1N65A

Family of nmr solution structures of ca ce calbindin d9k in denaturating conditions
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monitoring the Early Steps of Unfolding of Dicalcium and Mono-Ce(3+)-Substituted Forms of P43M Calbindin D(9k).
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Vitamin D-dependent calcium-binding protein, intestinal
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n65A00
4N5XA 3CWGA 1DF0B 1L2OC 1NPQA 1YTZC 1J7RA 1XFZO 1DTLA 5HKYA 2M97A 3FIAA 4YGEB 3KHEA 2ZNEA 1S5GZ 1SMGA 1QV0A 1IH0A 4MEWA 1NCYA 1YUTA 1PK0D 3D0YA 2JTTA 1X02A 2KI4B 3EVRA 1RECA 4MZLA 4C0JA 4GBAA 4CFQA 2LHIA 3WHUB 2L98A 3ZWHA 1CLLA 5GQQC 2Q91A 2NLNA 1NIWA 4Q04A 1KFXS 1DJGA 1FW4A 1MUXA 1PSBA 2BKIB 3D10A 4UPGA 1PRWA 1QS7A 1AUIB 1W7JB 1WRKA 3BOWA 1ZACA 1MXEA 1M45A 3GK1A 3VGOA 1JBAA 4PDZA 2FCEA 1OSAA 3NSIA 2LANA 2KFFA 3I5FC 1Y1XA 2HETA 2FOTA 2FJUB 2G2BA 2B1UA 3IF7A 1QX5B 2LV7A 1XA5A 4MRYA 5JOLA 5HKWA 1JFJA 1TTXA 2BBNA 3I5GC 1J7OA 2CNPA 3KPXA 1GJYA 2Y1NA 3LLEA 1UHHA 4BY5A 3ICBA 3PN7C 1DMOA 1EL4A 1YX8A 2WCBA 3VRPA 2QACA 2BKHB 4MRXA 5CSFA 1XVJA 2A4JA 1FF1A 1YUSA 1B7TY 2ZNDA 1SL8A 3DF0A 4JPZB 1L7ZA 2F3ZA 2Y1MA 3PFVA 1Y1AA 1UURA 2EC6C 2BL0B 3JVTB 5I2QA 2K2AA 2LMUA 1AJ4A 2L4IA 2BBMA 1MHOA 1N2DA 4PALA 1LINA 1CLBA 2O5GA 3OX5A 3FWBA 3CR2A 3LK1A 3JTDB 2LUCA 1PALA 1LA3A 4HRHA 1TOPA 3E3RA 2ZKMX 2GGZA 1B8LA 2KBMA 1RK9A 4AQJA 3O2PA 1S5GY 4PHMA 4MLWA 1KK7Y 4HRGA 4AOMA 2H61C 4CLNA 2BECA 4N1FA 3NSKA 4NQGA 3SG2A 1G8IA 4PHNA 4NDBA 1AHRA 3EVUA 3BUXB 4M2PA 1C7VA 4N1GA 4P5OE 3VRNA 1WDCC 3O6BA 3K21A 4JQ0D 2OS8C 5I2LA 1CNPA 2F33A 5CPVA 3SG4A 1SRAA 1NYAA 2M7NA 1DT7B 4MZKA 4CPVA 3PSRA 1R2UA 4I5KA 1JWDA 1QLKA 2EGDA 2JC2A 2JNXA 2SCPA 3I5IB 2KQ6A 3RLZA 3HCMA 1YR5A 1W7IB 1Y1UA 1BR4B 1QIVA 4F0ZB 3JTDC 1QLSA 1A4PA 1KSOA 2CCMA 3BQ3A 1SKTA 4GGFA 1SL7A 1XFUO 