1N65A

Family of nmr solution structures of ca ce calbindin d9k in denaturating conditions
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
b'KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin D-dependent calcium-binding protein, intestinal
publication title Monitoring the Early Steps of Unfolding of Dicalcium and Mono-Ce(3+)-Substituted Forms of P43M Calbindin D(9k).
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n65A00
4I5JA 1YVLA 1OOJA 1V1FA 3VRQA 1TCOB 1SPYA 2WNDA 4GUKA 3TS5C 1GGWA 1L2OB 3BUWB 4MEWA 1KFUS 2EGDA 1BU3A 5HKZA 4OV2A 4BY4A 1YTZC 2MAZA 4XJKA 3VRRA 3KEVA 1CFCA 1RROA 1BF5A 4P5OE 2M7LA 1C7VA 3CR5X 5I8NA 2O60A 2LUCA 1QX5B 1PK0D 2BKIB 1UHNA 3BUNB 2K2AA 4MZJA 2JT8A 4UPGA 1DJXA 1SCMC 3D0YB 4DRWA 4ICBA 2F2OA 2IS9A 2LMUA 3IQQA 2HQWA 3JVTB 1K2HA 2LANA 1NX1A 1FBVA 4P2YB 3EK7A 1Y0VH 1K94A 5B8IB 4MSPA 1AJ4A 2QACA 2R2IA 1IJ6A 1MHOA 4F0ZB 3EVUA 1XK4C 5KU1A 5ER5A 1F71A 1RJVA 3CTNA 1JWDA 3A4UB 3CZTX 4YGEB 5JOLA 3CR2A 1U5IA 1YRUB 1CLMA 1LKJA 2SCPA 4R1EA 1K93D 4ZCUA 1QVIY 2WCFA 5J3XA 1S6CA 1A75B 2EHBA 1CLBA 1XFXO 2K7OA 1NX0A 2K8MB 2LAPA 4HREE 2K7CA 1QIVA 1KWOB 1JUOA 1MWNA 2HETA 3DD4A 4I5NB 3FIAA 2BE6A 1XFVO 3NSLA 3O4YA 1FW4A 1QX2A 3AAKA 1QLSA 3VROA 1SK6D 4OVNF 1DJIA 2BE4A 2BCBA 1N0YA 3OHMB 2ZNDA 1UURA 1A29A 1VRKA 2L98A 1QS7A 1A03A 1ODBA 2M7NA 4PCWA 4GGFC 1QJTA 1OZOA 2JNFA 3EKJA 1EG4A 1YR5A 2M49B 1KSMA 3SJSA 4PE7A 1PULA 4HRHA 1KK7Z 1LXFC 2L4IA 1CKKA 3I5FC 4HSZA 3BUXB 1H4BA 2L2EA 5GQQC 2JQ6A 2Y4QA 2K0JA 2SASA 1AK8A 4A4CA 1YRTB 1BT6A 2OS8C 2ZRSA 2H2KA 4MLWA 1F4QA 3F45A 1JFKA 1ZUZA 1UWOA 2KHNA 4PHKA 5DKNA 1RFJA 1LA3A 1CFFA 1K95A 4NDCA 4MBEA 1K96A 1MQ1A 5AANA 1QATA 2E6WA 1X02A 5IBWA 2F3YA 2PSRA 1L2OC 3A8RA 2M1KB 3TZ1A 4ETOA 1B4CA 1UP5A 2L0PA 2MHHA 3E3RA 4JPZB 1M45A 1KFXS 4CPVA 4QJ5B 4MN0A 4PE0A 1CDMA 1B9AA 4GAOA 2LV7A 3GOFA 2E30A 1XK4A 1B1GA 1QV0A 1FPWA 3EK4A 1IGVA 3JVTC 5HLVA 1XFWO 2KGBC 2JU0A 1JSAA 1SKTA 4PHMA 3DF0B 1DJWA 1IJ5A 2I18A 3BYAA 1JBAA 2JOJA 1A4PA 1OMRA 2CCMA 4WQ2A 1G8IA 2M3WA 1B7TZ 2LCPA 1CMGA 3KO0A 2MA2A 4WRIA 2JRFA 4C0LA 1HQVA 4QJ4B 2EC6B 1GJYA 1KQMB 3NXAA 1KWOC 1J7RA 3NSIA 4A4BA 5HKYA 1MF8B 4I5LB 1ALVA 1UHKA 1KCYA 3CS1A 1PVAA 2LLTA 4GGFA 1ZACA 4NQGA 4E68A 1CM4A 4C0KA 1MXLC 2ZFDA 4JQ0D 1B8CA 2LVIA 4YGAA 4XJKB 2O5GA 3PM8A 1FI5A 3VRNA 2FJUB 3DVEA 2M8UA 1MXEA 2CTNA 1CDLA 5DKRA 2QPTA 1KSOA 4CFRA 3WXAA 1XVJA 2KAVA 1BR1B 3AKBA 3HX4A 1MR8A 2PALA 2Q91A 2ZN8A 1BODA 3GK2A 3JTDB 1IQ3A 1CFDA 2LLSA 2A4JA 2KQYA 3TDZA 1NSHA 2FCDA 1CB1A 1CTRA 4FQOA 1QASA 2KI6C 2F2PA 1KFUL 5HKWA 1OMDA 2WORA 1SL7A 1NCXA 1CNPA 4ORBB 1GGZA 1DJYA 1CDPA 4PE1A 2LP3A 1B8LA 2KBIA 2HF5A 3GK1A 4L9MA 5I2QA 1J7OA 1F55A 3TDIA 4WQ3A 1NYAA 4D1EA 1BOCA 1NWDA 1JC2A 1W7JB 1MUXA 1J1DA 1XFUO 1XO5A 4U8DA 1BG1A 2LHLA 1IH0A 1XFYO 3FWCA 1SYMA 1YX7A 2LE9B 2LMTA 2NCPA 2JWWA 5AXIA 1RK9A 1UHHA 1K8UA 2MRDA 3D0YA 4YI9A 1DF0B 1LVCD 5CSFA 2L4HA 4GFTA 1CLLA 1EL4A 2BBMA 2JT3A 1KK7Y 3I5HB 2M29A 3TUYB 2LHIA 1UUSA 5K89A 1A2XA 2JZIA 4GNKB 3CGAA 2Y1MA 1DMOA 1C7WA 2MBXA 3BXKA 2JNXA 1EG3A 1LA0A 1RECA 5D7FA 2Q4UA 1TOPA 3OB2B 2PASA 4M2OA 2ZN9A 1TNPA 2HPSA 1BJFA 4MVFA 1A75A 1S3PA 2JXCA 3LLEA 1HT9A 2JULA 4PDZA 2PMYA 3DVMA 1DGVA 1IQ5A 3BOWB 1G33A 2NCOA 2I94A 2LVKA 5CSIA 1IWQA 1DJGA 2CBLA 4MZLA 4CLNA 1DJHA 1SL9A 2JTZA 1SR6B 3KHEA 1SBJA 1TIZA 3O2PA 2EC6C 4M2PA 1KQMC 3RLZA 3VRPA 1K9UA 2F3ZA 4N1FA 4YGCB 1SW8A 3VGOA 2OTGB 1J7PA 1W7IB 3WNXB 1FI6A 3DVKA 2MLEC 3IF7A 1M31A 3BUOB 3D10A 3HCMA 1S5GZ 2OPOA 1WRZA 4DUQA 1PVBA 4N5XA 1NPQA 1XFZO 1JF0A 4GBAA 1NCYA 1YURA 1OZSA 3BQ3A 3SG7A 1B7TY 2MLFC 1BR4B 2ZRTA 5I2LA 1L7ZA 3JTDC 2LLUA 1JFJA 1NCZA 1PRWA 4PALA 1CM1A 3SG6A 2KAYA 2WOSA 3NSOA 1PSRA 3TDUA 3WHUB 2GV5A 1R2UA 3MSEB 3I5GB 2KQ6A 1KFXL 1CDNA 3CWGA 2K61A 2LVVA 5HYDA 2TN4A 3RM1A 5KSZA 5I2OA 2BECA 1UHIA 5PALA 1OE9B 2KI6D 2F8PA 3IQOA 1XYDA 5AERA 1QXPA 1IKUA 1AVSA 1S6IA 1NUBA 1TTXA 2M97A 1EXRA 2GGZA 2KSPA 3OX6A 4HRGA 4N1GA 4TNCA 1F8HA 2NXQA 1ZMZA 1WDCB 3PN7B 2CT9A 1F4OA 2AUCA 2DOQA 3OX5A 3PATA 2JC2A 4QJ3B 2CNPA 2LVJA 1QV1A 3NSKA 3K21A 4CFQA 3WHTB 3DF0A 4GGNA 3AKAA 3DVJA 3I5HC 3TUYC 1RWYA 4YI8A 1Y6WA 1C07A 1AP4A 1TRFA 2AAOA 1K9PA 1TN4A 5F6TA 2FCEA 1IRJA 2JPTA 2KYFA 1OQPA 3EKHA 1NP8A 4OCIA 1N65A 2BL0B 5KTYA 3ZWHA 1M63B 2KYCA 4DIRA 1E8AA 2M1UA 4M2QA 5G08A 1QVIZ 1Q80A 1JF2A 1U5IB 2KFHA 2NZ0A 3SIBA 4CIDA 1SR6C 3LK1A 1FF1A 5CPVA 1YVHA 3SG4A 1QIWA 2LM5A 3SG5A 1DVIA 1AHRA 4MZKA 3LCPC 2H61C 1H8BA 1B8RA 2D8NA 4MRXA 1EJ3A 4YBHB 4YGDB 1KK8B 2OTGC 2MJWB 1PALA 1DGUA 3ZNIA 2K7DA 1BLQA 2LC5A 3BUMB 4OKHA 4DCKA 1D1OA 2KAXA 1BMOA 2F33A 3GK4X 4AQJA 2BCAA 1M46A 1NX2A 1S36A 1RTP1 3PSRA 4OR9B 2KI4B 3C1VA 4AOMA 1YUSA 2JTTA 3H4SE 5CSJA 2BBNA 2KFGA 5HLOA 1ZOTB 2AMIA 2WCBA 3I5IB 2B1UA 1DTLA 4PHNA 1J7QA 1SCVA 1YX8A 2K2FA 3SG2A 4PE4A 1S26D 1ZFSA 3LL8B 4XYNA 1CFPA 3SIAA 3I5GC 1S6JA 1TCFA 2LMVA 3OP0A 1SRAA 2LP2A 5BPJA 3TS5B 1K9KA 4AQIA 1SL8A 3AAJA 4GPLB 5JJGA 1Y1XA 1DF0A 1PSBA 1XA5A 3FWBA 1AUIB 1S5GY 1LINA 3LK0A 2K7BA 1R6PA 2KDHA 4YGBB 1V1GA 3CLNA 1M39A 4NDDA 4USLA 1WLMA 3PN7C 1WDCC 1G4YR 1OSAA 2ZNEA 1AJ5A 1CMFA 1SCMB 3KF9A 5D69A 1SNLA 2WCEA 2L51A 5FYXA 2KGRA 2L50A 3EVVA 2KNEA 2I2RE 2NLNA 4ORAB 4ORCB 3EK8A 2L5XB 4YRUA 2VRGA 1WY9A 1QX7A 2M0RA 2PRUA 4ZCVA 5TNCA 5DKQA 1TNQA 2KBMA 3BOWA 2BCXA 1GQMA 3FS7A 5AFPA 2COLB 1F70A 1J1EA 2BL0C 2GGMA 2ISDA 1DT7B 4BY5A 3PLFB 2JT0A 2H61A 4C0JA 4IL1A 1SY9A 4DS7A 4NDBA 1J55A 1WLZA 2CXJA 3O78A 2LUXA 1KQVA 2BKHB 2JXLA 1S1EA 2HQ8A 4MRYA 1WRKA 1TNWA 3CR4X 5AEQA 1NX3A 2P6BB 2KFFA 2PVBA 4I5KA 2WC8A 2Y1NA 2G2BA 1N2DA 4Q04A 3SG3A 1WRLA 3PALA 1KK8C 3OB1B 1DJZA 5CSNA 1QTXA 2M9GA 1Y1AA 3QRXA 3PFVA 3EVRA 1UHJA 2Y5IA 3ICBA 2I7AA 5ER4X 1TNXA 3O6BA 3KPXA 2V53A 2KI4C 2FOTA 3I5FB 1F54A 4PHJA 1B47A 1YUUA 3M0WA 2LNKA 1Y1UA 1OMVA 1K90D 2KOTA 1SMGA 2ZKMX 2RGIA 3I5IC 2OS8B 2G9BA 1EH2A 1ALWA 1YUTA 1IG5A 4FTGA 1NIWA 1QLKA 4JWQA
