3B86A

Crystal structure of t57s substituted lush protein complexed with ethanol
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
b'MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGSVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 41
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b86A00
1TWOA 3D76A 2FJYA 2WCLA 3S0FA 3R1PA 3B6XA 3VB1A 2L2CA 3Q8IA 2WCJA 3DYEA 2P71A 2H8VA 1GM0A 4FQTA 4INWA 3S0AA 3RZSA 1OOGA 3CDNA 3BFHA 4INXA 2WC5A 5DICA 3L47A 3FE9A 1P28A 3D73A 1T14A 3CYZA 3B88A 3D74A 1OOHA 3S0BA 3B87A 2ERBA 3D77A 3NHTA 2GTEA 5EL2A 3DZTA 1LS8A 3DXLA 1ORGA 1TUJA 3NHIA 3NGVA 3R1VA 3DY9A 3K1EA 3PJIA 3L4LA 1QWVA 3CZ0A 2PQLA 2QEBA 2WCKA 3OGNA 3BFBA 2P70A 3QMEA 3B86A 4F7FA 2WC6A 3CABA 3FE6A 2QEHA 4PT1A 1C3ZA 2JPOA 3S0EA 3S0GA 2QEOA 3BJHA 2WCMA 2KPHA 3S0DA 4OZDA 3D78A 3V2LA 3FE8A 3R1OA 3L4AA 1C3YA 3BFAA 1OW4A 2WCHA 2QDIA 4JD9A 3CZ2A 1DQEA 1OOIX 3B7AA 1XFRA 3R72A 1OOFA 2QEVA 3N7HA 3CZ1A 3D75A
chains in the Genus database with same CATH superfamily
1KK7Y 1N0YA 1IGVA 2JRFA 3NSIA 4GFTA 1TWOA 1TIZA 2F2PA 2KAYA 2ZN8A 4PE7A 1IQ5A 4PE1A 1IQ3A 3CS1A 4PHKA 3RLZA 2KNEA 2LV7A 3DD4A 3SG2A 2O5GA 2OPOA 2HPSA 2WCLA 3BXKA 2JT0A 1Y1UA 3S0FA 2K2FA 2JOJA 2NCPA 1S26D 3Q8IA 1K95A 2JTZA 1Z2CB 1MHOA 2GGZA 1J1EA 1AJ4A 2H8VA 1GM0A 3DVMA 1K9KA 2K60A 1S36A 3BOWA 4HSZA 4ETOA 1CDMA 3EKHA 1NCXA 1L2OC 1OOGA 1QX2A 1UWOA 2R2IA 2F3YA 3BFHA 4MSPA 5PALA 2WCFA 1ALVA 1N2DA 3PN7C 2BNXA 2QACA 1QVIY 5I94A 1S5GY 1MUXA 1L2OB 1V1FA 2EGDA 2JNFA 4IJ7A 2EHBA 3SS4A 2KQ6A 3QRXA 4C0JA 1DJWA 1K93D 1JUOA 2JQ6A 3CYZA 4ORBB 1PSBA 1F4QA 1C7WA 2IS9A 2F8PA 2M1UA 1DJZA 1AHRA 1QX5B 2ZRSA 1OZOA 2COLB 2K8MB 3S0BA 2FCDA 1LA0A 2MLFC 2M1KB 2MLEC 3B87A 1QV1A 1WRLA 1NYAA 3CZTX 3SIBA 5AFPA 2BE4A 1MQ1A 2ERBA 3NHTA 2GTEA 1B8LA 1MXEA 1QASA 4PALA 1IJ5A 3FS7A 1YUUA 3A8RA 3KO0A 1TOPA 1NCYA 1UHNA 1K9PA 1XYDA 4D1EA 5I2LA 1GJYA 3WNXB 2LP2A 4CFRA 1XFUO 1SSEB 3PM2A 2M49B 1S6IA 2MJWB 3SJSA 3AAKA 4DRWA 4IL1A 1YRUB 3EKJA 5CSIA 1KFXL 2KAVA 2BAPA 3OGNA 2LVIA 2TN4A 4HRGA 1AP4A 2K61A 1W7IB 2BECA 1BMOA 3CR4X 1B8CA 2Y5IA 1W7JB 1IRJA 1EH2A 1K8UA 4MRYA 1KFXS 3I5FC 2EC6C 5FI6A 1D1OA 1YTZC 4F7FA 4QJ4B 2LVKA 2JPTA 1DTLA 4ICBA 3WXAA 1SW8A 5D3OA 1WDCC 3GK2A 3I5FB 1SNLA 2EC6B 2KFGA 2NXQA 2F33A 1QATA 2LLTA 4AQIA 2WCMA 1SL8A 1SL7A 4JWQA 1JSAA 1QX7A 2LMVA 3EVUA 3O6BA 1IG5A 1WDCB 3FE8A 1H8BA 3L4AA 1CDPA 3NXAA 1XFYO 1DVIA 2BCAA 1G33A 1OW4A 2KBMA 1UHJA 