1N65A

Family of nmr solution structures of ca ce calbindin d9k in denaturating conditions
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin D-dependent calcium-binding protein, intestinal
publication title Monitoring the Early Steps of Unfolding of Dicalcium and Mono-Ce(3+)-Substituted Forms of P43M Calbindin D(9k).
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n65A00
3CTNA 1OZSA 1IJ6A 1MF8B 1EH2A 1QX5B 2AUCA 3IQOA 3SG3A 3GK4X 1LINA 2M0RA 4PE7A 4WRIA 4XJKB 2JT8A 4USLA 1N65A 1KK8C 5I2QA 1DGUA 3MSEB 3AAJA 1E8AA 2R2IA 1JC2A 2FJUB 4YGAA 3BUNB 1YRUB 5ER5A 1RWYA 1SCMB 5HLOA 1W7IB 2KOTA 1RROA 4P5OE 1RJVA 2F3ZA 1CLMA 1LA0A 4GUKA 1MHOA 1KSOA 4FTGA 2CNPA 1QVIY 2GGMA 5F6TA 4OVNF 4YI9A 2JNXA 1NCYA 4JWQA 1CMGA 1QTXA 4MZJA 3EK8A 2L4IA 2PMYA 1AP4A 1BT6A 1VRKA 2M97A 3CWGA 2K8MB 2LC5A 5TNCA 1KQMB 1XFVO 2KGRA 2Y1MA 4YGBB 3KO0A 1JUOA 2ZN8A 1CTRA 1F4QA 2LVKA 3CR4X 4HRHA 2EC6C 3OP0A 2BCAA 4PE0A 1EXRA 2I94A 4N1FA 1GGWA 1KK7Y 4L9MA 1SYMA 3TDIA 5K89A 3O6BA 1SCMC 2V53A 1MUXA 4PCWA 1XFYO 4XYNA 3BYAA 3GK1A 2O5GA 1J7RA 1RECA 1X02A 1HQVA 1UHHA 1PSBA 4BY4A 1UHKA 2HQWA 1YVLA 4UPGA 1AVSA 4MZLA 3VGOA 3BUXB 1QXPA 1DJGA 1Y1XA 1DF0A 1KQMC 4YRUA 2KI6C 3CS1A 4AQIA 1NIWA 3EVRA 4I5LB 1U5IA 1BJFA 1UHNA 2MBXA 3TDZA 2MLEC 1CNPA 2O60A 1L2OC 2K2FA 3PFVA 2ISDA 2BL0B 4PE4A 2KGBC 1CDMA 3PALA 4OCIA 2OS8C 1KFUS 1KFXS 1QATA 2JC2A 1G4YR 1K9KA 1YR5A 4HRGA 1AK8A 2L5XB 1C7WA 2G9BA 1IH0A 4GPLB 1Y0VH 1WRZA 2KAVA 1XFUO 1K95A 2KFGA 2LUCA 3EVUA 4I5NB 4AQJA 4CFRA 1OSAA 2JXLA 2KI6D 1CKKA 3ZNIA 1CM1A 1QVIZ 2LVJA 2LLSA 1MXLC 1NX3A 1SY9A 1B4CA 1NCZA 1J7QA 2KHNA 2L98A 1B7TY 2QPTA 1QV0A 1S6CA 1NP8A 3OB2B 1A03A 1DVIA 3WHTB 1W7JB 2F3YA 2MLFC 3A4UB 1J7OA 1KWOC 1PALA 2H61A 1JSAA 3ICBA 1PK0D 1J1EA 1NUBA 5CPVA 2LVVA 1PRWA 4E68A 2JT0A 1B8LA 2LCPA 3H4SE 3FWCA 2LV7A 1IRJA 1B9AA 2WCEA 1UWOA 1SL9A 1CFDA 5AFPA 5GQQC 1WRKA 3NSKA 1S3PA 3K21A 1FPWA 2Y1NA 4ZCVA 3SG5A 2ZRSA 1TNWA 1AUIB 4FQOA 3NSLA 3NSIA 1S6IA 4MSPA 4XJKA 1GJYA 1KSMA 5PALA 1EL4A 1NSHA 2LMTA 1M63B 3D10A 5BPJA 2KBMA 1OQPA 2FCEA 2PVBA 2LLUA 3FIAA 3TDUA 3NSOA 3ZWHA 5JOLA 2MHHA 2JNFA 3TZ1A 3CLNA 1BU3A 4P2YB 1ODBA 1PVAA 4OV2A 1CDLA 4JQ0D 1F54A 4NQGA 2CTNA 4QJ3B 2EC6B 2JU0A 2P6BB 1DJIA 1LXFC 3RLZA 3A8RA 3VROA 2LUXA 3BQ3A 2NLNA 3PSRA 3D0YA 3QRXA 3O2PA 4MEWA 2KAYA 1OZOA 1K8UA 4WQ2A 4M2OA 1CFPA 2MJWB 3JVTC 1B7TZ 2M8UA 1UUSA 3VRRA 4MBEA 2AMIA 2BE6A 4GFTA 5D7FA 1FW4A 1D1OA 2LE9B 1FBVA 5KTYA 1MWNA 1LKJA 1XFXO 2LP2A 5HYDA 2A4JA 2BE4A 1R2UA 3CGAA 2I18A 4WQ3A 1B8CA 2FOTA 4CIDA 1G33A 4I5KA 3KHEA 1N2DA 1DJHA 2WCFA 1NYAA 1KFXL 1IQ5A 3PATA 1J7PA 1L2OB 2OTGC 1NWDA 1GQMA 5KU1A 1S5GZ 2HPSA 2OS8B 3LK0A 1H8BA 2LM5A 2E30A 2M7NA 1JBAA 4QJ4B 1YX8A 1OMRA 1PVBA 4PDZA 1F4OA 1WDCB 2CCMA 1MR8A 3NXAA 1XK4C 2M9GA 4YGDB 1BLQA 1RFJA 1IQ3A 1YTZC 2M7LA 2BKIB 3F45A 1BMOA 2OPOA 1UHJA 2BKHB 1OMDA 2JTZA 1XFWO 1XFZO 1TRFA 4M2QA 5I8NA 2GV5A 2WC8A 2HF5A 4M2PA 2RGIA 1KWOB 1CM4A 3OHMB 1BF5A 1NCXA 1YURA 1BOCA 2I2RE 4YBHB 3HCMA 1BR4B 5DKNA 1DMOA 2Q91A 2IS9A 3DVJA 4MLWA 1V1GA 1N0YA 4CFQA 3I5IB 1S6JA 1IJ5A 5DKQA 1SW8A 1WDCC 2KI4B 2LANA 1JF0A 2B1UA 2DOQA 1J55A 1XA5A 3KEVA 2KFHA 3WHUB 3O4YA 2FCDA 2F2PA 2JTTA 1FF1A 1SNLA 2L51A 4ICBA 3I5HB 1PSRA 1QIVA 4MRYA 3O78A 1DJWA 2KQ6A 1CDNA 2ZRTA 1Y6WA 4GGNA 4C0LA 2ZKMX 3I5FC 1TTXA 2F33A 1DF0B 4QJ5B 4ORCB 1TNQA 3BUWB 1MQ1A 1CLBA 2H2KA 4F0ZB 1B47A 1DJZA 3BXKA 2F2OA 2ZNEA 3DD4A 4GAOA 4CLNA 2CXJA 3I5IC 1ALVA 4DCKA 3GK2A 1DJYA 5CSFA 2K7BA 1TCOB 3DF0B 3OX5A 2KI4C 1YRTB 3CR5X 1M46A 3WNXB 1CB1A 1WRLA 2PRUA 2ZFDA 5ER4X 1FI5A 2LLTA 1S5GY 1UHIA 3CZTX 1LA3A 3PN7B 5G08A 1SCVA 2KFFA 2PSRA 3EK7A 1K9PA 1YX7A 3OX6A 4R1EA 3VRPA 3CR2A 3I5HC 4YI8A 3JVTB 2LAPA 1Y1AA 2K7DA 1HT9A 1QLSA 1PULA 1QV1A 2WNDA 1SK6D 2F8PA 1H4BA 4ZCUA 2KBIA 1S36A 1K96A 1OMVA 2M1KB 1XK4A 2KSPA 2L4HA 2LVIA 3EKJA 1TCFA 4GNKB 5HKZA 1QASA 2SCPA 4AOMA 3HX4A 2K0JA 1K2HA 4NDDA 4PHNA 2OTGB 1XO5A 3GOFA 1S1EA 2COLB 3PN7C 1AHRA 4BY5A 1NPQA 2LMVA 3TUYB 1TNPA 2EGDA 2M3WA 1DGVA 1V1FA 3AKBA 4GGFC 1C07A 1EG4A 4MRXA 2JPTA 4IL1A 2MA2A 4PHMA 1YUSA 2PASA 4N5XA 2LHLA 1SMGA 2WOSA 2WCBA 2ZNDA 1XVJA 4PE1A 1A75B 4C0JA 1S26D 2L2EA 1QIWA 1WLMA 2KDHA 5JJGA 3BOWB 1CMFA 1KQVA 1WY9A 1BODA 3IQQA 1B8RA 4A4BA 4ETOA 1G8IA 2H61C 1IGVA 3C1VA 2JZIA 2CT9A 5HKWA 4HSZA 2Y5IA 1F55A 2L0PA 1KFUL 1JWDA 2BCXA 4DUQA 1SL7A 3SIBA 3PM8A 4D1EA 4CPVA 1YVHA 3E3RA 1IG5A 3TUYC 3DVMA 5CSIA 1QJTA 5HKYA 2NZ0A 4NDBA 1OE9B 1QX7A 4YGEB 1ZUZA 3D0YB 1MXEA 3EKHA 1YUUA 1K90D 2NCOA 1NX0A 5J3XA 5FYXA 1AJ4A 1SR6B 1DJXA 1ZMZA 2CBLA 3DVKA 1ZACA 2E6WA 2JT3A 2LNKA 1CDPA 5I2LA 5AEQA 1QLKA 2PALA 3SIAA 2VRGA 1KCYA 2LMUA 3I5FB 3KPXA 4C0KA 1NX2A 3EVVA 5DKRA 1UURA 5IBWA 2M49B 1LVCD 1J1DA 2K61A 1TIZA 2HETA 3LL8B 3SJSA 3DVEA 4I5JA 1K93D 2WORA 1EG3A 4A4CA 3LCPC 4ORBB 1UP5A 2JOJA 2M29A 3LK1A 2BBNA 4GBAA 1F8HA 2I7AA 2Y4QA 3OB1B 3TS5B 2K7OA 1M39A 3I5GB 2D8NA 3IF7A 4PHJA 3VRNA 3WXAA 1CFFA 1SR6C 1L7ZA 4JPZB 2Q4UA 1JFJA 1C7VA 1NX1A 3FWBA 2EHBA 2G2BA 5D69A 3M0WA 1GGZA 3SG7A 3DF0A 1ZFSA 1SRAA 1QX2A 2BBMA 3EK4A 5I2OA 4OKHA 3SG4A 2L50A 2KNEA 4YGCB 3SG6A 3JTDB 2JRFA 1F71A 1F70A 3BUMB 1TOPA 2MRDA 1ZOTB 1RTP1 4ORAB 3FS7A 1BR1B 1CLLA 4GGFA 4DRWA 1U5IB 2JWWA 2MAZA 4NDCA 4PALA 1M45A 1OOJA 1YUTA 2BCBA 2M1UA 2ZN9A 5AXIA 3TS5C 1JF2A 1IWQA 3I5GC 2K7CA 3PLFB 4OR9B 3VRQA 1FI6A 1JFKA 4MZKA 5CSJA 1Y1UA 2GGZA 1RK9A 2JQ6A 1R6PA 1IKUA 4DS7A 5HLVA 1DTLA 2K2AA 2JULA 2KYCA 3KF9A 2SASA 2BL0C 4MN0A 4DIRA 4TNCA 4HREE 1KK7Z 1XYDA 1DT7B 4MVFA 3JTDC 5B8IB 2NCPA 2QACA 5AERA 1SL8A 2TN4A 1K9UA 3AAKA 2KYFA 1A4PA 1K94A 1QS7A 1BG1A 1KK8B 2JXCA 1SKTA 1TN4A 3LLEA 5AANA 1TNXA 1B1GA 1EJ3A 1WLZA 3BUOB 2KQYA 1AJ5A 4Q04A 5KSZA 2HQ8A 1A2XA 4N1GA 2AAOA 3AKAA 1ALWA 4U8DA 5CSNA 3RM1A 1Q80A 1M31A 1A29A 1A75A 4PHKA 2LHIA 3BOWA 2BECA 2KAXA 1SPYA 2NXQA 1CFCA 1SBJA 3SG2A 2LP3A
