4NQGA

Crystal structure of ca(2+)-regulated photoprotein mitrocomin from jellyfish mitrocoma cellularia at 1.3 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
197
structure length
197
Chain Sequence
SMGSRYAVKLDTDFDNPKWIARHKHMFNFLDINSNGQINLNEMVHKASNIICKKLGATEEQTRRHQKCVEDFFGGAGLEYDKDTTWPEYIEGWKRLAKTELERHSKNRVTLIRLWGDALFDIIDKDGNGSVSLDEWIQYTHCAGIQQSRGQCEATFAHCDLDGDGKLDVDEMTRQHLGFWYSVDSTCEGLYGGAVPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Mitrocomin
publication title Multiple Isospecies of Ca(2+)-regulated Photoprotein Mitrocomin from Jellyfish Mitrocoma cellularia: Cloning, Characterization, and Crystal Structure
rcsb
source organism Mitrocoma cellularia
total genus 81
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4nqgA00
1EG3A 1Y6WA 2MLEC 3HCMA 1X02A 1WDCC 2LHLA 2PMYA 2CT9A 4AOMA 3TUYC 4TNCA 2H61C 1YRTB 1NX1A 5AXIA 1CNPA 3NSOA 4CLNA 2LP3A 2M97A 1W7JB 4QJ4B 2KDHA 1WRKA 4M2OA 2PASA 3ZNIA 1CDLA 1SL9A 3NSKA 2Q91A 1SPYA 3NXAA 2H2KA 1QLSA 3EK7A 1ZACA 4R1EA 2LVIA 2M7LA 1B8CA 2I18A 4OV2A 1L2OC 1ZMZA 2L2EA 2ISDA 1RK9A 2H61A 1F70A 1QV1A 1DMOA 4PE7A 1K9UA 1CFCA 2CTNA 2K7OA 4MEWA 1KK8B 1LKJA 2K7BA 2LLUA 3ZWHA 1QJTA 1GGWA 5KU1A 1V1FA 2HF5A 2F3ZA 3IQQA 4DCKA 1YUTA 2BKIB 1QIVA 3FS7A 2LLTA 3BQ3A 1EG4A 2D8NA 1HT9A 1K95A 1G4YR 1PSRA 2K7DA 2HPSA 1RROA 1CDPA 1CLMA 4P5OE 1MXEA 1AVSA 1IKUA 2BL0B 2JRFA 1NX3A 1R6PA 1J1DA 1N2DA 2FJUB 3GOFA 1NUBA 1QVIY 3JTDB 2NCPA 1RWYA 1IH0A 1Y1AA 3OB2B 1GQMA 3HX4A 1WLMA 3SG4A 5CSIA 1E8AA 1TOPA 5ER5A 1KQMC 2V53A 1A4PA 3BUMB 3C1VA 3DD4A 5J3XA 5JOLA 5K89A 1A2XA 1K96A 3NSLA 1EXRA 2JTZA 3I5HB 2LP2A 3O6BA 4PHNA 2JNFA 5GQQC 4GGFC 2JPTA 4ZCUA 1YRUB 1DJIA 1KWOC 1WRZA 2KQYA 3KO0A 3ICBA 5AFPA 2L0PA 1S5GY 1XO5A 2M29A 1SR6C 1K9PA 1F71A 4GAOA 2M3WA 2G9BA 1DGVA 3NSIA 4PCWA 3VRRA 2BBNA 4PHKA 3LLEA 1D1OA 4XJKB 4GGFA 2F2OA 2WCBA 4YGBB 2F8PA 3I5IB 1S36A 1ZFSA 3VRPA 1S6JA 1U5IB 5DKRA 3SG5A 2LVJA 1CLBA 1GGZA 3CR4X 1TRFA 1S5GZ 2LMVA 2M0RA 3K21A 5AEQA 3CR2A 4M2QA 1MR8A 1NSHA 3WNXB 1KFUL 1PVAA 3KPXA 3MSEB 1OZSA 1CM1A 1S1EA 1B1GA 1SCVA 1YVHA 1B47A 1NPQA 1R2UA 3LL8B 3AKBA 2WORA 1TNQA 3TS5B 1S6CA 1XK4A 4YGAA 1B7TZ 1AK8A 2F33A 1LVCD 1SMGA 1ODBA 5F6TA 5D69A 4YI8A 3D10A 2JNXA 1AHRA 1G33A 3TDZA 2KFHA 2HQWA 4HRHA 1ZOTB 4HSZA 2L4HA 4MZLA 4WQ2A 3AAJA 4PHJA 3DVKA 2KI6C 1ALWA 1S26D 1TNWA 3TZ1A 4YBHB 1V1GA 2OPOA 1M39A 1QASA 1RJVA 1JFJA 1KFXS 2ZN8A 5BPJA 1SCMB 2MBXA 3DF0B 1UP5A 3PFVA 3PSRA 5B8IB 5DKQA 2KSPA 3BXKA 3BUNB 1DT7B 1M45A 1DTLA 1IQ5A 1JUOA 2P6BB 4MZKA 3CS1A 3EVVA 3TDIA 3BUOB 4YGEB 1MHOA 1CFFA 1QS7A 3SG7A 1TNXA 2EC6B 2LE9B 2WCEA 5I8NA 1RFJA 3OX6A 5FYXA 2EHBA 1CTRA 3O4YA 1OMRA 4ORAB 5KTYA 1IRJA 2COLB 5IBWA 1QTXA 3PN7B 4ORBB 1BLQA 1MXLC 1KK8C 2NZ0A 2LMUA 1K93D 2KOTA 1BJFA 3EK8A 1SYMA 1TCOB 5TNCA 3VRQA 1WDCB 3RLZA 1B9AA 3TUYB 1XYDA 2KAYA 1EJ3A 1LA0A 4JPZB 1SW8A 2Y1NA 1CMGA 1NWDA 2KGBC 2JT3A 2KI6D 2LUCA 1QXPA 1IWQA 1TNPA 1DJHA 2L5XB 4I5JA 3E3RA 4MBEA 1DJXA 1JBAA 1UHHA 1XFVO 2BCAA 4DRWA 2BL0C 2AMIA 2IS9A 1DJYA 2L4IA 2ZFDA 2ZRSA 3KHEA 2Y5IA 4ICBA 2LC5A 1LINA 2MA2A 1KSOA 1UUSA 1RECA 2KBMA 3H4SE 3KEVA 4F0ZB 1M63B 2I7AA 1B8LA 1OQPA 1XFUO 3FWCA 3I5HC 4NQGA 3OB1B 1PRWA 1BT6A 1ALVA 1C7VA 1NCXA 2LV7A 2K61A 5HKWA 3VGOA 2LAPA 1CFPA 1J7PA 2RGIA 1BR1B 1TN4A 2OS8C 3OP0A 1RTP1 3SIBA 4QJ5B 1N0YA 1XFXO 3BOWA 1SL7A 4FQOA 1OOJA 3SG2A 1EH2A 1CDMA 1QV0A 1J7OA 2PSRA 2L98A 3VRNA 4CPVA 1Y0VH 3I5IC 1J1EA 1NX2A 1KK7Y 5HYDA 2K0JA 4ETOA 3LK0A 1FPWA 2BE6A 1CB1A 2CNPA 1B7TY 4GNKB 3JVTC 1QX5B 1IG5A 1FI5A 1SR6B 2PRUA 2A4JA 1QIWA 1NCYA 1CM4A 1SL8A 4AQIA 4C0KA 5PALA 2K7CA 4DUQA 3GK2A 1J7QA 1KK7Z 2ZNDA 4MRXA 3AKAA 3FWBA 3TS5C 4E68A 3DVJA 1LXFC 4C0LA 2FOTA 2F2PA 1QX7A 4PHMA 2QPTA 1PALA 2HQ8A 1XFWO 1G8IA 2GV5A 1A75A 5CSNA 1IJ5A 1W7IB 2DOQA 2KNEA 5CSJA 1IQ3A 3CLNA 1QATA 3I5FB 4CFRA 2JWWA 1XFYO 2KI4C 3D0YA 1SKTA 2Q4UA 2KYFA 4A4BA 1BG1A 3AAKA 1LA3A 4P2YB 1JWDA 2BECA 2LM5A 3A4UB 2ZRTA 2BCXA 2MRDA 2R2IA 3PLFB 2LVKA 4PDZA 3KF9A 4YRUA 2Y1MA 3EKHA 1SY9A 2OTGB 3O78A 4BY4A 2JT0A 3BYAA 1PVBA 3VROA 1WRLA 4L9MA 1DF0A 1OSAA 3EVUA 4JQ0D 1AJ4A 1Y1XA 2EC6C 1CFDA 2FCEA 4MVFA 2KFGA 4NDBA 1CDNA 1KCYA 1JF2A 3I5GB 4UPGA 5D7FA 5HKYA 2PVBA 2SCPA 2E6WA 2JTTA 1YUUA 1YX8A 3OHMB 2JXCA 2JU0A 3IQOA 1WY9A 4GBAA 1ZUZA 4JWQA 3SG6A 5AERA 1S3PA 2CXJA 1B4CA 2ZN9A 4NDCA 3PN7C 1PK0D 2JOJA 2M7NA 1FF1A 1K8UA 1M31A 2LCPA 4GUKA 2M8UA 1F4OA 3RM1A 2I2RE 1EL4A 1NYAA 4OCIA 2KBIA 4I5KA 1M46A 4PE0A 3WXAA 2NCOA 1OE9B 4GFTA 3QRXA 1KFXL 2ZNEA 1L7ZA 1Y1UA 2LNKA 4BY5A 2CBLA 1MF8B 2VRGA 3EVRA 2O60A 4MSPA 3SG3A 4QJ3B 2JULA 4OVNF 4Q04A 4USLA 1K2HA 2K2FA 1QLKA 1L2OB 2JT8A 4U8DA 4MLWA 1KSMA 1F54A 5I2OA 1YX7A 3JTDC 1F4QA 1AP4A 1VRKA 2BKHB 2WOSA 1OMVA 1IGVA 1SK6D 3WHUB 3PM8A 1NX0A 1FBVA 2MLFC 1DJZA 1XFZO 4WRIA 1K9KA 1TIZA 2AUCA 2HETA 2QACA 5CPVA 3A8RA 5G08A 1FI6A 4GGNA 3LK1A 3PALA 2KHNA 3DVMA 4ZCVA 1DJWA 1YUSA 4MRYA 1KQVA 1B8RA 1BMOA 2GGMA 2KAXA 2GGZA 1TTXA 2LHIA 1XVJA 1OMDA 2KYCA 1SBJA 4M2PA 5DKNA 1YTZC 4HREE 4PE4A 4NDDA 1BR4B 1IJ6A 4N1FA 5HKZA 1NCZA 1JC2A 4MZJA 1UHNA 3BUWB 2LANA 2LLSA 1JF0A 3OX5A 1NP8A 1AJ5A 1PULA 1OZOA 2I94A 5HLVA 2LMTA 3BOWB 2O5GA 1KFUS 2BE4A 2G2BA 2JZIA 1KQMB 5KSZA 3CGAA 1YR5A 1MUXA 1TCFA 1YURA 3LCPC 1UURA 4OR9B 1BF5A 1H4BA 4PE1A 2Y4QA 1CLLA 4I5NB 1KWOB 2LVVA 3O2PA 2E30A 4N1GA 2B1UA 3EKJA 3CR5X 1S6IA 4IL1A 4XJKA 1BU3A 1F55A 2OS8B 1UHKA 1Q80A 1QVIZ 2KFFA 4YGCB 2FCDA 4GPLB 2JC2A 2SASA 1UWOA 2M1KB 2ZKMX 1K94A 2M9GA 1U5IA 2JQ6A 3BUXB 3CWGA 4PALA 3EK4A 5I2LA 4N5XA 2CCMA 2M1UA 4OKHA 1J7RA 2EGDA 5HLOA 4CIDA 1YVLA 1H8BA 3GK4X 2WNDA 1NIWA 4YGDB 5JJGA 3JVTB 2BBMA 2F3YA 4AQJA 5I2QA 1C07A 1XK4C 2MJWB 3GK1A 2TN4A 1UHIA 4D1EA 1J55A 4ORCB 3I5FC 1FW4A 1QX2A 4HRGA 2MHHA 3TDUA 2JXLA 1A29A 2L50A 3CTNA 5AANA 4MN0A 1A75B 1K90D 1JFKA 1MWNA 2KGRA 3FIAA 1BODA 1SNLA 1A03A 1JSAA 4A4CA 4I5LB 1SCMC 1UHJA 2WCFA 3SIAA 1XA5A 2LUXA 3D0YB 1DGUA 1CKKA 1C7WA 2OTGC 1F8HA 4WQ3A 1PSBA 2PALA 1WLZA 4CFQA 1DVIA 2WC8A 1DJGA 3DVEA 3IF7A 2NXQA 1MQ1A 4DIRA 2MAZA 2KAVA 2KQ6A 1CMFA 1SRAA 4C0JA 3I5GC 3CZTX 4DS7A 3DF0A 3WHTB 2K2AA 5CSFA 2KI4B 2BCBA 2K8MB 2L51A 3PATA 1HQVA 1DF0B 1BOCA 2NLNA 1AUIB 3F45A 4FTGA 5ER4X 3SJSA 2AAOA 2M49B 4YI9A 3M0WA 4XYNA 1N65A 1GJYA