2QDIA 1BU3A 2O60A 2PRUA 3IF7A 3CZ2A 4PE4A 1RECA 5F6TA 1QJTA 3ICBA 2LAPA 3D10A 3I5IC 3OB1B 4OR9B 4ORCB 3SIAA 3NSOA 1IWQA 1QV0A 2QEVA 5TNCA 3AAJA 2L0PA 1TCFA 1F55A 1Y6WA 4A4CA 4CPVA 5J3XA 3RM1A 2LLSA 2Q91A 2JT3A 2PALA 3I5IB 1UHIA 2LUCA 5CSJA 4MLWA 1TUZA 2MRDA 4YGDB 2LHLA 2AMIA 4MZJA 1CLMA 2CTNA 4CIDA 1X02A 2MA2A 5KU1A 2FJYA 2LCPA 4MN0A 3C1VA 3UNWA 2D8NA 2NLNA 4C0KA 1R2UA 2L2CA 1IIOA 3DYEA 1SYMA 2A4JA 4GAOA 1DELA 1NX3A 1V1GA 2FJUB 3VGOA 5AXIA 1U5IB 3S0AA 4FQOA 1NSHA 2K7CA 3CDNA 2L4HA 4QJ5B 1IKUA 2KI6D 2KOTA 4M2PA 2KLDA 2SCPA 2WC5A 1ZFSA 4AQJA 5I2OA 4NDBA 1K2HA 1NP8A 3L47A 1XFWO 4N1FA 5I2QA 1DGUA 3D73A 1T14A 1QIVA 5JJGA 2H61C 2JNXA 2E30A 2KSPA 3FWCA 3KPXA 2KDHA 1CTRA 1JC2A 3D74A 1YX8A 2PVBA 2FCEA 1WLZA 2Y4QA 1CFFA 2CT9A 1FBVA 1NWDA 3OP0A 1CB1A 3CTNA 1EL4A 2LP3A 1S3PA 1SR6C 2BBMA 5HKYA 1HQVA 2LMTA 1LS8A 3DVEA 1ORGA 3HCMA 3O78A 3D0YB 3AKBA 1J1DA 3I5HC 1E8AA 2P6BB 1TUJA 3IVTA 4JPZB 2JULA 4GGNA 1FPWA 1SR6B 3NGVA 3R1VA 1FW4A 3DY9A 4C0LA 3I5HB 3L4LA 4M2QA 3CZ0A 3PM8A 1K94A 3FWBA 3PN7B 1J7PA 4YI9A 2ZKMX 3SG4A 4BY4A 1M31A 1S1EA 3OX6A 1YR5A 1B7TZ 1KQMC 2PQLA 1U5IA 2CCMA 2L2EA 2QEBA 4MBEA 4WRIA 1CFCA 1PVAA 1XO5A 5ER5A 1TNXA 2ISDA 5HYDA 2KBIA 3EG5B 4GBAA 1BR1B 1KQMB 3BUMB 3EK7A 3TS5C 3KEVA 1UURA 2JC2A 2MHHA 1DJYA 1XFVO 4R1EA 2B1UA 2QEHA 1WY9A 2WCEA 3S0EA 1NX1A 1UHKA 3OHMB 3TS5B 1DF0B 3PLFB 1K90D 3S0GA 1UUSA 1HT9A 4N1GA 1RWYA 1XK4C 3S0DA 4NDCA 1QS7A 2H61A 3K21A 2L51A 3TDIA 3GK4X 1XFXO 1M45A 3TDZA 4AOMA 4E68A 1PALA 1XVJA 2M8UA 1KFUL 4OCIA 4MVFA 4BY5A 3VROA 1LKJA 3VRNA 4A4BA 1JBAA 1NX2A 1F54A 3SG7A 2NCOA 2GV5A 3D0YA 3NSLA 1TN4A 3KF9A 2I18A 1W9ZA 1MXLC 1TTXA 1WRKA 3WHTB 1KFUS 1J7OA 2L5XB 1QIWA 5HKWA 4I5KA 1OSAA 1XFRA 2BBNA 4PE0A 2VRGA 2KYFA 3EVRA 4N5XA 1OOFA 1YVHA 3ZNIA 2KLEA 2Y1NA 3N7HA 1Y0VH 2KI4C 2M3WA 1ODBA 3D75A 5K89A 2QPTA 2LC5A 3VRPA 1FF1A 3LL8B 5ER4X 1GGWA 1YUSA 1J55A 1OZSA 1PULA 1ZOTB 5D7FA 1XA5A 3IQOA 1CM4A 4WQ3A 1YRTB 4XYNA 1PK0D 3R1PA 1WLMA 2I2RE 1CNPA 1JFJA 3OBVA 4NDDA 1PRWA 2P71A 1DF0A 1M63B 3F45A 2M97A 1SMGA 4P2YB 4GGFC 4INWA 4L9MA 2DOQA 3JTDC 3OB2B 3BUNB 1OMVA 3RZSA 1PSRA 2F2OA 2PASA 3O4YA 1DMOA 4INXA 1SBJA 1GGZA 3EK8A 1XK4A 2LNKA 3I5GC 2L50A 1L7ZA 3H4SE 4YGBB 2JT8A 2F3ZA 1CFDA 3CLNA 4MRXA 3B88A 5CPVA 3PSRA 1EG4A 3I5GB 1CLBA 1OOHA 1LA3A 1SL9A 1Z4HA 1B9AA 1KK7Z 1Y1XA 1ZUZA 2M9GA 1R6PA 2LANA 1A75B 2BE6A 1NPQA 3D77A 4KYNA 3SS5A 1B1GA 2KFHA 2ZNEA 2E6WA 1AVSA 1SRAA 1WRZA 1ZACA 