2JWWA 2NCOA 2F3YA 2LUXA 1WRLA 2M8UA 1CFDA 2JZIA 3TDUA 1F54A 3EVVA 2LHLA 1JSAA 2JTZA 1NX2A 1KQVA 1K9KA 2PALA 4JWQA 5IBWA 1G33A 4IL1A 1OMVA 2LVJA 1BG1A 1WDCB 2KI6D 3OHMB 2ZFDA 2FCDA 3I5HB 3I5HC 1AK8A 2I2RE 1M46A 1WY9A 1B47A 1TNQA 1MWNA 4C0KA 1BJFA 4NDDA 1GQMA 1UHNA 2Y5IA 1CTRA 2OTGB 1WRZA 2JQ6A 1YVLA 4OV2A 1BR1B 4QJ5B 1U5IA 1RROA 2WOSA 2ISDA 4MBEA 2OPOA 2ZN8A 4WQ3A 5F6TA 1HT9A 1FPWA 4HSZA 1NCXA 4YGDB 2PASA 3RM1A 2L5XB 3PM8A 1S6CA 1D1OA 1QV1A 2WORA 2K7DA 2BL0C 3JVTC 4PE1A 1S3PA 4XYNA 5J3XA 4DCKA 1DGUA 1BF5A 5AXIA 1CMFA 2H2KA 4OCIA 1KCYA 2CXJA 1J1DA 2JT8A 4DUQA 2MAZA 5AEQA 2I18A 3A4UB 1OZSA 2KNEA 5CSNA 1OMRA 3CGAA 3AKAA 1NUBA 4NDCA 1Y6WA 1BODA 2K7OA 2E6WA 2MA2A 4GGFC 2L2EA 1KFUL 1IWQA 1EG3A 2LAPA 2LP3A 3I5GB 1SCMB 3OX6A 3AAJA 1BT6A 1QVIZ 3CLNA 1J55A 3DVEA 3VROA 1H8BA 2EHBA 3EK4A 1TCOB 4R1EA 3SIBA 1QX7A 2K2FA 4FQOA 3TZ1A 5I2OA 3CZTX 3SG5A 4QJ4B 1KK8B 4ZCVA 3OB1B 3GOFA 3GK4X 1QIWA 1PSRA 1QX2A 1OE9B 2JPTA 2KQYA 4YRUA 1SY9A 3DVMA 2HQWA 4A4BA 3H4SE 1B7TZ 1KWOC 5B8IB 2LVKA 2JRFA 1IJ6A 1PULA 1ZFSA 4ORCB 1BOCA 1SYMA 2D8NA 1K96A 3I5FB 1K93D 1NX0A 1SBJA 2M49B 1NSHA 5CSIA 4CIDA 1CM4A 2WC8A 1FBVA 1CDLA 1G4YR 1JF0A 2L4HA 1SCMC 1U5IB 2Y4QA 5BPJA 2AMIA 2ZRSA 1K95A 2Q4UA 1DF0A 1XFWO 2L50A 1TCFA 1CDMA 1YX7A 1J7PA 1K90D 2LLTA 1KQMC 1DJYA 2M0RA 4AQIA 3OP0A 2ZRTA 4MVFA 1TIZA 2LLSA 1DGVA 2F2PA 2LNKA 4YGCB 3FS7A 2H61A 3O78A 2MJWB 1BMOA 2WCEA 1CM1A 1R6PA 1S36A 3DVKA 4PE7A 2LMVA 5HYDA 1GGWA 1K8UA 5DKRA 4HREE 1K2HA 1IKUA 2KYFA 1SNLA 4P2YB 3IQOA 2G9BA 1CMGA 1OMDA 1CFPA 2LVVA 1SPYA 2CT9A 3D0YB 1SW8A 1JF2A 1FI5A 1JFKA 1LVCD 1F8HA 1IQ3A 3FWCA 1ZMZA 5AFPA 2KBIA 2LE9B 2HPSA 1EG4A 4YGBB 1CDNA 2KI4C 3AKBA 3PALA 1RTP1 1SR6B 2K61A 1J1EA 1SR6C 1SK6D 4YI8A 1B9AA 1EXRA 1KQMB 2BCAA 2M29A 1B8CA 3DF0B 1C07A 1TRFA 1QATA 5HLOA 3TUYC 1JC2A 2L0PA 5ER4X 1NP8A 1XK4A 2HF5A 4ZCUA 1IJ5A 