JQ0 D;  4DIR A;  1JWD A;  2M1K B;  1L2O C;  2HQW A;  1KQM B;  1KK7 Z;  3S0F A;  2QEO A;  1DEL A;  2L5X B;  2D8N A;  2K7O A;  1KQV A;  1S6I A;  2WOR A;  2K60 A;  1WRL A;  1P28 A;  2LUC A;  5D69 A;  2MRD A;  3JTD B;  2JPO A;  1A29 A;  3SG2 A;  1OMD A;  1S6J A;  1JF2 A;  5F6T A;  1YUR A;  3A8R A;  3BFH A;  2KBM A;  2WND A;  3LCP C;  1F54 A;  3B86 A;  1KFX S;  1QV0 A;  1CDN A;  3HX4 A;  3WHT B;  1MQ1 A;  1RK9 A;  3TS5 C;  1SRA A;  1V1G A;  2JUL A;  2L50 A;  1QX2 A;  3CZ0 A;  1MHO A;  4OVN F;  1BT6 A;  2RGI A;  3IVT A;  2KFG A;  1NCY A;  2CCM A;  5HKW A;  2BEC A;  1C3Y A;  2KFH A;  4YGD B;  1N65 A;  2F2P A;  1IWQ A;  1SPY A;  2LHL A;  3JVT B;  3OX6 A;  2MAZ A;  1NCX A;  2KAV A;  3EK7 A;  4I5N B;  2KQ6 A;  2CBL A;  1DJI A;  3SG4 A;  1SL7 A;  4HRH A;  1L2O B;  1Y6W A;  1KK8 B;  2WCJ A;  4YGE B;  1F8H A;  3B87 A;  2L2E A;  2I2R E;  2LVI A;  3LL8 B;  1AUI B;  1S5G Z;  5AEQ A;  3V2L A;  2KLD A;  1WY9 A;  4OV2 A;  3AAK A;  3RM1 A;  3O4X A;  3WHU B;  1RRO A;  1M63 B;  1A03 A;  1N0Y A;  1Z4H A;  1UP5 A;  2L98 A;  2O60 A;  1CM4 A;  3D78 A;  3OB1 B;  1XVJ A;  1OSA A;  1EXR A;  1QXP A;  1M45 A;  2KLE A;  1K9U A;  3D0Y A;  1CB1 A;  3PLF B;  2LLS A;  2LVK A;  1TUZ A;  2NXQ A;  4F7F A;  4YGB B;  4OKH A;  1J1E A;  3L4L A;  3QME A;  1QS7 A;  3DVE A;  3VRP A;  2G2B A;  4FQO A;  3WXA A;  1UUS A;  3IF7 A;  4HRE E;  1F4O A;  4PHM A;  2FJY A;  2CTN A;  2LVV A;  2H61 A;  1BU3 A;  1KFU S;  1CFP A;  1U5I A;  1DT7 B;  1XFX O;  1B47 A;  1DQE A;  2AUC A;  5HLO A;  3ZNI A;  1QIW A;  3KPX A;  5I2O A;  3S0D A;  2M29 A;  5DIC A;  2BAP A;  3D0Y B;  1XFU O;  4GFT A;  1MUX A;  3SG3 A;  1MXE A;  2LE9 B;  1IRJ A;  2AAO A;  4AQJ A;  2Q4U A;  1K95 A;  2KAX A;  2KFF A;  1PVA A;  2DOQ A;  2CT9 A;  2LLT A;  3FE9 A;  5D3O A;  3D74 A;  3DVM A;  4HRG A;  3BXK A;  1B8L A;  2F3Z A;  2LV7 A;  3B6X A;  4M2O A;  1NPQ A;  1LXF C;  1U5I B;  1QVI Y;  3CZT X;  4FTG A;  4TNC A;  3BUO B;  5CSJ A;  1BG1 A;  2L5Y A;  2M3W A;  4CLN A;  2EHB A;  1VRK A;  1DJG A;  4D1E A;  2QAC A;  1NUB A;  1GGW A;  2OTG C;  1YUU A;  5JJG A;  2ZRS A;  1DF0 A;  1UHJ A;  3PFV A;  1PK0 D;  2JQ6 A;  2WCM A;  