1ZMZA 3A4UB 3DZTA 4DCKA 1CMFA 3DXLA 1TNPA 1J7QA 2PYQA 2L4IA 5HKZA 2LMUA 1RK9A 1C7VA 1KK8C 3CWGA 4GPLB 2BKIB 1CDNA 2HF5A 2H2KA 3PALA 3K1EA 4USLA 1OE9B 1MWNA 3E3RA 4GNKB 3TDUA 1QWVA 2JWWA 1DC1A 1DT7B 3LLEA 3ZWHA 3LK0A 2MBXA 2I7AA 1SPYA 2LHIA 3PATA 3DVJA 1A29A 1S5GZ 2FOTA 2AUCA 5HLOA 4HRHA 3BFBA 2LE9B 4Q04A 2BCXA 2K2AA 1SCVA 1BT6A 4UPGA 1JWDA 1QXPA 2P70A 4GGFA 3VRRA 3B86A 1S6CA 3AKAA 3BUWB 3SS3A 5GQQC 1JF0A 2CXJA 2WC6A 2Y1MA 4MZKA 4P5OE 1C3ZA 4PT1A 1FI5A 3DVKA 1TNWA 3M0WA 2ZNDA 1ALWA 2QEOA 1QLSA 1K96A 1Y1AA 2HQ8A 2WNDA 2KGBC 2RGIA 1KSMA 4PHNA 4QJ3B 4CLNA 2M7NA 1TCOB 1A75A 3NSKA 1SKTA 3D78A 4YGCB 3SG5A 3V2LA 3R1OA 2ZN9A 5FI2A 1DGVA 1XFZO 1C3YA 4MEWA 5D69A 2G9BA 1KSOA 2WCHA 3CR5X 2WORA 3FIAA 2CBLA 4JD9A 1JF2A 2LVVA 2Q4UA 1A2XA 1J7RA 1TRFA 1DQEA 5KTYA 2BL0C 3B7AA 1BLQA 4PHMA 4PDZA 5KSZA 4XJKB 1JFKA 2HETA 1UHHA 2K7DA 3LCPC 3CZ1A 5DKRA 1CM1A 5DKNA 4F0ZB 3TUYC 2BL0B 3DF0B 1BJFA 5HLVA 5AEQA 1M46A 2WOSA 1YX7A 4JQ0D 3PFVA 5G08A 3D76A 4ZCUA 3TUYB 4HREE 1DJIA 1AK8A 4OKHA 1AJ5A 1SCMC 3LK1A 1SK6D 3B6XA 3VB1A 5BPJA 2AAOA 2WCJA 1H4BA 1F71A 3OX5A 1B8RA 1SCMB 4I5LB 4U8DA 4FTGA 4FQTA 2CNPA 2ZFDA 1CDLA 4TNCA 1RFJA 1VRKA 1IH0A 1EG3A 2BCBA 4YGAA 5IBWA 1BODA 5CSNA 4OV2A 5FI7A 1KCYA 1B7TY 1NX0A 2WC8A 5DICA 3VRQA 1B47A 1EJ3A 1G8IA 3FE9A 1OMDA 1P28A 3BYAA 2K0JA 4PCWA 3IQQA 2MAZA 1F4OA 1GQMA 2HQWA 2KI4B 3HX4A 2JXCA 3EVVA 4OVNF 1TNQA 2M0RA 1NCZA 4XJKA 1M39A 1YUTA 1CMGA 4YRUA 2WCBA 2V53A 4DUQA 1Q80A 4ORAB 3DF0A 1B4CA 5EL2A 2KAXA 4MZLA 3JVTC 2LUXA 1YURA 2YGUA 1YVLA 1F70A 2K7BA 3NHIA 1AUIB 2OS8C 3BUOB 2I94A 3JVTB 3O2PA 1OOJA 4NQGA 3PJIA 1NIWA 2OTGC 5I8NA 2L5YA 3JTDB 2ZRTA 1QLKA 1RJVA 1SY9A 2JZIA 5AERA 1RTP1 1PVBA 2OS8B 3BUXB 1DJHA 3UO9A 1DJXA 2JU0A 2KFFA 1OQPA 2G2BA 2OTGB 2WCKA 4PHJA 1CFPA 2KQYA 5FYXA 4YI8A 4JKTA 3GK1A 5HL1A 1KWOC 1MR8A 1K9UA 3SG3A 3QMEA 2KI6C 2NZ0A 4ZCVA 3CR2A 2SASA 4GUKA 5AANA 2BKHB 1C07A 1BOCA 3CABA 3FE6A 2K7OA 1FI6A 1KWOB 2GGMA 1BG1A 2JXLA 4WQ2A 2JPOA 2PSRA 1UP5A 2M29A 3WHUB 4DIRA 1N65A 1LXFC 3CGAA 2PMYA 5JOLA 1CLLA 1MF8B 3GOFA 3BOWB 3BJHA 4YGEB 1S6JA 2KPHA 1A4PA 3EK4A 4DS7A 2JTTA 1QTXA 1OMRA 2LLUA 4OZDA 4YBHB 5B8IB 3BQ3A 1KK8B 1DJGA 3MSEB 3SG6A 3TZ1A 1LINA 3O4XA 1BR4B 3BFAA 1BF5A 1QVIZ 1IJ6A 4CFQA 2KGRA 3KHEA 5CSFA 1RROA 2M7LA 1EXRA 4I5JA 1G4YR 1NUBA 1A03A 1OOIX 1CKKA 3R72A 2LM5A 2KYCA 5DKQA 2LVJA 1KQVA 1LVCD 2KHNA 4M2OA 2L98A 1F8HA 4I5NB 1DEKA
chains in the Genus database with same CATH topology