chains in the Genus database with same CATH superfamily
4I5JA 1DQEA 1YVLA 2WCLA 1OOJA 1V1FA 3VRQA 1TCOB 1SPYA 2WNDA 4GUKA 2QEOA 3TS5C 1GGWA 1L2OB 3BUWB 4MEWA 1KFUS 2EGDA 1BU3A 3CDNA 5HKZA 4OV2A 4BY4A 1YTZC 2MAZA 4XJKA 4PT1A 3VRRA 3KEVA 1CFCA 1RROA 1BF5A 4P5OE 2M7LA 1C7VA 3CR5X 5I8NA 2O60A 2LUCA 3S0DA 1QX5B 1PK0D 2BKIB 1UHNA 3BUNB 2K2AA 4MZJA 2JT8A 4UPGA 1DJXA 1SCMC 4IJ7A 3D0YB 4DRWA 4ICBA 2F2OA 2IS9A 2LMUA 3IQQA 2HQWA 3JVTB 1K2HA 2LANA 2QEBA 1NX1A 3R1OA 1FBVA 4P2YB 3V2LA 3EK7A 1Y0VH 1K94A 5B8IB 4MSPA 1AJ4A 2QACA 2R2IA 1IJ6A 1MHOA 4F0ZB 3EVUA 1XK4C 3SS4A 5KU1A 5ER5A 1F71A 1RJVA 2L5YA 3CTNA 1JWDA 3A4UB 3CZTX 4YGEB 5JOLA 3CR2A 1U5IA 1YRUB 1CLMA 1LKJA 2SCPA 4R1EA 1K93D 3D76A 1QVIY 2WCFA 4ZCUA 5J3XA 1S6CA 3PJIA 1A75B 2EHBA 1CLBA 1XFXO 2K7OA 1NX0A 2K8MB 2LAPA 4HREE 2K7CA 1QIVA 1KWOB 1JUOA 1MWNA 2HETA 3DD4A 3B88A 4I5NB 3FIAA 1LS8A 2BE6A 1XFVO 3DYEA 3NSLA 3O4YA 1FW4A 1QX2A 3AAKA 3R1VA 1QLSA 1OOGA 1SK6D 3VROA 3L4LA 4OVNF 1DJIA 3IVTA 2BE4A 2BCBA 1N0YA 3OHMB 2ZNDA 1UURA 1A29A 1VRKA 3FE9A 2L98A 1QS7A 1A03A 1ODBA 2ERBA 2M7NA 4PCWA 4GGFC 1QJTA 1OZOA 2JNFA 3EKJA 1EG4A 1YR5A 3CZ2A 2M49B 1KSMA 3SJSA 4PE7A 1PULA 4HRHA 3O4XA 1KK7Z 1LXFC 2L4IA 1CKKA 3I5FC 4HSZA 3BUXB 2P71A 2L2EA 5GQQC 1H4BA 2JQ6A 5FI7A 2Y4QA 2K0JA 2SASA 1AK8A 4A4CA 1YRTB 1BT6A 2OS8C 2ZRSA 2H2KA 4MLWA 1F4QA 3F45A 3D78A 1JFKA 3Q8IA 1ZUZA 1UWOA 2KHNA 4PHKA 5DKNA 1T14A 1RFJA 1LA3A 1CFFA 2YGUA 1K95A 4NDCA 4MBEA 1K96A 2FJYA 1MQ1A 5AANA 3NGVA 1QATA 5FI2A 2E6WA 1X02A 5IBWA 2F3YA 2PSRA 1L2OC 3A8RA 2M1KB 3TZ1A 4ETOA 1B4CA 3B87A 1UP5A 3RZSA 2L0PA 2MHHA 3D74A 3E3RA 4JPZB 1M45A 1KFXS 4CPVA 4QJ5B 3CYZA 4MN0A 4PE0A 1CDMA 1B9AA 4GAOA 2LV7A 3D73A 3GOFA 2E30A 1XK4A 1B1GA 1QV0A 1FPWA 3DZTA 3EK4A 1IGVA 3JVTC 5HLVA 1XFWO 2KGBC 2JU0A 1JSAA 1SKTA 4PHMA 3DF0B 1DJWA 1IJ5A 2I18A 3BYAA 2WCJA 1JBAA 2JOJA 1A4PA 1OMRA 2CCMA 4WQ2A 1G8IA 2M3WA 1B7TZ 2LCPA 1CMGA 3QMEA 2PYQA 1Z4HA 3KO0A 2MA2A 4WRIA 2JRFA 3NHTA 4C0LA 1HQVA 4QJ4B 2EC6B 1GJYA 1KQMB 3NXAA 1KWOC 1J7RA 3NSIA 4A4BA 5HKYA 1MF8B 4I5LB 1ALVA 1UHKA 1KCYA 3CS1A 1PVAA 2LLTA 4GGFA 1ZACA 4NQGA 4E68A 1CM4A 4C0KA 1MXLC 2ZFDA 4JQ0D 1B8CA 2LVIA 4YGAA 4XJKB 2O5GA 3PM8A 1FI5A 3VRNA 2FJUB 3DVEA 2M8UA 1MXEA 2CTNA 1CDLA 5DKRA 2QPTA 1KSOA 4CFRA 3WXAA 1XVJA 2KAVA 2L2CA 1BR1B 3AKBA 3HX4A 1MR8A 2PALA 2Q91A 2ZN8A 1BODA 3R1PA 3GK2A 3JTDB 1IQ3A 1CFDA 2LLSA 3UO9A 2A4JA 4KYNA 2KQYA 3TDZA 1NSHA 2FCDA 1CB1A 1CTRA 4FQOA 1QASA 2KI6C 3FE8A 5I94A 2F2PA 1KFUL 5HKWA 1OMDA 2WORA 1SL7A 3L4AA 1NCXA 1CNPA 4ORBB 1GGZA 1DJYA 1CDPA 4PE1A 2LP3A 1B8LA 2KBIA 2HF5A 3GK1A 4L9MA 5I2QA 1J7OA 1F55A 3TDIA 2WCKA 4WQ3A 1NYAA 4D1EA 1BOCA 1NWDA 1JC2A 1W7JB 1MUXA 1J1DA 1XFUO 1XO5A 4U8DA 1BG1A 2LHLA 2KLEA 3B6XA 1IH0A 1XFYO 3FWCA 1SYMA 1YX7A 2LE9B 2LMTA 2NCPA 2JWWA 5AXIA 1RK9A 1UHHA 1K8UA 2MRDA 3D0YA 4YI9A 1DF0B 1LVCD 5CSFA 2L4HA 3D75A 4GFTA 2WC6A 1CLLA 1EL4A 2BBMA 2JT3A 1KK7Y 3I5HB 2M29A 3TUYB 2LHIA 1UUSA 5K89A 1A2XA 2JZIA 4GNKB 3CGAA 2Y1MA 1DMOA 1C7WA 2MBXA 3BXKA 2JNXA 1EG3A 1LA0A 1RECA 5D7FA 2BNXA 1TUJA 1TOPA 1OW4A 2Q4UA 3OB2B 3UNWA 2PASA 4M2OA 2ZN9A 1TNPA 2HPSA 1IIOA 1BJFA 4MVFA 1TUZA 1A75A 1S3PA 2JXCA 3LLEA 1HT9A 2JULA 4PDZA 2BAPA 2PMYA 3R72A 3DVMA 1OOIX 1DGVA 1IQ5A 4FQTA 3BOWB 1G33A 2NCOA 2I94A 2LVKA 5CSIA 1IWQA 1DJGA 2CBLA 3B86A 4MZLA 5EL2A 4CLNA 1DJHA 1SL9A 2JTZA 3S0BA 1SR6B 3KHEA 1SBJA 1TIZA 5DICA 3O2PA 2EC6C 4M2PA 1KQMC 2KPHA 3RLZA 3VRPA 1DELA 1K9UA 2F3ZA 4N1FA 4YGCB 1SW8A 3VGOA 2OTGB 1J7PA 1W7IB 3WNXB 3S0FA 1FI6A 3DVKA 1GM0A 2MLEC 3IF7A 1M31A 3FE6A 3BUOB 2WC5A 3D10A 3HCMA 1S5GZ 3S0EA 2OPOA 1WRZA 4DUQA 1PVBA 4N5XA 1NPQA 1XFZO 1JF0A 4GBAA 1NCYA 1YURA 1OZSA 3BQ3A 3SG7A 1B7TY 2MLFC 1BR4B 1ORGA 2ZRTA 3L47A 5I2LA 1L7ZA 3JTDC 2LLUA 1JFJA 1NCZA 1PRWA 4PALA 1CM1A 3SG6A 2KAYA 2WOSA 3NSOA 1PSRA 3TDUA 3WHUB 2GV5A 1R2UA 3MSEB 1OOHA 3I5GB 1QWVA 2KQ6A 1KFXL 1CDNA 3CWGA 2K61A 2PQLA 2LVVA 4OZDA 5HYDA 2TN4A 3RM1A 5KSZA 5I2OA 2BECA 1UHIA 5PALA 1OE9B 2KI6D 2F8PA 3IQOA 1XYDA 5AERA 1QXPA 1IKUA 1AVSA 1S6IA 1NUBA 1TTXA 2M97A 1EXRA 2GGZA 2KSPA 2QEVA 3OX6A 4HRGA 4N1GA 4TNCA 2NXQA 1ZMZA 1WDCB 3PN7B 2CT9A 1F4OA 2AUCA 2DOQA 3OX5A 3PATA 2JC2A 4QJ3B 4INWA 2CNPA 2KLDA 2LVJA 1QV1A 3CZ1A 3NSKA 3BJHA 3K21A 4CFQA 3WHTB 2QDIA 3DF0A 3AKAA 4GGNA 3DVJA 3I5HC 3TUYC 1RWYA 4YI8A 1Y6WA 3N7HA 1C07A 1AP4A 1TRFA 5HL1A 2AAOA 1K9PA 3VB1A 1TN4A 5F6TA 2FCEA 1IRJA 2JPTA 2K60A 1OQPA 2KYFA 3EKHA 1NP8A 4OCIA 1N65A 2BL0B 5KTYA 3ZWHA 1M63B 2KYCA 4DIRA 1E8AA 2M1UA 4M2QA 5G08A 5D3OA 4JD9A 1QVIZ 1Q80A 1JF2A 1U5IB 2KFHA 1SSEB 2NZ0A 3SIBA 4CIDA 1F8HA 1SR6C 3LK1A 1FF1A 5CPVA 1YVHA 3SG4A 1QIWA 2JPOA 2LM5A 3SG5A 1DVIA 1AHRA 1Z2CB 4MZKA 3LCPC 2H61C 1H8BA 1B8RA 2D8NA 4MRXA 1EJ3A 4YBHB 4YGDB 1KK8B 2OTGC 2MJWB 1PALA 1DGUA 3ZNIA 2K7DA 1BLQA 1C3YA 2LC5A 3BUMB 4OKHA 4DCKA 1D1OA 2KAXA 1BMOA 2F33A 3GK4X 4AQJA 2BCAA 1M46A 1NX2A 1S36A 3NHIA 1RTP1 3PSRA 4OR9B 2KI4B 3C1VA 4F7FA 4AOMA 1YUSA 2JTTA 3H4SE 5CSJA 3B7AA 2H8VA 2BBNA 2KFGA 3BFAA 1ZOTB 2AMIA 5HLOA 2WCBA 3I5IB 2B1UA 3SS5A 