chains in the Genus database with same CATH superfamily
3CTNA 1OZSA 1TWOA 1IJ6A 4INWA 1MF8B 1EH2A 1QX5B 2AUCA 3IQOA 3SG3A 3GK4X 1LINA 3D78A 2M0RA 4PE7A 4WRIA 4XJKB 2JT8A 4USLA 1N65A 1KK8C 5I2QA 1DGUA 1DQEA 3MSEB 3AAJA 1E8AA 2R2IA 1JC2A 2FJUB 4YGAA 3OBVA 3BUNB 1YRUB 5ER5A 1RWYA 1SCMB 5HLOA 1W7IB 2KOTA 1RROA 4P5OE 1RJVA 2F3ZA 1CLMA 1LA0A 4GUKA 3UNWA 1MHOA 1KSOA 5FI7A 4FTGA 1Z4HA 2CNPA 1QVIY 2GGMA 5F6TA 4OVNF 4YI9A 2JNXA 1TUJA 1NCYA 4JWQA 1CMGA 1QTXA 4MZJA 3EK8A 2L4IA 2PMYA 1AP4A 1BT6A 1VRKA 2M97A 3CWGA 2K8MB 2LC5A 5TNCA 1KQMB 1XFVO 2KGRA 2Y1MA 4YGBB 3KO0A 1JUOA 1OW4A 1XFRA 3PM2A 2ZN8A 1CTRA 1F4QA 2LVKA 3CR4X 4HRHA 2EC6C 3OP0A 2BCAA 4PE0A 1EXRA 2I94A 4N1FA 1GGWA 1KK7Y 4L9MA 1SYMA 3TDIA 5K89A 3O6BA 1SCMC 2V53A 1MUXA 4PCWA 1XFYO 4XYNA 3BYAA 3GK1A 3NHIA 3R1PA 2O5GA 3S0DA 1J7RA 1RECA 1X02A 1HQVA 1UHHA 1PSBA 4BY4A 1UHKA 2HQWA 1YVLA 4UPGA 1AVSA 4MZLA 3VGOA 3BUXB 1QXPA 1DJGA 1Y1XA 1DF0A 1KQMC 4YRUA 2KI6C 3CS1A 4AQIA 1NIWA 3CYZA 2QEBA 3EVRA 4I5LB 1U5IA 1BJFA 1UHNA 2MBXA 3TDZA 2MLEC 1CNPA 2O60A 1L2OC 2K2FA 3PFVA 2ISDA 2BL0B 4PE4A 2KGBC 3CZ2A 1CDMA 3PALA 4OCIA 2OS8C 1KFUS 1KFXS 1QATA 2JC2A 1G4YR 1K9KA 1YR5A 4HRGA 1OOIX 1AK8A 2L5XB 1C7WA 2G9BA 1IH0A 4GPLB 1Y0VH 1WRZA 2KAVA 1XFUO 1K95A 2KFGA 2LUCA 2WCMA 3D74A 3EVUA 4I5NB 1OSAA 4AQJA 4CFRA 2JXLA 2KI6D 4PT1A 1CKKA 1QWVA 3ZNIA 1CM1A 1QVIZ 2LVJA 2LLSA 1MXLC 1NX3A 1SY9A 1B4CA 1NCZA 1J7QA 3CDNA 2KHNA 2L98A 1B7TY 2QPTA 1QV0A 1S6CA 1NP8A 3NHTA 3OB2B 1A03A 1DVIA 3WHTB 1W7JB 2F3YA 2MLFC 2KLDA 3A4UB 1J7OA 1KWOC 1PALA 2H61A 1JSAA 3ICBA 1PK0D 1J1EA 1NUBA 5CPVA 2LVVA 1PRWA 2YGUA 1LS8A 4E68A 2JT0A 1B8LA 2WC5A 2LCPA 1IIOA 3H4SE 3FWCA 2PQLA 2LV7A 1IRJA 1B9AA 2WCEA 1UWOA 1SL9A 1CFDA 5AFPA 5GQQC 1WRKA 3NSKA 1S3PA 2WCLA 3K21A 1FPWA 1W9ZA 2BNXA 2Y1NA 4ZCVA 3SG5A 2ZRSA 1TNWA 1AUIB 4FQOA 3NSLA 3NSIA 1S6IA 3L4LA 4MSPA 2L2CA 4XJKA 1GJYA 1KSMA 5PALA 1EL4A 1NSHA 2LMTA 1M63B 2WCHA 3D10A 5BPJA 2KBMA 1OQPA 2FCEA 2PVBA 2LLUA 3FIAA 3TDUA 3NSOA 3ZWHA 5JOLA 2MHHA 2JNFA 3TZ1A 3CLNA 1BU3A 4P2YB 1ODBA 1PVAA 4OV2A 1CDLA 1GM0A 4JQ0D 1F54A 4NQGA 2CTNA 1OOGA 4QJ3B 2EC6B 2JU0A 2P6BB 1DJIA 1LXFC 3RLZA 3A8RA 3VROA 2LUXA 3BQ3A 2NLNA 3PSRA 3D0YA 3QRXA 3O2PA 4MEWA 2KAYA 1OZOA 1K8UA 4WQ2A 2KLEA 4M2OA 1CFPA 2MJWB 3JVTC 1B7TZ 1DELA 1UUSA 2M8UA 3DZTA 2AMIA 2BE6A 2QEOA 4GFTA 1FW4A 4MBEA 5D7FA 3VRRA 1D1OA 2LE9B 1FBVA 1ORGA 3CZ0A 5KTYA 1MWNA 1LKJA 1XFXO 2LP2A 5HYDA 2A4JA 2BE4A 1R2UA 3CGAA 3R1OA 2I18A 4WQ3A 1B8CA 2FOTA 4CIDA 3CZ1A 1G33A 4I5KA 4FQTA 3KHEA 1N2DA 1DJHA 2WCFA 2QEHA 1NYAA 1KFXL 1IQ5A 2BAPA 3B88A 3PATA 1J7PA 1L2OB 3R1VA 2OTGC 1NWDA 1GQMA 3PJIA 5KU1A 3IVTA 1S5GZ 2HPSA 2OS8B 3LK0A 1H8BA 3S0EA 5FI6A 2LM5A 1DC1A 2E30A 2M7NA 1JBAA 4QJ4B 1YX8A 1OMRA 1PVBA 3QMEA 1F4OA 1WDCB 2CCMA 3DY9A 4PDZA 1MR8A 3NXAA 4KYNA 1XK4C 2M9GA 4YGDB 1BLQA 1RFJA 2JPOA 1IQ3A 1YTZC 2M7LA 2BKIB 5EL2A 3L4AA 3F45A 1BMOA 2OPOA 1UHJA 1OMDA 2BKHB 2JTZA 1XFWO 1XFZO 1TRFA 4M2QA 5I8NA 2GV5A 2QDIA 1SSEB 2WC8A 2HF5A 4M2PA 3VB1A 3D76A 2RGIA 1KWOB 1CM4A 3OHMB 1BF5A 1NCXA 1YURA 1BOCA 2I2RE 4YBHB 3HCMA 1BR4B 1TUZA 4IJ7A 5DKNA 1C3ZA 2IS9A 2Q91A 5FI2A 3DVJA 3R72A 4MLWA 1DMOA 1V1GA 1N0YA 4CFQA 3I5IB 1S6JA 1IJ5A 5DKQA 1SW8A 1WDCC 2KI4B 2LANA 1P28A 1JF0A 2B1UA 2DOQA 3CABA 1J55A 1XA5A 3KEVA 2KFHA 1C3YA 3WHUB 3O4YA 2FCDA 2F2PA 2JTTA 1FF1A 1SNLA 2L51A 4ICBA 3I5HB 1PSRA 1QIVA 4MRYA 3O78A 1DJWA 2KQ6A 1CDNA 2ZRTA 1Y6WA 3BFBA 4GGNA 4C0LA 2ZKMX 3I5FC 1TTXA 2F33A 1DF0B 4QJ5B 4ORCB 2QEVA 1TNQA 3BUWB 1MQ1A 1CLBA 2H2KA 4F0ZB 1B47A 1DJZA 3BXKA 2F2OA 2ZNEA 3DD4A 4GAOA 4CLNA 2CXJA 3I5IC 1ALVA 4DCKA 3GK2A 1DJYA 5CSFA 2K7BA 1TCOB 3DF0B 3OX5A 2KI4C 3RZSA 1YRTB 3CR5X 1M46A 3WNXB 3EG5B 1WRLA 1CB1A 2PRUA 2ZFDA 5ER4X 1FI5A 2LLTA 1S5GY 1UHIA 3CZTX 1LA3A 3PN7B 5G08A 1SCVA 2KFFA 2PSRA 3EK7A 1K9PA 1YX7A 3OX6A 4R1EA 3VRPA 3CR2A 3I5HC 4YI8A 5DICA 3S0GA 3JVTB 3L47A 2LAPA 3D73A 1Y1AA 2ERBA 2K7DA 1HT9A 1QLSA 1PULA 1QV1A 4OZDA 2WNDA 1SK6D 2F8PA 1H4BA 4ZCUA 2KBIA 1S36A 1K96A 1OMVA 2M1KB 1XK4A 2KSPA 2L4HA 2LVIA 3B6XA 1TCFA 3EKJA 5HKZA 1QASA 2SCPA 4AOMA 3HX4A 2K0JA 1K2HA 4NDDA 4PHNA 2OTGB 1Z2CB 1XO5A 3GOFA 1S1EA 2COLB 3PN7C 3SS5A 1AHRA 3D77A 4BY5A 1NPQA 2LMVA 1OOFA 1TNPA 2EGDA 2M3WA 3TUYB 1DGVA 1V1FA 3AKBA 4GGFC 1C07A 1EG4A 4MRXA 2JPTA 4IL1A 2MA2A 4PHMA 1YUSA 2PASA 2WC6A 2LHLA 4N5XA 1SMGA 2WOSA 2WCBA 2ZNDA 1XVJA 2H8VA 4PE1A 1A75B 4C0JA 1S26D 2L2EA 1QIWA 2KPHA 1WLMA 2K60A 2KDHA 3BOWB 5JJGA 1CMFA 1KQVA 1WY9A 1BODA 3IQQA 1B8RA 4A4BA 4ETOA 1G8IA 2H61C 1T14A 1IGVA 3C1VA 2JZIA 2CT9A 5HKWA 4HSZA 2Y5IA 1F55A 2L0PA 1KFUL 1JWDA 2BCXA 4DUQA 1SL7A 3SIBA 3PM8A 4D1EA 3S0FA 4CPVA 1YVHA 3DYEA 3E3RA 1IG5A 3TUYC 3DVMA 5CSIA 4F7FA 1QJTA 5HKYA 2NZ0A 4NDBA 1OE9B 1QX7A 4YGEB 1ZUZA 2L5YA 3D0YB 1MXEA 3EKHA 1YUUA 1K90D 2NCOA 1NX0A 2P70A 5FYXA 5J3XA 1AJ4A 1SR6B 3OGNA 1DJXA 1ZMZA 2CBLA 3DVKA 1ZACA 2E6WA 3K1EA 2JT3A 2LNKA 1CDPA 5I2LA 4GNKB 1QLKA 5AEQA 2PALA 3V2LA 3SIAA 3S0AA 3FE6A 3B87A 2GTEA 2VRGA 1KCYA 2LMUA 3I5FB 3KPXA 4C0KA 1NX2A 3EVVA 5DKRA 1UURA 5IBWA 2M49B 1LVCD 1J1DA 2K61A 1TIZA 2HETA 