1TWOA 3D76A 2FJYA 2WCLA 3S0FA 3R1PA 3B6XA 3VB1A 2L2CA 3Q8IA 2WCJA 3DYEA 2P71A 2H8VA 1GM0A 4FQTA 4INWA 3S0AA 3RZSA 1OOGA 3CDNA 3BFHA 4INXA 2WC5A 5DICA 3L47A 3FE9A 1P28A 3D73A 1T14A 3CYZA 3B88A 3D74A 1OOHA 3S0BA 3B87A 2ERBA 3D77A 3NHTA 2GTEA 5EL2A 3DZTA 1LS8A 3DXLA 1ORGA 1TUJA 3NHIA 3NGVA 3R1VA 3DY9A 3K1EA 3PJIA 3L4LA 1QWVA 3CZ0A 2PQLA 2QEBA 2WCKA 3OGNA 3BFBA 2P70A 3QMEA 3B86A 4F7FA 2WC6A 3CABA 3FE6A 2QEHA 4PT1A 1C3ZA 2JPOA 3S0EA 3S0GA 2QEOA 3BJHA 2WCMA 2KPHA 3S0DA 4OZDA 3D78A 3V2LA 3FE8A 3R1OA 3L4AA 1C3YA 3BFAA 1OW4A 2WCHA 2QDIA 4JD9A 3CZ2A 1DQEA 1OOIX 3B7AA 1XFRA 3R72A 1OOFA 2QEVA 3N7HA 3CZ1A 3D75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWO A;  3D76 A;  2FJY A;  2WCL A;  3S0F A;  3R1P A;  3B6X A;  3VB1 A;  2L2C A;  3Q8I A;  2WCJ A;  3DYE A;  2P71 A;  2H8V A;  1GM0 A;  4FQT A;  4INW A;  3S0A A;  3RZS A;  1OOG A;  3CDN A;  3BFH A;  4INX A;  2WC5 A;  5DIC A;  3L47 A;  3FE9 A;  1P28 A;  3D73 A;  1T14 A;  3CYZ A;  3B88 A;  3D74 A;  1OOH A;  3S0B A;  3B87 A;  2ERB A;  3D77 A;  3NHT A;  2GTE A;  5EL2 A;  3DZT A;  1LS8 A;  3DXL A;  1ORG A;  1TUJ A;  3NHI A;  3NGV A;  3R1V A;  3DY9 A;  3K1E A;  3PJI A;  3L4L A;  1QWV A;  3CZ0 A;  2PQL A;  2QEB A;  2WCK A;  3OGN A;  3BFB A;  2P70 A;  3QME A;  3B86 A;  4F7F A;  2WC6 A;  3CAB A;  3FE6 A;  2QEH A;  4PT1 A;  1C3Z A;  2JPO A;  3S0E A;  3S0G A;  2QEO A;  3BJH A;  2WCM A;  2KPH A;  3S0D A;  4OZD A;  3D78 A;  3V2L A;  3FE8 A;  3R1O A;  3L4A A;  1C3Y A;  3BFA A;  1OW4 A;  2WCH A;  2QDI A;  4JD9 A;  3CZ2 A;  1DQE A;  1OOI X;  3B7A A;  1XFR A;  3R72 A;  1OOF A;  2QEV A;  3N7H A;  3CZ1 A;  3D75 A; 
#chains in the Genus database with same CATH topology
 1KK7 Y;  1N0Y A;  1IGV A;  2JRF A;  3NSI A;  4GFT A;  1TWO A;  1TIZ A;  2F2P A;  2KAY A;  2ZN8 A;  4PE7 A;  1IQ5 A;  4PE1 A;  1IQ3 A;  3CS1 A;  4PHK A;  3RLZ A;  2KNE A;  2LV7 A;  3DD4 A;  3SG2 A;  2O5G A;  2OPO A;  2HPS A;  2WCL A;  3BXK A;  2JT0 A;  1Y1U A;  3S0F A;  2K2F A;  2JOJ A;  2NCP A;  1S26 D;  3Q8I A;  1K95 A;  2JTZ A;  1Z2C B;  1MHO A;  2GGZ A;  1J1E A;  1AJ4 A;  2H8V A;  1GM0 A;  3DVM A;  1K9K A;  2K60 A;  1S36 A;  3BOW A;  4HSZ A;  4ETO A;  1CDM A;  3EKH A;  1NCX A;  1L2O C;  1OOG A;  1QX2 A;  1UWO A;  2R2I A;  2F3Y A;  3BFH A;  4MSP A;  5PAL A;  2WCF A;  1ALV A;  1N2D A;  3PN7 C;  2BNX A;  2QAC A;  1QVI Y;  5I94 A;  1S5G Y;  1MUX A;  1L2O