1DTLA 4PHNA 1J7QA 1SCVA 1YX8A 2K2FA 3SG2A 4PE4A 1S26D 5FI6A 1ZFSA 3LL8B 4XYNA 1CFPA 3SIAA 3I5GC 1S6JA 1TCFA 2LMVA 3OP0A 1SRAA 2LP2A 5BPJA 3TS5B 1K9KA 4AQIA 3DXLA 1SL8A 3AAJA 4GPLB 5JJGA 1Y1XA 1DF0A 1PSBA 1XA5A 3CZ0A 3EG5B 3FWBA 1AUIB 1S5GY 1LINA 3LK0A 2K7BA 1R6PA 2KDHA 3BFBA 4YGBB 1V1GA 3CLNA 1M39A 4NDDA 4USLA 1P28A 1WLMA 3PN7C 1WDCC 1G4YR 3D77A 1OSAA 2ZNEA 1AJ5A 1CMFA 1SCMB 3KF9A 5D69A 1SNLA 2WCEA 2L51A 5FYXA 2KGRA 1XFRA 2L50A 3EVVA 2KNEA 2I2RE 2NLNA 4ORAB 4ORCB 3EK8A 2L5XB 3BFHA 4YRUA 2VRGA 1WY9A 1QX7A 2M0RA 2PRUA 4ZCVA 5TNCA 5DKQA 1C3ZA 1TNQA 2KBMA 3BOWA 2BCXA 1GQMA 3FS7A 3PM2A 5AFPA 2COLB 1F70A 1J1EA 2BL0C 2QEHA 1OOFA 2GGMA 3OGNA 2ISDA 4INXA 4BY5A 1DT7B 3PLFB 2JT0A 2H61A 4JKTA 4IL1A 4C0JA 1SY9A 3DY9A 4DS7A 4NDBA 1J55A 1WLZA 2CXJA 3O78A 2LUXA 1KQVA 2BKHB 2JXLA 1S1EA 2HQ8A 4MRYA 1WRKA 1DC1A 1TNWA 3CR4X 5AEQA 1NX3A 2P6BB 3K1EA 3OBVA 2KFFA 2PVBA 2WCMA 4I5KA 2WC8A 2Y1NA 3SS3A 2G2BA 3S0GA 1N2DA 4Q04A 3SG3A 1WRLA 3PALA 1KK8C 3OB1B 1DJZA 5CSNA 1QTXA 2M9GA 1Y1AA 3QRXA 4JWQA 3PFVA 3EVRA 1UHJA 2Y5IA 3ICBA 2I7AA 5ER4X 1TNXA 3O6BA 3KPXA 2V53A 2KI4C 2FOTA 3I5FB 1F54A 4PHJA 1TWOA 3CABA 1B47A 1YUUA 3M0WA 2LNKA 1DEKA 3S0AA 1Y1UA 1OMVA 1K90D 1W9ZA 2GTEA 2KOTA 1SMGA 2ZKMX 2RGIA 3I5IC 2OS8B 2G9BA 1EH2A 1ALWA 1YUTA 1IG5A 4FTGA 1NIWA 1QLKA 2P70A 2WCHA
chains in the Genus database with same CATH topology
4I5JA 1YVLA 1OOJA 1V1FA 3VRQA 1TCOB 1SPYA 2WNDA 4GUKA 3TS5C 1GGWA 1L2OB 3BUWB 4MEWA 1KFUS 2EGDA 1BU3A 5HKZA 4OV2A 4BY4A 1YTZC 2MAZA 4XJKA 3VRRA 3KEVA 1CFCA 1RROA 1BF5A 4P5OE 2M7LA 1C7VA 3CR5X 5I8NA 2O60A 2LUCA 1QX5B 1PK0D 2BKIB 1UHNA 3BUNB 2K2AA 4MZJA 2JT8A 4UPGA 1DJXA 1SCMC 3D0YB 4DRWA 4ICBA 2F2OA 2IS9A 2LMUA 3IQQA 2HQWA 3JVTB 1K2HA 2LANA 1NX1A 1FBVA 4P2YB 3EK7A 1Y0VH 1K94A 5B8IB 4MSPA 1AJ4A 2QACA 2R2IA 1IJ6A 1MHOA 4F0ZB 3EVUA 1XK4C 5KU1A 5ER5A 1F71A 1RJVA 3CTNA 1JWDA 3A4UB 3CZTX 4YGEB 5JOLA 3CR2A 1U5IA 1YRUB 1CLMA 1LKJA 2SCPA 4R1EA 1K93D 4ZCUA 1QVIY 2WCFA 5J3XA 1S6CA 1A75B 2EHBA 1CLBA 1XFXO 2K7OA 1NX0A 2K8MB 2LAPA 4HREE 2K7CA 1QIVA 1KWOB 1JUOA 1MWNA 2HETA 3DD4A 4I5NB 3FIAA 2BE6A 1XFVO 3NSLA 3O4YA 1FW4A 1QX2A 3AAKA 1QLSA 3VROA 1SK6D 4OVNF 1DJIA 2BE4A 2BCBA 1N0YA 3OHMB 2ZNDA 1UURA 1A29A 1VRKA 2L98A 1QS7A 1A03A 1ODBA 2M7NA 4PCWA 4GGFC 1QJTA 1OZOA 2JNFA 3EKJA 1EG4A 1YR5A 2M49B 1KSMA 3SJSA 4PE7A 1PULA 4HRHA 1KK7Z 1LXFC 2L4IA 1CKKA 3I5FC 4HSZA 3BUXB 1H4BA 2L2EA 5GQQC 2JQ6A 2Y4QA 2K0JA 2SASA 1AK8A 4A4CA 1YRTB 1BT6A 2OS8C 2ZRSA 2H2KA 4MLWA 1F4QA 3F45A 1JFKA 1ZUZA 1UWOA 2KHNA 4PHKA 5DKNA 1RFJA 1LA3A 1CFFA 1K95A 4NDCA 4MBEA 1K96A 1MQ1A 5AANA 1QATA 2E6WA 1X02A 5IBWA 2F3YA 2PSRA 1L2OC 3A8RA 2M1KB 3TZ1A 4ETOA 1B4CA 1UP5A 2L0PA 2MHHA 3E3RA 4JPZB 1M45A 1KFXS 4CPVA 4QJ5B 4MN0A 4PE0A 1CDMA 1B9AA 4GAOA 2LV7A 3GOFA 2E30A 1XK4A 1B1GA 1QV0A 1FPWA 3EK4A 1IGVA 3JVTC 5HLVA 1XFWO 2KGBC 2JU0A 1JSAA 1SKTA 4PHMA 3DF0B 1DJWA 1IJ5A 2I18A 3BYAA 1JBAA 2JOJA 1A4PA 1OMRA 2CCMA 4WQ2A 1G8IA 2M3WA 1B7TZ 2LCPA 1CMGA 3KO0A 2MA2A 4WRIA 2JRFA 4C0LA 1HQVA 4QJ4B 2EC6B 1GJYA 1KQMB 3NXAA 1KWOC 1J7RA 3NSIA 4A4BA 5HKYA 1MF8B 4I5LB 1ALVA 1UHKA 1KCYA 3CS1A 1PVAA 2LLTA 4GGFA 1ZACA 4NQGA 4E68A 1CM4A 4C0KA 1MXLC 2ZFDA 4JQ0D 1B8CA 2LVIA 4YGAA 4XJKB 2O5GA 3PM8A 1FI5A 3VRNA 2FJUB 3DVEA 2M8UA 1MXEA 2CTNA 1CDLA 5DKRA 2QPTA 1KSOA 4CFRA 3WXAA 1XVJA 2KAVA 1BR1B 3AKBA 3HX4A 1MR8A 2PALA 2Q91A 2ZN8A 1BODA 3GK2A 3JTDB 1IQ3A 1CFDA 2LLSA 2A4JA 2KQYA 3TDZA 1NSHA 2FCDA 1CB1A 1CTRA 4FQOA 1QASA 2KI6C 2F2PA 1KFUL 5HKWA 1OMDA 2WORA 1SL7A 1NCXA 1CNPA 4ORBB 1GGZA 1DJYA 1CDPA 4PE1A 2LP3A 1B8LA 2KBIA 2HF5A 3GK1A 4L9MA 5I2QA 1J7OA 1F55A 3TDIA 4WQ3A 1NYAA 4D1EA 1BOCA 1NWDA 1JC2A 1W7JB 1MUXA 1J1DA 1XFUO 1XO5A 4U8DA 1BG1A 2LHLA 1IH0A 1XFYO 3FWCA 1SYMA 1YX7A 2LE9B 2LMTA 2NCPA 2JWWA 5AXIA 1RK9A 1UHHA 1K8UA 2MRDA 3D0YA 4YI9A 1DF0B 1LVCD 5CSFA 2L4HA 4GFTA 1CLLA 1EL4A 2BBMA 2JT3A 1KK7Y 3I5HB 2M29A 3TUYB 2LHIA 1UUSA 5K89A 1A2XA 2JZIA 4GNKB 3CGAA 2Y1MA 1DMOA 1C7WA 2MBXA 3BXKA 2JNXA 1EG3A 1LA0A 1RECA 5D7FA 2Q4UA 1TOPA 3OB2B 2PASA 4M2OA 2ZN9A 1TNPA 2HPSA 1BJFA 4MVFA 1A75A 1S3PA 2JXCA 3LLEA 1HT9A 2JULA 4PDZA 2PMYA 3DVMA 1DGVA 1IQ5A 3BOWB 1G33A 2NCOA 2I94A 2LVKA 5CSIA 1IWQA 1DJGA 2CBLA 4MZLA 4CLNA 1DJHA 1SL9A 2JTZA 1SR6B 3KHEA 1SBJA 1TIZA 3O2PA 2EC6C 4M2PA 1KQMC 3RLZA 3VRPA 1K9UA 2F3ZA 4N1FA 4YGCB 1SW8A 3VGOA 2OTGB 1J7PA 1W7IB 3WNXB 1FI6A 3DVKA 2MLEC 3IF7A 1M31A 3BUOB 3D10A 3HCMA 1S5GZ 2OPOA 1WRZA 4DUQA 1PVBA 4N5XA 1NPQA 1XFZO 1JF0A 4GBAA 1NCYA 1YURA 1OZSA 3BQ3A 3SG7A 1B7TY 2MLFC 1BR4B 2ZRTA 5I2LA 1L7ZA 3JTDC 2LLUA 1JFJA 1NCZA 1PRWA 4PALA 1CM1A 3SG6A 2KAYA 2WOSA 3NSOA 1PSRA 3TDUA 3WHUB 2GV5A 1R2UA 3MSEB 3I5GB 2KQ6A 1KFXL 1CDNA 3CWGA 2K61A 2LVVA 5HYDA 2TN4A 3RM1A 5KSZA 5I2OA 2BECA 1UHIA 5PALA 1OE9B 2KI6D 2F8PA 3IQOA 1XYDA 5AERA 1QXPA 1IKUA 1AVSA 1S6IA 1NUBA 1TTXA 2M97A 1EXRA 2GGZA 2KSPA 3OX6A 4HRGA 4N1GA 4TNCA 1F8HA 2NXQA 1ZMZA 1WDCB 3PN7B 2CT9A 1F4OA 2AUCA 2DOQA 3OX5A 3PATA 2JC2A 4QJ3B 2CNPA 2LVJA 1QV1A 3NSKA 3K21A 4CFQA 3WHTB 3DF0A 4GGNA 3AKAA 3DVJA 3I5HC 3TUYC 1RWYA 4YI8A 1Y6WA 1C07A 1AP4A 1TRFA 2AAOA 1K9PA 1TN4A 5F6TA 2FCEA 1IRJA 2JPTA 2KYFA 1OQPA 3EKHA 1NP8A 4OCIA 1N65A 2BL0B 5KTYA 3ZWHA 1M63B 2KYCA 4DIRA 1E8AA 2M1UA 4M2QA 5G08A 1QVIZ 1Q80A 1JF2A 1U5IB 2KFHA 2NZ0A 3SIBA 4CIDA 1SR6C 3LK1A 1FF1A 5CPVA 1YVHA 3SG4A 1QIWA 2LM5A 3SG5A 1DVIA 1AHRA 4MZKA 3LCPC 2H61C 1H8BA 1B8RA 2D8NA 4MRXA 1EJ3A 4YBHB 4YGDB 1KK8B 2OTGC 2MJWB 1PALA 1DGUA 3ZNIA 