3CR2 A;  4XYN A;  4ORB B;  2MLF C;  1UWO A;  1SL8 A;  1KQM C;  2JPT A;  2KQY A;  5HKZ A;  3O2P A;  4GGF C;  1YX7 A;  2QPT A;  2ZKM X;  1LA0 A;  2O5G A;  2NCO A;  5ER5 A;  2FJU B;  3QRX A;  1ALW A;  1SR6 B;  2FCD A;  1UHK A;  1N2D A;  2LVJ A;  1C3Z A;  2SCP A;  1YR5 A;  1XFW O;  1KSM A;  1K93 D;  3JTD C;  2ZND A;  5I2L A;  1WLZ A;  2ZFD A;  3L4A A;  1S1E A;  2P70 A;  4PE4 A;  4GPL B;  3CZ2 A;  5AAN A;  1QJT A;  3B88 A;  3FE6 A;  1C07 A;  1PAL A;  3NHT A;  2COL B;  1UUR A;  1WRZ A;  1DF0 B; 
#chains in the Genus database with same CATH homology
 4PDZ A;  3KO0 A;  1ALV A;  1DJZ A;  3VGO A;  4CFR A;  2LMV A;  4YGA A;  4DCK A;  1H8B A;  1S26 D;  1XA5 A;  5KU1 A;  4P5O E;  1LIN A;  3AKB A;  5IBW A;  4NDC A;  3JVT C;  5FYX A;  1QAT A;  1NX1 A;  1EH2 A;  1TNW A;  1DMO A;  1CDM A;  1CDP A;  1GQM A;  3D10 A;  2JC2 A;  2CNP A;  4ZCV A;  5TNC A;  1IQ3 A;  4CID A;  4NDB A;  1KK8 C;  5B8I B;  4YGC B;  1WRK A;  5AXI A;  2BBM A;  1NX0 A;  2LCP A;  1CMG A;  4GAO A;  4GNK B;  1NYA A;  3H4S E;  5CSI A;  1A2X A;  2K2F A;  4AQI A;  2Y5I A;  3TDZ A;  1C7W A;  2HF5 A;  2LAN A;  4MZL A;  2MLE C;  1OOJ A;  1RFJ A;  1JUO A;  4R1E A;  3PN7 B;  1MWN A;  2Q91 A;  2PAS A;  3LK1 A;  1CKK A;  4JWQ A;  1QV1 A;  2LC5 A;  3FWC A;  3EK4 A;  1IH0 A;  1E8A A;  3DF0 A;  2BBN A;  3EVV A;  3HCM A;  2KGB C;  1DJH A;  3A4U B;  1CFF A;  1J7Q A;  1AJ5 A;  1JBA A;  1RWY A;  2I18 A;  2JXL A;  4M2Q A;  1F4Q A;  3GK1 A;  5KSZ A;  2M49 B;  4PE7 A;  3DVK A;  1NCZ A;  1QIV A;  1BOD A;  3EK8 A;  3TZ1 A;  1DJX A;  5CSF A;  1NWD A;  1NX2 A;  2HET A;  2TN4 A;  5JOL A;  2MHH A;  4M2P A;  2GGZ A;  2K7B A;  3OB2 B;  3DF0 B;  1J7P A;  3BQ3 A;  3ICB A;  1S6C A;  1IJ6 A;  4WRI A;  1PVB A;  2H61 C;  2KI6 D;  4ORC B;  3I5F C;  2KBI A;  3LLE A;  1A4P A;  2K8M B;  2M7N A;  4MSP A;  1CNP A;  1TNP A;  3PAT A;  1PUL A;  4IL1 A;  1FI5 A;  1QAS A;  2H2K A;  2V53 A;  2I7A A;  3RLZ A;  1F70 A;  1W7I B;  1DVI A;  2LNK A;  4U8D A;  1K9K A;  1FPW A;  3CR5 X;  1YUS A;  1L7Z A;  3GOF A;  1MR8 A;  4MZJ A;  3F45 A;  2MJW B;  5D7F A;  1OMV A;  2WC8 A;  4I5J A;  5AER A;  1K2H A;  1QLS A;  3DVJ A;  3PSR