B;  1V1F A;  2EGD A;  2JNF A;  4IJ7 A;  2EHB A;  3SS4 A;  2KQ6 A;  3QRX A;  4C0J A;  1DJW A;  1K93 D;  1JUO A;  2JQ6 A;  3CYZ A;  4ORB B;  1PSB A;  1F4Q A;  1C7W A;  2IS9 A;  2F8P A;  2M1U A;  1DJZ A;  1AHR A;  1QX5 B;  2ZRS A;  1OZO A;  2COL B;  2K8M B;  3S0B A;  2FCD A;  1LA0 A;  2MLF C;  2M1K B;  2MLE C;  3B87 A;  1QV1 A;  1WRL A;  1NYA A;  3CZT X;  3SIB A;  5AFP A;  2BE4 A;  1MQ1 A;  2ERB A;  3NHT A;  2GTE A;  1B8L A;  1MXE A;  1QAS A;  4PAL A;  1IJ5 A;  3FS7 A;  1YUU A;  3A8R A;  3KO0 A;  1TOP A;  1NCY A;  1UHN A;  1K9P A;  1XYD A;  4D1E A;  5I2L A;  1GJY A;  3WNX B;  2LP2 A;  4CFR A;  1XFU O;  1SSE B;  3PM2 A;  2M49 B;  1S6I A;  2MJW B;  3SJS A;  3AAK A;  4DRW A;  4IL1 A;  1YRU B;  3EKJ A;  5CSI A;  1KFX L;  2KAV A;  2BAP A;  3OGN A;  2LVI A;  2TN4 A;  4HRG A;  1AP4 A;  2K61 A;  1W7I B;  2BEC A;  1BMO A;  3CR4 X;  1B8C A;  2Y5I A;  1W7J B;  1IRJ A;  1EH2 A;  1K8U A;  4MRY A;  1KFX S;  3I5F C;  2EC6 C;  5FI6 A;  1D1O A;  1YTZ C;  4F7F A;  4QJ4 B;  2LVK A;  2JPT A;  1DTL A;  4ICB A;  3WXA A;  1SW8 A;  5D3O A;  1WDC C;  3GK2 A;  3I5F B;  1SNL A;  2EC6 B;  2KFG A;  2NXQ A;  2F33 A;  1QAT A;  2LLT A;  4AQI A;  2WCM A;  1SL8 A;  1SL7 A;  4JWQ A;  1JSA A;  1QX7 A;  2LMV A;  3EVU A;  3O6B A;  1IG5 A;  1WDC B;  3FE8 A;  1H8B A;  3L4A A;  1CDP A;  3NXA A;  1XFY O;  1DVI A;  2BCA A;  1G33 A;  1OW4 A;  2KBM A;  1UHJ A;  2QDI A;  1BU3 A;  2O60 A;  2PRU A;  3IF7 A;  3CZ2 A;  4PE4 A;  1REC A;  5F6T A;  1QJT A;  3ICB A;  2LAP A;  3D10 A;  3I5I C;  3OB1 B;  4OR9 B;  4ORC B;  3SIA A;  3NSO A;  1IWQ A;  1QV0 A;  2QEV A;  5TNC A;  3AAJ A;  2L0P A;  1TCF A;  1F55 A;  1Y6W A;  4A4C A;  4CPV A;  5J3X A;  3RM1 A;  2LLS A;  2Q91 A;  2JT3 A;  2PAL A;  3I5I B;  1UHI A;  2LUC A;  5CSJ A;  4MLW A;  1TUZ A;  2MRD A;  4YGD B;  2LHL A;  2AMI A;  4MZJ A;  1CLM A;  2CTN A;  4CID A;  1X02 A;  2MA2 A;  5KU1 A;  2FJY A;  2LCP A;  4MN0 A;  3C1V A;  3UNW A;  2D8N A;  2NLN A;  4C0K A;  1R2U A;  2L2C A;  1IIO A;  3DYE A;  1SYM A;  2A4J A;  4GAO A;  1DEL A;  1NX3 A;  1V1G A;  2FJU B;  3VGO A;  5AXI A;  1U5I B;  3S0A A;  4FQO A;  1NSH A;  2K7C A;  3CDN A;  2L4H A;  4QJ5 B;  1IKU A;  2KI6 D;  2KOT A;  4M2P A;  2KLD A;  2SCP A;  2WC5 A;  1ZFS A;  4AQJ A;  5I2O A;  4NDB A;  1K2H A;  1NP8 A;  3L47 A;  1XFW O;  4N1F A;  5I2Q A;  1DGU A;  3D73 A;  1T14 A;  1QIV A;  5JJG A;  2H61 C;  2JNX A;  2E30 A;  2KSP A;  