chains in the Genus database with same CATH superfamily
1EG3A 1Y6WA 2MLEC 3HCMA 1X02A 1WDCC 2LHLA 2PMYA 2CT9A 4AOMA 3TUYC 4TNCA 2H61C 1YRTB 1NX1A 5AXIA 1CNPA 2H8VA 3NSOA 4CLNA 2LP3A 2M97A 1W7JB 4QJ4B 2KDHA 1WRKA 4M2OA 2PASA 3ZNIA 1CDLA 1SL9A 3NSKA 2P70A 1SPYA 2Q91A 3NXAA 1OOIX 1QLSA 2H2KA 3EK7A 1ZACA 4R1EA 2LVIA 2M7LA 1B8CA 2I18A 1DC1A 4OV2A 1L2OC 1ZMZA 2L2EA 3FE6A 2ISDA 1RK9A 2H61A 1F70A 1QV1A 1DMOA 4PE7A 1K9UA 1CFCA 2CTNA 2K7OA 4MEWA 1KK8B 1LKJA 1TUZA 2K7BA 2LLUA 2BAPA 3ZWHA 1QJTA 3N7HA 1GGWA 5KU1A 1V1FA 2HF5A 2F3ZA 3IQQA 4DCKA 1YUTA 2BKIB 3FE8A 1QIVA 3FS7A 2LLTA 3BQ3A 1Z2CB 1EG4A 5DICA 2D8NA 1HT9A 1K95A 1G4YR 1PSRA 2K7DA 2HPSA 3B87A 1RROA 4OZDA 1CDPA 1OOHA 1CLMA 4P5OE 1MXEA 1AVSA 1IKUA 2BL0B 2JRFA 1NX3A 1R6PA 1J1DA 1N2DA 2FJUB 3GOFA 1NUBA 3SS3A 1QVIY 3JTDB 2NCPA 1RWYA 1IH0A 3BFAA 3K1EA 1Y1AA 3OB2B 1GQMA 3HX4A 1WLMA 3SG4A 1IIOA 3R1OA 5CSIA 1E8AA 1TOPA 5ER5A 1KQMC 2V53A 1A4PA 3BUMB 3C1VA 3DD4A 5J3XA 5JOLA 5K89A 1A2XA 1K96A 3NSLA 1EXRA 2JTZA 3I5HB 2LP2A 3O6BA 4PHNA 2JNFA 5GQQC 4GGFC 2JPTA 4ZCUA 1YRUB 1DJIA 1KWOC 1WRZA 2KQYA 3KO0A 3ICBA 5AFPA 3SS5A 2L0PA 2JPOA 1S5GY 1XO5A 2M29A 1SR6C 1K9PA 1F71A 3NGVA 4GAOA 2M3WA 2G9BA 1DGVA 3NSIA 4PCWA 3VRRA 2BBNA 4PHKA 2P71A 1OOFA 3LLEA 1D1OA 1OOGA 4XJKB 4GGFA 2F2OA 2WCBA 4YGBB 4F7FA 2F8PA 3I5IB 3BFBA 1S36A 1ZFSA 3VRPA 1S6JA 1U5IB 5DKRA 2WCHA 3SG5A 2LVJA 1CLBA 1GGZA 2KLEA 3CR4X 1TRFA 1S5GZ 2LMVA 2M0RA 3K21A 5AEQA 3CR2A 4M2QA 1MR8A 1NSHA 3WNXB 1KFUL 2PQLA 1PVAA 2QEBA 3KPXA 3MSEB 1OZSA 1CM1A 1S1EA 1B1GA 1DQEA 1SCVA 1B47A 1NPQA 1YVHA 1R2UA 1DEKA 3LL8B 3AKBA 2WORA 1TNQA 3D77A 1S6CA 1XK4A 4PT1A 4YGAA 3TS5B 1B7TZ 1AK8A 2F33A 4IJ7A 1LVCD 1SMGA 1ODBA 5F6TA 5D69A 3B86A 4YI8A 3D10A 2JNXA 1AHRA 1G33A 3TDZA 2KFHA 2HQWA 3B6XA 4HRHA 1ZOTB 1TUJA 4HSZA 2L4HA 4MZLA 4WQ2A 3DY9A 3AAJA 4PHJA 3DVKA 2KI6C 1ALWA 2KLDA 1S26D 1TNWA 3TZ1A 4YBHB 5I94A 3O4XA 1V1GA 2OPOA 1M39A 1QASA 3PM2A 1RJVA 1OW4A 1JFJA 1KFXS 2ZN8A 5BPJA 1SCMB 2MBXA 3DF0B 1UP5A 3PFVA 3PSRA 5B8IB 5DKQA 2KSPA 3BXKA 3BUNB 1DT7B 1M45A 1DTLA 1IQ5A 1JUOA 2P6BB 4MZKA 3CS1A 3EVVA 3TDIA 3BUOB 4YGEB 1MHOA 2WCJA 1CFFA 1QS7A 3SG7A 1TNXA 2EC6B 2LE9B 2WCEA 3DXLA 5I8NA 1RFJA 3OX6A 5FYXA 2EHBA 3PJIA 1CTRA 3O4YA 2BNXA 1OMRA 4ORAB 5KTYA 1IRJA 2COLB 5IBWA 1QTXA 3PN7B 4ORBB 1DELA 1BLQA 1MXLC 1C3ZA 3VB1A 1KK8C 2NZ0A 3BJHA 2LMUA 1K93D 2KOTA 1BJFA 3EK8A 1SYMA 1TCOB 5TNCA 3VRQA 3L4AA 3UNWA 1WDCB 3RLZA 1B9AA 3TUYB 1XYDA 2KAYA 1EJ3A 1LA0A 4JPZB 1SW8A 2Y1NA 1CMGA 1NWDA 2KGBC 2JT3A 2KI6D 2LUCA 1QXPA 3CZ2A 1IWQA 1TNPA 1DJHA 2L5XB 4I5JA 3E3RA 4MBEA 1DJXA 1C07A 3V2LA 1JBAA 1UHHA 1XFVO 2BCAA 4DRWA 2BL0C 2AMIA 2IS9A 1DJYA 2L4IA 2ZFDA 2ZRSA 3KHEA 2Y5IA 4ICBA 2LC5A 2WC5A 1LINA 2MA2A 1KSOA 4INXA 5EL2A 3S0AA 1UUSA 1RECA 2KBMA 2WCMA 3H4SE 3KEVA 4F0ZB 1M63B 5JJGA 2I7AA 1B8LA 1OQPA 1W9ZA 4JKTA 1XFUO 3FWCA 3I5HC 1XFRA 3OB1B 4NQGA 1PRWA 1BT6A 1ALVA 1C7VA 1NCXA 2LV7A 2K61A 5HKWA 3VGOA 2LAPA 1CFPA 1J7PA 1C3YA 2RGIA 1BR1B 1TN4A 2OS8C 3OP0A 1RTP1 3SIBA 4QJ5B 1N0YA 1XFXO 3BOWA 1SL7A 3S0FA 4FQOA 1OOJA 3SG2A 1EH2A 1CDMA 1QV0A 1J7OA 2PSRA 2L98A 3VRNA 3Q8IA 3CABA 4CPVA 3D78A 3NHTA 1Y0VH 3I5IC 1J1EA 1NX2A 1KK7Y 3D75A 5HYDA 2K0JA 4ETOA 3LK0A 1FPWA 3R1PA 2BE6A 1CB1A 2CNPA 2GTEA 1B7TY 4GNKB 5FI2A 3JVTC 1QX5B 1IG5A 2FJYA 1FI5A 1SR6B 3OBVA 2PRUA 2A4JA 1QIWA 1NCYA 3L4LA 1CM4A 1SL8A 4AQIA 1QWVA 2K60A 4C0KA 5PALA 2K7CA 4DUQA 3GK2A 4FQTA 1J7QA 1KK7Z 2ZNDA 4MRXA 3AKAA 3FWBA 4JD9A 3TS5C 4E68A 3DVJA 1LXFC 4C0LA 2FOTA 2F2PA 1QX7A 4PHMA 2QPTA 1PALA 2WCLA 2HQ8A 1XFWO 1G8IA 2GV5A 1A75A 3DYEA 5CSNA 3CZ0A 1IJ5A 1W7IB 2DOQA 2KNEA 5CSJA 1IQ3A 3CLNA 1QATA 3I5FB 4CFRA 2JWWA 1XFYO 2KI4C 3D0YA 1SKTA 2Q4UA 2KYFA 4A4BA 1BG1A 3AAKA 1LA3A 4P2YB 1JWDA 2BECA 3B88A 2LM5A 3A4UB 2ZRTA 2BCXA 3D74A 2MRDA 2R2IA 3PLFB 2LVKA 4PDZA 3KF9A 3S0DA 4YRUA 2Y1MA 3EKHA 1SY9A 2OTGB 3O78A 4BY4A 2JT0A 3BYAA 1PVBA 3VROA 1WRLA 4L9MA 1DF0A 1GM0A 1OSAA 3EVUA 4JQ0D 1AJ4A 1Y1XA 2EC6C 1CFDA 2FCEA 3B7AA 4MVFA 2KFGA 4NDBA 5FI6A 1CDNA 1KCYA 1JF2A 3I5GB 4UPGA 5D7FA 5HKYA 2PVBA 2SCPA 2E6WA 2JTTA 1YUUA 4INWA 1YX8A 3OHMB 2JXCA 2JU0A 3IQOA 1WY9A 4GBAA 1ZUZA 4JWQA 3SG6A 5AERA 1S3PA 2CXJA 1B4CA 2ZN9A 4NDCA 3PN7C 1ORGA 1PK0D 2JOJA 2M7NA 1FF1A 1K8UA 1M31A 2LCPA 3IVTA 4GUKA 2QEVA 2M8UA 1F4OA 3RM1A 3R1VA 2I2RE 1EL4A 1NYAA 4OCIA 2KBIA 4I5KA 1M46A 4PE0A 3WXAA 2NCOA 1OE9B 4GFTA 3QRXA 1KFXL 2ERBA 2ZNEA 5D3OA 1L7ZA 1Y1UA 2LNKA 4BY5A 2CBLA 1MF8B 2VRGA 3D76A 2O60A 3EVRA 4MSPA 3SG3A 3CYZA 4QJ3B 2JULA 3SS4A 4OVNF 1Z4HA 4Q04A 4USLA 1K2HA 2K2FA 1QLKA 1L2OB 2JT8A 4U8DA 4MLWA 1KSMA 1F54A 3QMEA 5I2OA 1YX7A 3JTDC 1F4QA 1AP4A 1VRKA 2BKHB 2WOSA 1OMVA 1IGVA 1SK6D 3WHUB 3PM8A 2QDIA 1NX0A 1FBVA 2MLFC 2L5YA 1DJZA 5HL1A 2PYQA 1XFZO 4WRIA 1K9KA 1TIZA 2AUCA 2HETA 2QACA 