2K7DA 1BLQA 2LC5A 3BUMB 4OKHA 4DCKA 1D1OA 2KAXA 1BMOA 2F33A 3GK4X 4AQJA 2BCAA 1M46A 1NX2A 1S36A 1RTP1 3PSRA 4OR9B 2KI4B 3C1VA 4AOMA 1YUSA 2JTTA 3H4SE 5CSJA 2BBNA 2KFGA 5HLOA 1ZOTB 2AMIA 2WCBA 3I5IB 2B1UA 1DTLA 4PHNA 1J7QA 1SCVA 1YX8A 2K2FA 3SG2A 4PE4A 1S26D 1ZFSA 3LL8B 4XYNA 1CFPA 3SIAA 3I5GC 1S6JA 1TCFA 2LMVA 3OP0A 1SRAA 2LP2A 5BPJA 3TS5B 1K9KA 4AQIA 1SL8A 3AAJA 4GPLB 5JJGA 1Y1XA 1DF0A 1PSBA 1XA5A 3FWBA 1AUIB 1S5GY 1LINA 3LK0A 2K7BA 1R6PA 2KDHA 4YGBB 1V1GA 3CLNA 1M39A 4NDDA 4USLA 1WLMA 3PN7C 1WDCC 1G4YR 1OSAA 2ZNEA 1AJ5A 1CMFA 1SCMB 3KF9A 5D69A 1SNLA 2WCEA 2L51A 5FYXA 2KGRA 2L50A 3EVVA 2KNEA 2I2RE 2NLNA 4ORAB 4ORCB 3EK8A 2L5XB 4YRUA 2VRGA 1WY9A 1QX7A 2M0RA 2PRUA 4ZCVA 5TNCA 5DKQA 1TNQA 2KBMA 3BOWA 2BCXA 1GQMA 3FS7A 5AFPA 2COLB 1F70A 1J1EA 2BL0C 2GGMA 2ISDA 1DT7B 4BY5A 3PLFB 2JT0A 2H61A 4C0JA 4IL1A 1SY9A 4DS7A 4NDBA 1J55A 1WLZA 2CXJA 3O78A 2LUXA 1KQVA 2BKHB 2JXLA 1S1EA 2HQ8A 4MRYA 1WRKA 1TNWA 3CR4X 5AEQA 1NX3A 2P6BB 2KFFA 2PVBA 4I5KA 2WC8A 2Y1NA 2G2BA 1N2DA 4Q04A 3SG3A 1WRLA 3PALA 1KK8C 3OB1B 1DJZA 5CSNA 1QTXA 2M9GA 1Y1AA 3QRXA 3PFVA 3EVRA 1UHJA 2Y5IA 3ICBA 2I7AA 5ER4X 1TNXA 3O6BA 3KPXA 2V53A 2KI4C 2FOTA 3I5FB 1F54A 4PHJA 1B47A 1YUUA 3M0WA 2LNKA 1Y1UA 1OMVA 1K90D 2KOTA 1SMGA 2ZKMX 2RGIA 3I5IC 2OS8B 2G9BA 1EH2A 1ALWA 1YUTA 1IG5A 4FTGA 1NIWA 1QLKA 4JWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5J A;  1YVL A;  1OOJ A;  1V1F A;  3VRQ A;  1TCO B;  1SPY A;  2WND A;  4GUK A;  3TS5 C;  1GGW A;  1L2O B;  3BUW B;  4MEW A;  1KFU S;  2EGD A;  1BU3 A;  5HKZ A;  4OV2 A;  4BY4 A;  1YTZ C;  2MAZ A;  4XJK A;  3VRR A;  3KEV A;  1CFC A;  1RRO A;  1BF5 A;  4P5O E;  2M7L A;  1C7V A;  3CR5 X;  5I8N A;  2O60 A;  2LUC A;  1QX5 B;  1PK0 D;  2BKI B;  1UHN A;  3BUN B;  2K2A A;  4MZJ A;  2JT8 A;  4UPG A;  1DJX A;  1SCM C;  3D0Y B;  4DRW A;  4ICB A;  2F2O A;  2IS9 A;  2LMU A;  3IQQ A;  2HQW A;  3JVT B;  1K2H A;  2LAN A;  1NX1 A;  1FBV A;  4P2Y B;  3EK7 A;  1Y0V H;  1K94 A;  5B8I B;  4MSP A;  1AJ4 A;  2QAC A;  2R2I A;  1IJ6 A;  1MHO A;  4F0Z B;  3EVU A;  1XK4 C;  5KU1 A;  5ER5 A;  1F71 A;  1RJV A;  3CTN A;  1JWD A;  3A4U B;  3CZT X;  4YGE B;  5JOL A;  3CR2 A;  1U5I A;  1YRU B;  1CLM A;  1LKJ A;  2SCP A;  4R1E A;  1K93 D;  4ZCU A;  1QVI Y;  2WCF A;  5J3X A;  1S6C A;  1A75 B;  2EHB A;  1CLB A;  1XFX O;  2K7O A;  1NX0 A;  2K8M B;  2LAP A;  4HRE E;  2K7C A;  1QIV A;  1KWO B;  1JUO A;  1MWN A;  2HET A;  3DD4 A;  4I5N B;  3FIA A;  2BE6 A;  1XFV O;  3NSL A;  3O4Y A;  1FW4 A;  1QX2 A;  3AAK A;  1QLS A;  3VRO A;  1SK6 D;  4OVN F;  1DJI A;  2BE4 A;  2BCB A;  1N0Y A;  3OHM B;  2ZND A;  1UUR A;  1A29 A;  1VRK A;  2L98 A;  1QS7 A;  1A03 A;  1ODB A;  2M7N A;  4PCW A;  4GGF C;  1QJT A;  1OZO A;  2JNF A;  3EKJ A;  1EG4 A;  1YR5 A;  2M49 B;  1KSM A;  3SJS A;  4PE7 A;  1PUL A;  4HRH A;  1KK7 Z;  1LXF C;  2L4I A;  1CKK A;  3I5F C;  4HSZ A;  3BUX B;  1H4B A;  2L2E A;  5GQQ C;  2JQ6 A;  2Y4Q A;  2K0J A;  2SAS A;  1AK8 A;  4A4C A;  1YRT B;  1BT6 A;  2OS8 C;  2ZRS A;  2H2K A;  4MLW A;  1F4Q A;  3F45 A;  1JFK A;  1ZUZ A;  1UWO A;  2KHN A;  4PHK A;  5DKN A;  1RFJ A;  1LA3 A;  1CFF A;  1K95 A;  4NDC A;  4MBE A;  1K96 A;  1MQ1 A;  5AAN A;  1QAT A;  2E6W A;  1X02 A;  5IBW A;  2F3Y A;  2PSR A;  1L2O C;  3A8R A;  2M1K B;  3TZ1 A;  4ETO A;  1B4C A;  1UP5 A;  2L0P A;  2MHH A;  3E3R A;  4JPZ B;  1M45 A;  1KFX S;  4CPV A;  4QJ5 B;  4MN0 A;  4PE0 A;  1CDM A;  1B9A A;  4GAO A;  2LV7 A;  3GOF A;  2E30 A;  1XK4 A;  1B1G A;  1QV0 A;  1FPW A;  3EK4 A;  1IGV A;  3JVT C;  5HLV A;  1XFW O;  2KGB C;  2JU0 A;  1JSA A;  1SKT A;  4PHM A;  3DF0 B;  1DJW A;  1IJ5 A;  2I18 A;  3BYA A;  1JBA A;  2JOJ A;  1A4P A;  1OMR A;  2CCM A;  4WQ2 A;  1G8I A;  2M3W A;  1B7T Z;  2LCP A;  1CMG A;  3KO0 A;  2MA2 A;  4WRI A;  2JRF A;  4C0L A;  1HQV A;  4QJ4 B;  2EC6 B;  1GJY A;  1KQM B;  3NXA A;  1KWO C;  1J7R A;  3NSI A;  4A4B A;  5HKY A;  1MF8 B;  4I5L B;  1ALV A;  1UHK A;  1KCY A;  3CS1 A;  1PVA A;  2LLT A;  4GGF A;  1ZAC A;  4NQG A;  4E68 A;  1CM4 A;  4C0K A;  1MXL C;  2ZFD A;  4JQ0 D;  1B8C A;  2LVI A;  4YGA A;  4XJK B;  2O5G A;  3PM8 A;  1FI5 A;  3VRN A;  2FJU B;  3DVE A;  2M8U A;  1MXE A;  2CTN A;  1CDL A;  5DKR A;  2QPT A;  1KSO A;  4CFR A;  3WXA A;  1XVJ A;  2KAV A;  1BR1 B;  3AKB A;  3HX4 A;  1MR8 A;  2PAL A;  2Q91 A;  2ZN8 A;  1BOD A;  3GK2 A;  3JTD B;  1IQ3 A;  1CFD A;  2LLS A;  2A4J A;  2KQY A;  3TDZ A;  1NSH A;  2FCD A;  1CB1 A;  1CTR A;  4FQO A;  1QAS A;  2KI6 C;  2F2P A;  1KFU L;  5HKW A;  1OMD A;  2WOR A;  1SL7 A;  1NCX A;  1CNP A;  4ORB B;  1GGZ A;  1DJY A;  1CDP A;  4PE1 A;  2LP3 A;  1B8L A;  2KBI A;  2HF5 A;  3GK1 A;  4L9M A;  5I2Q A;  1J7O A;  1F55 A;  3TDI A;  4WQ3 A;  1NYA A;  4D1E A;  1BOC A;  1NWD A;  1JC2 A;  1W7J B;  1MUX A;  1J1D A;  1XFU O;  1XO5 A;  4U8D A;  1BG1 A;  2LHL A;  1IH0 A;  1XFY O;  3FWC A;  1SYM A;  1YX7 A;  2LE9 B;  2LMT A;  2NCP A;  2JWW A;  5AXI A;  1RK9 A;  1UHH A;  1K8U A;  2MRD A;  3D0Y A;  4YI9 A;  1DF0 B;  1LVC D;  5CSF A;  2L4H A;  4GFT A;  1CLL A;  1EL4 A;  2BBM A;  2JT3 A;  1KK7 Y;  3I5H B;  2M29 A;  3TUY B;  2LHI A;  1UUS A;  5K89 A;  1A2X A;  2JZI A;  4GNK B;  3CGA A;  2Y1M A;  1DMO A;  1C7W A;  2MBX A;  3BXK A;  2JNX A;  1EG3 A;  1LA0 A;  1REC A;  5D7F A;  2Q4U A;  1TOP A;  3OB2 B;  2PAS A;  4M2O A;  2ZN9 A;  1TNP A;  2HPS A;  1BJF A;  4MVF A;  1A75 A;  1S3P A;  