3FWC A;  3KPX A;  2KDH A;  1CTR A;  1JC2 A;  3D74 A;  1YX8 A;  2PVB A;  2FCE A;  1WLZ A;  2Y4Q A;  1CFF A;  2CT9 A;  1FBV A;  1NWD A;  3OP0 A;  1CB1 A;  3CTN A;  1EL4 A;  2LP3 A;  1S3P A;  1SR6 C;  2BBM A;  5HKY A;  1HQV A;  2LMT A;  1LS8 A;  3DVE A;  1ORG A;  3HCM A;  3O78 A;  3D0Y B;  3AKB A;  1J1D A;  3I5H C;  1E8A A;  2P6B B;  1TUJ A;  3IVT A;  4JPZ B;  2JUL A;  4GGN A;  1FPW A;  1SR6 B;  3NGV A;  3R1V A;  1FW4 A;  3DY9 A;  4C0L A;  3I5H B;  3L4L A;  4M2Q A;  3CZ0 A;  3PM8 A;  1K94 A;  3FWB A;  3PN7 B;  1J7P A;  4YI9 A;  2ZKM X;  3SG4 A;  4BY4 A;  1M31 A;  1S1E A;  3OX6 A;  1YR5 A;  1B7T Z;  1KQM C;  2PQL A;  1U5I A;  2CCM A;  2L2E A;  2QEB A;  4MBE A;  4WRI A;  1CFC A;  1PVA A;  1XO5 A;  5ER5 A;  1TNX A;  2ISD A;  5HYD A;  2KBI A;  3EG5 B;  4GBA A;  1BR1 B;  1KQM B;  3BUM B;  3EK7 A;  3TS5 C;  3KEV A;  1UUR A;  2JC2 A;  2MHH A;  1DJY A;  1XFV O;  4R1E A;  2B1U A;  2QEH A;  1WY9 A;  2WCE A;  3S0E A;  1NX1 A;  1UHK A;  3OHM B;  3TS5 B;  1DF0 B;  3PLF B;  1K90 D;  3S0G A;  1UUS A;  1HT9 A;  4N1G A;  1RWY A;  1XK4 C;  3S0D A;  4NDC A;  1QS7 A;  2H61 A;  3K21 A;  2L51 A;  3TDI A;  3GK4 X;  1XFX O;  1M45 A;  3TDZ A;  4AOM A;  4E68 A;  1PAL A;  1XVJ A;  2M8U A;  1KFU L;  4OCI A;  4MVF A;  4BY5 A;  3VRO A;  1LKJ A;  3VRN A;  4A4B A;  1JBA A;  1NX2 A;  1F54 A;  3SG7 A;  2NCO A;  2GV5 A;  3D0Y A;  3NSL A;  1TN4 A;  3KF9 A;  2I18 A;  1W9Z A;  1MXL C;  1TTX A;  1WRK A;  3WHT B;  1KFU S;  1J7O A;  2L5X B;  1QIW A;  5HKW A;  4I5K A;  1OSA A;  1XFR A;  2BBN A;  4PE0 A;  2VRG A;  2KYF A;  3EVR A;  4N5X A;  1OOF A;  1YVH A;  3ZNI A;  2KLE A;  2Y1N A;  3N7H A;  1Y0V H;  2KI4 C;  2M3W A;  1ODB A;  3D75 A;  5K89 A;  2QPT A;  2LC5 A;  3VRP A;  1FF1 A;  3LL8 B;  5ER4 X;  1GGW A;  1YUS A;  1J55 A;  1OZS A;  1PUL A;  1ZOT B;  5D7F A;  1XA5 A;  3IQO A;  1CM4 A;  4WQ3 A;  1YRT B;  4XYN A;  1PK0 D;  3R1P A;  1WLM A;  2I2R E;  1CNP A;  1JFJ A;  3OBV A;  4NDD A;  1PRW A;  2P71 A;  1DF0 A;  1M63 B;  3F45 A;  2M97 A;  1SMG A;  4P2Y B;  4GGF C;  4INW A;  4L9M A;  2DOQ A;  3JTD C;  3OB2 B;  3BUN B;  1OMV A;  3RZS A;  1PSR A;  2F2O A;  2PAS A;  3O4Y A;  1DMO A;  4INX A;  1SBJ A;  1GGZ A;  3EK8 A;  1XK4 A;  2LNK A;  3I5G C;  2L50 A;  1L7Z A;  3H4S E;  4YGB B;  2JT8 A;  2F3Z A;  1CFD A;  3CLN A;  4MRX A;  3B88 A;  5CPV A;  3PSR A;  1EG4 A;  3I5G B;  1CLB A;  1OOH A;  1LA3 A;  1SL9 A;  1Z4H A;  