5CPVA 3A8RA 5G08A 3S0GA 1FI6A 4GGNA 3LK1A 2WCKA 3PALA 2KHNA 3DVMA 4ZCVA 1DJWA 1YUSA 4MRYA 1KQVA 1B8RA 1BMOA 2GGMA 2KAXA 2GGZA 2KPHA 1TTXA 2LHIA 1XVJA 3DZTA 1OMDA 2KYCA 1SBJA 4M2PA 5DKNA 1YTZC 4HREE 4PE4A 4NDDA 1BR4B 1IJ6A 3OGNA 4N1FA 1NCZA 5HKZA 1JC2A 4MZJA 1UHNA 3BUWB 2LANA 2LLSA 1JF0A 3OX5A 1NP8A 1AJ5A 1PULA 1OZOA 2I94A 5HLVA 2LMTA 3BOWB 2O5GA 1KFUS 2BE4A 2G2BA 2JZIA 1KQMB 3RZSA 5KSZA 3CGAA 1YR5A 1MUXA 1TCFA 1YURA 3LCPC 1UURA 4OR9B 1BF5A 1H4BA 4PE1A 2Y4QA 1CLLA 4I5NB 1KWOB 2LVVA 3O2PA 3UO9A 2E30A 4N1GA 2B1UA 3EKJA 3CR5X 1S6IA 4IL1A 4XJKA 1BU3A 1F55A 2OS8B 1UHKA 1Q80A 1QVIZ 2KFFA 2QEHA 2FCDA 4GPLB 4YGCB 2JC2A 2SASA 1UWOA 2M1KB 2ZKMX 1K94A 2M9GA 1U5IA 2JQ6A 3BUXB 3CWGA 4PALA 3EK4A 5I2LA 4N5XA 2CCMA 2M1UA 4OKHA 3R72A 1J7RA 2EGDA 5HLOA 4CIDA 1YVLA 1H8BA 3GK4X 3EG5B 1P28A 2WNDA 1NIWA 2YGUA 4YGDB 3BFHA 3JVTB 2BBMA 2F3YA 3S0EA 4AQJA 5I2QA 4KYNA 1XK4C 2MJWB 3GK1A 2QEOA 1UHIA 2TN4A 3CZ1A 1J55A 4ORCB 4D1EA 3I5FC 1FW4A 1QX2A 4HRGA 2MHHA 3TDUA 2JXLA 1A29A 2L50A 3CTNA 5AANA 4MN0A 2L2CA 3NHIA 1A75B 1K90D 1JFKA 1MWNA 2WC6A 2KGRA 3FIAA 1SSEB 1BODA 1SNLA 1A03A 3L47A 1JSAA 4A4CA 1LS8A 4I5LB 1SCMC 1UHJA 2WCFA 3SIAA 1XA5A 2LUXA 3D0YB 5FI7A 1DGUA 1CKKA 1C7WA 2OTGC 1F8HA 4WQ3A 1PSBA 2PALA 1WLZA 3FE9A 4CFQA 1DVIA 2WC8A 1DJGA 3DVEA 3IF7A 2NXQA 3S0BA 1MQ1A 4DIRA 2MAZA 2KAVA 2KQ6A 1CMFA 1SRAA 1TWOA 4C0JA 3I5GC 3CZTX 4DS7A 1T14A 3DF0A 3WHTB 2K2AA 5CSFA 2KI4B 2BCBA 2K8MB 2L51A 3CDNA 1HQVA 3PATA 1DF0B 3D73A 1BOCA 2NLNA 1AUIB 3F45A 4FTGA 5ER4X 3SJSA 2AAOA 2M49B 4YI9A 3M0WA 4XYNA 1N65A 1GJYA
chains in the Genus database with same CATH topology
1EG3A 1Y6WA 2MLEC 3HCMA 1X02A 1WDCC 2LHLA 2PMYA 2CT9A 4AOMA 3TUYC 4TNCA 2H61C 1YRTB 1NX1A 5AXIA 1CNPA 3NSOA 4CLNA 2LP3A 2M97A 1W7JB 4QJ4B 2KDHA 1WRKA 4M2OA 2PASA 3ZNIA 1CDLA 1SL9A 3NSKA 2Q91A 1SPYA 3NXAA 2H2KA 1QLSA 3EK7A 1ZACA 4R1EA 2LVIA 2M7LA 1B8CA 2I18A 4OV2A 1L2OC 1ZMZA 2L2EA 2ISDA 1RK9A 2H61A 1F70A 1QV1A 1DMOA 4PE7A 1K9UA 1CFCA 2CTNA 2K7OA 4MEWA 1KK8B 1LKJA 2K7BA 2LLUA 3ZWHA 1QJTA 1GGWA 5KU1A 1V1FA 2HF5A 2F3ZA 3IQQA 4DCKA 1YUTA 2BKIB 1QIVA 3FS7A 2LLTA 3BQ3A 1EG4A 2D8NA 1HT9A 1K95A 1G4YR 1PSRA 2K7DA 2HPSA 1RROA 1CDPA 1CLMA 4P5OE 1MXEA 1AVSA 1IKUA 2BL0B 2JRFA 1NX3A 1R6PA 1J1DA 1N2DA 2FJUB 3GOFA 1NUBA 1QVIY 3JTDB 2NCPA 1RWYA 1IH0A 1Y1AA 3OB2B 1GQMA 3HX4A 1WLMA 3SG4A 5CSIA 1E8AA 1TOPA 5ER5A 1KQMC 2V53A 1A4PA 3BUMB 3C1VA 3DD4A 5J3XA 5JOLA 5K89A 1A2XA 1K96A 3NSLA 1EXRA 2JTZA 3I5HB 2LP2A 3O6BA 4PHNA 2JNFA 5GQQC 4GGFC 2JPTA 4ZCUA 1YRUB 1DJIA 1KWOC 1WRZA 2KQYA 3KO0A 3ICBA 5AFPA 2L0PA 1S5GY 1XO5A 2M29A 1SR6C 1K9PA 1F71A 4GAOA 2M3WA 2G9BA 1DGVA 3NSIA 4PCWA 3VRRA 2BBNA 4PHKA 3LLEA 1D1OA 4XJKB 4GGFA 2F2OA 2WCBA 4YGBB 2F8PA 3I5IB 1S36A 1ZFSA 3VRPA 1S6JA 1U5IB 5DKRA 3SG5A 2LVJA 1CLBA 1GGZA 3CR4X 1TRFA 1S5GZ 2LMVA 2M0RA 3K21A 5AEQA 3CR2A 4M2QA 1MR8A 1NSHA 3WNXB 1KFUL 1PVAA 3KPXA 3MSEB 1OZSA 1CM1A 1S1EA 1B1GA 1SCVA 1YVHA 1B47A 1NPQA 1R2UA 3LL8B 3AKBA 2WORA 1TNQA 3TS5B 1S6CA 1XK4A 4YGAA 1B7TZ 1AK8A 2F33A 1LVCD 1SMGA 1ODBA 5F6TA 5D69A 4YI8A 3D10A 2JNXA 1AHRA 1G33A 3TDZA 2KFHA 2HQWA 4HRHA 1ZOTB 4HSZA 2L4HA 4MZLA 4WQ2A 3AAJA 4PHJA 3DVKA 2KI6C 1ALWA 1S26D 1TNWA 3TZ1A 4YBHB 1V1GA 2OPOA 1M39A 1QASA 1RJVA 1JFJA 1KFXS 2ZN8A 5BPJA 1SCMB 2MBXA 3DF0B 1UP5A 3PFVA 3PSRA 5B8IB 5DKQA 2KSPA 3BXKA 3BUNB 1DT7B 1M45A 1DTLA 1IQ5A 1JUOA 2P6BB 4MZKA 3CS1A 3EVVA 3TDIA 3BUOB 4YGEB 1MHOA 1CFFA 1QS7A 3SG7A 1TNXA 2EC6B 2LE9B 2WCEA 5I8NA 1RFJA 3OX6A 5FYXA 2EHBA 1CTRA 3O4YA 1OMRA 4ORAB 5KTYA 1IRJA 2COLB 5IBWA 1QTXA 3PN7B 4ORBB 1BLQA 1MXLC 1KK8C 2NZ0A 2LMUA 1K93D 2KOTA 1BJFA 3EK8A 1SYMA 1TCOB 5TNCA 3VRQA 1WDCB 3RLZA 1B9AA 3TUYB 1XYDA 2KAYA 1EJ3A 1LA0A 4JPZB 1SW8A 2Y1NA 1CMGA 1NWDA 2KGBC 2JT3A 2KI6D 2LUCA 1QXPA 1IWQA 1TNPA 1DJHA 2L5XB 4I5JA 3E3RA 4MBEA 1DJXA 1JBAA 1UHHA 1XFVO 2BCAA 4DRWA 2BL0C 2AMIA 2IS9A 1DJYA 2L4IA 2ZFDA 2ZRSA 3KHEA 2Y5IA 4ICBA 2LC5A 1LINA 2MA2A 1KSOA 1UUSA 1RECA 2KBMA 3H4SE 3KEVA 4F0ZB 1M63B 2I7AA 1B8LA 1OQPA 1XFUO 3FWCA 3I5HC 4NQGA 3OB1B 1PRWA 1BT6A 1ALVA 1C7VA 1NCXA 2LV7A 2K61A 5HKWA 3VGOA 2LAPA 1CFPA 1J7PA 2RGIA 1BR1B 1TN4A 2OS8C 3OP0A 1RTP1 3SIBA 4QJ5B 1N0YA 1XFXO 3BOWA 1SL7A 4FQOA 1OOJA 3SG2A 1EH2A 1CDMA 1QV0A 1J7OA 2PSRA 2L98A 3VRNA 4CPVA 1Y0VH 3I5IC 1J1EA 1NX2A 1KK7Y 5HYDA 2K0JA 4ETOA 3LK0A 1FPWA 2BE6A 1CB1A 2CNPA 1B7TY 4GNKB 3JVTC 1QX5B 1IG5A 1FI5A 1SR6B 2PRUA 2A4JA 1QIWA 1NCYA 1CM4A 1SL8A 4AQIA 4C0KA 5PALA 2K7CA 4DUQA 3GK2A 1J7QA 1KK7Z 2ZNDA 4MRXA 3AKAA 3FWBA 3TS5C 4E68A 3DVJA 1LXFC 4C0LA 2FOTA 2F2PA 1QX7A 4PHMA 2QPTA 1PALA 2HQ8A 1XFWO 1G8IA 2GV5A 1A75A 5CSNA 1IJ5A 1W7IB 2DOQA 2KNEA 5CSJA 1IQ3A 3CLNA 1QATA 3I5FB 4CFRA 2JWWA 1XFYO 2KI4C 3D0YA 1SKTA 2Q4UA 2KYFA 4A4BA 1BG1A 3AAKA 1LA3A 4P2YB 1JWDA 2BECA 2LM5A 3A4UB 2ZRTA 2BCXA 2MRDA 2R2IA 3PLFB 2LVKA 4PDZA 3KF9A 4YRUA 2Y1MA 3EKHA 1SY9A 2OTGB 3O78A 4BY4A 2JT0A 3BYAA 1PVBA 3VROA 1WRLA 4L9MA 1DF0A 1OSAA 3EVUA 4JQ0D 1AJ4A 1Y1XA 2EC6C 1CFDA 2FCEA 4MVFA 2KFGA 4NDBA 1CDNA 1KCYA 1JF2A 3I5GB 4UPGA 5D7FA 5HKYA 2PVBA 2SCPA 2E6WA 2JTTA 1YUUA 1YX8A 3OHMB 2JXCA 2JU0A 3IQOA 1WY9A 4GBAA 1ZUZA 4JWQA 3SG6A 5AERA 1S3PA 2CXJA 1B4CA 2ZN9A 4NDCA 3PN7C 1PK0D 2JOJA 2M7NA 1FF1A 1K8UA 1M31A 2LCPA 4GUKA 2M8UA 1F4OA 3RM1A 2I2RE 1EL4A 1NYAA 4OCIA 2KBIA 4I5KA 1M46A 4PE0A 3WXAA 2NCOA 1OE9B 4GFTA 3QRXA 1KFXL 2ZNEA 1L7ZA 1Y1UA 2LNKA 4BY5A 2CBLA 1MF8B 2VRGA 3EVRA 2O60A 4MSPA 3SG3A 4QJ3B 2JULA 4OVNF 4Q04A 4USLA 1K2HA 2K2FA 1QLKA 1L2OB 2JT8A 4U8DA 4MLWA 1KSMA 