2JXC A;  3LLE A;  1HT9 A;  2JUL A;  4PDZ A;  2PMY A;  3DVM A;  1DGV A;  1IQ5 A;  3BOW B;  1G33 A;  2NCO A;  2I94 A;  2LVK A;  5CSI A;  1IWQ A;  1DJG A;  2CBL A;  4MZL A;  4CLN A;  1DJH A;  1SL9 A;  2JTZ A;  1SR6 B;  3KHE A;  1SBJ A;  1TIZ A;  3O2P A;  2EC6 C;  4M2P A;  1KQM C;  3RLZ A;  3VRP A;  1K9U A;  2F3Z A;  4N1F A;  4YGC B;  1SW8 A;  3VGO A;  2OTG B;  1J7P A;  1W7I B;  3WNX B;  1FI6 A;  3DVK A;  2MLE C;  3IF7 A;  1M31 A;  3BUO B;  3D10 A;  3HCM A;  1S5G Z;  2OPO A;  1WRZ A;  4DUQ A;  1PVB A;  4N5X A;  1NPQ A;  1XFZ O;  1JF0 A;  4GBA A;  1NCY A;  1YUR A;  1OZS A;  3BQ3 A;  3SG7 A;  1B7T Y;  2MLF C;  1BR4 B;  2ZRT A;  5I2L A;  1L7Z A;  3JTD C;  2LLU A;  1JFJ A;  1NCZ A;  1PRW A;  4PAL A;  1CM1 A;  3SG6 A;  2KAY A;  2WOS A;  3NSO A;  1PSR A;  3TDU A;  3WHU B;  2GV5 A;  1R2U A;  3MSE B;  3I5G B;  2KQ6 A;  1KFX L;  1CDN A;  3CWG A;  2K61 A;  2LVV A;  5HYD A;  2TN4 A;  3RM1 A;  5KSZ A;  5I2O A;  2BEC A;  1UHI A;  5PAL A;  1OE9 B;  2KI6 D;  2F8P A;  3IQO A;  1XYD A;  5AER A;  1QXP A;  1IKU A;  1AVS A;  1S6I A;  1NUB A;  1TTX A;  2M97 A;  1EXR A;  2GGZ A;  2KSP A;  3OX6 A;  4HRG A;  4N1G A;  4TNC A;  1F8H A;  2NXQ A;  1ZMZ A;  1WDC B;  3PN7 B;  2CT9 A;  1F4O A;  2AUC A;  2DOQ A;  3OX5 A;  3PAT A;  2JC2 A;  4QJ3 B;  2CNP A;  2LVJ A;  1QV1 A;  3NSK A;  3K21 A;  4CFQ A;  3WHT B;  3DF0 A;  4GGN A;  3AKA A;  3DVJ A;  3I5H C;  3TUY C;  1RWY A;  4YI8 A;  1Y6W A;  1C07 A;  1AP4 A;  1TRF A;  2AAO A;  1K9P A;  1TN4 A;  5F6T A;  2FCE A;  1IRJ A;  2JPT A;  2KYF A;  1OQP A;  3EKH A;  1NP8 A;  4OCI A;  1N65 A;  2BL0 B;  5KTY A;  3ZWH A;  1M63 B;  2KYC A;  4DIR A;  1E8A A;  2M1U A;  4M2Q A;  5G08 A;  1QVI Z;  1Q80 A;  1JF2 A;  1U5I B;  2KFH A;  2NZ0 A;  3SIB A;  4CID A;  1SR6 C;  3LK1 A;  1FF1 A;  5CPV A;  1YVH A;  3SG4 A;  1QIW A;  2LM5 A;  3SG5 A;  1DVI A;  1AHR A;  4MZK A;  3LCP C;  2H61 C;  1H8B A;  1B8R A;  2D8N A;  4MRX A;  1EJ3 A;  4YBH B;  4YGD B;  1KK8 B;  2OTG C;  2MJW B;  1PAL A;  1DGU A;  3ZNI A;  2K7D A;  1BLQ A;  2LC5 A;  3BUM B;  4OKH A;  4DCK A;  1D1O A;  2KAX A;  1BMO A;  2F33 A;  3GK4 X;  4AQJ A;  2BCA A;  1M46 A;  1NX2 A;  1S36 A;  1RTP 1;  3PSR A;  4OR9 B;  2KI4 B;  3C1V A;  4AOM A;  1YUS A;  2JTT A;  3H4S E;  5CSJ A;  2BBN A;  2KFG A;  5HLO A;  1ZOT B;  2AMI A;  2WCB A;  3I5I B;  2B1U A;  1DTL A;  4PHN A;  1J7Q A;  1SCV A;  1YX8 A;  2K2F A;  3SG2 A;  4PE4 A;  1S26 D;  1ZFS A;  3LL8 B;  4XYN A;  1CFP A;  3SIA A;  3I5G C;  1S6J A;  1TCF A;  2LMV A;  3OP0 A;  1SRA A;  2LP2 A;  5BPJ A;  3TS5 B;  1K9K A;  4AQI A;  1SL8 A;  3AAJ A;  4GPL B;  5JJG A;  1Y1X A;  1DF0 A;  1PSB A;  1XA5 A;  3FWB A;  1AUI B;  1S5G Y;  1LIN A;  3LK0 A;  2K7B A;  1R6P A;  2KDH A;  4YGB B;  1V1G A;  3CLN A;  1M39 A;  4NDD A;  4USL A;  1WLM A;  3PN7 C;  1WDC C;  1G4Y R;  1OSA A;  2ZNE A;  1AJ5 A;  1CMF A;  1SCM B;  3KF9 A;  5D69 A;  1SNL A;  2WCE A;  2L51 A;  5FYX A;  2KGR A;  2L50 A;  3EVV A;  2KNE A;  2I2R E;  2NLN A;  4ORA B;  4ORC B;  3EK8 A;  2L5X B;  4YRU A;  2VRG A;  1WY9 A;  1QX7 A;  2M0R A;  2PRU A;  4ZCV A;  5TNC A;  5DKQ A;  1TNQ A;  2KBM A;  3BOW A;  2BCX A;  1GQM A;  3FS7 A;  5AFP A;  2COL B;  1F70 A;  1J1E A;  2BL0 C;  2GGM A;  2ISD A;  1DT7 B;  4BY5 A;  3PLF B;  2JT0 A;  2H61 A;  4C0J A;  4IL1 A;  1SY9 A;  4DS7 A;  4NDB A;  1J55 A;  1WLZ A;  2CXJ A;  3O78 A;  2LUX A;  1KQV A;  2BKH B;  2JXL A;  1S1E A;  2HQ8 A;  4MRY A;  1WRK A;  1TNW A;  3CR4 X;  5AEQ A;  1NX3 A;  2P6B B;  2KFF A;  2PVB A;  4I5K A;  2WC8 A;  2Y1N A;  2G2B A;  1N2D A;  4Q04 A;  3SG3 A;  1WRL A;  3PAL A;  1KK8 C;  3OB1 B;  1DJZ A;  5CSN A;  1QTX A;  2M9G A;  1Y1A A;  3QRX A;  3PFV A;  3EVR A;  1UHJ A;  2Y5I A;  3ICB A;  2I7A A;  5ER4 X;  1TNX A;  3O6B A;  3KPX A;  2V53 A;  2KI4 C;  2FOT A;  3I5F B;  1F54 A;  4PHJ A;  1B47 A;  1YUU A;  3M0W A;  2LNK A;  1Y1U A;  1OMV A;  1K90 D;  2KOT A;  1SMG A;  2ZKM X;  2RGI A;  3I5I C;  2OS8 B;  2G9B A;  1EH2 A;  1ALW A;  1YUT A;  1IG5 A;  4FTG A;  1NIW A;  1QLK A;  4JWQ A; 
#chains in the Genus database with same CATH topology
 4I5J A;  1DQE A;  1YVL A;  2WCL A;  1OOJ A;  1V1F A;  3VRQ A;  1TCO B;  1SPY A;  2WND A;  4GUK A;  2QEO A;  3TS5 C;  1GGW A;  1L2O B;  3BUW B;  4MEW A;  1KFU S;  2EGD A;  1BU3 A;  3CDN A;  5HKZ A;  4OV2 A;  4BY4 A;  1YTZ C;  2MAZ A;  4XJK A;  4PT1 A;  3VRR A;  3KEV A;  1CFC A;  1RRO A;  1BF5 A;  4P5O E;  2M7L A;  1C7V A;  3CR5 X;  5I8N A;  2O60 A;  2LUC A;  3S0D A;  1QX5 B;  1PK0 D;  2BKI B;  1UHN A;  3BUN B;  2K2A A;  4MZJ A;  2JT8 A;  4UPG A;  1DJX A;  1SCM C;  4IJ7 A;  3D0Y B;  4DRW A;  4ICB A;  2F2O A;  2IS9 A;  2LMU A;  3IQQ A;  2HQW A;  3JVT B;  1K2H A;  2LAN A;  2QEB A;  1NX1 A;  3R1O A;  1FBV A;  4P2Y B;  3V2L A;  3EK7 A;  1Y0V H;  1K94 A;  5B8I B;  4MSP A;  1AJ4 A;  2QAC A;  2R2I A;  1IJ6 A;  1MHO A;  4F0Z B;  3EVU A;  1XK4 C;  3SS4 A;  5KU1 A;  5ER5 A;  1F71 A;  1RJV A;  2L5Y A;  3CTN A;  1JWD A;  3A4U B;  3CZT X;  4YGE B;  5JOL A;  3CR2 A;  1U5I A;  1YRU B;  1CLM A;  1LKJ A;  2SCP A;  4R1E A;  1K93 D;  3D76 A;  1QVI Y;  2WCF A;  4ZCU A;  5J3X A;  1S6C A;  3PJI A;  1A75 B;  2EHB A;  1CLB A;  1XFX O;  2K7O A;  1NX0 A;  2K8M B;  2LAP A;  4HRE E;  2K7C A;  1QIV A;  1KWO B;  1JUO A;  1MWN A;  2HET A;  3DD4 A;  3B88 A;  4I5N B;  3FIA A;  1LS8 A;  2BE6 A;  1XFV O;  3DYE A;  3NSL A;  3O4Y A;  1FW4 A;  1QX2 A;  3AAK