1OOJA 1ZUZA 2PVBA 1IGVA 1K94A 1F70A 1N0YA 1K9PA 1HQVA 2E30A 2LCPA 2F8PA 3O4YA 1A2XA 1UUSA 3IQQA 3WHTB 2JT0A 3LL8B 1UP5A 4PE4A 1NX1A 1CDPA 3M0WA 4GPLB 3SG3A 2V53A 2VRGA 4PCWA 1UWOA 1KFUS 1KFXL 1RJVA 3BOWB 1DJZA 1GGZA 1CLMA 3SG6A 2JOJA 4I5LB 4A4CA 1QTXA 1TNXA 1B1GA 1CFFA 2COLB 2LC5A 3CR4X 1UHJA 5HKZA 1XK4C 4GFTA 1KK8C 4YI9A 1M63B 1CB1A 2MLEC 4MZJA 4C0LA 4PHKA 4ETOA 1IRJA 5DKQA 1YUUA 1QVIY 1KWOB 2I94A 3AAKA 1TN4A 3KO0A 2KSPA 1DJIA 2K7BA 1XYDA 1QJTA 4OVNF 1DVIA 2RGIA 4E68A 4TNCA 3CR5X 3WXAA 2JT3A 1YRTB 2M9GA 3CS1A 1XFVO 1LA0A 4PE0A 4PHJA 2GV5A 2MLFC 4OR9B 1ODBA 1ALVA 5CSJA 5KTYA 2JXCA 1JUOA 1RFJA 2AUCA 1NCZA 1EJ3A 1E8AA 3VRQA 3EK7A 3EK8A 2KGBC 1AJ5A 1F71A 4M2QA 1OZOA 2WNDA 5D7FA 4D1EA 4MN0A 1UHKA 5TNCA 2MBXA 1K9UA 1A29A 1V1GA 1SL9A 5DKNA 2KGRA 2QPTA 5ER5A 3PATA 4DS7A 1DJXA 3TDIA 1LXFC 1CFCA 2KAXA 2KOTA 1YURA 3BUNB 2MHHA 3EKJA 2SASA 2MRDA 3I5IC 4GGNA 1AVSA 3WNXB 2LLUA 4YGAA 1YRUB 1DJWA 1TNWA 3NSLA 2AAOA 2DOQA 3KF9A 5KU1A 1WLMA 1MR8A 2M1KB 3BYAA 1S26D 1SCVA 5JJGA 2I7AA 4MSPA 1F4OA 2JXLA 4DIRA 4QJ3B 3GK2A 2KYCA 1XO5A 3A8RA 4DRWA 3MSEB 2KI6C 3BUMB 3BUOB 3BXKA 4BY4A 1XFXO 1RWYA 4I5JA 3SJSA 1Y0VH 3NXAA 4WRIA 4U8DA 5PALA 1A03A 1QXPA 2K0JA 2OS8B 3KEVA 4ORBB 1MQ1A 2F2OA 1Q80A 1L2OB 1PVBA 3NSOA 4OKHA 4XJKB 2KFGA 2TN4A 2M7LA 2KDHA 3F45A 2KHNA 3CTNA 4M2OA 1A75B 1F4QA 2HQ8A 2LP2A 2O60A 1BLQA 1CKKA 5D69A 1B8RA 1KSMA 1DJHA 4ORAB 1S6IA 3DD4A 1M31A 3OB2B 4GUKA 1M39A 5AANA 3LK0A 2BCBA 1IQ5A 2CTNA 5HLVA 2JULA 2LVIA 3TS5C 2IS9A 1AP4A 2KAVA 4WQ2A 1WLZA 5I8NA 2ZN9A 4CFRA 3LCPC 2NCPA 1MF8B 1QASA 3TUYB 1OQPA 5K89A 1V1FA 1LKJA 2GGMA 2LM5A 2K8MB 5KSZA 2EC6B 1KK7Z 1VRKA 2BE4A 2PSRA 4I5NB 4ICBA 1ZOTB 1N65A 3SIAA 1B4CA 2M3WA 2M1UA 1YVHA 2P6BB 4GAOA 2WCFA 2OTGC 1FI6A 1MXLC 1C7WA 1IG5A 3ZNIA 1ALWA 4USLA 3HX4A 5AERA 3PLFB 3PN7B 1S6JA 5FYXA 1H4BA 2CBLA 2JNFA 1NWDA 2NXQA 1A75A 2BCXA 4GNKB 5G08A 4FTGA 2NZ0A 2BE6A 3EKHA 2JU0A 2KAYA 2KFHA 3QRXA 3TDZA 1J7QA 1BU3A 1TNPA 3VRRA 4XJKA 2K7CA 2PMYA 4L9MA 1EH2A 1PVAA 1UHIA 2LMTA 3DVJA 1S1EA 3TS5B 2R2IA 2PRUA 1NX3A 3C1VA 1XFYO 3BUWB 3SG7A 1F55A 4YBHB 2L51A