1B9A A;  1KK7 Z;  1Y1X A;  1ZUZ A;  2M9G A;  1R6P A;  2LAN A;  1A75 B;  2BE6 A;  1NPQ A;  3D77 A;  4KYN A;  3SS5 A;  1B1G A;  2KFH A;  2ZNE A;  2E6W A;  1AVS A;  1SRA A;  1WRZ A;  1ZAC A;  1ZMZ A;  3A4U B;  3DZT A;  4DCK A;  1CMF A;  3DXL A;  1TNP A;  1J7Q A;  2PYQ A;  2L4I A;  5HKZ A;  2LMU A;  1RK9 A;  1C7V A;  1KK8 C;  3CWG A;  4GPL B;  2BKI B;  1CDN A;  2HF5 A;  2H2K A;  3PAL A;  3K1E A;  4USL A;  1OE9 B;  1MWN A;  3E3R A;  4GNK B;  3TDU A;  1QWV A;  2JWW A;  1DC1 A;  1DT7 B;  3LLE A;  3ZWH A;  3LK0 A;  2MBX A;  2I7A A;  1SPY A;  2LHI A;  3PAT A;  3DVJ A;  1A29 A;  1S5G Z;  2FOT A;  2AUC A;  5HLO A;  4HRH A;  3BFB A;  2LE9 B;  4Q04 A;  2BCX A;  2K2A A;  1SCV A;  1BT6 A;  4UPG A;  1JWD A;  1QXP A;  2P70 A;  4GGF A;  3VRR A;  3B86 A;  1S6C A;  3AKA A;  3BUW B;  3SS3 A;  5GQQ C;  1JF0 A;  2CXJ A;  2WC6 A;  2Y1M A;  4MZK A;  4P5O E;  1C3Z A;  4PT1 A;  1FI5 A;  3DVK A;  1TNW A;  3M0W A;  2ZND A;  1ALW A;  2QEO A;  1QLS A;  1K96 A;  1Y1A A;  2HQ8 A;  2WND A;  2KGB C;  2RGI A;  1KSM A;  4PHN A;  4QJ3 B;  4CLN A;  2M7N A;  1TCO B;  1A75 A;  3NSK A;  1SKT A;  3D78 A;  4YGC B;  3SG5 A;  3V2L A;  3R1O A;  2ZN9 A;  5FI2 A;  1DGV A;  1XFZ O;  1C3Y A;  4MEW A;  5D69 A;  2G9B A;  1KSO A;  2WCH A;  3CR5 X;  2WOR A;  3FIA A;  2CBL A;  4JD9 A;  1JF2 A;  2LVV A;  2Q4U A;  1A2X A;  1J7R A;  1TRF A;  1DQE A;  5KTY A;  2BL0 C;  3B7A A;  1BLQ A;  4PHM A;  4PDZ A;  5KSZ A;  4XJK B;  1JFK A;  2HET A;  1UHH A;  2K7D A;  3LCP C;  3CZ1 A;  5DKR A;  1CM1 A;  5DKN A;  4F0Z B;  3TUY C;  2BL0 B;  3DF0 B;  1BJF A;  5HLV A;  5AEQ A;  1M46 A;  2WOS A;  1YX7 A;  4JQ0 D;  3PFV A;  5G08 A;  3D76 A;  4ZCU A;  3TUY B;  4HRE E;  1DJI A;  1AK8 A;  4OKH A;  1AJ5 A;  1SCM C;  3LK1 A;  1SK6 D;  3B6X A;  3VB1 A;  5BPJ A;  2AAO A;  2WCJ A;  1H4B A;  1F71 A;  3OX5 A;  1B8R A;  1SCM B;  4I5L B;  4U8D A;  4FTG A;  4FQT A;  2CNP A;  2ZFD A;  1CDL A;  4TNC A;  1RFJ A;  1VRK A;  1IH0 A;  1EG3 A;  2BCB A;  4YGA A;  5IBW A;  1BOD A;  5CSN A;  4OV2 A;  5FI7 A;  1KCY A;  1B7T Y;  1NX0 A;  2WC8 A;  5DIC A;  3VRQ A;  1B47 A;  1EJ3 A;  1G8I A;  3FE9 A;  1OMD A;  1P28 A;  3BYA A;  2K0J A;  4PCW A;  3IQQ A;  2MAZ A;  1F4O A;  1GQM A;  2HQW A;  2KI4 B;  3HX4 A;  2JXC A;  3EVV A;  4OVN F;  1TNQ A;  2M0R A;  1NCZ A;  4XJK A;  1M39 A;  1YUT A;  1CMG A;  4YRU A;  2WCB A;  2V53 A;  4DUQ A;  1Q80 A;  4ORA B;  3DF0 A;  1B4C A;  5EL2 