3LL8B 5D3OA 3DVEA 3SJSA 4I5JA 3BFHA 1K93D 2WORA 1EG3A 4JD9A 4A4CA 3LCPC 4ORBB 3BJHA 1UP5A 2JOJA 2WCKA 2M29A 3DXLA 3LK1A 3Q8IA 2BBNA 4GBAA 1F8HA 2I7AA 2Y4QA 3OB1B 4INXA 3TS5B 2PYQA 2K7OA 1M39A 3I5GB 2D8NA 3IF7A 4PHJA 3VRNA 3WXAA 1CFFA 1SR6C 1L7ZA 4JPZB 2Q4UA 3UO9A 1JFJA 1C7VA 2P71A 1NX1A 3FWBA 2EHBA 2G2BA 5D69A 3M0WA 1GGZA 3SG7A 3DF0A 1ZFSA 1SRAA 1QX2A 2BBMA 3EK4A 5I2OA 4OKHA 3SG4A 2L50A 2KNEA 4YGCB 3SG6A 3B86A 3JTDB 1OOHA 2JRFA 3D75A 1F71A 1F70A 3BUMB 1TOPA 2MRDA 1ZOTB 3FE8A 1RTP1 3SS3A 4ORAB 3FS7A 1BR1B 1CLLA 4GGFA 4DRWA 1U5IB 2JWWA 3FE9A 2MAZA 4NDCA 4PALA 1M45A 1OOJA 3B7AA 1YUTA 2BCBA 2M1UA 2ZN9A 5AXIA 3TS5C 1JF2A 1IWQA 3I5GC 2K7CA 3PLFB 3O4XA 4OR9B 3VRQA 1FI6A 1JFKA 4MZKA 5CSJA 1Y1UA 2GGZA 1RK9A 2JQ6A 1R6PA 1IKUA 4DS7A 5HLVA 3BFAA 1DTLA 2K2AA 2JULA 2KYCA 3KF9A 2SASA 2BL0C 4JKTA 4MN0A 4DIRA 4TNCA 4HREE 1KK7Z 1XYDA 1DT7B 4MVFA 3NGVA 3JTDC 5B8IB 2NCPA 2QACA 5AERA 1SL8A 2TN4A 1K9UA 3AAKA 2KYFA 1A4PA 1K94A 1QS7A 1BG1A 1KK8B 2JXCA 1SKTA 1TN4A 2WCJA 3LLEA 5AANA 1TNXA 1B1GA 1EJ3A 1WLZA 3BUOB 2KQYA 1AJ5A 4Q04A 5KSZA 2HQ8A 1A2XA 4N1GA 2AAOA 2FJYA 3AKAA 1ALWA 4U8DA 5CSNA 3RM1A 1Q80A 5I94A 1M31A 1A29A 1A75A 3N7HA 1DEKA 2LHIA 4PHKA 5HL1A 3BOWA 2BECA 2KAXA 1SPYA 2NXQA 3SS4A 1CFCA 1SBJA 3S0BA 3SG2A 2LP3A
chains in the Genus database with same CATH topology
3CTNA 1OZSA 1IJ6A 1MF8B 1EH2A 1QX5B 2AUCA 3IQOA 3SG3A 3GK4X 1LINA 2M0RA 4PE7A 4WRIA 4XJKB 2JT8A 4USLA 1N65A 1KK8C 5I2QA 1DGUA 3MSEB 3AAJA 1E8AA 2R2IA 1JC2A 2FJUB 4YGAA 3BUNB 1YRUB 5ER5A 1RWYA 1SCMB 5HLOA 1W7IB 2KOTA 1RROA 4P5OE 1RJVA 2F3ZA 1CLMA 1LA0A 4GUKA 1MHOA 1KSOA 4FTGA 2CNPA 1QVIY 2GGMA 5F6TA 4OVNF 4YI9A 2JNXA 1NCYA 4JWQA 1CMGA 1QTXA 4MZJA 3EK8A 2L4IA 2PMYA 1AP4A 1BT6A 1VRKA 2M97A 3CWGA 2K8MB 2LC5A 5TNCA 1KQMB 1XFVO 2KGRA 2Y1MA 4YGBB 3KO0A 1JUOA 2ZN8A 1CTRA 1F4QA 2LVKA 3CR4X 4HRHA 2EC6C 3OP0A 2BCAA 4PE0A 1EXRA 2I94A 4N1FA 1GGWA 1KK7Y 4L9MA 1SYMA 3TDIA 5K89A 3O6BA 1SCMC 2V53A 1MUXA 4PCWA 1XFYO 4XYNA 3BYAA 3GK1A 2O5GA 1J7RA 1RECA 1X02A 1HQVA 1UHHA 1PSBA 4BY4A 1UHKA 2HQWA 1YVLA 4UPGA 1AVSA 4MZLA 3VGOA 3BUXB 1QXPA 1DJGA 1Y1XA 1DF0A 1KQMC 4YRUA 2KI6C 3CS1A 4AQIA 1NIWA 3EVRA 4I5LB 1U5IA 1BJFA 1UHNA 2MBXA 3TDZA 2MLEC 1CNPA 2O60A 1L2OC 2K2FA 3PFVA 2ISDA 2BL0B 4PE4A 2KGBC 1CDMA 3PALA 4OCIA 2OS8C 1KFUS 1KFXS 1QATA 2JC2A 1G4YR 1K9KA 1YR5A 4HRGA 1AK8A 2L5XB 1C7WA 2G9BA 1IH0A 4GPLB 1Y0VH 1WRZA 2KAVA 1XFUO 1K95A 2KFGA 2LUCA 3EVUA 4I5NB 4AQJA 4CFRA 1OSAA 2JXLA 2KI6D 1CKKA 3ZNIA 1CM1A 1QVIZ 2LVJA 2LLSA 1MXLC 1NX3A 1SY9A 1B4CA 1NCZA 1J7QA 2KHNA 2L98A 1B7TY 2QPTA 1QV0A 1S6CA 1NP8A 3OB2B 1A03A 1DVIA 3WHTB 1W7JB 2F3YA 2MLFC 3A4UB 1J7OA 1KWOC 1PALA 2H61A 1JSAA 3ICBA 1PK0D 1J1EA 1NUBA 5CPVA 2LVVA 1PRWA 4E68A 2JT0A 1B8LA 2LCPA 3H4SE 3FWCA 2LV7A 1IRJA 1B9AA 2WCEA 1UWOA 1SL9A 1CFDA 5AFPA 5GQQC 1WRKA 3NSKA 1S3PA 3K21A 1FPWA 2Y1NA 4ZCVA 3SG5A 2ZRSA 1TNWA 1AUIB 4FQOA 3NSLA 3NSIA 1S6IA 4MSPA 4XJKA 1GJYA 1KSMA 5PALA 1EL4A 1NSHA 2LMTA 1M63B 3D10A 5BPJA 2KBMA 1OQPA 2FCEA 2PVBA 2LLUA 3FIAA 3TDUA 3NSOA 3ZWHA 5JOLA 2MHHA 2JNFA 3TZ1A 3CLNA 1BU3A 4P2YB 1ODBA 1PVAA 4OV2A 1CDLA 4JQ0D 1F54A 4NQGA 2CTNA 4QJ3B 2EC6B 2JU0A 2P6BB 1DJIA 1LXFC 3RLZA 3A8RA 3VROA 2LUXA 3BQ3A 2NLNA 3PSRA 3D0YA 3QRXA 3O2PA 4MEWA 2KAYA 1OZOA 1K8UA 4WQ2A 4M2OA 1CFPA 2MJWB 3JVTC 1B7TZ 2M8UA 1UUSA 3VRRA 4MBEA 2AMIA 2BE6A 4GFTA 5D7FA 1FW4A 1D1OA 2LE9B 1FBVA 5KTYA 1MWNA 1LKJA 1XFXO 2LP2A 5HYDA 2A4JA 2BE4A 1R2UA 3CGAA 2I18A 4WQ3A 1B8CA 2FOTA 4CIDA 1G33A 4I5KA 3KHEA 1N2DA 1DJHA 2WCFA 1NYAA 1KFXL 1IQ5A 3PATA 1J7PA 1L2OB 2OTGC 1NWDA 1GQMA 5KU1A 1S5GZ 2HPSA 2OS8B 3LK0A 1H8BA 2LM5A 2E30A 2M7NA 1JBAA 4QJ4B 1YX8A 1OMRA 1PVBA 4PDZA 1F4OA 1WDCB 2CCMA 1MR8A 3NXAA 1XK4C 2M9GA 4YGDB 1BLQA 1RFJA 1IQ3A 1YTZC 2M7LA 2BKIB 3F45A 1BMOA 2OPOA 1UHJA 2BKHB 1OMDA 2JTZA 1XFWO 1XFZO 1TRFA 4M2QA 5I8NA 2GV5A 2WC8A 2HF5A 4M2PA 2RGIA 1KWOB 1CM4A 3OHMB 1BF5A 1NCXA 1YURA 1BOCA 2I2RE 4YBHB 3HCMA 1BR4B 5DKNA 1DMOA 2Q91A 2IS9A 3DVJA 4MLWA 1V1GA 1N0YA 4CFQA 3I5IB 1S6JA 1IJ5A 5DKQA 1SW8A 1WDCC 2KI4B 2LANA 1JF0A 2B1UA 2DOQA 1J55A 1XA5A 3KEVA 2KFHA 3WHUB 3O4YA 2FCDA 2F2PA 2JTTA 1FF1A 1SNLA 2L51A 4ICBA 3I5HB 1PSRA 1QIVA 4MRYA 3O78A 1DJWA 2KQ6A 1CDNA 2ZRTA 1Y6WA 4GGNA 4C0LA 2ZKMX 3I5FC 1TTXA 2F33A 1DF0B 4QJ5B 4ORCB 1TNQA 3BUWB 1MQ1A 1CLBA 2H2KA 4F0ZB 1B47A 1DJZA 3BXKA 2F2OA 2ZNEA 3DD4A 4GAOA 4CLNA 2CXJA 3I5IC 1ALVA 4DCKA 3GK2A 1DJYA 5CSFA 2K7BA 1TCOB 3DF0B 3OX5A 2KI4C 1YRTB 3CR5X 1M46A 3WNXB 1CB1A 1WRLA 2PRUA 2ZFDA 5ER4X 1FI5A 2LLTA 1S5GY 1UHIA 3CZTX 1LA3A 3PN7B 5G08A 1SCVA 2KFFA 2PSRA 3EK7A 1K9PA 1YX7A 3OX6A 4R1EA 3VRPA 3CR2A 3I5HC 4YI8A 3JVTB 2LAPA 1Y1AA 2K7DA 1HT9A 1QLSA 1PULA 1QV1A 2WNDA 1SK6D 2F8PA 1H4BA 4ZCUA 2KBIA 1S36A 1K96A 1OMVA 2M1KB 1XK4A 2KSPA 2L4HA 2LVIA 3EKJA 1TCFA 4GNKB 5HKZA 1QASA 2SCPA 4AOMA 3HX4A 2K0JA 1K2HA 4NDDA 4PHNA 2OTGB 1XO5A 3GOFA 1S1EA 2COLB 3PN7C 1AHRA 4BY5A 1NPQA 2LMVA 3TUYB 1TNPA 2EGDA 2M3WA 1DGVA 1V1FA 3AKBA 4GGFC 1C07A 1EG4A 4MRXA 2JPTA 4IL1A 2MA2A 4PHMA 1YUSA 2PASA 4N5XA 2LHLA 1SMGA 2WOSA 2WCBA 2ZNDA 1XVJA 4PE1A 1A75B 4C0JA 1S26D 2L2EA 1QIWA 1WLMA 2KDHA 5JJGA 3BOWB 1CMFA 1KQVA 1WY9A 1BODA 3IQQA 1B8RA 4A4BA 4ETOA 1G8IA 2H61C 1IGVA 3C1VA 2JZIA 2CT9A 5HKWA 4HSZA 2Y5IA 1F55A 2L0PA 1KFUL 1JWDA 2BCXA 4DUQA 1SL7A 3SIBA 3PM8A 4D1EA 4CPVA 1YVHA 3E3RA 1IG5A 3TUYC 3DVMA 5CSIA 1QJTA 5HKYA 2NZ0A 4NDBA 1OE9B 1QX7A 4YGEB 1ZUZA 3D0YB 1MXEA 3EKHA 1YUUA 1K90D 2NCOA 1NX0A 5J3XA 