1F54A 5I2OA 1YX7A 3JTDC 1F4QA 1AP4A 1VRKA 2BKHB 2WOSA 1OMVA 1IGVA 1SK6D 3WHUB 3PM8A 1NX0A 1FBVA 2MLFC 1DJZA 1XFZO 4WRIA 1K9KA 1TIZA 2AUCA 2HETA 2QACA 5CPVA 3A8RA 5G08A 1FI6A 4GGNA 3LK1A 3PALA 2KHNA 3DVMA 4ZCVA 1DJWA 1YUSA 4MRYA 1KQVA 1B8RA 1BMOA 2GGMA 2KAXA 2GGZA 1TTXA 2LHIA 1XVJA 1OMDA 2KYCA 1SBJA 4M2PA 5DKNA 1YTZC 4HREE 4PE4A 4NDDA 1BR4B 1IJ6A 4N1FA 5HKZA 1NCZA 1JC2A 4MZJA 1UHNA 3BUWB 2LANA 2LLSA 1JF0A 3OX5A 1NP8A 1AJ5A 1PULA 1OZOA 2I94A 5HLVA 2LMTA 3BOWB 2O5GA 1KFUS 2BE4A 2G2BA 2JZIA 1KQMB 5KSZA 3CGAA 1YR5A 1MUXA 1TCFA 1YURA 3LCPC 1UURA 4OR9B 1BF5A 1H4BA 4PE1A 2Y4QA 1CLLA 4I5NB 1KWOB 2LVVA 3O2PA 2E30A 4N1GA 2B1UA 3EKJA 3CR5X 1S6IA 4IL1A 4XJKA 1BU3A 1F55A 2OS8B 1UHKA 1Q80A 1QVIZ 2KFFA 4YGCB 2FCDA 4GPLB 2JC2A 2SASA 1UWOA 2M1KB 2ZKMX 1K94A 2M9GA 1U5IA 2JQ6A 3BUXB 3CWGA 4PALA 3EK4A 5I2LA 4N5XA 2CCMA 2M1UA 4OKHA 1J7RA 2EGDA 5HLOA 4CIDA 1YVLA 1H8BA 3GK4X 2WNDA 1NIWA 4YGDB 5JJGA 3JVTB 2BBMA 2F3YA 4AQJA 5I2QA 1C07A 1XK4C 2MJWB 3GK1A 2TN4A 1UHIA 4D1EA 1J55A 4ORCB 3I5FC 1FW4A 1QX2A 4HRGA 2MHHA 3TDUA 2JXLA 1A29A 2L50A 3CTNA 5AANA 4MN0A 1A75B 1K90D 1JFKA 1MWNA 2KGRA 3FIAA 1BODA 1SNLA 1A03A 1JSAA 4A4CA 4I5LB 1SCMC 1UHJA 2WCFA 3SIAA 1XA5A 2LUXA 3D0YB 1DGUA 1CKKA 1C7WA 2OTGC 1F8HA 4WQ3A 1PSBA 2PALA 1WLZA 4CFQA 1DVIA 2WC8A 1DJGA 3DVEA 3IF7A 2NXQA 1MQ1A 4DIRA 2MAZA 2KAVA 2KQ6A 1CMFA 1SRAA 4C0JA 3I5GC 3CZTX 4DS7A 3DF0A 3WHTB 2K2AA 5CSFA 2KI4B 2BCBA 2K8MB 2L51A 3PATA 1HQVA 1DF0B 1BOCA 2NLNA 1AUIB 3F45A 4FTGA 5ER4X 3SJSA 2AAOA 2M49B 4YI9A 3M0WA 4XYNA 1N65A 1GJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  1Y6W A;  2MLE C;  3HCM A;  1X02 A;  1WDC C;  2LHL A;  2PMY A;  2CT9 A;  4AOM A;  3TUY C;  4TNC A;  2H61 C;  1YRT B;  1NX1 A;  5AXI A;  1CNP A;  3NSO A;  4CLN A;  2LP3 A;  2M97 A;  1W7J B;  4QJ4 B;  2KDH A;  1WRK A;  4M2O A;  2PAS A;  3ZNI A;  1CDL A;  1SL9 A;  3NSK A;  2Q91 A;  1SPY A;  3NXA A;  2H2K A;  1QLS A;  3EK7 A;  1ZAC A;  4R1E A;  2LVI A;  2M7L A;  1B8C A;  2I18 A;  4OV2 A;  1L2O C;  1ZMZ A;  2L2E A;  2ISD A;  1RK9 A;  2H61 A;  1F70 A;  1QV1 A;  1DMO A;  4PE7 A;  1K9U A;  1CFC A;  2CTN A;  2K7O A;  4MEW A;  1KK8 B;  1LKJ A;  2K7B A;  2LLU A;  3ZWH A;  1QJT A;  1GGW A;  5KU1 A;  1V1F A;  2HF5 A;  2F3Z A;  3IQQ A;  4DCK A;  1YUT A;  2BKI B;  1QIV A;  3FS7 A;  2LLT A;  3BQ3 A;  1EG4 A;  2D8N A;  1HT9 A;  1K95 A;  1G4Y R;  1PSR A;  2K7D A;  2HPS A;  1RRO A;  1CDP A;  1CLM A;  4P5O E;  1MXE A;  1AVS A;  1IKU A;  2BL0 B;  2JRF A;  1NX3 A;  1R6P A;  1J1D A;  1N2D A;  2FJU B;  3GOF A;  1NUB A;  1QVI Y;  3JTD B;  2NCP A;  1RWY A;  1IH0 A;  1Y1A A;  3OB2 B;  1GQM A;  3HX4 A;  1WLM A;  3SG4 A;  5CSI A;  1E8A A;  1TOP A;  5ER5 A;  1KQM C;  2V53 A;  1A4P A;  3BUM B;  3C1V A;  3DD4 A;  5J3X A;  5JOL A;  5K89 A;  1A2X A;  1K96 A;  3NSL A;  1EXR A;  2JTZ A;  3I5H B;  2LP2 A;  3O6B A;  4PHN A;  2JNF A;  5GQQ C;  4GGF C;  2JPT A;  4ZCU A;  1YRU B;  1DJI A;  1KWO C;  1WRZ A;  2KQY A;  3KO0 A;  3ICB A;  5AFP A;  2L0P A;  1S5G Y;  1XO5 A;  2M29 A;  1SR6 C;  1K9P A;  1F71 A;  4GAO A;  2M3W A;  2G9B A;  1DGV A;  3NSI A;  4PCW A;  3VRR A;  2BBN A;  4PHK A;  3LLE A;  1D1O A;  4XJK B;  4GGF A;  2F2O A;  2WCB A;  4YGB B;  2F8P A;  3I5I B;  1S36 A;  1ZFS A;  3VRP A;  1S6J A;  1U5I B;  5DKR A;  3SG5 A;  2LVJ A;  1CLB A;  1GGZ A;  3CR4 X;  1TRF A;  1S5G Z;  2LMV A;  2M0R A;  3K21 A;  5AEQ A;  3CR2 A;  4M2Q A;  1MR8 A;  1NSH A;  3WNX B;  1KFU L;  1PVA A;  3KPX A;  3MSE B;  1OZS A;  1CM1 A;  1S1E A;  1B1G A;  1SCV A;  1YVH A;  1B47 A;  1NPQ A;  1R2U A;  3LL8 B;  3AKB A;  2WOR A;  1TNQ A;  3TS5 B;  1S6C A;  1XK4 A;  4YGA A;  1B7T Z;  1AK8 A;  2F33 A;  1LVC D;  1SMG A;  1ODB A;  5F6T A;  5D69 A;  4YI8 A;  3D10 A;  2JNX A;  1AHR A;  1G33 A;  3TDZ A;  2KFH A;  2HQW A;  4HRH A;  1ZOT B;  4HSZ A;  2L4H A;  4MZL A;  4WQ2 A;  3AAJ A;  4PHJ A;  3DVK A;  2KI6 C;  1ALW A;  1S26 D;  1TNW A;  3TZ1 A;  4YBH B;  1V1G A;  2OPO A;  1M39 A;  1QAS A;  1RJV A;  1JFJ A;  1KFX S;  2ZN8 A;  5BPJ A;  1SCM B;  2MBX A;  3DF0 B;  1UP5 A;  3PFV A;  3PSR A;  5B8I B;  5DKQ A;  2KSP A;  3BXK A;  3BUN B;  1DT7 B;  1M45 A;  1DTL A;  1IQ5 A;  1JUO A;  2P6B B;  4MZK A;  3CS1 A;  3EVV A;  3TDI A;  3BUO B;  4YGE B;  1MHO A;  1CFF A;  1QS7 A;  3SG7 A;  1TNX A;  2EC6 B;  2LE9 B;  2WCE A;  5I8N A;  1RFJ A;  3OX6 A;  5FYX A;  2EHB A;  1CTR A;  3O4Y A;  1OMR A;  4ORA B;  5KTY A;  1IRJ A;  2COL B;  5IBW A;  1QTX A;  3PN7 B;  4ORB B;  1BLQ A;  1MXL C;  1KK8 C;  2NZ0 A;  2LMU A;  1K93 D;  2KOT A;  1BJF A;  3EK8 A;  1SYM A;  1TCO B;  5TNC A;  3VRQ A;  1WDC B;  3RLZ A;  1B9A A;  3TUY B;  1XYD A;  2KAY A;  1EJ3 A;  1LA0 A;  4JPZ B;  1SW8 A;  2Y1N A;  1CMG A;  1NWD A;  2KGB C;  2JT3 A;  2KI6 D;  2LUC A;  1QXP A;  1IWQ A;  1TNP A;  1DJH A;  2L5X B;  4I5J A;  3E3R A;  4MBE A;  1DJX A;  1JBA A;  1UHH A;  1XFV O;  2BCA A;  4DRW A;  2BL0 C;  2AMI A;  2IS9 A;  1DJY A;  2L4I A;  2ZFD A;  2ZRS A;  3KHE A;  2Y5I A;  4ICB A;  2LC5 A;  1LIN A;  2MA2 A;  1KSO A;  1UUS A;  1REC A;  2KBM A;  3H4S E;  3KEV A;  4F0Z B;  1M63 B;  2I7A A;  1B8L A;  1OQP A;  1XFU O;  3FWC A;  3I5H C;  4NQG A;  3OB1 B;  1PRW A;  1BT6 A;  1ALV A;  1C7V A;  1NCX A;  2LV7 A;  2K61 A;  5HKW A;  3VGO A;  2LAP A;  1CFP A;  1J7P A;  2RGI A;  1BR1 B;  1TN4 A;  2OS8 C;  3OP0 A;  1RTP 1;  3SIB A;  4QJ5 B;  1N0Y A;  1XFX O;  3BOW A;  1SL7 A;  4FQO A;  1OOJ A;  3SG2 A;  1EH2 A;  1CDM A;  1QV0 A;  