A;  1SR6 C;  5GQQ C;  2M1U A;  4I5K A;  4WQ3 A;  1XFZ O;  1ZOT B;  1BR4 B;  3AKA A;  3BOW A;  4YRU A;  4YI8 A;  2GV5 A;  1B9A A;  1KSO A;  1SBJ A;  4A4B A;  2WCB A;  1EG3 A;  1NIW A;  1TIZ A;  2JT3 A;  1EJ3 A;  4C0L A;  1FF1 A;  1FI6 A;  2LP3 A;  4PHJ A;  2FOT A;  2NZ0 A;  3I5F B;  2M9G A;  4MN0 A;  2OS8 C;  1MXL C;  1Y1X A;  4C0J A;  1JFK A;  2EC6 C;  1OE9 B;  2LMU A;  2JRF A;  4E68 A;  1J55 A;  4MRX A;  2VRG A;  5K89 A;  2KAY A;  2L4I A;  2WOS A;  3OP0 A;  4OR9 B;  2KOT A;  2ISD A;  5CSN A;  2K2A A;  5HYD A;  1CTR A;  1BOC A;  1DGU A;  2LLU A;  2LP2 A;  3DD4 A;  1DJW A;  1XYD A;  4GUK A;  1R6P A;  4UPG A;  2L4H A;  3K21 A;  5KTY A;  1M39 A;  1K94 A;  1S3P A;  3PN7 C;  2JNX A;  1CLB A;  2JU0 A;  1HT9 A;  2KNE A;  2ZN9 A;  1SNL A;  1K8U A;  1B7T Y;  4BY5 A;  4Q04 A;  3PAL A;  2JOJ A;  3CGA A;  4MVF A;  3LK0 A;  4GBA A;  1KK7 Y;  2NCP A;  2L51 A;  4OCI A;  2OS8 B;  2OPO A;  4F0Z B;  1JC2 A;  1K90 D;  2L0P A;  1KCY A;  3FIA A;  1DTL A;  2EC6 B;  3I5I B;  2PSR A;  3NSO A;  1YVL A;  1YRU B;  1AP4 A;  1MF8 B;  1QTX A;  2LAP A;  3CS1 A;  3OX5 A;  2MA2 A;  1C7V A;  1YUT A;  5G08 A;  2KYF A;  3SIA A;  3EKH A;  2KGR A;  2JTZ A;  2WCF A;  3M0W A;  5DKR A;  1XO5 A;  2B1U A;  3NXA A;  1AK8 A;  3TUY B;  2F3Y A;  5BPJ A;  1XK4 C;  1YVH A;  2BL0 C;  5HLV A;  4ETO A;  1AHR A;  1OMR A;  2JZI A;  3OHM B;  1KFX L;  5ER4 X;  1BLQ A;  2ZRT A;  3SIB A;  3SG7 A;  3GK4 X;  4USL A;  4QJ4 B;  3FWB A;  4MRY A;  1ZMZ A;  1AJ4 A;  1EG4 A;  4QJ5 B;  1SL9 A;  1A75 A;  2K0J A;  2KI4 C;  3FS7 A;  1S5G Y;  3CR4 X;  1AVS A;  1S36 A;  1XK4 A;  1CFC A;  1LKJ A;  1Y1U A;  3C1V A;  4JPZ B;  4YI9 A;  3CTN A;  1G33 A;  3KF9 A;  4PHK A;  2GGM A;  5CPV A;  1B8R A;  1IJ5 A;  2KDH A;  1NX3 A;  3EVU A;  1K96 A;  1Q80 A;  2LMT A;  1WDC B;  1V1F A;  1EL4 A;  2K7C A;  4P2Y B;  3NSK A;  3E3R A;  2FCE A;  4MLW A;  3VRO A;  1A75 B;  1SMG A;  1TNQ A;  2PRU A;  1QX7 A;  4XJK A;  4ZCU A;  5J3X A;  2M7L A;  4YBH B;  2BL0 B;  2IS9 A;  5AFP A;  1FBV A;  1NSH A;  1SCM C;  1UHN A;  3SG5 A;  3TDI A;  1BF5 A;  2PVB A;  1TCF A;  2Y1N A;  2BE4 A;  3I5G C;  5I8N A;  1CFD A;  1GJY A;  2F8P