chains in the Genus database with same CATH superfamily
4N5XA 3BFBA 3CWGA 1DF0B 1L2OC 1NPQA 1YTZC 1J7RA 1XFZO 1DTLA 5HKYA 2M97A 3FIAA 3SS5A 4YGEB 3KHEA 2ZNEA 1S5GZ 1SMGA 1QV0A 1IH0A 4MEWA 1NCYA 1YUTA 1PK0D 3D0YA 1OOIX 2JTTA 1X02A 2KI4B 2P71A 3EVRA 3D73A 1RECA 4MZLA 4C0JA 4GBAA 4CFQA 2LHIA 3WHUB 2L98A 3ZWHA 1CLLA 5GQQC 2Q91A 2NLNA 4IJ7A 1NIWA 4Q04A 1KFXS 1DJGA 1FW4A 1MUXA 1PSBA 2BKIB 2WCKA 3D10A 4UPGA 1PRWA 1QS7A 1AUIB 1W7JB 1WRKA 3BOWA 1ZACA 1MXEA 1M45A 3GK1A 3VGOA 2L2CA 1JBAA 4PDZA 2FCEA 1OSAA 3NSIA 2LANA 2KFFA 3I5FC 1Y1XA 2HETA 2FOTA 2FJUB 2G2BA 2B1UA 3IF7A 1QX5B 2LV7A 1XA5A 3PJIA 4MRYA 5JOLA 5HKWA 3S0EA 1TTXA 2BBNA 3I5GC 1J7OA 2CNPA 1JFJA 3KPXA 1GJYA 3D78A 2Y1NA 3LLEA 1UHHA 2H8VA 3ICBA 4BY5A 3PN7C 1DMOA 1EL4A 1YX8A 2WCBA 3VRPA 2QACA 2BKHB 4MRXA 3CZ0A 5CSFA 1XVJA 2A4JA 1FF1A 1P28A 1B7TY 1YUSA 2ZNDA 1SL8A 3DF0A 4JPZB 1L7ZA 2F3ZA 2Y1MA 3PFVA 1Y1AA 1UURA 2EC6C 4INXA 2BL0B 3JVTB 5I2QA 2K2AA 2LMUA 1AJ4A 2L4IA 2BBMA 3NGVA 1MHOA 3BFHA 3B7AA 1N2DA 4PALA 1LINA 1CLBA 2O5GA 3OX5A 3FWBA 3CR2A 3LK1A 3JTDB 2LUCA 1PALA 1DC1A 1LA3A 4HRHA 1TOPA 3E3RA 2ZKMX 2GGZA 1B8LA 2KBMA 1RK9A 4AQJA 3O2PA 1S5GY 4PHMA 2WC5A 4MLWA 1KK7Y 4HRGA 4AOMA 2H61C 4CLNA 2BECA 4N1FA 3NSKA 4NQGA 3SG2A 1OOGA 1G8IA 4PHNA 3NHIA 1AHRA 3Q8IA 3EVUA 4NDBA 3BUXB 4M2PA 1C7VA 4N1GA 4P5OE 3VRNA 1GM0A 2WCHA 1WDCC 3O6BA 3K21A 4JQ0D 2OS8C 5I2LA 1CNPA 2F33A 5CPVA 3SG4A 1SRAA 2KLDA 1NYAA 3B86A 2M7NA 1DT7B 4MZKA 4CPVA 3PSRA 1R2UA 3UNWA 4I5KA 1JWDA 1QLKA 2EGDA 2JC2A 2JNXA 2SCPA 3I5IB 2KQ6A 3RLZA 3HCMA 1YR5A 1W7IB 1Y1UA 1W9ZA 1BR4B 2QDIA 1QIVA 4F0ZB 3JTDC 3B6XA 1QLSA 1A4PA 