1J7O A;  2PSR A;  2L98 A;  3VRN A;  4CPV A;  1Y0V H;  3I5I C;  1J1E A;  1NX2 A;  1KK7 Y;  5HYD A;  2K0J A;  4ETO A;  3LK0 A;  1FPW A;  2BE6 A;  1CB1 A;  2CNP A;  1B7T Y;  4GNK B;  3JVT C;  1QX5 B;  1IG5 A;  1FI5 A;  1SR6 B;  2PRU A;  2A4J A;  1QIW A;  1NCY A;  1CM4 A;  1SL8 A;  4AQI A;  4C0K A;  5PAL A;  2K7C A;  4DUQ A;  3GK2 A;  1J7Q A;  1KK7 Z;  2ZND A;  4MRX A;  3AKA A;  3FWB A;  3TS5 C;  4E68 A;  3DVJ A;  1LXF C;  4C0L A;  2FOT A;  2F2P A;  1QX7 A;  4PHM A;  2QPT A;  1PAL A;  2HQ8 A;  1XFW O;  1G8I A;  2GV5 A;  1A75 A;  5CSN A;  1IJ5 A;  1W7I B;  2DOQ A;  2KNE A;  5CSJ A;  1IQ3 A;  3CLN A;  1QAT A;  3I5F B;  4CFR A;  2JWW A;  1XFY O;  2KI4 C;  3D0Y A;  1SKT A;  2Q4U A;  2KYF A;  4A4B A;  1BG1 A;  3AAK A;  1LA3 A;  4P2Y B;  1JWD A;  2BEC A;  2LM5 A;  3A4U B;  2ZRT A;  2BCX A;  2MRD A;  2R2I A;  3PLF B;  2LVK A;  4PDZ A;  3KF9 A;  4YRU A;  2Y1M A;  3EKH A;  1SY9 A;  2OTG B;  3O78 A;  4BY4 A;  2JT0 A;  3BYA A;  1PVB A;  3VRO A;  1WRL A;  4L9M A;  1DF0 A;  1OSA A;  3EVU A;  4JQ0 D;  1AJ4 A;  1Y1X A;  2EC6 C;  1CFD A;  2FCE A;  4MVF A;  2KFG A;  4NDB A;  1CDN A;  1KCY A;  1JF2 A;  3I5G B;  4UPG A;  5D7F A;  5HKY A;  2PVB A;  2SCP A;  2E6W A;  2JTT A;  1YUU A;  1YX8 A;  3OHM B;  2JXC A;  2JU0 A;  3IQO A;  1WY9 A;  4GBA A;  1ZUZ A;  4JWQ A;  3SG6 A;  5AER A;  1S3P A;  2CXJ A;  1B4C A;  2ZN9 A;  4NDC A;  3PN7 C;  1PK0 D;  2JOJ A;  2M7N A;  1FF1 A;  1K8U A;  1M31 A;  2LCP A;  4GUK A;  2M8U A;  1F4O A;  3RM1 A;  2I2R E;  1EL4 A;  1NYA A;  4OCI A;  2KBI A;  4I5K A;  1M46 A;  4PE0 A;  3WXA A;  2NCO A;  1OE9 B;  4GFT A;  3QRX A;  1KFX L;  2ZNE A;  1L7Z A;  1Y1U A;  2LNK A;  4BY5 A;  2CBL A;  1MF8 B;  2VRG A;  3EVR A;  2O60 A;  4MSP A;  3SG3 A;  4QJ3 B;  2JUL A;  4OVN F;  4Q04 A;  4USL A;  1K2H A;  2K2F A;  1QLK A;  1L2O B;  2JT8 A;  4U8D A;  4MLW A;  1KSM A;  1F54 A;  5I2O A;  1YX7 A;  3JTD C;  1F4Q A;  1AP4 A;  1VRK A;  2BKH B;  2WOS A;  1OMV A;  1IGV A;  1SK6 D;  3WHU B;  3PM8 A;  1NX0 A;  1FBV A;  2MLF C;  1DJZ A;  1XFZ O;  4WRI A;  1K9K A;  1TIZ A;  2AUC A;  2HET A;  2QAC A;  5CPV A;  3A8R A;  5G08 A;  1FI6 A;  4GGN A;  3LK1 A;  3PAL A;  2KHN A;  3DVM A;  4ZCV A;  1DJW A;  1YUS A;  4MRY A;  1KQV A;  1B8R A;  1BMO A;  2GGM A;  2KAX A;  2GGZ A;  1TTX A;  2LHI A;  1XVJ A;  1OMD A;  2KYC A;  1SBJ A;  4M2P A;  5DKN A;  1YTZ C;  4HRE E;  4PE4 A;  4NDD A;  1BR4 B;  1IJ6 A;  4N1F A;  5HKZ A;  1NCZ A;  1JC2 A;  4MZJ A;  1UHN A;  3BUW B;  2LAN A;  2LLS A;  1JF0 A;  3OX5 A;  1NP8 A;  1AJ5 A;  1PUL A;  1OZO A;  2I94 A;  5HLV A;  2LMT A;  3BOW B;  2O5G A;  1KFU S;  2BE4 A;  2G2B A;  2JZI A;  1KQM B;  5KSZ A;  3CGA A;  1YR5 A;  1MUX A;  1TCF A;  1YUR A;  3LCP C;  1UUR A;  4OR9 B;  1BF5 A;  1H4B A;  4PE1 A;  2Y4Q A;  1CLL A;  4I5N B;  1KWO B;  2LVV A;  3O2P A;  2E30 A;  4N1G A;  2B1U A;  3EKJ A;  3CR5 X;  1S6I A;  4IL1 A;  4XJK A;  1BU3 A;  1F55 A;  2OS8 B;  1UHK A;  1Q80 A;  1QVI Z;  2KFF A;  4YGC B;  2FCD A;  4GPL B;  2JC2 A;  2SAS A;  1UWO A;  2M1K B;  2ZKM X;  1K94 A;  2M9G A;  1U5I A;  2JQ6 A;  3BUX B;  3CWG A;  4PAL A;  3EK4 A;  5I2L A;  4N5X A;  2CCM A;  2M1U A;  4OKH A;  1J7R A;  2EGD A;  5HLO A;  4CID A;  1YVL A;  1H8B A;  3GK4 X;  2WND A;  1NIW A;  4YGD B;  5JJG A;  3JVT B;  2BBM A;  2F3Y A;  4AQJ A;  5I2Q A;  1C07 A;  1XK4 C;  2MJW B;  3GK1 A;  2TN4 A;  1UHI A;  4D1E A;  1J55 A;  4ORC B;  3I5F C;  1FW4 A;  1QX2 A;  4HRG A;  2MHH A;  3TDU A;  2JXL A;  1A29 A;  2L50 A;  3CTN A;  5AAN A;  4MN0 A;  1A75 B;  1K90 D;  1JFK A;  1MWN A;  2KGR A;  3FIA A;  1BOD A;  1SNL A;  1A03 A;  1JSA A;  4A4C A;  4I5L B;  1SCM C;  1UHJ A;  2WCF A;  3SIA A;  1XA5 A;  2LUX A;  3D0Y B;  1DGU A;  1CKK A;  1C7W A;  2OTG C;  1F8H A;  4WQ3 A;  1PSB A;  2PAL A;  1WLZ A;  4CFQ A;  1DVI A;  2WC8 A;  1DJG A;  3DVE A;  3IF7 A;  2NXQ A;  1MQ1 A;  4DIR A;  2MAZ A;  2KAV A;  2KQ6 A;  1CMF A;  1SRA A;  4C0J A;  3I5G C;  3CZT X;  4DS7 A;  3DF0 A;  3WHT B;  2K2A A;  5CSF A;  2KI4 B;  2BCB A;  2K8M B;  2L51 A;  3PAT A;  1HQV A;  1DF0 B;  1BOC A;  2NLN A;  1AUI B;  3F45 A;  4FTG A;  5ER4 X;  3SJS A;  2AAO A;  2M49 B;  4YI9 A;  3M0W A;  4XYN A;  1N65 A;  1GJY A; 
#chains in the Genus database with same CATH topology
 1EG3 A;  1Y6W A;  2MLE C;  3HCM A;  1X02 A;  1WDC C;  2LHL A;  2PMY A;  2CT9 A;  4AOM A;  3TUY C;  4TNC A;  2H61 C;  1YRT B;  1NX1 A;  5AXI A;  1CNP A;  2H8V A;  3NSO A;  4CLN A;  2LP3 A;  2M97 A;  1W7J B;  4QJ4 B;  2KDH A;  1WRK A;  4M2O A;  2PAS A;  3ZNI A;  1CDL A;  1SL9 A;  3NSK A;  2P70 A;  1SPY A;  2Q91 A;  3NXA A;  1OOI X;  1QLS A;  2H2K A;  3EK7 A;  1ZAC A;  4R1E A;  2LVI A;  2M7L A;  1B8C A;  2I18 A;  1DC1 A;  4OV2 A;  1L2O C;  1ZMZ A;  2L2E A;  3FE6 A;  2ISD A;  1RK9 A;  2H61 A;  1F70 A;  1QV1 A;  1DMO A;  4PE7 A;  1K9U A;  1CFC A;  2CTN A;  2K7O A;  4MEW A;  1KK8 B;  1LKJ A;  1TUZ A;  2K7B A;  2LLU A;  2BAP A;  3ZWH A;  1QJT A;  3N7H A;  1GGW A;  5KU1 A;  1V1F A;  2HF5 A;  2F3Z A;  3IQQ A;  4DCK A;  1YUT A;  2BKI B;  3FE8 A;  1QIV A;  3FS7 A;  2LLT A;  3BQ3 A;  1Z2C B;  1EG4 A;  5DIC A;  2D8N A;  1HT9 A;  1K95 A;  1G4Y R;  1PSR A;  2K7D A;  2HPS A;  3B87 A;  1RRO A;  4OZD A;  1CDP A;  1OOH A;  1CLM A;  4P5O E;  1MXE A;  1AVS A;  1IKU A;  2BL0 B;  2JRF A;  1NX3 A;  1R6P A;  1J1D A;  1N2D A;  2FJU B;  3GOF A;  1NUB A;  3SS3 A;  1QVI Y;  3JTD B;  2NCP A;  1RWY A;  1IH0 A;  3BFA A;  3K1E A;  1Y1A A;  