5FYXA 1AJ4A 1SR6B 1DJXA 1ZMZA 2CBLA 3DVKA 1ZACA 2E6WA 2JT3A 2LNKA 1CDPA 5I2LA 5AEQA 1QLKA 2PALA 3SIAA 2VRGA 1KCYA 2LMUA 3I5FB 3KPXA 4C0KA 1NX2A 3EVVA 5DKRA 1UURA 5IBWA 2M49B 1LVCD 1J1DA 2K61A 1TIZA 2HETA 3LL8B 3SJSA 3DVEA 4I5JA 1K93D 2WORA 1EG3A 4A4CA 3LCPC 4ORBB 1UP5A 2JOJA 2M29A 3LK1A 2BBNA 4GBAA 1F8HA 2I7AA 2Y4QA 3OB1B 3TS5B 2K7OA 1M39A 3I5GB 2D8NA 3IF7A 4PHJA 3VRNA 3WXAA 1CFFA 1SR6C 1L7ZA 4JPZB 2Q4UA 1JFJA 1C7VA 1NX1A 3FWBA 2EHBA 2G2BA 5D69A 3M0WA 1GGZA 3SG7A 3DF0A 1ZFSA 1SRAA 1QX2A 2BBMA 3EK4A 5I2OA 4OKHA 3SG4A 2L50A 2KNEA 4YGCB 3SG6A 3JTDB 2JRFA 1F71A 1F70A 3BUMB 1TOPA 2MRDA 1ZOTB 1RTP1 4ORAB 3FS7A 1BR1B 1CLLA 4GGFA 4DRWA 1U5IB 2JWWA 2MAZA 4NDCA 4PALA 1M45A 1OOJA 1YUTA 2BCBA 2M1UA 2ZN9A 5AXIA 3TS5C 1JF2A 1IWQA 3I5GC 2K7CA 3PLFB 4OR9B 3VRQA 1FI6A 1JFKA 4MZKA 5CSJA 1Y1UA 2GGZA 1RK9A 2JQ6A 1R6PA 1IKUA 4DS7A 5HLVA 1DTLA 2K2AA 2JULA 2KYCA 3KF9A 2SASA 2BL0C 4MN0A 4DIRA 4TNCA 4HREE 1KK7Z 1XYDA 1DT7B 4MVFA 3JTDC 5B8IB 2NCPA 2QACA 5AERA 1SL8A 2TN4A 1K9UA 3AAKA 2KYFA 1A4PA 1K94A 1QS7A 1BG1A 1KK8B 2JXCA 1SKTA 1TN4A 3LLEA 5AANA 1TNXA 1B1GA 1EJ3A 1WLZA 3BUOB 2KQYA 1AJ5A 4Q04A 5KSZA 2HQ8A 1A2XA 4N1GA 2AAOA 3AKAA 1ALWA 4U8DA 5CSNA 3RM1A 1Q80A 1M31A 1A29A 1A75A 4PHKA 2LHIA 3BOWA 2BECA 2KAXA 1SPYA 2NXQA 1CFCA 1SBJA 3SG2A 2LP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTN A;  1OZS A;  1IJ6 A;  1MF8 B;  1EH2 A;  1QX5 B;  2AUC A;  3IQO A;  3SG3 A;  3GK4 X;  1LIN A;  2M0R A;  4PE7 A;  4WRI A;  4XJK B;  2JT8 A;  4USL A;  1N65 A;  1KK8 C;  5I2Q A;  1DGU A;  3MSE B;  3AAJ A;  1E8A A;  2R2I A;  1JC2 A;  2FJU B;  4YGA A;  3BUN B;  1YRU B;  5ER5 A;  1RWY A;  1SCM B;  5HLO A;  1W7I B;  2KOT A;  1RRO A;  4P5O E;  1RJV A;  2F3Z A;  1CLM A;  1LA0 A;  4GUK A;  1MHO A;  1KSO A;  4FTG A;  2CNP A;  1QVI Y;  2GGM A;  5F6T A;  4OVN F;  4YI9 A;  2JNX A;  1NCY A;  4JWQ A;  1CMG A;  1QTX A;  4MZJ A;  3EK8 A;  2L4I A;  2PMY A;  1AP4 A;  1BT6 A;  1VRK A;  2M97 A;  3CWG A;  2K8M B;  2LC5 A;  5TNC A;  1KQM B;  1XFV O;  2KGR A;  2Y1M A;  4YGB B;  3KO0 A;  1JUO A;  2ZN8 A;  1CTR A;  1F4Q A;  2LVK A;  3CR4 X;  4HRH A;  2EC6 C;  3OP0 A;  2BCA A;  4PE0 A;  1EXR A;  2I94 A;  4N1F A;  1GGW A;  1KK7 Y;  4L9M A;  1SYM A;  3TDI A;  5K89 A;  3O6B A;  1SCM C;  2V53 A;  1MUX A;  4PCW A;  1XFY O;  4XYN A;  3BYA A;  3GK1 A;  2O5G A;  1J7R A;  1REC A;  1X02 A;  1HQV A;  1UHH A;  1PSB A;  4BY4 A;  1UHK A;  2HQW A;  1YVL A;  4UPG A;  1AVS A;  4MZL A;  3VGO A;  3BUX B;  1QXP A;  1DJG A;  1Y1X A;  1DF0 A;  1KQM C;  4YRU A;  2KI6 C;  3CS1 A;  4AQI A;  1NIW A;  3EVR A;  4I5L B;  1U5I A;  1BJF A;  1UHN A;  2MBX A;  3TDZ A;  2MLE C;  1CNP A;  2O60 A;  1L2O C;  2K2F A;  3PFV A;  2ISD A;  2BL0 B;  4PE4 A;  2KGB C;  1CDM A;  3PAL A;  4OCI A;  2OS8 C;  1KFU S;  1KFX S;  1QAT A;  2JC2 A;  1G4Y R;  1K9K A;  1YR5 A;  4HRG A;  1AK8 A;  2L5X B;  1C7W A;  2G9B A;  1IH0 A;  4GPL B;  1Y0V H;  1WRZ A;  2KAV A;  1XFU O;  1K95 A;  2KFG A;  2LUC A;  3EVU A;  4I5N B;  4AQJ A;  4CFR A;  1OSA A;  2JXL A;  2KI6 D;  1CKK A;  3ZNI A;  1CM1 A;  1QVI Z;  2LVJ A;  2LLS A;  1MXL C;  1NX3 A;  1SY9 A;  1B4C A;  1NCZ A;  1J7Q A;  2KHN A;  2L98 A;  1B7T Y;  2QPT A;  1QV0 A;  1S6C A;  1NP8 A;  3OB2 B;  1A03 A;  1DVI A;  3WHT B;  1W7J B;  2F3Y A;  2MLF C;  3A4U B;  1J7O A;  1KWO C;  1PAL A;  2H61 A;  1JSA A;  3ICB A;  1PK0 D;  1J1E A;  1NUB A;  5CPV A;  2LVV A;  1PRW A;  4E68 A;  2JT0 A;  1B8L A;  2LCP A;  3H4S E;  3FWC A;  2LV7 A;  1IRJ A;  1B9A A;  2WCE A;  1UWO A;  1SL9 A;  1CFD A;  5AFP A;  5GQQ C;  1WRK A;  3NSK A;  1S3P A;  3K21 A;  1FPW A;  2Y1N A;  4ZCV A;  3SG5 A;  2ZRS A;  1TNW A;  1AUI B;  4FQO A;  3NSL A;  3NSI A;  1S6I A;  4MSP A;  4XJK A;  1GJY A;  1KSM A;  5PAL A;  1EL4 A;  1NSH A;  2LMT A;  1M63 B;  3D10 A;  5BPJ A;  2KBM A;  1OQP A;  2FCE A;  2PVB A;  2LLU A;  3FIA A;  3TDU A;  3NSO A;  3ZWH A;  5JOL A;  2MHH A;  2JNF A;  3TZ1 A;  3CLN A;  1BU3 A;  4P2Y B;  1ODB A;  1PVA A;  4OV2 A;  1CDL A;  4JQ0 D;  1F54 A;  4NQG A;  2CTN A;  4QJ3 B;  2EC6 B;  2JU0 A;  2P6B B;  1DJI A;  1LXF C;  3RLZ A;  3A8R A;  3VRO A;  2LUX A;  3BQ3 A;  2NLN A;  3PSR A;  3D0Y A;  3QRX A;  3O2P A;  4MEW A;  2KAY A;  1OZO A;  1K8U A;  4WQ2 A;  4M2O A;  1CFP A;  2MJW B;  3JVT C;  1B7T Z;  2M8U A;  1UUS A;  3VRR A;  4MBE A;  2AMI A;  2BE6 A;  4GFT A;  5D7F A;  1FW4 A;  1D1O A;  2LE9 B;  1FBV A;  5KTY A;  1MWN A;  1LKJ A;  1XFX O;  2LP2 A;  5HYD A;  2A4J A;  2BE4 A;  1R2U A;  3CGA A;  2I18 A;  4WQ3 A;  1B8C A;  2FOT A;  4CID A;  1G33 A;  4I5K A;  3KHE A;  1N2D A;  1DJH A;  2WCF A;  1NYA A;  1KFX L;  1IQ5 A;  3PAT A;  1J7P A;  1L2O B;  2OTG C;  1NWD A;  1GQM A;  5KU1 A;  1S5G Z;  2HPS A;  2OS8 B;  3LK0 A;  1H8B A;  2LM5 A;  2E30 A;  2M7N A;  1JBA A;  4QJ4 B;  1YX8 A;  1OMR A;  1PVB A;  4PDZ A;  1F4O A;  1WDC B;  2CCM A;  1MR8 A;  3NXA A;  1XK4 C;  2M9G A;  4YGD B;  1BLQ A;  1RFJ A;  1IQ3 A;  1YTZ C;  2M7L A;  2BKI B;  3F45 A;  1BMO A;  2OPO A;  1UHJ A;  2BKH B;  1OMD A;  2JTZ A;  1XFW O;  1XFZ O;  1TRF A;  4M2Q A;  5I8N A;  2GV5 A;  2WC8 A;  2HF5 A;  4M2P A;  2RGI A;  1KWO B;  1CM4 A;  3OHM B;  1BF5 A;  1NCX A;  1YUR A;  1BOC A;  2I2R E;  4YBH B;  3HCM A;  1BR4 B;  5DKN A;  1DMO A;  2Q91 A;  2IS9 A;  3DVJ A;  4MLW A;  1V1G A;  1N0Y A;  4CFQ A;  3I5I B;  1S6J A;  1IJ5 A;  5DKQ A;  1SW8 A;  1WDC C;  2KI4 B;  2LAN A;  1JF0 A;  