A;  2BCA A;  3KHE A;  1H4B A;  4DRW A;  3SG6 A;  2KI4 B;  4DS7 A;  1M46 A;  1SY9 A;  1KFU L;  4N1F A;  1OZO A;  1BR1 B;  1PRW A;  2LUX A;  3O4Y A;  4L9M A;  4XJK B;  4A4C A;  1M31 A;  4BY4 A;  3WNX B;  1G4Y R;  3AAJ A;  1DGV A;  2G9B A;  1PSR A;  2I94 A;  1RJV A;  2BCB A;  2BE6 A;  2MBX A;  1XFV O;  2LHI A;  1IGV A;  1J7R A;  1REC A;  1JSA A;  4AOM A;  1YTZ C;  1OZS A;  3IQQ A;  1BJF A;  4MBE A;  3TS5 B;  1HQV A;  1IG5 A;  2EGD A;  4PE1 A;  2ZNE A;  1CLM A;  4PAL A;  1TOP A;  3VRR A;  1SW8 A;  2JWW A;  1SCM B;  3CWG A;  5DKN A;  1JFJ A;  2K7D A;  3I5G B;  1Y0V H;  1W7J B;  4CPV A;  3I5H C;  2HQ8 A;  2M8U A;  1UHH A;  2JNF A;  2BCX A;  3BYA A;  4PCW A;  2SAS A;  1G8I A;  1FW4 A;  1UHI A;  3VRQ A;  3IQO A;  3ZWH A;  1ZUZ A;  4N5X A;  5I2Q A;  4MZK A;  1X02 A;  2BKI B;  1LVC D;  1TRF A;  5HKY A;  4DUQ A;  1TN4 A;  3I5I C;  1WLM A;  2M97 A;  3BOW B;  3NSL A;  2KSP A;  1CDL A;  3MSE B;  1B4C A;  1OQP A;  2PMY A;  1IQ5 A;  2JT8 A;  4WQ2 A;  1ODB A;  3BUM B;  1KWO C;  1GGZ A;  3TUY C;  3NSI A;  3PM8 A;  3KEV A;  1B1G A;  1TCO B;  2JT0 A;  2E30 A;  2R2I A;  3BUW B;  1SKT A;  1Y1A A;  3EVR A;  1DJY A;  2M0R A;  2K61 A;  4CFQ A;  4NQG A;  2Y4Q A;  3TDU A;  1ZAC A;  3I5H B;  3GK2 A;  3CLN A;  4ICB A;  1J7O A;  1SK6 D;  1QVI Z;  1J1D A;  2KHN A;  3O78 A;  1CMF A;  2AMI A;  4ORA B;  1R2U A;  1YX8 A;  1CM1 A;  4PE0 A;  2BKH B;  2HPS A;  1ZFS A;  1WDC C;  3VRN A;  1YRT B;  3BUX B;  1TTX A;  4NDD A;  2ZN8 A;  1LA3 A;  1JF0 A;  2KI6 C;  1CLL A;  1NP8 A;  1XFY O;  2A4J A;  5DKQ A;  4GGF A;  5PAL A;  1D1O A;  1F55 A;  2E6W A;  4N1G A;  2LM5 A;  1SYM A;  2P6B B;  3O6B A;  3SJS A;  3EKJ A;  2JTT A;  4QJ3 B;  1IKU A;  1TNX A;  1KWO B;  4GGN A;  2F2O A;  4PHN A;  1SCV A;  2KYC A;  1F71 A;  1K9P A;  2F33 A;  1B8C A;  4I5L B;  2NLN A;  2PAL A;  1QX5 B;  2OTG B;  1RTP 1;  2Y1M A;  2WCE A;  1QLK A;  4HSZ A;  3BUN B;  2CXJ A;  2JXC A;  1BMO A;  4C0K A;  1B7T Z;  4MEW A;  1PSB A;  4JQ0 D;  4DIR A;  1JWD A;  2M1K B;  1L2O C;  2HQW A;  1KQM B;  1KK7 Z;  1KQV A;  2L5X B;  2D8N A;  2K7O A;  1S6I A;  2WOR A;  1WRL A;  2LUC A;  5D69 A;  2MRD A;  3JTD B;  1A29 