A;  3R1V A;  1QLS A;  1OOG A;  1SK6 D;  3VRO A;  3L4L A;  4OVN F;  1DJI A;  3IVT A;  2BE4 A;  2BCB A;  1N0Y A;  3OHM B;  2ZND A;  1UUR A;  1A29 A;  1VRK A;  3FE9 A;  2L98 A;  1QS7 A;  1A03 A;  1ODB A;  2ERB A;  2M7N A;  4PCW A;  4GGF C;  1QJT A;  1OZO A;  2JNF A;  3EKJ A;  1EG4 A;  1YR5 A;  3CZ2 A;  2M49 B;  1KSM A;  3SJS A;  4PE7 A;  1PUL A;  4HRH A;  3O4X A;  1KK7 Z;  1LXF C;  2L4I A;  1CKK A;  3I5F C;  4HSZ A;  3BUX B;  2P71 A;  2L2E A;  5GQQ C;  1H4B A;  2JQ6 A;  5FI7 A;  2Y4Q A;  2K0J A;  2SAS A;  1AK8 A;  4A4C A;  1YRT B;  1BT6 A;  2OS8 C;  2ZRS A;  2H2K A;  4MLW A;  1F4Q A;  3F45 A;  3D78 A;  1JFK A;  3Q8I A;  1ZUZ A;  1UWO A;  2KHN A;  4PHK A;  5DKN A;  1T14 A;  1RFJ A;  1LA3 A;  1CFF A;  2YGU A;  1K95 A;  4NDC A;  4MBE A;  1K96 A;  2FJY A;  1MQ1 A;  5AAN A;  3NGV A;  1QAT A;  5FI2 A;  2E6W A;  1X02 A;  5IBW A;  2F3Y A;  2PSR A;  1L2O C;  3A8R A;  2M1K B;  3TZ1 A;  4ETO A;  1B4C A;  3B87 A;  1UP5 A;  3RZS A;  2L0P A;  2MHH A;  3D74 A;  3E3R A;  4JPZ B;  1M45 A;  1KFX S;  4CPV A;  4QJ5 B;  3CYZ A;  4MN0 A;  4PE0 A;  1CDM A;  1B9A A;  4GAO A;  2LV7 A;  3D73 A;  3GOF A;  2E30 A;  1XK4 A;  1B1G A;  1QV0 A;  1FPW A;  3DZT A;  3EK4 A;  1IGV A;  3JVT C;  5HLV A;  1XFW O;  2KGB C;  2JU0 A;  1JSA A;  1SKT A;  4PHM A;  3DF0 B;  1DJW A;  1IJ5 A;  2I18 A;  3BYA A;  2WCJ A;  1JBA A;  2JOJ A;  1A4P A;  1OMR A;  2CCM A;  4WQ2 A;  1G8I A;  2M3W A;  1B7T Z;  2LCP A;  1CMG A;  3QME A;  2PYQ A;  1Z4H A;  3KO0 A;  2MA2 A;  4WRI A;  2JRF A;  3NHT A;  4C0L A;  1HQV A;  4QJ4 B;  2EC6 B;  1GJY A;  1KQM B;  3NXA A;  1KWO C;  1J7R A;  3NSI A;  4A4B A;  5HKY A;  1MF8 B;  4I5L B;  1ALV A;  1UHK A;  1KCY A;  3CS1 A;  1PVA A;  2LLT A;  4GGF A;  1ZAC A;  4NQG A;  4E68 A;  1CM4 A;  4C0K A;  1MXL C;  2ZFD A;  4JQ0 D;  1B8C A;  2LVI A;  4YGA A;  4XJK B;  2O5G A;  3PM8 A;  1FI5 A;  3VRN A;  2FJU B;  3DVE A;  2M8U A;  1MXE A;  2CTN A;  1CDL A;  5DKR A;  2QPT A;  1KSO A;  4CFR A;  3WXA A;  1XVJ A;  2KAV A;  2L2C A;  1BR1 B;  3AKB A;  3HX4 A;  1MR8 A;  2PAL A;  2Q91 A;  2ZN8 A;  1BOD A;  3R1P A;  3GK2 A;  3JTD B;  1IQ3 A;  1CFD A;  2LLS A;  3UO9 A;  2A4J A;  4KYN A;  2KQY A;  3TDZ A;  1NSH A;  2FCD A;  1CB1 A;  1CTR A;  4FQO A;  1QAS A;  2KI6 C;  3FE8 A;  5I94 A;  2F2P A;  1KFU L;  5HKW A;  1OMD A;  2WOR A;  1SL7 A;  3L4A A;  1NCX A;  1CNP A;  4ORB B;  1GGZ A;  1DJY A;  1CDP A;  4PE1 A;  2LP3 A;  1B8L A;  2KBI A;  2HF5 A;  3GK1 A;  4L9M A;  5I2Q A;  1J7O A;  1F55 A;  3TDI A;  2WCK A;  4WQ3 A;  1NYA A;  4D1E A;  1BOC A;  1NWD A;  1JC2 A;  1W7J B;  1MUX A;  1J1D A;  1XFU O;  1XO5 A;  4U8D A;  1BG1 A;  2LHL A;  2KLE A;  3B6X A;  1IH0 A;  1XFY O;  3FWC A;  1SYM A;  1YX7 A;  2LE9 B;  2LMT A;  2NCP A;  2JWW A;  5AXI A;  1RK9 A;  1UHH A;  1K8U A;  2MRD A;  3D0Y A;  4YI9 A;  1DF0 B;  1LVC D;  5CSF A;  2L4H A;  3D75 A;  4GFT A;  2WC6 A;  1CLL A;  1EL4 A;  2BBM A;  2JT3 A;  1KK7 Y;  3I5H B;  2M29 A;  3TUY B;  2LHI A;  1UUS A;  5K89 A;  1A2X A;  2JZI A;  4GNK B;  3CGA A;  2Y1M A;  1DMO A;  1C7W A;  2MBX A;  3BXK A;  2JNX A;  1EG3 A;  1LA0 A;  1REC A;  5D7F A;  2BNX A;  1TUJ A;  1TOP A;  1OW4 A;  2Q4U A;  3OB2 B;  3UNW A;  2PAS A;  4M2O A;  2ZN9 A;  1TNP A;  2HPS A;  1IIO A;  1BJF A;  4MVF A;  1TUZ A;  1A75 A;  1S3P A;  2JXC A;  3LLE A;  1HT9 A;  2JUL A;  4PDZ A;  2BAP A;  2PMY A;  3R72 A;  3DVM A;  1OOI X;  1DGV A;  1IQ5 A;  4FQT A;  3BOW B;  1G33 A;  2NCO A;  2I94 A;  2LVK A;  5CSI A;  1IWQ A;  1DJG A;  2CBL A;  3B86 A;  4MZL A;  5EL2 A;  4CLN A;  1DJH A;  1SL9 A;  2JTZ A;  3S0B A;  1SR6 B;  3KHE A;  1SBJ A;  1TIZ A;  5DIC A;  3O2P A;  2EC6 C;  4M2P A;  1KQM C;  2KPH A;  3RLZ A;  3VRP A;  1DEL A;  1K9U A;  2F3Z A;  4N1F A;  4YGC B;  1SW8 A;  3VGO A;  2OTG B;  1J7P A;  1W7I B;  3WNX B;  3S0F A;  1FI6 A;  3DVK A;  1GM0 A;  2MLE C;  3IF7 A;  1M31 A;  3FE6 A;  3BUO B;  2WC5 A;  3D10 A;  3HCM A;  1S5G Z;  3S0E A;  2OPO A;  1WRZ A;  4DUQ A;  1PVB A;  4N5X A;  1NPQ A;  1XFZ O;  1JF0 A;  4GBA A;  1NCY A;  1YUR A;  1OZS A;  3BQ3 A;  3SG7 A;  1B7T Y;  2MLF C;  1BR4 B;  1ORG A;  2ZRT A;  3L47 A;  5I2L A;  1L7Z A;  3JTD C;  2LLU A;  1JFJ A;  1NCZ A;  1PRW A;  4PAL A;  1CM1 A;  3SG6 A;  2KAY A;  2WOS A;  3NSO A;  1PSR A;  3TDU A;  3WHU B;  2GV5 A;  1R2U A;  3MSE B;  1OOH A;  3I5G B;  1QWV A;  2KQ6 A;  1KFX L;  1CDN A;  3CWG A;  2K61 A;  2PQL A;  2LVV A;  4OZD A;  5HYD A;  2TN4 A;  3RM1 A;  5KSZ A;  5I2O A;  2BEC A;  1UHI A;  5PAL A;  1OE9 B;  2KI6 D;  2F8P A;  3IQO A;  1XYD A;  5AER A;  1QXP A;  1IKU A;  1AVS A;  1S6I A;  1NUB A;  1TTX A;  2M97 A;  1EXR A;  2GGZ A;  2KSP A;  2QEV A;  3OX6 A;  4HRG A;  4N1G A;  4TNC A;  2NXQ A;  1ZMZ A;  1WDC B;  3PN7 B;  2CT9 A;  1F4O A;  2AUC A;  2DOQ A;  3OX5 A;  3PAT A;  2JC2 A;  4QJ3 B;  4INW A;  2CNP A;  2KLD A;  2LVJ A;  1QV1 A;  3CZ1 A;  3NSK A;  3BJH A;  3K21 A;  4CFQ A;  3WHT B;  2QDI A;  3DF0 A;  3AKA A;  4GGN A;  3DVJ A;  3I5H C;  3TUY C;  1RWY A;  4YI8 A;  1Y6W A;  3N7H A;  1C07 A;  1AP4 A;  1TRF A;  5HL1 A;  2AAO A;  1K9P A;  3VB1 A;  1TN4 A;  5F6T A;  2FCE A;  1IRJ A;  2JPT A;  2K60 A;  1OQP A;  2KYF A;  3EKH A;  1NP8 A;  4OCI A;  1N65 A;  2BL0 B;  5KTY A;  3ZWH A;  1M63 B;  2KYC A;  4DIR A;  1E8A A;  2M1U A;  4M2Q A;  5G08 A;  5D3O A;  4JD9 A;  1QVI Z;  1Q80 A;  1JF2 A;  1U5I B;  2KFH A;  1SSE B;  2NZ0 A;  3SIB A;  4CID A;  1F8H A;  