2B1U A;  2DOQ A;  1J55 A;  1XA5 A;  3KEV A;  2KFH A;  3WHU B;  3O4Y A;  2FCD A;  2F2P A;  2JTT A;  1FF1 A;  1SNL A;  2L51 A;  4ICB A;  3I5H B;  1PSR A;  1QIV A;  4MRY A;  3O78 A;  1DJW A;  2KQ6 A;  1CDN A;  2ZRT A;  1Y6W A;  4GGN A;  4C0L A;  2ZKM X;  3I5F C;  1TTX A;  2F33 A;  1DF0 B;  4QJ5 B;  4ORC B;  1TNQ A;  3BUW B;  1MQ1 A;  1CLB A;  2H2K A;  4F0Z B;  1B47 A;  1DJZ A;  3BXK A;  2F2O A;  2ZNE A;  3DD4 A;  4GAO A;  4CLN A;  2CXJ A;  3I5I C;  1ALV A;  4DCK A;  3GK2 A;  1DJY A;  5CSF A;  2K7B A;  1TCO B;  3DF0 B;  3OX5 A;  2KI4 C;  1YRT B;  3CR5 X;  1M46 A;  3WNX B;  1CB1 A;  1WRL A;  2PRU A;  2ZFD A;  5ER4 X;  1FI5 A;  2LLT A;  1S5G Y;  1UHI A;  3CZT X;  1LA3 A;  3PN7 B;  5G08 A;  1SCV A;  2KFF A;  2PSR A;  3EK7 A;  1K9P A;  1YX7 A;  3OX6 A;  4R1E A;  3VRP A;  3CR2 A;  3I5H C;  4YI8 A;  3JVT B;  2LAP A;  1Y1A A;  2K7D A;  1HT9 A;  1QLS A;  1PUL A;  1QV1 A;  2WND A;  1SK6 D;  2F8P A;  1H4B A;  4ZCU A;  2KBI A;  1S36 A;  1K96 A;  1OMV A;  2M1K B;  1XK4 A;  2KSP A;  2L4H A;  2LVI A;  3EKJ A;  1TCF A;  4GNK B;  5HKZ A;  1QAS A;  2SCP A;  4AOM A;  3HX4 A;  2K0J A;  1K2H A;  4NDD A;  4PHN A;  2OTG B;  1XO5 A;  3GOF A;  1S1E A;  2COL B;  3PN7 C;  1AHR A;  4BY5 A;  1NPQ A;  2LMV A;  3TUY B;  1TNP A;  2EGD A;  2M3W A;  1DGV A;  1V1F A;  3AKB A;  4GGF C;  1C07 A;  1EG4 A;  4MRX A;  2JPT A;  4IL1 A;  2MA2 A;  4PHM A;  1YUS A;  2PAS A;  4N5X A;  2LHL A;  1SMG A;  2WOS A;  2WCB A;  2ZND A;  1XVJ A;  4PE1 A;  1A75 B;  4C0J A;  1S26 D;  2L2E A;  1QIW A;  1WLM A;  2KDH A;  5JJG A;  3BOW B;  1CMF A;  1KQV A;  1WY9 A;  1BOD A;  3IQQ A;  1B8R A;  4A4B A;  4ETO A;  1G8I A;  2H61 C;  1IGV A;  3C1V A;  2JZI A;  2CT9 A;  5HKW A;  4HSZ A;  2Y5I A;  1F55 A;  2L0P A;  1KFU L;  1JWD A;  2BCX A;  4DUQ A;  1SL7 A;  3SIB A;  3PM8 A;  4D1E A;  4CPV A;  1YVH A;  3E3R A;  1IG5 A;  3TUY C;  3DVM A;  5CSI A;  1QJT A;  5HKY A;  2NZ0 A;  4NDB A;  1OE9 B;  1QX7 A;  4YGE B;  1ZUZ A;  3D0Y B;  1MXE A;  3EKH A;  1YUU A;  1K90 D;  2NCO A;  1NX0 A;  5J3X A;  5FYX A;  1AJ4 A;  1SR6 B;  1DJX A;  1ZMZ A;  2CBL A;  3DVK A;  1ZAC A;  2E6W A;  2JT3 A;  2LNK A;  1CDP A;  5I2L A;  5AEQ A;  1QLK A;  2PAL A;  3SIA A;  2VRG A;  1KCY A;  2LMU A;  3I5F B;  3KPX A;  4C0K A;  1NX2 A;  3EVV A;  5DKR A;  1UUR A;  5IBW A;  2M49 B;  1LVC D;  1J1D A;  2K61 A;  1TIZ A;  2HET A;  3LL8 B;  3SJS A;  3DVE A;  4I5J A;  1K93 D;  2WOR A;  1EG3 A;  4A4C A;  3LCP C;  4ORB B;  1UP5 A;  2JOJ A;  2M29 A;  3LK1 A;  2BBN A;  4GBA A;  1F8H A;  2I7A A;  2Y4Q A;  3OB1 B;  3TS5 B;  2K7O A;  1M39 A;  3I5G B;  2D8N A;  3IF7 A;  4PHJ A;  3VRN A;  3WXA A;  1CFF A;  1SR6 C;  1L7Z A;  4JPZ B;  2Q4U A;  1JFJ A;  1C7V A;  1NX1 A;  3FWB A;  2EHB A;  2G2B A;  5D69 A;  3M0W A;  1GGZ A;  3SG7 A;  3DF0 A;  1ZFS A;  1SRA A;  1QX2 A;  2BBM A;  3EK4 A;  5I2O A;  4OKH A;  3SG4 A;  2L50 A;  2KNE A;  4YGC B;  3SG6 A;  3JTD B;  2JRF A;  1F71 A;  1F70 A;  3BUM B;  1TOP A;  2MRD A;  1ZOT B;  1RTP 1;  4ORA B;  3FS7 A;  1BR1 B;  1CLL A;  4GGF A;  4DRW A;  1U5I B;  2JWW A;  2MAZ A;  4NDC A;  4PAL A;  1M45 A;  1OOJ A;  1YUT A;  2BCB A;  2M1U A;  2ZN9 A;  5AXI A;  3TS5 C;  1JF2 A;  1IWQ A;  3I5G C;  2K7C A;  3PLF B;  4OR9 B;  3VRQ A;  1FI6 A;  1JFK A;  4MZK A;  5CSJ A;  1Y1U A;  2GGZ A;  1RK9 A;  2JQ6 A;  1R6P A;  1IKU A;  4DS7 A;  5HLV A;  1DTL A;  2K2A A;  2JUL A;  2KYC A;  3KF9 A;  2SAS A;  2BL0 C;  4MN0 A;  4DIR A;  4TNC A;  4HRE E;  1KK7 Z;  1XYD A;  1DT7 B;  4MVF A;  3JTD C;  5B8I B;  2NCP A;  2QAC A;  5AER A;  1SL8 A;  2TN4 A;  1K9U A;  3AAK A;  2KYF A;  1A4P A;  1K94 A;  1QS7 A;  1BG1 A;  1KK8 B;  2JXC A;  1SKT A;  1TN4 A;  3LLE A;  5AAN A;  1TNX A;  1B1G A;  1EJ3 A;  1WLZ A;  3BUO B;  2KQY A;  1AJ5 A;  4Q04 A;  5KSZ A;  2HQ8 A;  1A2X A;  4N1G A;  2AAO A;  3AKA A;  1ALW A;  4U8D A;  5CSN A;  3RM1 A;  1Q80 A;  1M31 A;  1A29 A;  1A75 A;  4PHK A;  2LHI A;  3BOW A;  2BEC A;  2KAX A;  1SPY A;  2NXQ A;  1CFC A;  1SBJ A;  3SG2 A;  2LP3 A; 
#chains in the Genus database with same CATH topology
 3CTN A;  1OZS A;  1TWO A;  1IJ6 A;  4INW A;  1MF8 B;  1EH2 A;  1QX5 B;  2AUC A;  3IQO A;  3SG3 A;  3GK4 X;  1LIN A;  3D78 A;  2M0R A;  4PE7 A;  4WRI A;  4XJK B;  2JT8 A;  4USL A;  1N65 A;  1KK8 C;  5I2Q A;  1DGU A;  1DQE A;  3MSE B;  3AAJ A;  1E8A A;  2R2I A;  1JC2 A;  2FJU B;  4YGA A;  3OBV A;  3BUN B;  1YRU B;  5ER5 A;  1RWY A;  1SCM B;  5HLO A;  1W7I B;  2KOT A;  1RRO A;  4P5O E;  1RJV A;  2F3Z A;  1CLM A;  1LA0 A;  4GUK A;  3UNW A;  1MHO A;  1KSO A;  5FI7 A;  4FTG A;  1Z4H A;  2CNP A;  1QVI Y;  2GGM A;  5F6T A;  4OVN F;  4YI9 A;  2JNX A;  1TUJ A;  1NCY A;  4JWQ A;  1CMG A;  1QTX A;  4MZJ A;  3EK8 A;  2L4I A;  2PMY A;  1AP4 A;  1BT6 A;  1VRK A;  2M97 A;  3CWG A;  2K8M B;  2LC5 A;  5TNC A;  1KQM B;  1XFV O;  2KGR A;  2Y1M A;  4YGB B;  3KO0 A;  1JUO A;  1OW4 A;  1XFR A;  3PM2 A;  2ZN8 A;  1CTR A;  1F4Q A;  2LVK A;  3CR4 X;  4HRH A;  2EC6 C;  3OP0 A;  2BCA A;  4PE0 A;  1EXR A;  2I94 A;  4N1F A;  1GGW A;  1KK7 Y;  4L9M A;  1SYM A;  3TDI A;  5K89 A;  3O6B A;  1SCM C;  2V53 A;  1MUX A;  4PCW A;  1XFY O;  4XYN A;  3BYA A;  3GK1 A;  3NHI A;  3R1P A;  2O5G A;  3S0D A;  1J7R A;  1REC A;  1X02 A;  1HQV A;  1UHH A;  1PSB A;  4BY4 A;  1UHK A;  2HQW A;  1YVL A;  4UPG A;  1AVS A;  4MZL A;  3VGO A;  3BUX B;  1QXP A;  1DJG A;  1Y1X A;  1DF0 A;  1KQM C;  