1KSOA 2CCMA 3BQ3A 1SKTA 4GGFA 1SL7A 1XFUO 3S0DA 3S0BA 2JWWA 2NCOA 2F3YA 3DZTA 2LUXA 1WRLA 2M8UA 1CFDA 2JZIA 3TDUA 1TWOA 3EVVA 1F54A 3S0FA 1OOFA 2LHLA 3B87A 1JSAA 2JTZA 1NX2A 1KQVA 1K9KA 2PALA 4JWQA 5IBWA 1G33A 4FQTA 1DEKA 2WCLA 1OMVA 2LVJA 4IL1A 1BG1A 1WDCB 2KI6D 3OHMB 2ZFDA 2FCDA 3I5HB 3I5HC 1AK8A 2I2RE 1M46A 1WY9A 1B47A 1TNQA 5DICA 1MWNA 4C0KA 1BJFA 3CZ2A 4NDDA 1GQMA 1UHNA 2Y5IA 1CTRA 2OTGB 1WRZA 2JQ6A 1YVLA 4OV2A 1BR1B 4QJ5B 2ERBA 1U5IA 1RROA 3OGNA 2WOSA 2ISDA 4MBEA 2OPOA 2ZN8A 4WQ3A 5F6TA 1HT9A 1FPWA 4HSZA 1NCXA 4YGDB 1GGWA 2PASA 3DYEA 3RM1A 1C3YA 2L5XB 3PM8A 1S6CA 1D1OA 1QV1A 2WORA 2K7DA 2BL0C 3JVTC 4PE1A 1T14A 1S3PA 4XYNA 5J3XA 4DCKA 1DGUA 1BF5A 5AXIA 1ORGA 1SSEB 1CMFA 2H2KA 4OCIA 1KCYA 2CXJA 1J1DA 1DELA 2JT8A 4DUQA 2MAZA 5AEQA 2I18A 3A4UB 1OZSA 2KNEA 5CSNA 1OMRA 3CGAA 3AKAA 1NUBA 2BAPA 4NDCA 1Y6WA 3D76A 2K7OA 2E6WA 1BODA 2MA2A 4GGFC 2L2EA 1KFUL 1IWQA 1EG3A 2LAPA 2LP3A 3I5GB 3R72A 1Z4HA 1SCMB 3OX6A 3AAJA 1BT6A 1QVIZ 1TUJA 1J55A 3CLNA 3DVEA 3VROA 1H8BA 2EHBA 3EK4A 1TCOB 4R1EA 3SIBA 1QX7A 2K2FA 4FQOA 3TZ1A 5I2OA 3CZTX 3SG5A 3N7HA 4QJ4B 1KK8B 4ZCVA 3OB1B 3GOFA 3GK4X 1QIWA 1PSRA 3BFAA 1QX2A 1OE9B 2JPTA 2KQYA 2QEBA 4YRUA 1SY9A 3DVMA 2HQWA 4A4BA 3H4SE 1B7TZ 1KWOC 1C3ZA 2LVKA 3OBVA 5B8IB 3S0GA 2JRFA 1IJ6A 1PULA 1ZFSA 4ORCB 1BOCA 2QEOA 1SYMA 3D74A 2D8NA 4PT1A 1K96A 1TUZA 3I5FB 1K93D 1NX0A 1SBJA 2M49B 1Z2CB 1NSHA 5CSIA 4CIDA 1CM4A 2WC8A 1FBVA 1CDLA 1G4YR 1JF0A 2L4HA 1SCMC 1U5IB 2Y4QA 5BPJA 2AMIA 2ZRSA 1K95A 2Q4UA 1DF0A 1XFWO 2L50A 1TCFA 1CDMA 3RZSA 2KLEA 1YX7A 4KYNA 1J7PA 1K90D 2LLTA 1KQMC 1DJYA 2M0RA 4AQIA 3OP0A 2ZRTA 4MVFA 1TIZA 2LLSA 1DGVA 2F2PA 2LNKA 3SS3A 4YGCB 3FS7A 2H61A 3O78A 5FI2A 2MJWB 1BMOA 2WCEA 1CM1A 1R6PA 1S36A 3DVKA 4PE7A 2LMVA 5HYDA 3R1PA 2WCJA 1K8UA 5DKRA 4HREE 1K2HA 2K60A 2KYFA 1IKUA 1SNLA 4P2YB 3IQOA 2G9BA 1CMGA 1OMDA 