3OB2 B;  1GQM A;  3HX4 A;  1WLM A;  3SG4 A;  1IIO A;  3R1O A;  5CSI A;  1E8A A;  1TOP A;  5ER5 A;  1KQM C;  2V53 A;  1A4P A;  3BUM B;  3C1V A;  3DD4 A;  5J3X A;  5JOL A;  5K89 A;  1A2X A;  1K96 A;  3NSL A;  1EXR A;  2JTZ A;  3I5H B;  2LP2 A;  3O6B A;  4PHN A;  2JNF A;  5GQQ C;  4GGF C;  2JPT A;  4ZCU A;  1YRU B;  1DJI A;  1KWO C;  1WRZ A;  2KQY A;  3KO0 A;  3ICB A;  5AFP A;  3SS5 A;  2L0P A;  2JPO A;  1S5G Y;  1XO5 A;  2M29 A;  1SR6 C;  1K9P A;  1F71 A;  3NGV A;  4GAO A;  2M3W A;  2G9B A;  1DGV A;  3NSI A;  4PCW A;  3VRR A;  2BBN A;  4PHK A;  2P71 A;  1OOF A;  3LLE A;  1D1O A;  1OOG A;  4XJK B;  4GGF A;  2F2O A;  2WCB A;  4YGB B;  4F7F A;  2F8P A;  3I5I B;  3BFB A;  1S36 A;  1ZFS A;  3VRP A;  1S6J A;  1U5I B;  5DKR A;  2WCH A;  3SG5 A;  2LVJ A;  1CLB A;  1GGZ A;  2KLE A;  3CR4 X;  1TRF A;  1S5G Z;  2LMV A;  2M0R A;  3K21 A;  5AEQ A;  3CR2 A;  4M2Q A;  1MR8 A;  1NSH A;  3WNX B;  1KFU L;  2PQL A;  1PVA A;  2QEB A;  3KPX A;  3MSE B;  1OZS A;  1CM1 A;  1S1E A;  1B1G A;  1DQE A;  1SCV A;  1B47 A;  1NPQ A;  1YVH A;  1R2U A;  1DEK A;  3LL8 B;  3AKB A;  2WOR A;  1TNQ A;  3D77 A;  1S6C A;  1XK4 A;  4PT1 A;  4YGA A;  3TS5 B;  1B7T Z;  1AK8 A;  2F33 A;  4IJ7 A;  1LVC D;  1SMG A;  1ODB A;  5F6T A;  5D69 A;  3B86 A;  4YI8 A;  3D10 A;  2JNX A;  1AHR A;  1G33 A;  3TDZ A;  2KFH A;  2HQW A;  3B6X A;  4HRH A;  1ZOT B;  1TUJ A;  4HSZ A;  2L4H A;  4MZL A;  4WQ2 A;  3DY9 A;  3AAJ A;  4PHJ A;  3DVK A;  2KI6 C;  1ALW A;  2KLD A;  1S26 D;  1TNW A;  3TZ1 A;  4YBH B;  5I94 A;  3O4X A;  1V1G A;  2OPO A;  1M39 A;  1QAS A;  3PM2 A;  1RJV A;  1OW4 A;  1JFJ A;  1KFX S;  2ZN8 A;  5BPJ A;  1SCM B;  2MBX A;  3DF0 B;  1UP5 A;  3PFV A;  3PSR A;  5B8I B;  5DKQ A;  2KSP A;  3BXK A;  3BUN B;  1DT7 B;  1M45 A;  1DTL A;  1IQ5 A;  1JUO A;  2P6B B;  4MZK A;  3CS1 A;  3EVV A;  3TDI A;  3BUO B;  4YGE B;  1MHO A;  2WCJ A;  1CFF A;  1QS7 A;  3SG7 A;  1TNX A;  2EC6 B;  2LE9 B;  2WCE A;  3DXL A;  5I8N A;  1RFJ A;  3OX6 A;  5FYX A;  2EHB A;  3PJI A;  1CTR A;  3O4Y A;  2BNX A;  1OMR A;  4ORA B;  5KTY A;  1IRJ A;  2COL B;  5IBW A;  1QTX A;  3PN7 B;  4ORB B;  1DEL A;  1BLQ A;  1MXL C;  1C3Z A;  3VB1 A;  1KK8 C;  2NZ0 A;  3BJH A;  2LMU A;  1K93 D;  2KOT A;  1BJF A;  3EK8 A;  1SYM A;  1TCO B;  5TNC A;  3VRQ A;  3L4A A;  3UNW A;  1WDC B;  3RLZ A;  1B9A A;  3TUY B;  1XYD A;  2KAY A;  1EJ3 A;  1LA0 A;  4JPZ B;  1SW8 A;  2Y1N A;  1CMG A;  1NWD A;  2KGB C;  2JT3 A;  2KI6 D;  2LUC A;  1QXP A;  3CZ2 A;  1IWQ A;  1TNP A;  1DJH A;  2L5X B;  4I5J A;  3E3R A;  4MBE A;  1DJX A;  1C07 A;  3V2L A;  1JBA A;  1UHH A;  1XFV O;  2BCA A;  4DRW A;  2BL0 C;  2AMI A;  2IS9 A;  1DJY A;  2L4I A;  2ZFD A;  2ZRS A;  3KHE A;  2Y5I A;  4ICB A;  2LC5 A;  2WC5 A;  1LIN A;  2MA2 A;  1KSO A;  4INX A;  5EL2 A;  3S0A A;  1UUS A;  1REC A;  2KBM A;  2WCM A;  3H4S E;  3KEV A;  4F0Z B;  1M63 B;  5JJG A;  2I7A A;  1B8L A;  1OQP A;  1W9Z A;  4JKT A;  1XFU O;  3FWC A;  3I5H C;  1XFR A;  3OB1 B;  4NQG A;  1PRW A;  1BT6 A;  1ALV A;  1C7V A;  1NCX A;  2LV7 A;  2K61 A;  5HKW A;  3VGO A;  2LAP A;  1CFP A;  1J7P A;  1C3Y A;  2RGI A;  1BR1 B;  1TN4 A;  2OS8 C;  3OP0 A;  1RTP 1;  3SIB A;  4QJ5 B;  1N0Y A;  1XFX O;  3BOW A;  1SL7 A;  3S0F A;  4FQO A;  1OOJ A;  3SG2 A;  1EH2 A;  1CDM A;  1QV0 A;  1J7O A;  2PSR A;  2L98 A;  3VRN A;  3Q8I A;  3CAB A;  4CPV A;  3D78 A;  3NHT A;  1Y0V H;  3I5I C;  1J1E A;  1NX2 A;  1KK7 Y;  3D75 A;  5HYD A;  2K0J A;  4ETO A;  3LK0 A;  1FPW A;  3R1P A;  2BE6 A;  1CB1 A;  2CNP A;  2GTE A;  1B7T Y;  4GNK B;  5FI2 A;  3JVT C;  1QX5 B;  1IG5 A;  2FJY A;  1FI5 A;  1SR6 B;  3OBV A;  2PRU A;  2A4J A;  1QIW A;  1NCY A;  3L4L A;  1CM4 A;  1SL8 A;  4AQI A;  1QWV A;  2K60 A;  4C0K A;  5PAL A;  2K7C A;  4DUQ A;  3GK2 A;  4FQT A;  1J7Q A;  1KK7 Z;  2ZND A;  4MRX A;  3AKA A;  3FWB A;  4JD9 A;  3TS5 C;  4E68 A;  3DVJ A;  1LXF C;  4C0L A;  2FOT A;  2F2P A;  1QX7 A;  4PHM A;  2QPT A;  1PAL A;  2WCL A;  2HQ8 A;  1XFW O;  1G8I A;  2GV5 A;  1A75 A;  3DYE A;  5CSN A;  3CZ0 A;  1IJ5 A;  1W7I B;  2DOQ A;  2KNE A;  5CSJ A;  1IQ3 A;  3CLN A;  1QAT A;  3I5F B;  4CFR A;  2JWW A;  1XFY O;  2KI4 C;  3D0Y A;  1SKT A;  2Q4U A;  2KYF A;  4A4B A;  1BG1 A;  3AAK A;  1LA3 A;  4P2Y B;  1JWD A;  2BEC A;  3B88 A;  2LM5 A;  3A4U B;  2ZRT A;  2BCX A;  3D74 A;  2MRD A;  2R2I A;  3PLF B;  2LVK A;  4PDZ A;  3KF9 A;  3S0D A;  4YRU A;  2Y1M A;  3EKH A;  1SY9 A;  2OTG B;  3O78 A;  4BY4 A;  2JT0 A;  3BYA A;  1PVB A;  3VRO A;  1WRL A;  4L9M A;  1DF0 A;  1GM0 A;  1OSA A;  3EVU A;  4JQ0 D;  1AJ4 A;  1Y1X A;  2EC6 C;  1CFD A;  2FCE A;  3B7A A;  4MVF A;  2KFG A;  4NDB A;  5FI6 A;  1CDN A;  1KCY A;  1JF2 A;  3I5G B;  4UPG A;  5D7F A;  5HKY A;  2PVB A;  2SCP A;  2E6W A;  2JTT A;  1YUU A;  4INW A;  1YX8 A;  3OHM B;  2JXC A;  2JU0 A;  3IQO A;  1WY9 A;  4GBA A;  1ZUZ A;  4JWQ A;  3SG6 A;  5AER A;  1S3P A;  2CXJ A;  1B4C A;  2ZN9 A;  4NDC A;  3PN7 C;  1ORG A;  1PK0 D;  2JOJ A;  2M7N A;  1FF1 A;  1K8U A;  1M31 A;  2LCP A;  3IVT A;  4GUK A;  2QEV A;  2M8U A;  1F4O A;  3RM1 A;  3R1V A;  2I2R E;  1EL4 A;  1NYA A;  4OCI A;  2KBI A;  4I5K A;  1M46 A;  4PE0 A;  3WXA A;  2NCO A;  1OE9 B;  4GFT A;  3QRX A;  1KFX L;  2ERB A;  2ZNE A;  5D3O A;  1L7Z A;  1Y1U A;  2LNK A;  4BY5 A;  2CBL A;  1MF8 B;  2VRG A;  3D76 A;  2O60 A;  3EVR A;  4MSP A;  3SG3 A;  3CYZ A;  4QJ3 B;  2JUL A;  3SS4 A;  4OVN F;  1Z4H A;  4Q04 