4YRU A;  2KI6 C;  3CS1 A;  4AQI A;  1NIW A;  3CYZ A;  2QEB A;  3EVR A;  4I5L B;  1U5I A;  1BJF A;  1UHN A;  2MBX A;  3TDZ A;  2MLE C;  1CNP A;  2O60 A;  1L2O C;  2K2F A;  3PFV A;  2ISD A;  2BL0 B;  4PE4 A;  2KGB C;  3CZ2 A;  1CDM A;  3PAL A;  4OCI A;  2OS8 C;  1KFU S;  1KFX S;  1QAT A;  2JC2 A;  1G4Y R;  1K9K A;  1YR5 A;  4HRG A;  1OOI X;  1AK8 A;  2L5X B;  1C7W A;  2G9B A;  1IH0 A;  4GPL B;  1Y0V H;  1WRZ A;  2KAV A;  1XFU O;  1K95 A;  2KFG A;  2LUC A;  2WCM A;  3D74 A;  3EVU A;  4I5N B;  1OSA A;  4AQJ A;  4CFR A;  2JXL A;  2KI6 D;  4PT1 A;  1CKK A;  1QWV A;  3ZNI A;  1CM1 A;  1QVI Z;  2LVJ A;  2LLS A;  1MXL C;  1NX3 A;  1SY9 A;  1B4C A;  1NCZ A;  1J7Q A;  3CDN A;  2KHN A;  2L98 A;  1B7T Y;  2QPT A;  1QV0 A;  1S6C A;  1NP8 A;  3NHT A;  3OB2 B;  1A03 A;  1DVI A;  3WHT B;  1W7J B;  2F3Y A;  2MLF C;  2KLD A;  3A4U B;  1J7O A;  1KWO C;  1PAL A;  2H61 A;  1JSA A;  3ICB A;  1PK0 D;  1J1E A;  1NUB A;  5CPV A;  2LVV A;  1PRW A;  2YGU A;  1LS8 A;  4E68 A;  2JT0 A;  1B8L A;  2WC5 A;  2LCP A;  1IIO A;  3H4S E;  3FWC A;  2PQL A;  2LV7 A;  1IRJ A;  1B9A A;  2WCE A;  1UWO A;  1SL9 A;  1CFD A;  5AFP A;  5GQQ C;  1WRK A;  3NSK A;  1S3P A;  2WCL A;  3K21 A;  1FPW A;  1W9Z A;  2BNX A;  2Y1N A;  4ZCV A;  3SG5 A;  2ZRS A;  1TNW A;  1AUI B;  4FQO A;  3NSL A;  3NSI A;  1S6I A;  3L4L A;  4MSP A;  2L2C A;  4XJK A;  1GJY A;  1KSM A;  5PAL A;  1EL4 A;  1NSH A;  2LMT A;  1M63 B;  2WCH A;  3D10 A;  5BPJ A;  2KBM A;  1OQP A;  2FCE A;  2PVB A;  2LLU A;  3FIA A;  3TDU A;  3NSO A;  3ZWH A;  5JOL A;  2MHH A;  2JNF A;  3TZ1 A;  3CLN A;  1BU3 A;  4P2Y B;  1ODB A;  1PVA A;  4OV2 A;  1CDL A;  1GM0 A;  4JQ0 D;  1F54 A;  4NQG A;  2CTN A;  1OOG A;  4QJ3 B;  2EC6 B;  2JU0 A;  2P6B B;  1DJI A;  1LXF C;  3RLZ A;  3A8R A;  3VRO A;  2LUX A;  3BQ3 A;  2NLN A;  3PSR A;  3D0Y A;  3QRX A;  3O2P A;  4MEW A;  2KAY A;  1OZO A;  1K8U A;  4WQ2 A;  2KLE A;  4M2O A;  1CFP A;  2MJW B;  3JVT C;  1B7T Z;  1DEL A;  1UUS A;  2M8U A;  3DZT A;  2AMI A;  2BE6 A;  2QEO A;  4GFT A;  1FW4 A;  4MBE A;  5D7F A;  3VRR A;  1D1O A;  2LE9 B;  1FBV A;  1ORG A;  3CZ0 A;  5KTY A;  1MWN A;  1LKJ A;  1XFX O;  2LP2 A;  5HYD A;  2A4J A;  2BE4 A;  1R2U A;  3CGA A;  3R1O A;  2I18 A;  4WQ3 A;  1B8C A;  2FOT A;  4CID A;  3CZ1 A;  1G33 A;  4I5K A;  4FQT A;  3KHE A;  1N2D A;  1DJH A;  2WCF A;  2QEH A;  1NYA A;  1KFX L;  1IQ5 A;  2BAP A;  3B88 A;  3PAT A;  1J7P A;  1L2O B;  3R1V A;  2OTG C;  1NWD A;  1GQM A;  3PJI A;  5KU1 A;  3IVT A;  1S5G Z;  2HPS A;  2OS8 B;  3LK0 A;  1H8B A;  3S0E A;  5FI6 A;  2LM5 A;  1DC1 A;  2E30 A;  2M7N A;  1JBA A;  4QJ4 B;  1YX8 A;  1OMR A;  1PVB A;  3QME A;  1F4O A;  1WDC B;  2CCM A;  3DY9 A;  4PDZ A;  1MR8 A;  3NXA A;  4KYN A;  1XK4 C;  2M9G A;  4YGD B;  1BLQ A;  1RFJ A;  2JPO A;  1IQ3 A;  1YTZ C;  2M7L A;  2BKI B;  5EL2 A;  3L4A A;  3F45 A;  1BMO A;  2OPO A;  1UHJ A;  1OMD A;  2BKH B;  2JTZ A;  1XFW O;  1XFZ O;  1TRF A;  4M2Q A;  5I8N A;  2GV5 A;  2QDI A;  1SSE B;  2WC8 A;  2HF5 A;  4M2P A;  3VB1 A;  3D76 A;  2RGI A;  1KWO B;  1CM4 A;  3OHM B;  1BF5 A;  1NCX A;  1YUR A;  1BOC A;  2I2R E;  4YBH B;  3HCM A;  1BR4 B;  1TUZ A;  4IJ7 A;  5DKN A;  1C3Z A;  2IS9 A;  2Q91 A;  5FI2 A;  3DVJ A;  3R72 A;  4MLW A;  1DMO A;  1V1G A;  1N0Y A;  4CFQ A;  3I5I B;  1S6J A;  1IJ5 A;  5DKQ A;  1SW8 A;  1WDC C;  2KI4 B;  2LAN A;  1P28 A;  1JF0 A;  2B1U A;  2DOQ A;  3CAB A;  1J55 A;  1XA5 A;  3KEV A;  2KFH A;  1C3Y A;  3WHU B;  3O4Y A;  2FCD A;  2F2P A;  2JTT A;  1FF1 A;  1SNL A;  2L51 A;  4ICB A;  3I5H B;  1PSR A;  1QIV A;  4MRY A;  3O78 A;  1DJW A;  2KQ6 A;  1CDN A;  2ZRT A;  1Y6W A;  3BFB A;  4GGN A;  4C0L A;  2ZKM X;  3I5F C;  1TTX A;  2F33 A;  1DF0 B;  4QJ5 B;  4ORC B;  2QEV A;  1TNQ A;  3BUW B;  1MQ1 A;  1CLB A;  2H2K A;  4F0Z B;  1B47 A;  1DJZ A;  3BXK A;  2F2O A;  2ZNE A;  3DD4 A;  4GAO A;  4CLN A;  2CXJ A;  3I5I C;  1ALV A;  4DCK A;  3GK2 A;  1DJY A;  5CSF A;  2K7B A;  1TCO B;  3DF0 B;  3OX5 A;  2KI4 C;  3RZS A;  1YRT B;  3CR5 X;  1M46 A;  3WNX B;  3EG5 B;  1WRL A;  1CB1 A;  2PRU A;  2ZFD A;  5ER4 X;  1FI5 A;  2LLT A;  1S5G Y;  1UHI A;  3CZT X;  1LA3 A;  3PN7 B;  5G08 A;  1SCV A;  2KFF A;  2PSR A;  3EK7 A;  1K9P A;  1YX7 A;  3OX6 A;  4R1E A;  3VRP A;  3CR2 A;  3I5H C;  4YI8 A;  5DIC A;  3S0G A;  3JVT B;  3L47 A;  2LAP A;  3D73 A;  1Y1A A;  2ERB A;  2K7D A;  1HT9 A;  1QLS A;  1PUL A;  1QV1 A;  4OZD A;  2WND A;  1SK6 D;  2F8P A;  1H4B A;  4ZCU A;  2KBI A;  1S36 A;  1K96 A;  1OMV A;  2M1K B;  1XK4 A;  2KSP A;  2L4H A;  2LVI A;  3B6X A;  1TCF A;  3EKJ A;  5HKZ A;  1QAS A;  2SCP A;  4AOM A;  3HX4 A;  2K0J A;  1K2H A;  4NDD A;  4PHN A;  2OTG B;  1Z2C B;  1XO5 A;  3GOF A;  1S1E A;  2COL B;  3PN7 C;  3SS5 A;  1AHR A;  3D77 A;  4BY5 A;  1NPQ A;  2LMV A;  1OOF A;  1TNP A;  2EGD A;  2M3W A;  3TUY B;  1DGV A;  1V1F A;  3AKB A;  4GGF C;  1C07 A;  1EG4 A;  4MRX A;  2JPT A;  4IL1 A;  2MA2 A;  4PHM A;  1YUS A;  2PAS A;  2WC6 A;  2LHL A;  4N5X A;  1SMG A;  2WOS A;  2WCB A;  2ZND A;  1XVJ A;  2H8V A;  4PE1 A;  1A75 B;  4C0J A;  1S26 D;  2L2E A;  1QIW A;  2KPH A;  1WLM A;  2K60 A;  2KDH A;  3BOW B;  5JJG A;  1CMF A;  1KQV A;  1WY9 A;  1BOD A;  3IQQ A;  1B8R A;  4A4B A;  4ETO A;  1G8I A;  2H61 C;  1T14 A;  1IGV A;  3C1V A;  2JZI A;  2CT9 A;  5HKW A;  4HSZ A;  2Y5I A;  1F55 A;  2L0P A;  1KFU L;  1JWD A;  2BCX A;  