A;  2KAX A;  4MZL A;  3JVT C;  2LUX A;  1YUR A;  2YGU A;  1YVL A;  1F70 A;  2K7B A;  3NHI A;  1AUI B;  2OS8 C;  3BUO B;  2I94 A;  3JVT B;  3O2P A;  1OOJ A;  4NQG A;  3PJI A;  1NIW A;  2OTG C;  5I8N A;  2L5Y A;  3JTD B;  2ZRT A;  1QLK A;  1RJV A;  1SY9 A;  2JZI A;  5AER A;  1RTP 1;  1PVB A;  2OS8 B;  3BUX B;  1DJH A;  3UO9 A;  1DJX A;  2JU0 A;  2KFF A;  1OQP A;  2G2B A;  2OTG B;  2WCK A;  4PHJ A;  1CFP A;  2KQY A;  5FYX A;  4YI8 A;  4JKT A;  3GK1 A;  5HL1 A;  1KWO C;  1MR8 A;  1K9U A;  3SG3 A;  3QME A;  2KI6 C;  2NZ0 A;  4ZCV A;  3CR2 A;  2SAS A;  4GUK A;  5AAN A;  2BKH B;  1C07 A;  1BOC A;  3CAB A;  3FE6 A;  2K7O A;  1FI6 A;  1KWO B;  2GGM A;  1BG1 A;  2JXL A;  4WQ2 A;  2JPO A;  2PSR A;  1UP5 A;  2M29 A;  3WHU B;  4DIR A;  1N65 A;  1LXF C;  3CGA A;  2PMY A;  5JOL A;  1CLL A;  1MF8 B;  3GOF A;  3BOW B;  3BJH A;  4YGE B;  1S6J A;  2KPH A;  1A4P A;  3EK4 A;  4DS7 A;  2JTT A;  1QTX A;  1OMR A;  2LLU A;  4OZD A;  4YBH B;  5B8I B;  3BQ3 A;  1KK8 B;  1DJG A;  3MSE B;  3SG6 A;  3TZ1 A;  1LIN A;  3O4X A;  1BR4 B;  3BFA A;  1BF5 A;  1QVI Z;  1IJ6 A;  4CFQ A;  2KGR A;  3KHE A;  5CSF A;  1RRO A;  2M7L A;  1EXR A;  4I5J A;  1G4Y R;  1NUB A;  1A03 A;  1OOI X;  1CKK A;  3R72 A;  2LM5 A;  2KYC A;  5DKQ A;  2LVJ A;  1KQV A;  1LVC D;  2KHN A;  4M2O A;  2L98 A;  1F8H A;  4I5N B;  1DEK A; 
#chains in the Genus database with same CATH homology
 1TWO A;  3D76 A;  2FJY A;  2WCL A;  3S0F A;  3R1P A;  3B6X A;  3VB1 A;  2L2C A;  3Q8I A;  2WCJ A;  3DYE A;  2P71 A;  2H8V A;  1GM0 A;  4FQT A;  4INW A;  3S0A A;  3RZS A;  1OOG A;  3CDN A;  3BFH A;  4INX A;  2WC5 A;  5DIC A;  3L47 A;  3FE9 A;  1P28 A;  3D73 A;  1T14 A;  3CYZ A;  3B88 A;  3D74 A;  1OOH A;  3S0B A;  3B87 A;  2ERB A;  3D77 A;  3NHT A;  2GTE A;  5EL2 A;  3DZT A;  1LS8 A;  3DXL A;  1ORG A;  1TUJ A;  3NHI A;  3NGV A;  3R1V A;  3DY9 A;  3K1E A;  3PJI A;  3L4L A;  1QWV A;  3CZ0 A;  2PQL A;  2QEB A;  2WCK A;  3OGN A;  3BFB A;  2P70 A;  3QME A;  3B86 A;  4F7F A;  2WC6 A;  3CAB A;  3FE6 A;  2QEH A;  4PT1 A;  1C3Z A;  2JPO A;  3S0E A;  3S0G A;  2QEO A;  3BJH A;  2WCM A;  2KPH A;  3S0D A;  4OZD A;  3D78 A;  3V2L A;  3FE8 A;  3R1O A;  3L4A A;  1C3Y A;  3BFA A;  1OW4 A;  2WCH A;  2QDI A;  4JD9 A;  3CZ2 A;  1DQE A;  1OOI X;  3B7A A;  1XFR A;  3R72 A;  1OOF A;  2QEV A;  3N7H A;  3CZ1 A;  3D75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...