1SR6 C;  3LK1 A;  1FF1 A;  5CPV A;  1YVH A;  3SG4 A;  1QIW A;  2JPO A;  2LM5 A;  3SG5 A;  1DVI A;  1AHR A;  1Z2C B;  4MZK A;  3LCP C;  2H61 C;  1H8B A;  1B8R A;  2D8N A;  4MRX A;  1EJ3 A;  4YBH B;  4YGD B;  1KK8 B;  2OTG C;  2MJW B;  1PAL A;  1DGU A;  3ZNI A;  2K7D A;  1BLQ A;  1C3Y A;  2LC5 A;  3BUM B;  4OKH A;  4DCK A;  1D1O A;  2KAX A;  1BMO A;  2F33 A;  3GK4 X;  4AQJ A;  2BCA A;  1M46 A;  1NX2 A;  1S36 A;  3NHI A;  1RTP 1;  3PSR A;  4OR9 B;  2KI4 B;  3C1V A;  4F7F A;  4AOM A;  1YUS A;  2JTT A;  3H4S E;  5CSJ A;  3B7A A;  2H8V A;  2BBN A;  2KFG A;  3BFA A;  1ZOT B;  2AMI A;  5HLO A;  2WCB A;  3I5I B;  2B1U A;  3SS5 A;  1DTL A;  4PHN A;  1J7Q A;  1SCV A;  1YX8 A;  2K2F A;  3SG2 A;  4PE4 A;  1S26 D;  5FI6 A;  1ZFS A;  3LL8 B;  4XYN A;  1CFP A;  3SIA A;  3I5G C;  1S6J A;  1TCF A;  2LMV A;  3OP0 A;  1SRA A;  2LP2 A;  5BPJ A;  3TS5 B;  1K9K A;  4AQI A;  3DXL A;  1SL8 A;  3AAJ A;  4GPL B;  5JJG A;  1Y1X A;  1DF0 A;  1PSB A;  1XA5 A;  3CZ0 A;  3EG5 B;  3FWB A;  1AUI B;  1S5G Y;  1LIN A;  3LK0 A;  2K7B A;  1R6P A;  2KDH A;  3BFB A;  4YGB B;  1V1G A;  3CLN A;  1M39 A;  4NDD A;  4USL A;  1P28 A;  1WLM A;  3PN7 C;  1WDC C;  1G4Y R;  3D77 A;  1OSA A;  2ZNE A;  1AJ5 A;  1CMF A;  1SCM B;  3KF9 A;  5D69 A;  1SNL A;  2WCE A;  2L51 A;  5FYX A;  2KGR A;  1XFR A;  2L50 A;  3EVV A;  2KNE A;  2I2R E;  2NLN A;  4ORA B;  4ORC B;  3EK8 A;  2L5X B;  3BFH A;  4YRU A;  2VRG A;  1WY9 A;  1QX7 A;  2M0R A;  2PRU A;  4ZCV A;  5TNC A;  5DKQ A;  1C3Z A;  1TNQ A;  2KBM A;  3BOW A;  2BCX A;  1GQM A;  3FS7 A;  3PM2 A;  5AFP A;  2COL B;  1F70 A;  1J1E A;  2BL0 C;  2QEH A;  1OOF A;  2GGM A;  3OGN A;  2ISD A;  4INX A;  4BY5 A;  1DT7 B;  3PLF B;  2JT0 A;  2H61 A;  4JKT A;  4IL1 A;  4C0J A;  1SY9 A;  3DY9 A;  4DS7 A;  4NDB A;  1J55 A;  1WLZ A;  2CXJ A;  3O78 A;  2LUX A;  1KQV A;  2BKH B;  2JXL A;  1S1E A;  2HQ8 A;  4MRY A;  1WRK A;  1DC1 A;  1TNW A;  3CR4 X;  5AEQ A;  1NX3 A;  2P6B B;  3K1E A;  3OBV A;  2KFF A;  2PVB A;  2WCM A;  4I5K A;  2WC8 A;  2Y1N A;  3SS3 A;  2G2B A;  3S0G A;  1N2D A;  4Q04 A;  3SG3 A;  1WRL A;  3PAL A;  1KK8 C;  3OB1 B;  1DJZ A;  5CSN A;  1QTX A;  2M9G A;  1Y1A A;  3QRX A;  4JWQ A;  3PFV A;  3EVR A;  1UHJ A;  2Y5I A;  3ICB A;  2I7A A;  5ER4 X;  1TNX A;  3O6B A;  3KPX A;  2V53 A;  2KI4 C;  2FOT A;  3I5F B;  1F54 A;  4PHJ A;  1TWO A;  3CAB A;  1B47 A;  1YUU A;  3M0W A;  2LNK A;  1DEK A;  3S0A A;  1Y1U A;  1OMV A;  1K90 D;  1W9Z A;  2GTE A;  2KOT A;  1SMG A;  2ZKM X;  2RGI A;  3I5I C;  2OS8 B;  2G9B A;  1EH2 A;  1ALW A;  1YUT A;  1IG5 A;  4FTG A;  1NIW A;  1QLK A;  2P70 A;  2WCH A; 
#chains in the Genus database with same CATH homology
 4I5J A;  1YVL A;  1OOJ A;  1V1F A;  3VRQ A;  1TCO B;  1SPY A;  2WND A;  4GUK A;  3TS5 C;  1GGW A;  1L2O B;  3BUW B;  4MEW A;  1KFU S;  2EGD A;  1BU3 A;  5HKZ A;  4OV2 A;  4BY4 A;  1YTZ C;  2MAZ A;  4XJK A;  3VRR A;  3KEV A;  1CFC A;  1RRO A;  1BF5 A;  4P5O E;  2M7L A;  1C7V A;  3CR5 X;  5I8N A;  2O60 A;  2LUC A;  1QX5 B;  1PK0 D;  2BKI B;  1UHN A;  3BUN B;  2K2A A;  4MZJ A;  2JT8 A;  4UPG A;  1DJX A;  1SCM C;  3D0Y B;  4DRW A;  4ICB A;  2F2O A;  2IS9 A;  2LMU A;  3IQQ A;  2HQW A;  3JVT B;  1K2H A;  2LAN A;  1NX1 A;  1FBV A;  4P2Y B;  3EK7 A;  1Y0V H;  1K94 A;  5B8I B;  4MSP A;  1AJ4 A;  2QAC A;  2R2I A;  1IJ6 A;  1MHO A;  4F0Z B;  3EVU A;  1XK4 C;  5KU1 A;  5ER5 A;  1F71 A;  1RJV A;  3CTN A;  1JWD A;  3A4U B;  3CZT X;  4YGE B;  5JOL A;  3CR2 A;  1U5I A;  1YRU B;  1CLM A;  1LKJ A;  2SCP A;  4R1E A;  1K93 D;  4ZCU A;  1QVI Y;  2WCF A;  5J3X A;  1S6C A;  1A75 B;  2EHB A;  1CLB A;  1XFX O;  2K7O A;  1NX0 A;  2K8M B;  2LAP A;  4HRE E;  2K7C A;  1QIV A;  1KWO B;  1JUO A;  1MWN A;  2HET A;  3DD4 A;  4I5N B;  3FIA A;  2BE6 A;  1XFV O;  3NSL A;  3O4Y A;  1FW4 A;  1QX2 A;  3AAK A;  1QLS A;  3VRO A;  1SK6 D;  4OVN F;  1DJI A;  2BE4 A;  2BCB A;  1N0Y A;  3OHM B;  2ZND A;  1UUR A;  1A29 A;  1VRK A;  2L98 A;  1QS7 A;  1A03 A;  1ODB A;  2M7N A;  4PCW A;  4GGF C;  1QJT A;  1OZO A;  2JNF A;  3EKJ A;  1EG4 A;  1YR5 A;  2M49 B;  1KSM A;  3SJS A;  4PE7 A;  1PUL A;  4HRH A;  1KK7 Z;  1LXF C;  2L4I A;  1CKK A;  3I5F C;  4HSZ A;  3BUX B;  1H4B A;  2L2E A;  5GQQ C;  2JQ6 A;  2Y4Q A;  2K0J A;  2SAS A;  1AK8 A;  4A4C A;  1YRT B;  1BT6 A;  2OS8 C;  2ZRS A;  2H2K A;  4MLW A;  1F4Q A;  3F45 A;  1JFK A;  1ZUZ A;  1UWO A;  2KHN A;  4PHK A;  5DKN A;  1RFJ A;  1LA3 A;  1CFF A;  1K95 A;  4NDC A;  4MBE A;  1K96 A;  1MQ1 A;  5AAN A;  1QAT A;  2E6W A;  1X02 A;  5IBW A;  2F3Y A;  2PSR A;  1L2O C;  3A8R A;  2M1K B;  3TZ1 A;  4ETO A;  1B4C A;  1UP5 A;  2L0P A;  2MHH A;  3E3R A;  4JPZ B;  1M45 A;  1KFX S;  4CPV A;  4QJ5 B;  4MN0 A;  4PE0 A;  1CDM A;  1B9A A;  4GAO A;  2LV7 A;  3GOF A;  2E30 A;  1XK4 A;  1B1G A;  1QV0 A;  1FPW A;  3EK4 A;  1IGV A;  3JVT C;  5HLV A;  1XFW O;  2KGB C;  2JU0 A;  1JSA A;  1SKT A;  4PHM A;  3DF0 B;  1DJW A;  1IJ5 A;  2I18 A;  3BYA A;  1JBA A;  2JOJ A;  1A4P A;  1OMR A;  2CCM A;  4WQ2 A;  1G8I A;  2M3W A;  1B7T Z;  2LCP A;  1CMG A;  3KO0 A;  2MA2 A;  4WRI A;  2JRF A;  4C0L A;  1HQV A;  4QJ4 B;  2EC6 B;  1GJY A;  1KQM B;  3NXA A;  1KWO C;  1J7R A;  3NSI A;  4A4B A;  5HKY A;  1MF8 B;  4I5L B;  1ALV A;  1UHK A;  1KCY A;  3CS1 A;  1PVA A;  2LLT A;  4GGF A;  1ZAC A;  4NQG A;  4E68 A;  1CM4 A;  4C0K A;  1MXL C;  2ZFD A;  4JQ0 D;  1B8C A;  