2QEVA 1CFPA 2LVVA 1SPYA 2CT9A 3D0YB 1SW8A 1JF2A 1FI5A 1JFKA 1LVCD 1F8HA 1IQ3A 3FWCA 1ZMZA 5AFPA 2KBIA 2LE9B 2HPSA 1EG4A 4YGBB 1CDNA 2KI4C 3AKBA 3PALA 1RTP1 1SR6B 2K61A 1QWVA 1J1EA 1SR6C 1SK6D 4YI8A 1B9AA 1EXRA 1KQMB 2BCAA 2M29A 1B8CA 3DF0B 1C07A 1TRFA 1QATA 5HLOA 1LS8A 3TUYC 1JC2A 2L0PA 5ER4X 2QEHA 1NP8A 1XK4A 2HF5A 2GTEA 3FE6A 1IJ5A 1OOJA 1ZUZA 4ZCUA 2PVBA 5I94A 1IGVA 1K94A 1F70A 1N0YA 1K9PA 1HQVA 2E30A 2LCPA 2F8PA 2KPHA 1A2XA 1UUSA 3IQQA 3NHTA 3O4YA 3WHTB 2JT0A 3D75A 3LL8B 1UP5A 4PE4A 1NX1A 1CDPA 3M0WA 4GPLB 3SG3A 2V53A 2VRGA 4PCWA 1UWOA 1KFUS 1KFXL 1RJVA 3BOWB 4F7FA 1DJZA 1GGZA 1CLMA 3SG6A 2JOJA 4I5LB 4A4CA 1QTXA 1TNXA 1B1GA 1CFFA 2COLB 2LC5A 3CR4X 1UHJA 5HKZA 3IVTA 1XK4C 4GFTA 1KK8C 3VB1A 4OZDA 4YI9A 1M63B 3QMEA 1CB1A 2MLEC 4MZJA 4C0LA 4PHKA 4ETOA 1IRJA 5DKQA 1YUUA 1QVIY 1KWOB 2I94A 3AAKA 1TN4A 3KO0A 2KSPA 1DJIA 1XFRA 2K7BA 1XYDA 2WC6A 1QJTA 4OVNF 1DVIA 2RGIA 3UO9A 4E68A 4TNCA 3CR5X 4INWA 3FE8A 3WXAA 2JT3A 1YRTB 2M9GA 3CS1A 1XFVO 1LA0A 4PE0A 4PHJA 2GV5A 2MLFC 4OR9B 1ODBA 1ALVA 5CSJA 3V2LA 5KTYA 2JXCA 1JUOA 1RFJA 2AUCA 1NCZA 1EJ3A 1E8AA 3VRQA 3EK7A 1OW4A 3EK8A 2KGBC 3SS4A 5D3OA 1AJ5A 1F71A 4M2QA 1DQEA 2JPOA 1OZOA 2WNDA 5D7FA 3K1EA 4D1EA 4MN0A 1UHKA 5TNCA 2MBXA 1K9UA 3PM2A 1A29A 1V1GA 1SL9A 5DKNA 2KGRA 2QPTA 5ER5A 3PATA 4DS7A 1DJXA 3TDIA 1LXFC 3L4LA 1CFCA 2KAXA 2KOTA 3D77A 1YURA 3BUNB 2MHHA 3EKJA 2SASA 2MRDA 3I5IC 4GGNA 1AVSA 3WNXB 1OOHA 2LLUA 4YGAA 1YRUB 1DJWA 1TNWA 3NSLA 2P70A 2AAOA 2DOQA 3KF9A 5KU1A 1WLMA 1MR8A 2M1KB 3BYAA 1S26D 3EG5B 1SCVA 5JJGA 2I7AA 4MSPA 1F4OA 2JXLA 4DIRA 4QJ3B 3GK2A 2KYCA 1XO5A 3A8RA 4DRWA 3MSEB 2KI6C 3BUMB 3BUOB 3BXKA 4BY4A 1XFXO 1RWYA 4I5JA 3SJSA 5FI6A 4JKTA 3R1VA 1Y0VH 3BJHA 3NXAA 4WRIA 4U8DA 5PALA 1A03A 1QXPA 2K0JA 2OS8B 3KEVA 4ORBB 1MQ1A 2F2OA 1Q80A 2YGUA 1L2OB 1PVBA 3NSOA 4OKHA 4XJKB 1IIOA 2KFGA 2L5YA 