A;  3SG2 A;  1OMD A;  1S6J A;  1JF2 A;  5F6T A;  1YUR A;  3A8R A;  2KBM A;  2WND A;  3LCP C;  1F54 A;  1KFX S;  1QV0 A;  1CDN A;  3HX4 A;  3WHT B;  1MQ1 A;  1RK9 A;  3TS5 C;  1SRA A;  1V1G A;  2JUL A;  2L50 A;  1QX2 A;  4OVN F;  1MHO A;  1BT6 A;  2RGI A;  2KFG A;  1NCY A;  2CCM A;  5HKW A;  2BEC A;  2KFH A;  4YGD B;  1N65 A;  2F2P A;  1IWQ A;  1SPY A;  2LHL A;  3JVT B;  3OX6 A;  2MAZ A;  1NCX A;  2KAV A;  3EK7 A;  4I5N B;  2KQ6 A;  2CBL A;  1DJI A;  3SG4 A;  1SL7 A;  4HRH A;  1L2O B;  1Y6W A;  1KK8 B;  4YGE B;  1F8H A;  2L2E A;  2I2R E;  2LVI A;  3LL8 B;  1AUI B;  1S5G Z;  5AEQ A;  4OV2 A;  1WY9 A;  3AAK A;  3RM1 A;  3WHU B;  1RRO A;  1M63 B;  1A03 A;  1N0Y A;  1UP5 A;  2L98 A;  2O60 A;  1CM4 A;  3OB1 B;  1XVJ A;  1OSA A;  1EXR A;  1QXP A;  1M45 A;  3D0Y A;  1K9U A;  1CB1 A;  3PLF B;  2LLS A;  2LVK A;  2NXQ A;  4YGB B;  4OKH A;  1J1E A;  1QS7 A;  3DVE A;  3VRP A;  2G2B A;  4FQO A;  3WXA A;  1UUS A;  3IF7 A;  4HRE E;  1F4O A;  4PHM A;  2CTN A;  2LVV A;  2H61 A;  1BU3 A;  1KFU S;  1CFP A;  1U5I A;  1DT7 B;  1XFX O;  1B47 A;  2AUC A;  5HLO A;  3ZNI A;  1QIW A;  3KPX A;  5I2O A;  2M29 A;  3D0Y B;  1XFU O;  4GFT A;  1MUX A;  3SG3 A;  1MXE A;  2LE9 B;  1IRJ A;  2AAO A;  4AQJ A;  2Q4U A;  1K95 A;  2KAX A;  2KFF A;  1PVA A;  2DOQ A;  2CT9 A;  2LLT A;  3DVM A;  4HRG A;  3BXK A;  1B8L A;  2F3Z A;  2LV7 A;  4M2O A;  1NPQ A;  1LXF C;  1U5I B;  1QVI Y;  3CZT X;  4FTG A;  4TNC A;  3BUO B;  5CSJ A;  1BG1 A;  2M3W A;  4CLN A;  2EHB A;  1VRK A;  1DJG A;  4D1E A;  2QAC A;  1NUB A;  1GGW A;  2OTG C;  1YUU A;  5JJG A;  2ZRS A;  1DF0 A;  1UHJ A;  3PFV A;  1PK0 D;  2JQ6 A;  3CR2 A;  4XYN A;  4ORB B;  2MLF C;  1UWO A;  1SL8 A;  1KQM C;  2JPT A;  2KQY A;  5HKZ A;  3O2P A;  4GGF C;  1YX7 A;  2QPT A;  2ZKM X;  1LA0 A;  2O5G A;  2NCO A;  5ER5 A;  2FJU B;  3QRX A;  1ALW A;  1SR6 B;  2FCD A;  1UHK A;  1N2D A;  2LVJ A;  2SCP A;  1YR5 A;  1XFW O;  1KSM A;  1K93 D;  3JTD C;  2ZND A;  5I2L A;  1WLZ A;  2ZFD A;  1S1E A;  4PE4 A;  4GPL B;  5AAN A;  1QJT A;  1C07 A;  1PAL A;  2COL B;  1UUR A;  1WRZ A;  1DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...