2LVI A;  4YGA A;  4XJK B;  2O5G A;  3PM8 A;  1FI5 A;  3VRN A;  2FJU B;  3DVE A;  2M8U A;  1MXE A;  2CTN A;  1CDL A;  5DKR A;  2QPT A;  1KSO A;  4CFR A;  3WXA A;  1XVJ A;  2KAV A;  1BR1 B;  3AKB A;  3HX4 A;  1MR8 A;  2PAL A;  2Q91 A;  2ZN8 A;  1BOD A;  3GK2 A;  3JTD B;  1IQ3 A;  1CFD A;  2LLS A;  2A4J A;  2KQY A;  3TDZ A;  1NSH A;  2FCD A;  1CB1 A;  1CTR A;  4FQO A;  1QAS A;  2KI6 C;  2F2P A;  1KFU L;  5HKW A;  1OMD A;  2WOR A;  1SL7 A;  1NCX A;  1CNP A;  4ORB B;  1GGZ A;  1DJY A;  1CDP A;  4PE1 A;  2LP3 A;  1B8L A;  2KBI A;  2HF5 A;  3GK1 A;  4L9M A;  5I2Q A;  1J7O A;  1F55 A;  3TDI A;  4WQ3 A;  1NYA A;  4D1E A;  1BOC A;  1NWD A;  1JC2 A;  1W7J B;  1MUX A;  1J1D A;  1XFU O;  1XO5 A;  4U8D A;  1BG1 A;  2LHL A;  1IH0 A;  1XFY O;  3FWC A;  1SYM A;  1YX7 A;  2LE9 B;  2LMT A;  2NCP A;  2JWW A;  5AXI A;  1RK9 A;  1UHH A;  1K8U A;  2MRD A;  3D0Y A;  4YI9 A;  1DF0 B;  1LVC D;  5CSF A;  2L4H A;  4GFT A;  1CLL A;  1EL4 A;  2BBM A;  2JT3 A;  1KK7 Y;  3I5H B;  2M29 A;  3TUY B;  2LHI A;  1UUS A;  5K89 A;  1A2X A;  2JZI A;  4GNK B;  3CGA A;  2Y1M A;  1DMO A;  1C7W A;  2MBX A;  3BXK A;  2JNX A;  1EG3 A;  1LA0 A;  1REC A;  5D7F A;  2Q4U A;  1TOP A;  3OB2 B;  2PAS A;  4M2O A;  2ZN9 A;  1TNP A;  2HPS A;  1BJF A;  4MVF A;  1A75 A;  1S3P A;  2JXC A;  3LLE A;  1HT9 A;  2JUL A;  4PDZ A;  2PMY A;  3DVM A;  1DGV A;  1IQ5 A;  3BOW B;  1G33 A;  2NCO A;  2I94 A;  2LVK A;  5CSI A;  1IWQ A;  1DJG A;  2CBL A;  4MZL A;  4CLN A;  1DJH A;  1SL9 A;  2JTZ A;  1SR6 B;  3KHE A;  1SBJ A;  1TIZ A;  3O2P A;  2EC6 C;  4M2P A;  1KQM C;  3RLZ A;  3VRP A;  1K9U A;  2F3Z A;  4N1F A;  4YGC B;  1SW8 A;  3VGO A;  2OTG B;  1J7P A;  1W7I B;  3WNX B;  1FI6 A;  3DVK A;  2MLE C;  3IF7 A;  1M31 A;  3BUO B;  3D10 A;  3HCM A;  1S5G Z;  2OPO A;  1WRZ A;  4DUQ A;  1PVB A;  4N5X A;  1NPQ A;  1XFZ O;  1JF0 A;  4GBA A;  1NCY A;  1YUR A;  1OZS A;  3BQ3 A;  3SG7 A;  1B7T Y;  2MLF C;  1BR4 B;  2ZRT A;  5I2L A;  1L7Z A;  3JTD C;  2LLU A;  1JFJ A;  1NCZ A;  1PRW A;  4PAL A;  1CM1 A;  3SG6 A;  2KAY A;  2WOS A;  3NSO A;  1PSR A;  3TDU A;  3WHU B;  2GV5 A;  1R2U A;  3MSE B;  3I5G B;  2KQ6 A;  1KFX L;  1CDN A;  3CWG A;  2K61 A;  2LVV A;  5HYD A;  2TN4 A;  3RM1 A;  5KSZ A;  5I2O A;  2BEC A;  1UHI A;  5PAL A;  1OE9 B;  2KI6 D;  2F8P A;  3IQO A;  1XYD A;  5AER A;  1QXP A;  1IKU A;  1AVS A;  1S6I A;  1NUB A;  1TTX A;  2M97 A;  1EXR A;  2GGZ A;  2KSP A;  3OX6 A;  4HRG A;  4N1G A;  4TNC A;  1F8H A;  2NXQ A;  1ZMZ A;  1WDC B;  3PN7 B;  2CT9 A;  1F4O A;  2AUC A;  2DOQ A;  3OX5 A;  3PAT A;  2JC2 A;  4QJ3 B;  2CNP A;  2LVJ A;  1QV1 A;  3NSK A;  3K21 A;  4CFQ A;  3WHT B;  3DF0 A;  4GGN A;  3AKA A;  3DVJ A;  3I5H C;  3TUY C;  1RWY A;  4YI8 A;  1Y6W A;  1C07 A;  1AP4 A;  1TRF A;  2AAO A;  1K9P A;  1TN4 A;  5F6T A;  2FCE A;  1IRJ A;  2JPT A;  2KYF A;  1OQP A;  3EKH A;  1NP8 A;  4OCI A;  1N65 A;  2BL0 B;  5KTY A;  3ZWH A;  1M63 B;  2KYC A;  4DIR A;  1E8A A;  2M1U A;  4M2Q A;  5G08 A;  1QVI Z;  1Q80 A;  1JF2 A;  1U5I B;  2KFH A;  2NZ0 A;  3SIB A;  4CID A;  1SR6 C;  3LK1 A;  1FF1 A;  5CPV A;  1YVH A;  3SG4 A;  1QIW A;  2LM5 A;  3SG5 A;  1DVI A;  1AHR A;  4MZK A;  3LCP C;  2H61 C;  1H8B A;  1B8R A;  2D8N A;  4MRX A;  1EJ3 A;  4YBH B;  4YGD B;  1KK8 B;  2OTG C;  2MJW B;  1PAL A;  1DGU A;  3ZNI A;  2K7D A;  1BLQ A;  2LC5 A;  3BUM B;  4OKH A;  4DCK A;  1D1O A;  2KAX A;  1BMO A;  2F33 A;  3GK4 X;  4AQJ A;  2BCA A;  1M46 A;  1NX2 A;  1S36 A;  1RTP 1;  3PSR A;  4OR9 B;  2KI4 B;  3C1V A;  4AOM A;  1YUS A;  2JTT A;  3H4S E;  5CSJ A;  2BBN A;  2KFG A;  5HLO A;  1ZOT B;  2AMI A;  2WCB A;  3I5I B;  2B1U A;  1DTL A;  4PHN A;  1J7Q A;  1SCV A;  1YX8 A;  2K2F A;  3SG2 A;  4PE4 A;  1S26 D;  1ZFS A;  3LL8 B;  4XYN A;  1CFP A;  3SIA A;  3I5G C;  1S6J A;  1TCF A;  2LMV A;  3OP0 A;  1SRA A;  2LP2 A;  5BPJ A;  3TS5 B;  1K9K A;  4AQI A;  1SL8 A;  3AAJ A;  4GPL B;  5JJG A;  1Y1X A;  1DF0 A;  1PSB A;  1XA5 A;  3FWB A;  1AUI B;  1S5G Y;  1LIN A;  3LK0 A;  2K7B A;  1R6P A;  2KDH A;  4YGB B;  1V1G A;  3CLN A;  1M39 A;  4NDD A;  4USL A;  1WLM A;  3PN7 C;  1WDC C;  1G4Y R;  1OSA A;  2ZNE A;  1AJ5 A;  1CMF A;  1SCM B;  3KF9 A;  5D69 A;  1SNL A;  2WCE A;  2L51 A;  5FYX A;  2KGR A;  2L50 A;  3EVV A;  2KNE A;  2I2R E;  2NLN A;  4ORA B;  4ORC B;  3EK8 A;  2L5X B;  4YRU A;  2VRG A;  1WY9 A;  1QX7 A;  2M0R A;  2PRU A;  4ZCV A;  5TNC A;  5DKQ A;  1TNQ A;  2KBM A;  3BOW A;  2BCX A;  1GQM A;  3FS7 A;  5AFP A;  2COL B;  1F70 A;  1J1E A;  2BL0 C;  2GGM A;  2ISD A;  1DT7 B;  4BY5 A;  3PLF B;  2JT0 A;  2H61 A;  4C0J A;  4IL1 A;  1SY9 A;  4DS7 A;  4NDB A;  1J55 A;  1WLZ A;  2CXJ A;  3O78 A;  2LUX A;  1KQV A;  2BKH B;  2JXL A;  1S1E A;  2HQ8 A;  4MRY A;  1WRK A;  1TNW A;  3CR4 X;  5AEQ A;  1NX3 A;  2P6B B;  2KFF A;  2PVB A;  4I5K A;  2WC8 A;  2Y1N A;  2G2B A;  1N2D A;  4Q04 A;  3SG3 A;  1WRL A;  3PAL A;  1KK8 C;  3OB1 B;  1DJZ A;  5CSN A;  1QTX A;  2M9G A;  1Y1A A;  3QRX A;  3PFV A;  3EVR A;  1UHJ A;  2Y5I A;  3ICB A;  2I7A A;  5ER4 X;  1TNX A;  3O6B A;  3KPX A;  2V53 A;  2KI4 C;  2FOT A;  3I5F B;  1F54 A;  4PHJ A;  1B47 A;  1YUU A;  3M0W A;  2LNK A;  1Y1U A;  1OMV A;  1K90 D;  2KOT A;  1SMG A;  2ZKM X;  2RGI A;  3I5I C;  2OS8 B;  2G9B A;  1EH2 A;  1ALW A;  1YUT A;  1IG5 A;  4FTG A;  1NIW A;  1QLK A;  4JWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...