2TN4A 2M7LA 2KDHA 3F45A 2KHNA 3CTNA 4M2OA 1A75B 1F4QA 2BNXA 2HQ8A 2LP2A 2O60A 3O4XA 1BLQA 5D69A 1CKKA 1B8RA 1KSMA 1DJHA 4ORAB 1S6IA 3DD4A 5FI7A 1M31A 3OB2B 4GUKA 1M39A 5AANA 3L4AA 3LK0A 2BCBA 1IQ5A 2CTNA 5HLVA 3S0AA 2JULA 2LVIA 3TS5C 2IS9A 1AP4A 2KAVA 4WQ2A 1WLZA 5I8NA 2ZN9A 4CFRA 3LCPC 3CYZA 2NCPA 1MF8B 1QASA 3TUYB 1OQPA 5K89A 1V1FA 1LKJA 2GGMA 2LM5A 2FJYA 2K8MB 5KSZA 2PQLA 2EC6B 1KK7Z 1VRKA 2BE4A 2PSRA 3R1OA 4ICBA 4I5NB 1ZOTB 1N65A 3SIAA 1B4CA 2M3WA 2M1UA 1YVHA 2P6BB 3B88A 3DY9A 4GAOA 2WCFA 2OTGC 1FI6A 1MXLC 1C7WA 1IG5A 3CABA 4JD9A 3ZNIA 1ALWA 2WCMA 3HX4A 4USLA 5AERA 3PLFB 3PN7B 1S6JA 3L47A 5FYXA 1H4BA 2CBLA 2JNFA 1NWDA 2NXQA 1A75A 2BCXA 4GNKB 5G08A 4FTGA 2NZ0A 2BE6A 3EKHA 5HL1A 2JU0A 3DXLA 2KAYA 2KFHA 3QRXA 3TDZA 3CZ1A 1J7QA 3CDNA 1BU3A 1TNPA 3VRRA 4XJKA 2K7CA 2PMYA 4L9MA 2PYQA 1PVAA 1UHIA 2LMTA 3FE9A 3DVJA 1EH2A 1S1EA 1F55A 3TS5B 2R2IA 2PRUA 1NX3A 3C1VA 1XFYO 3BUWB 3SG7A 5EL2A 4YBHB 2L51A
chains in the Genus database with same CATH topology
4N5XA 3CWGA 1DF0B 1L2OC 1NPQA 1YTZC 1J7RA 1XFZO 1DTLA 5HKYA 2M97A 3FIAA 4YGEB 3KHEA 2ZNEA 1S5GZ 1SMGA 1QV0A 1IH0A 4MEWA 1NCYA 1YUTA 1PK0D 3D0YA 2JTTA 1X02A 2KI4B 3EVRA 1RECA 4MZLA 4C0JA 4GBAA 4CFQA 2LHIA 3WHUB 2L98A 3ZWHA 1CLLA 5GQQC 2Q91A 2NLNA 1NIWA 4Q04A 1KFXS 1DJGA 1FW4A 1MUXA 1PSBA 2BKIB 3D10A 4UPGA 1PRWA 1QS7A 1AUIB 1W7JB 1WRKA 3BOWA 1ZACA 1MXEA 1M45A 3GK1A 3VGOA 1JBAA 4PDZA 2FCEA 1OSAA 3NSIA 2LANA 2KFFA 3I5FC 1Y1XA 2HETA 2FOTA 2FJUB 2G2BA 2B1UA 3IF7A 1QX5B 2LV7A 1XA5A 4MRYA 5JOLA 5HKWA 1JFJA 1TTXA 2BBNA 3I5GC 1J7OA 2CNPA 3KPXA 1GJYA 2Y1NA 3LLEA 1UHHA 4BY5A 3ICBA 3PN7C 1DMOA 1EL4A 1YX8A 2WCBA 3VRPA 2QACA 2BKHB 4MRXA 5CSFA 1XVJA 2A4JA 1FF1A 1YUSA 1B7TY 2ZNDA 1SL8A 3DF0A 4JPZB 1L7ZA 2F3ZA 2Y1MA 3PFVA 1Y1AA 1UURA 2EC6C 2BL0B 3JVTB 5I2QA 2K2AA 2LMUA 1AJ4A 2L4IA 2BBMA 1MHOA 1N2DA 4PALA 1LINA 