A;  4USL A;  1K2H A;  2K2F A;  1QLK A;  1L2O B;  2JT8 A;  4U8D A;  4MLW A;  1KSM A;  1F54 A;  3QME A;  5I2O A;  1YX7 A;  3JTD C;  1F4Q A;  1AP4 A;  1VRK A;  2BKH B;  2WOS A;  1OMV A;  1IGV A;  1SK6 D;  3WHU B;  3PM8 A;  2QDI A;  1NX0 A;  1FBV A;  2MLF C;  2L5Y A;  1DJZ A;  5HL1 A;  2PYQ A;  1XFZ O;  4WRI A;  1K9K A;  1TIZ A;  2AUC A;  2HET A;  2QAC A;  5CPV A;  3A8R A;  5G08 A;  3S0G A;  1FI6 A;  4GGN A;  3LK1 A;  2WCK A;  3PAL A;  2KHN A;  3DVM A;  4ZCV A;  1DJW A;  1YUS A;  4MRY A;  1KQV A;  1B8R A;  1BMO A;  2GGM A;  2KAX A;  2GGZ A;  2KPH A;  1TTX A;  2LHI A;  1XVJ A;  3DZT A;  1OMD A;  2KYC A;  1SBJ A;  4M2P A;  5DKN A;  1YTZ C;  4HRE E;  4PE4 A;  4NDD A;  1BR4 B;  1IJ6 A;  3OGN A;  4N1F A;  1NCZ A;  5HKZ A;  1JC2 A;  4MZJ A;  1UHN A;  3BUW B;  2LAN A;  2LLS A;  1JF0 A;  3OX5 A;  1NP8 A;  1AJ5 A;  1PUL A;  1OZO A;  2I94 A;  5HLV A;  2LMT A;  3BOW B;  2O5G A;  1KFU S;  2BE4 A;  2G2B A;  2JZI A;  1KQM B;  3RZS A;  5KSZ A;  3CGA A;  1YR5 A;  1MUX A;  1TCF A;  1YUR A;  3LCP C;  1UUR A;  4OR9 B;  1BF5 A;  1H4B A;  4PE1 A;  2Y4Q A;  1CLL A;  4I5N B;  1KWO B;  2LVV A;  3O2P A;  3UO9 A;  2E30 A;  4N1G A;  2B1U A;  3EKJ A;  3CR5 X;  1S6I A;  4IL1 A;  4XJK A;  1BU3 A;  1F55 A;  2OS8 B;  1UHK A;  1Q80 A;  1QVI Z;  2KFF A;  2QEH A;  2FCD A;  4GPL B;  4YGC B;  2JC2 A;  2SAS A;  1UWO A;  2M1K B;  2ZKM X;  1K94 A;  2M9G A;  1U5I A;  2JQ6 A;  3BUX B;  3CWG A;  4PAL A;  3EK4 A;  5I2L A;  4N5X A;  2CCM A;  2M1U A;  4OKH A;  3R72 A;  1J7R A;  2EGD A;  5HLO A;  4CID A;  1YVL A;  1H8B A;  3GK4 X;  3EG5 B;  1P28 A;  2WND A;  1NIW A;  2YGU A;  4YGD B;  3BFH A;  3JVT B;  2BBM A;  2F3Y A;  3S0E A;  4AQJ A;  5I2Q A;  4KYN A;  1XK4 C;  2MJW B;  3GK1 A;  2QEO A;  1UHI A;  2TN4 A;  3CZ1 A;  1J55 A;  4ORC B;  4D1E A;  3I5F C;  1FW4 A;  1QX2 A;  4HRG A;  2MHH A;  3TDU A;  2JXL A;  1A29 A;  2L50 A;  3CTN A;  5AAN A;  4MN0 A;  2L2C A;  3NHI A;  1A75 B;  1K90 D;  1JFK A;  1MWN A;  2WC6 A;  2KGR A;  3FIA A;  1SSE B;  1BOD A;  1SNL A;  1A03 A;  3L47 A;  1JSA A;  4A4C A;  1LS8 A;  4I5L B;  1SCM C;  1UHJ A;  2WCF A;  3SIA A;  1XA5 A;  2LUX A;  3D0Y B;  5FI7 A;  1DGU A;  1CKK A;  1C7W A;  2OTG C;  1F8H A;  4WQ3 A;  1PSB A;  2PAL A;  1WLZ A;  3FE9 A;  4CFQ A;  1DVI A;  2WC8 A;  1DJG A;  3DVE A;  3IF7 A;  2NXQ A;  3S0B A;  1MQ1 A;  4DIR A;  2MAZ A;  2KAV A;  2KQ6 A;  1CMF A;  1SRA A;  1TWO A;  4C0J A;  3I5G C;  3CZT X;  4DS7 A;  1T14 A;  3DF0 A;  3WHT B;  2K2A A;  5CSF A;  2KI4 B;  2BCB A;  2K8M B;  2L51 A;  3CDN A;  1HQV A;  3PAT A;  1DF0 B;  3D73 A;  1BOC A;  2NLN A;  1AUI B;  3F45 A;  4FTG A;  5ER4 X;  3SJS A;  2AAO A;  2M49 B;  4YI9 A;  3M0W A;  4XYN A;  1N65 A;  1GJY A; 
#chains in the Genus database with same CATH homology
 1EG3 A;  1Y6W A;  2MLE C;  3HCM A;  1X02 A;  1WDC C;  2LHL A;  2PMY A;  2CT9 A;  4AOM A;  3TUY C;  4TNC A;  2H61 C;  1YRT B;  1NX1 A;  5AXI A;  1CNP A;  3NSO A;  4CLN A;  2LP3 A;  2M97 A;  1W7J B;  4QJ4 B;  2KDH A;  1WRK A;  4M2O A;  2PAS A;  3ZNI A;  1CDL A;  1SL9 A;  3NSK A;  2Q91 A;  1SPY A;  3NXA A;  2H2K A;  1QLS A;  3EK7 A;  1ZAC A;  4R1E A;  2LVI A;  2M7L A;  1B8C A;  2I18 A;  4OV2 A;  1L2O C;  1ZMZ A;  2L2E A;  2ISD A;  1RK9 A;  2H61 A;  1F70 A;  1QV1 A;  1DMO A;  4PE7 A;  1K9U A;  1CFC A;  2CTN A;  2K7O A;  4MEW A;  1KK8 B;  1LKJ A;  2K7B A;  2LLU A;  3ZWH A;  1QJT A;  1GGW A;  5KU1 A;  1V1F A;  2HF5 A;  2F3Z A;  3IQQ A;  4DCK A;  1YUT A;  2BKI B;  1QIV A;  3FS7 A;  2LLT A;  3BQ3 A;  1EG4 A;  2D8N A;  1HT9 A;  1K95 A;  1G4Y R;  1PSR A;  2K7D A;  2HPS A;  1RRO A;  1CDP A;  1CLM A;  4P5O E;  1MXE A;  1AVS A;  1IKU A;  2BL0 B;  2JRF A;  1NX3 A;  1R6P A;  1J1D A;  1N2D A;  2FJU B;  3GOF A;  1NUB A;  1QVI Y;  3JTD B;  2NCP A;  1RWY A;  1IH0 A;  1Y1A A;  3OB2 B;  1GQM A;  3HX4 A;  1WLM A;  3SG4 A;  5CSI A;  1E8A A;  1TOP A;  5ER5 A;  1KQM C;  2V53 A;  1A4P A;  3BUM B;  3C1V A;  3DD4 A;  5J3X A;  5JOL A;  5K89 A;  1A2X A;  1K96 A;  3NSL A;  1EXR A;  2JTZ A;  3I5H B;  2LP2 A;  3O6B A;  4PHN A;  2JNF A;  5GQQ C;  4GGF C;  2JPT A;  4ZCU A;  1YRU B;  1DJI A;  1KWO C;  1WRZ A;  2KQY A;  3KO0 A;  3ICB A;  5AFP A;  2L0P A;  1S5G Y;  1XO5 A;  2M29 A;  1SR6 C;  1K9P A;  1F71 A;  4GAO A;  2M3W A;  2G9B A;  1DGV A;  3NSI A;  4PCW A;  3VRR A;  2BBN A;  4PHK A;  3LLE A;  1D1O A;  4XJK B;  4GGF A;  2F2O A;  2WCB A;  4YGB B;  2F8P A;  3I5I B;  1S36 A;  1ZFS A;  3VRP A;  1S6J A;  1U5I B;  5DKR A;  3SG5 A;  2LVJ A;  1CLB A;  1GGZ A;  3CR4 X;  1TRF A;  1S5G Z;  2LMV A;  2M0R A;  3K21 A;  5AEQ A;  3CR2 A;  4M2Q A;  1MR8 A;  1NSH A;  3WNX B;  1KFU L;  1PVA A;  3KPX A;  3MSE B;  1OZS A;  1CM1 A;  1S1E A;  1B1G A;  1SCV A;  1YVH A;  1B47 A;  1NPQ A;  1R2U A;  3LL8 B;  3AKB A;  2WOR A;  1TNQ A;  3TS5 B;  1S6C A;  1XK4 A;  4YGA A;  1B7T Z;  1AK8 A;  2F33 A;  1LVC D;  1SMG A;  1ODB A;  5F6T A;  5D69 A;  4YI8 A;  3D10 A;  2JNX A;  1AHR A;  1G33 A;  3TDZ A;  2KFH A;  2HQW A;  4HRH A;  1ZOT B;  4HSZ A;  2L4H A;  4MZL A;  4WQ2 A;  3AAJ A;  4PHJ A;  3DVK A;  2KI6 C;  1ALW A;  1S26 D;  1TNW A;  3TZ1 A;  4YBH B;  1V1G A;  2OPO A;  1M39 A;  1QAS A;  1RJV A;  1JFJ A;  1KFX S;  2ZN8 A;  5BPJ A;  1SCM B;  2MBX A;  3DF0 B;  1UP5 A;  3PFV A;  3PSR A;  5B8I B;  5DKQ A;  2KSP A;  3BXK A;  3BUN B;  1DT7 B;  1M45 A;  1DTL A;  1IQ5 A;  1JUO A;  2P6B B;  4MZK A;  3CS1 A;  3EVV A;  3TDI A;  3BUO B;  4YGE B;  1MHO A;  1CFF