4DUQ A;  1SL7 A;  3SIB A;  3PM8 A;  4D1E A;  3S0F A;  4CPV A;  1YVH A;  3DYE A;  3E3R A;  1IG5 A;  3TUY C;  3DVM A;  5CSI A;  4F7F A;  1QJT A;  5HKY A;  2NZ0 A;  4NDB A;  1OE9 B;  1QX7 A;  4YGE B;  1ZUZ A;  2L5Y A;  3D0Y B;  1MXE A;  3EKH A;  1YUU A;  1K90 D;  2NCO A;  1NX0 A;  2P70 A;  5FYX A;  5J3X A;  1AJ4 A;  1SR6 B;  3OGN A;  1DJX A;  1ZMZ A;  2CBL A;  3DVK A;  1ZAC A;  2E6W A;  3K1E A;  2JT3 A;  2LNK A;  1CDP A;  5I2L A;  4GNK B;  1QLK A;  5AEQ A;  2PAL A;  3V2L A;  3SIA A;  3S0A A;  3FE6 A;  3B87 A;  2GTE A;  2VRG A;  1KCY A;  2LMU A;  3I5F B;  3KPX A;  4C0K A;  1NX2 A;  3EVV A;  5DKR A;  1UUR A;  5IBW A;  2M49 B;  1LVC D;  1J1D A;  2K61 A;  1TIZ A;  2HET A;  3LL8 B;  5D3O A;  3DVE A;  3SJS A;  4I5J A;  3BFH A;  1K93 D;  2WOR A;  1EG3 A;  4JD9 A;  4A4C A;  3LCP C;  4ORB B;  3BJH A;  1UP5 A;  2JOJ A;  2WCK A;  2M29 A;  3DXL A;  3LK1 A;  3Q8I A;  2BBN A;  4GBA A;  1F8H A;  2I7A A;  2Y4Q A;  3OB1 B;  4INX A;  3TS5 B;  2PYQ A;  2K7O A;  1M39 A;  3I5G B;  2D8N A;  3IF7 A;  4PHJ A;  3VRN A;  3WXA A;  1CFF A;  1SR6 C;  1L7Z A;  4JPZ B;  2Q4U A;  3UO9 A;  1JFJ A;  1C7V A;  2P71 A;  1NX1 A;  3FWB A;  2EHB A;  2G2B A;  5D69 A;  3M0W A;  1GGZ A;  3SG7 A;  3DF0 A;  1ZFS A;  1SRA A;  1QX2 A;  2BBM A;  3EK4 A;  5I2O A;  4OKH A;  3SG4 A;  2L50 A;  2KNE A;  4YGC B;  3SG6 A;  3B86 A;  3JTD B;  1OOH A;  2JRF A;  3D75 A;  1F71 A;  1F70 A;  3BUM B;  1TOP A;  2MRD A;  1ZOT B;  3FE8 A;  1RTP 1;  3SS3 A;  4ORA B;  3FS7 A;  1BR1 B;  1CLL A;  4GGF A;  4DRW A;  1U5I B;  2JWW A;  3FE9 A;  2MAZ A;  4NDC A;  4PAL A;  1M45 A;  1OOJ A;  3B7A A;  1YUT A;  2BCB A;  2M1U A;  2ZN9 A;  5AXI A;  3TS5 C;  1JF2 A;  1IWQ A;  3I5G C;  2K7C A;  3PLF B;  3O4X A;  4OR9 B;  3VRQ A;  1FI6 A;  1JFK A;  4MZK A;  5CSJ A;  1Y1U A;  2GGZ A;  1RK9 A;  2JQ6 A;  1R6P A;  1IKU A;  4DS7 A;  5HLV A;  3BFA A;  1DTL A;  2K2A A;  2JUL A;  2KYC A;  3KF9 A;  2SAS A;  2BL0 C;  4JKT A;  4MN0 A;  4DIR A;  4TNC A;  4HRE E;  1KK7 Z;  1XYD A;  1DT7 B;  4MVF A;  3NGV A;  3JTD C;  5B8I B;  2NCP A;  2QAC A;  5AER A;  1SL8 A;  2TN4 A;  1K9U A;  3AAK A;  2KYF A;  1A4P A;  1K94 A;  1QS7 A;  1BG1 A;  1KK8 B;  2JXC A;  1SKT A;  1TN4 A;  2WCJ A;  3LLE A;  5AAN A;  1TNX A;  1B1G A;  1EJ3 A;  1WLZ A;  3BUO B;  2KQY A;  1AJ5 A;  4Q04 A;  5KSZ A;  2HQ8 A;  1A2X A;  4N1G A;  2AAO A;  2FJY A;  3AKA A;  1ALW A;  4U8D A;  5CSN A;  3RM1 A;  1Q80 A;  5I94 A;  1M31 A;  1A29 A;  1A75 A;  3N7H A;  1DEK A;  2LHI A;  4PHK A;  5HL1 A;  3BOW A;  2BEC A;  2KAX A;  1SPY A;  2NXQ A;  3SS4 A;  1CFC A;  1SBJ A;  3S0B A;  3SG2 A;  2LP3 A; 
#chains in the Genus database with same CATH homology
 3CTN A;  1OZS A;  1IJ6 A;  1MF8 B;  1EH2 A;  1QX5 B;  2AUC A;  3IQO A;  3SG3 A;  3GK4 X;  1LIN A;  2M0R A;  4PE7 A;  4WRI A;  4XJK B;  2JT8 A;  4USL A;  1N65 A;  1KK8 C;  5I2Q A;  1DGU A;  3MSE B;  3AAJ A;  1E8A A;  2R2I A;  1JC2 A;  2FJU B;  4YGA A;  3BUN B;  1YRU B;  5ER5 A;  1RWY A;  1SCM B;  5HLO A;  1W7I B;  2KOT A;  1RRO A;  4P5O E;  1RJV A;  2F3Z A;  1CLM A;  1LA0 A;  4GUK A;  1MHO A;  1KSO A;  4FTG A;  2CNP A;  1QVI Y;  2GGM A;  5F6T A;  4OVN F;  4YI9 A;  2JNX A;  1NCY A;  4JWQ A;  1CMG A;  1QTX A;  4MZJ A;  3EK8 A;  2L4I A;  2PMY A;  1AP4 A;  1BT6 A;  1VRK A;  2M97 A;  3CWG A;  2K8M B;  2LC5 A;  5TNC A;  1KQM B;  1XFV O;  2KGR A;  2Y1M A;  4YGB B;  3KO0 A;  1JUO A;  2ZN8 A;  1CTR A;  1F4Q A;  2LVK A;  3CR4 X;  4HRH A;  2EC6 C;  3OP0 A;  2BCA A;  4PE0 A;  1EXR A;  2I94 A;  4N1F A;  1GGW A;  1KK7 Y;  4L9M A;  1SYM A;  3TDI A;  5K89 A;  3O6B A;  1SCM C;  2V53 A;  1MUX A;  4PCW A;  1XFY O;  4XYN A;  3BYA A;  3GK1 A;  2O5G A;  1J7R A;  1REC A;  1X02 A;  1HQV A;  1UHH A;  1PSB A;  4BY4 A;  1UHK A;  2HQW A;  1YVL A;  4UPG A;  1AVS A;  4MZL A;  3VGO A;  3BUX B;  1QXP A;  1DJG A;  1Y1X A;  1DF0 A;  1KQM C;  4YRU A;  2KI6 C;  3CS1 A;  4AQI A;  1NIW A;  3EVR A;  4I5L B;  1U5I A;  1BJF A;  1UHN A;  2MBX A;  3TDZ A;  2MLE C;  1CNP A;  2O60 A;  1L2O C;  2K2F A;  3PFV A;  2ISD A;  2BL0 B;  4PE4 A;  2KGB C;  1CDM A;  3PAL A;  4OCI A;  2OS8 C;  1KFU S;  1KFX S;  1QAT A;  2JC2 A;  1G4Y R;  1K9K A;  1YR5 A;  4HRG A;  1AK8 A;  2L5X B;  1C7W A;  2G9B A;  1IH0 A;  4GPL B;  1Y0V H;  1WRZ A;  2KAV A;  1XFU O;  1K95 A;  2KFG A;  2LUC A;  3EVU A;  4I5N B;  4AQJ A;  4CFR A;  1OSA A;  2JXL A;  2KI6 D;  1CKK A;  3ZNI A;  1CM1 A;  1QVI Z;  2LVJ A;  2LLS A;  1MXL C;  1NX3 A;  1SY9 A;  1B4C A;  1NCZ A;  1J7Q A;  2KHN A;  2L98 A;  1B7T Y;  2QPT A;  1QV0 A;  1S6C A;  1NP8 A;  3OB2 B;  1A03 A;  1DVI A;  3WHT B;  1W7J B;  2F3Y A;  2MLF C;  3A4U B;  1J7O A;  1KWO C;  1PAL A;  2H61 A;  1JSA A;  3ICB A;  1PK0 D;  1J1E A;  1NUB A;  5CPV A;  2LVV A;  1PRW A;  4E68 A;  2JT0 A;  1B8L A;  2LCP A;  3H4S E;  3FWC A;  2LV7 A;  1IRJ A;  1B9A A;  2WCE A;  1UWO A;  1SL9 A;  1CFD A;  5AFP A;  5GQQ C;  1WRK A;  3NSK A;  1S3P A;  3K21 A;  1FPW A;  2Y1N A;  4ZCV A;  3SG5 A;  2ZRS A;  1TNW A;  1AUI B;  4FQO A;  3NSL A;  3NSI A;  1S6I A;  4MSP A;  4XJK A;  1GJY A;  1KSM A;  5PAL A;  1EL4 A;  1NSH A;  2LMT A;  1M63 B;  3D10 A;  5BPJ A;  2KBM A;  1OQP A;  2FCE A;  2PVB A;  2LLU A;  3FIA A;  3TDU A;  3NSO A;  3ZWH A;  5JOL A;  2MHH A;  2JNF A;  3TZ1 A;  3CLN A;  1BU3 A;  4P2Y B;  1ODB A;  1PVA A;  4OV2 A;  1CDL A;  4JQ0 D;  1F54 A;  4NQG A;  2CTN A;  4QJ3 B;  2EC6 B;  2JU0 