A;  1QS7 A;  3SG7 A;  1TNX A;  2EC6 B;  2LE9 B;  2WCE A;  5I8N A;  1RFJ A;  3OX6 A;  5FYX A;  2EHB A;  1CTR A;  3O4Y A;  1OMR A;  4ORA B;  5KTY A;  1IRJ A;  2COL B;  5IBW A;  1QTX A;  3PN7 B;  4ORB B;  1BLQ A;  1MXL C;  1KK8 C;  2NZ0 A;  2LMU A;  1K93 D;  2KOT A;  1BJF A;  3EK8 A;  1SYM A;  1TCO B;  5TNC A;  3VRQ A;  1WDC B;  3RLZ A;  1B9A A;  3TUY B;  1XYD A;  2KAY A;  1EJ3 A;  1LA0 A;  4JPZ B;  1SW8 A;  2Y1N A;  1CMG A;  1NWD A;  2KGB C;  2JT3 A;  2KI6 D;  2LUC A;  1QXP A;  1IWQ A;  1TNP A;  1DJH A;  2L5X B;  4I5J A;  3E3R A;  4MBE A;  1DJX A;  1JBA A;  1UHH A;  1XFV O;  2BCA A;  4DRW A;  2BL0 C;  2AMI A;  2IS9 A;  1DJY A;  2L4I A;  2ZFD A;  2ZRS A;  3KHE A;  2Y5I A;  4ICB A;  2LC5 A;  1LIN A;  2MA2 A;  1KSO A;  1UUS A;  1REC A;  2KBM A;  3H4S E;  3KEV A;  4F0Z B;  1M63 B;  2I7A A;  1B8L A;  1OQP A;  1XFU O;  3FWC A;  3I5H C;  4NQG A;  3OB1 B;  1PRW A;  1BT6 A;  1ALV A;  1C7V A;  1NCX A;  2LV7 A;  2K61 A;  5HKW A;  3VGO A;  2LAP A;  1CFP A;  1J7P A;  2RGI A;  1BR1 B;  1TN4 A;  2OS8 C;  3OP0 A;  1RTP 1;  3SIB A;  4QJ5 B;  1N0Y A;  1XFX O;  3BOW A;  1SL7 A;  4FQO A;  1OOJ A;  3SG2 A;  1EH2 A;  1CDM A;  1QV0 A;  1J7O A;  2PSR A;  2L98 A;  3VRN A;  4CPV A;  1Y0V H;  3I5I C;  1J1E A;  1NX2 A;  1KK7 Y;  5HYD A;  2K0J A;  4ETO A;  3LK0 A;  1FPW A;  2BE6 A;  1CB1 A;  2CNP A;  1B7T Y;  4GNK B;  3JVT C;  1QX5 B;  1IG5 A;  1FI5 A;  1SR6 B;  2PRU A;  2A4J A;  1QIW A;  1NCY A;  1CM4 A;  1SL8 A;  4AQI A;  4C0K A;  5PAL A;  2K7C A;  4DUQ A;  3GK2 A;  1J7Q A;  1KK7 Z;  2ZND A;  4MRX A;  3AKA A;  3FWB A;  3TS5 C;  4E68 A;  3DVJ A;  1LXF C;  4C0L A;  2FOT A;  2F2P A;  1QX7 A;  4PHM A;  2QPT A;  1PAL A;  2HQ8 A;  1XFW O;  1G8I A;  2GV5 A;  1A75 A;  5CSN A;  1IJ5 A;  1W7I B;  2DOQ A;  2KNE A;  5CSJ A;  1IQ3 A;  3CLN A;  1QAT A;  3I5F B;  4CFR A;  2JWW A;  1XFY O;  2KI4 C;  3D0Y A;  1SKT A;  2Q4U A;  2KYF A;  4A4B A;  1BG1 A;  3AAK A;  1LA3 A;  4P2Y B;  1JWD A;  2BEC A;  2LM5 A;  3A4U B;  2ZRT A;  2BCX A;  2MRD A;  2R2I A;  3PLF B;  2LVK A;  4PDZ A;  3KF9 A;  4YRU A;  2Y1M A;  3EKH A;  1SY9 A;  2OTG B;  3O78 A;  4BY4 A;  2JT0 A;  3BYA A;  1PVB A;  3VRO A;  1WRL A;  4L9M A;  1DF0 A;  1OSA A;  3EVU A;  4JQ0 D;  1AJ4 A;  1Y1X A;  2EC6 C;  1CFD A;  2FCE A;  4MVF A;  2KFG A;  4NDB A;  1CDN A;  1KCY A;  1JF2 A;  3I5G B;  4UPG A;  5D7F A;  5HKY A;  2PVB A;  2SCP A;  2E6W A;  2JTT A;  1YUU A;  1YX8 A;  3OHM B;  2JXC A;  2JU0 A;  3IQO A;  1WY9 A;  4GBA A;  1ZUZ A;  4JWQ A;  3SG6 A;  5AER A;  1S3P A;  2CXJ A;  1B4C A;  2ZN9 A;  4NDC A;  3PN7 C;  1PK0 D;  2JOJ A;  2M7N A;  1FF1 A;  1K8U A;  1M31 A;  2LCP A;  4GUK A;  2M8U A;  1F4O A;  3RM1 A;  2I2R E;  1EL4 A;  1NYA A;  4OCI A;  2KBI A;  4I5K A;  1M46 A;  4PE0 A;  3WXA A;  2NCO A;  1OE9 B;  4GFT A;  3QRX A;  1KFX L;  2ZNE A;  1L7Z A;  1Y1U A;  2LNK A;  4BY5 A;  2CBL A;  1MF8 B;  2VRG A;  3EVR A;  2O60 A;  4MSP A;  3SG3 A;  4QJ3 B;  2JUL A;  4OVN F;  4Q04 A;  4USL A;  1K2H A;  2K2F A;  1QLK A;  1L2O B;  2JT8 A;  4U8D A;  4MLW A;  1KSM A;  1F54 A;  5I2O A;  1YX7 A;  3JTD C;  1F4Q A;  1AP4 A;  1VRK A;  2BKH B;  2WOS A;  1OMV A;  1IGV A;  1SK6 D;  3WHU B;  3PM8 A;  1NX0 A;  1FBV A;  2MLF C;  1DJZ A;  1XFZ O;  4WRI A;  1K9K A;  1TIZ A;  2AUC A;  2HET A;  2QAC A;  5CPV A;  3A8R A;  5G08 A;  1FI6 A;  4GGN A;  3LK1 A;  3PAL A;  2KHN A;  3DVM A;  4ZCV A;  1DJW A;  1YUS A;  4MRY A;  1KQV A;  1B8R A;  1BMO A;  2GGM A;  2KAX A;  2GGZ A;  1TTX A;  2LHI A;  1XVJ A;  1OMD A;  2KYC A;  1SBJ A;  4M2P A;  5DKN A;  1YTZ C;  4HRE E;  4PE4 A;  4NDD A;  1BR4 B;  1IJ6 A;  4N1F A;  5HKZ A;  1NCZ A;  1JC2 A;  4MZJ A;  1UHN A;  3BUW B;  2LAN A;  2LLS A;  1JF0 A;  3OX5 A;  1NP8 A;  1AJ5 A;  1PUL A;  1OZO A;  2I94 A;  5HLV A;  2LMT A;  3BOW B;  2O5G A;  1KFU S;  2BE4 A;  2G2B A;  2JZI A;  1KQM B;  5KSZ A;  3CGA A;  1YR5 A;  1MUX A;  1TCF A;  1YUR A;  3LCP C;  1UUR A;  4OR9 B;  1BF5 A;  1H4B A;  4PE1 A;  2Y4Q A;  1CLL A;  4I5N B;  1KWO B;  2LVV A;  3O2P A;  2E30 A;  4N1G A;  2B1U A;  3EKJ A;  3CR5 X;  1S6I A;  4IL1 A;  4XJK A;  1BU3 A;  1F55 A;  2OS8 B;  1UHK A;  1Q80 A;  1QVI Z;  2KFF A;  4YGC B;  2FCD A;  4GPL B;  2JC2 A;  2SAS A;  1UWO A;  2M1K B;  2ZKM X;  1K94 A;  2M9G A;  1U5I A;  2JQ6 A;  3BUX B;  3CWG A;  4PAL A;  3EK4 A;  5I2L A;  4N5X A;  2CCM A;  2M1U A;  4OKH A;  1J7R A;  2EGD A;  5HLO A;  4CID A;  1YVL A;  1H8B A;  3GK4 X;  2WND A;  1NIW A;  4YGD B;  5JJG A;  3JVT B;  2BBM A;  2F3Y A;  4AQJ A;  5I2Q A;  1C07 A;  1XK4 C;  2MJW B;  3GK1 A;  2TN4 A;  1UHI A;  4D1E A;  1J55 A;  4ORC B;  3I5F C;  1FW4 A;  1QX2 A;  4HRG A;  2MHH A;  3TDU A;  2JXL A;  1A29 A;  2L50 A;  3CTN A;  5AAN A;  4MN0 A;  1A75 B;  1K90 D;  1JFK A;  1MWN A;  2KGR A;  3FIA A;  1BOD A;  1SNL A;  1A03 A;  1JSA A;  4A4C A;  4I5L B;  1SCM C;  1UHJ A;  2WCF A;  3SIA A;  1XA5 A;  2LUX A;  3D0Y B;  1DGU A;  1CKK A;  1C7W A;  2OTG C;  1F8H A;  4WQ3 A;  1PSB A;  2PAL A;  1WLZ A;  4CFQ A;  1DVI A;  2WC8 A;  1DJG A;  3DVE A;  3IF7 A;  2NXQ A;  1MQ1 A;  4DIR A;  2MAZ A;  2KAV A;  2KQ6 A;  1CMF A;  1SRA A;  4C0J A;  3I5G C;  3CZT X;  4DS7 A;  3DF0 A;  3WHT B;  2K2A A;  5CSF A;  2KI4 B;  2BCB A;  2K8M B;  2L51 A;  3PAT A;  1HQV A;  1DF0 B;  1BOC A;  2NLN A;  1AUI B;  3F45 A;  4FTG A;  5ER4 X;  3SJS A;  2AAO A;  2M49 B;  4YI9 A;  3M0W A;  4XYN A;  1N65 A;  1GJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...