A;  2P6B B;  1DJI A;  1LXF C;  3RLZ A;  3A8R A;  3VRO A;  2LUX A;  3BQ3 A;  2NLN A;  3PSR A;  3D0Y A;  3QRX A;  3O2P A;  4MEW A;  2KAY A;  1OZO A;  1K8U A;  4WQ2 A;  4M2O A;  1CFP A;  2MJW B;  3JVT C;  1B7T Z;  2M8U A;  1UUS A;  3VRR A;  4MBE A;  2AMI A;  2BE6 A;  4GFT A;  5D7F A;  1FW4 A;  1D1O A;  2LE9 B;  1FBV A;  5KTY A;  1MWN A;  1LKJ A;  1XFX O;  2LP2 A;  5HYD A;  2A4J A;  2BE4 A;  1R2U A;  3CGA A;  2I18 A;  4WQ3 A;  1B8C A;  2FOT A;  4CID A;  1G33 A;  4I5K A;  3KHE A;  1N2D A;  1DJH A;  2WCF A;  1NYA A;  1KFX L;  1IQ5 A;  3PAT A;  1J7P A;  1L2O B;  2OTG C;  1NWD A;  1GQM A;  5KU1 A;  1S5G Z;  2HPS A;  2OS8 B;  3LK0 A;  1H8B A;  2LM5 A;  2E30 A;  2M7N A;  1JBA A;  4QJ4 B;  1YX8 A;  1OMR A;  1PVB A;  4PDZ A;  1F4O A;  1WDC B;  2CCM A;  1MR8 A;  3NXA A;  1XK4 C;  2M9G A;  4YGD B;  1BLQ A;  1RFJ A;  1IQ3 A;  1YTZ C;  2M7L A;  2BKI B;  3F45 A;  1BMO A;  2OPO A;  1UHJ A;  2BKH B;  1OMD A;  2JTZ A;  1XFW O;  1XFZ O;  1TRF A;  4M2Q A;  5I8N A;  2GV5 A;  2WC8 A;  2HF5 A;  4M2P A;  2RGI A;  1KWO B;  1CM4 A;  3OHM B;  1BF5 A;  1NCX A;  1YUR A;  1BOC A;  2I2R E;  4YBH B;  3HCM A;  1BR4 B;  5DKN A;  1DMO A;  2Q91 A;  2IS9 A;  3DVJ A;  4MLW A;  1V1G A;  1N0Y A;  4CFQ A;  3I5I B;  1S6J A;  1IJ5 A;  5DKQ A;  1SW8 A;  1WDC C;  2KI4 B;  2LAN A;  1JF0 A;  2B1U A;  2DOQ A;  1J55 A;  1XA5 A;  3KEV A;  2KFH A;  3WHU B;  3O4Y A;  2FCD A;  2F2P A;  2JTT A;  1FF1 A;  1SNL A;  2L51 A;  4ICB A;  3I5H B;  1PSR A;  1QIV A;  4MRY A;  3O78 A;  1DJW A;  2KQ6 A;  1CDN A;  2ZRT A;  1Y6W A;  4GGN A;  4C0L A;  2ZKM X;  3I5F C;  1TTX A;  2F33 A;  1DF0 B;  4QJ5 B;  4ORC B;  1TNQ A;  3BUW B;  1MQ1 A;  1CLB A;  2H2K A;  4F0Z B;  1B47 A;  1DJZ A;  3BXK A;  2F2O A;  2ZNE A;  3DD4 A;  4GAO A;  4CLN A;  2CXJ A;  3I5I C;  1ALV A;  4DCK A;  3GK2 A;  1DJY A;  5CSF A;  2K7B A;  1TCO B;  3DF0 B;  3OX5 A;  2KI4 C;  1YRT B;  3CR5 X;  1M46 A;  3WNX B;  1CB1 A;  1WRL A;  2PRU A;  2ZFD A;  5ER4 X;  1FI5 A;  2LLT A;  1S5G Y;  1UHI A;  3CZT X;  1LA3 A;  3PN7 B;  5G08 A;  1SCV A;  2KFF A;  2PSR A;  3EK7 A;  1K9P A;  1YX7 A;  3OX6 A;  4R1E A;  3VRP A;  3CR2 A;  3I5H C;  4YI8 A;  3JVT B;  2LAP A;  1Y1A A;  2K7D A;  1HT9 A;  1QLS A;  1PUL A;  1QV1 A;  2WND A;  1SK6 D;  2F8P A;  1H4B A;  4ZCU A;  2KBI A;  1S36 A;  1K96 A;  1OMV A;  2M1K B;  1XK4 A;  2KSP A;  2L4H A;  2LVI A;  3EKJ A;  1TCF A;  4GNK B;  5HKZ A;  1QAS A;  2SCP A;  4AOM A;  3HX4 A;  2K0J A;  1K2H A;  4NDD A;  4PHN A;  2OTG B;  1XO5 A;  3GOF A;  1S1E A;  2COL B;  3PN7 C;  1AHR A;  4BY5 A;  1NPQ A;  2LMV A;  3TUY B;  1TNP A;  2EGD A;  2M3W A;  1DGV A;  1V1F A;  3AKB A;  4GGF C;  1C07 A;  1EG4 A;  4MRX A;  2JPT A;  4IL1 A;  2MA2 A;  4PHM A;  1YUS A;  2PAS A;  4N5X A;  2LHL A;  1SMG A;  2WOS A;  2WCB A;  2ZND A;  1XVJ A;  4PE1 A;  1A75 B;  4C0J A;  1S26 D;  2L2E A;  1QIW A;  1WLM A;  2KDH A;  5JJG A;  3BOW B;  1CMF A;  1KQV A;  1WY9 A;  1BOD A;  3IQQ A;  1B8R A;  4A4B A;  4ETO A;  1G8I A;  2H61 C;  1IGV A;  3C1V A;  2JZI A;  2CT9 A;  5HKW A;  4HSZ A;  2Y5I A;  1F55 A;  2L0P A;  1KFU L;  1JWD A;  2BCX A;  4DUQ A;  1SL7 A;  3SIB A;  3PM8 A;  4D1E A;  4CPV A;  1YVH A;  3E3R A;  1IG5 A;  3TUY C;  3DVM A;  5CSI A;  1QJT A;  5HKY A;  2NZ0 A;  4NDB A;  1OE9 B;  1QX7 A;  4YGE B;  1ZUZ A;  3D0Y B;  1MXE A;  3EKH A;  1YUU A;  1K90 D;  2NCO A;  1NX0 A;  5J3X A;  5FYX A;  1AJ4 A;  1SR6 B;  1DJX A;  1ZMZ A;  2CBL A;  3DVK A;  1ZAC A;  2E6W A;  2JT3 A;  2LNK A;  1CDP A;  5I2L A;  5AEQ A;  1QLK A;  2PAL A;  3SIA A;  2VRG A;  1KCY A;  2LMU A;  3I5F B;  3KPX A;  4C0K A;  1NX2 A;  3EVV A;  5DKR A;  1UUR A;  5IBW A;  2M49 B;  1LVC D;  1J1D A;  2K61 A;  1TIZ A;  2HET A;  3LL8 B;  3SJS A;  3DVE A;  4I5J A;  1K93 D;  2WOR A;  1EG3 A;  4A4C A;  3LCP C;  4ORB B;  1UP5 A;  2JOJ A;  2M29 A;  3LK1 A;  2BBN A;  4GBA A;  1F8H A;  2I7A A;  2Y4Q A;  3OB1 B;  3TS5 B;  2K7O A;  1M39 A;  3I5G B;  2D8N A;  3IF7 A;  4PHJ A;  3VRN A;  3WXA A;  1CFF A;  1SR6 C;  1L7Z A;  4JPZ B;  2Q4U A;  1JFJ A;  1C7V A;  1NX1 A;  3FWB A;  2EHB A;  2G2B A;  5D69 A;  3M0W A;  1GGZ A;  3SG7 A;  3DF0 A;  1ZFS A;  1SRA A;  1QX2 A;  2BBM A;  3EK4 A;  5I2O A;  4OKH A;  3SG4 A;  2L50 A;  2KNE A;  4YGC B;  3SG6 A;  3JTD B;  2JRF A;  1F71 A;  1F70 A;  3BUM B;  1TOP A;  2MRD A;  1ZOT B;  1RTP 1;  4ORA B;  3FS7 A;  1BR1 B;  1CLL A;  4GGF A;  4DRW A;  1U5I B;  2JWW A;  2MAZ A;  4NDC A;  4PAL A;  1M45 A;  1OOJ A;  1YUT A;  2BCB A;  2M1U A;  2ZN9 A;  5AXI A;  3TS5 C;  1JF2 A;  1IWQ A;  3I5G C;  2K7C A;  3PLF B;  4OR9 B;  3VRQ A;  1FI6 A;  1JFK A;  4MZK A;  5CSJ A;  1Y1U A;  2GGZ A;  1RK9 A;  2JQ6 A;  1R6P A;  1IKU A;  4DS7 A;  5HLV A;  1DTL A;  2K2A A;  2JUL A;  2KYC A;  3KF9 A;  2SAS A;  2BL0 C;  4MN0 A;  4DIR A;  4TNC A;  4HRE E;  1KK7 Z;  1XYD A;  1DT7 B;  4MVF A;  3JTD C;  5B8I B;  2NCP A;  2QAC A;  5AER A;  1SL8 A;  2TN4 A;  1K9U A;  3AAK A;  2KYF A;  1A4P A;  1K94 A;  1QS7 A;  1BG1 A;  1KK8 B;  2JXC A;  1SKT A;  1TN4 A;  3LLE A;  5AAN A;  1TNX A;  1B1G A;  1EJ3 A;  1WLZ A;  3BUO B;  2KQY A;  1AJ5 A;  4Q04 A;  5KSZ A;  2HQ8 A;  1A2X A;  4N1G A;  2AAO A;  3AKA A;  1ALW A;  4U8D A;  5CSN A;  3RM1 A;  1Q80 A;  1M31 A;  1A29 A;  1A75 A;  4PHK A;  2LHI A;  3BOW A;  2BEC A;  2KAX A;  1SPY A;  2NXQ A;  1CFC A;  1SBJ A;  3SG2 A;  2LP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...