1CLBA 2O5GA 3OX5A 3FWBA 3CR2A 3LK1A 3JTDB 2LUCA 1PALA 1LA3A 4HRHA 1TOPA 3E3RA 2ZKMX 2GGZA 1B8LA 2KBMA 1RK9A 4AQJA 3O2PA 1S5GY 4PHMA 4MLWA 1KK7Y 4HRGA 4AOMA 2H61C 4CLNA 2BECA 4N1FA 3NSKA 4NQGA 3SG2A 1G8IA 4PHNA 4NDBA 1AHRA 3EVUA 3BUXB 4M2PA 1C7VA 4N1GA 4P5OE 3VRNA 1WDCC 3O6BA 3K21A 4JQ0D 2OS8C 5I2LA 1CNPA 2F33A 5CPVA 3SG4A 1SRAA 1NYAA 2M7NA 1DT7B 4MZKA 4CPVA 3PSRA 1R2UA 4I5KA 1JWDA 1QLKA 2EGDA 2JC2A 2JNXA 2SCPA 3I5IB 2KQ6A 3RLZA 3HCMA 1YR5A 1W7IB 1Y1UA 1BR4B 1QIVA 4F0ZB 3JTDC 1QLSA 1A4PA 1KSOA 2CCMA 3BQ3A 1SKTA 4GGFA 1SL7A 1XFUO 2JWWA 2NCOA 2F3YA 2LUXA 1WRLA 2M8UA 1CFDA 2JZIA 3TDUA 1F54A 3EVVA 2LHLA 1JSAA 2JTZA 1NX2A 1KQVA 1K9KA 2PALA 4JWQA 5IBWA 1G33A 4IL1A 1OMVA 2LVJA 1BG1A 1WDCB 2KI6D 3OHMB 2ZFDA 2FCDA 3I5HB 3I5HC 1AK8A 2I2RE 1M46A 1WY9A 1B47A 1TNQA 1MWNA 4C0KA 1BJFA 4NDDA 1GQMA 1UHNA 2Y5IA 1CTRA 2OTGB 1WRZA 2JQ6A 1YVLA 4OV2A 1BR1B 4QJ5B 1U5IA 1RROA 2WOSA 2ISDA 4MBEA 2OPOA 2ZN8A 4WQ3A 5F6TA 1HT9A 1FPWA 4HSZA 1NCXA 4YGDB 2PASA 3RM1A 2L5XB 3PM8A 1S6CA 1D1OA 1QV1A 2WORA 2K7DA 2BL0C 3JVTC 4PE1A 1S3PA 4XYNA 5J3XA 4DCKA 1DGUA 1BF5A 5AXIA 1CMFA 2H2KA 4OCIA 1KCYA 2CXJA 1J1DA 2JT8A 4DUQA 2MAZA 5AEQA 2I18A 3A4UB 1OZSA 2KNEA 5CSNA 1OMRA 3CGAA 3AKAA 1NUBA 4NDCA 1Y6WA 1BODA 2K7OA 2E6WA 2MA2A 4GGFC 2L2EA 1KFUL 1IWQA 1EG3A 2LAPA 2LP3A 3I5GB 1SCMB 3OX6A 3AAJA 1BT6A 1QVIZ 3CLNA 1J55A 3DVEA 3VROA 1H8BA 2EHBA 3EK4A 1TCOB 4R1EA 3SIBA 1QX7A 2K2FA 4FQOA 3TZ1A 5I2OA 3CZTX 3SG5A 4QJ4B 1KK8B 4ZCVA 3OB1B 3GOFA 3GK4X 1QIWA 1PSRA 1QX2A 1OE9B 2JPTA 2KQYA 4YRUA 1SY9A 3DVMA 2HQWA 4A4BA 3H4SE 1B7TZ 1KWOC 5B8IB 2LVKA 2JRFA 1IJ6A 1PULA 1ZFSA 4ORCB 1BOCA 1SYMA 2D8NA 1K96A 3I5FB 1K93D 1NX0A 1SBJA 2M49B 1NSHA 5CSIA 4CIDA 1CM4A 2WC8A 1FBVA 1CDLA 1G4YR 1JF0A 2L4HA 1SCMC 1U5IB 2Y4QA 5BPJA 2AMIA 2ZRSA 1K95A 2Q4UA 1DF0A 1XFWO 2L50A 1TCFA 1CDMA 1YX7A 1J7PA 1K90D 2LLTA 1KQMC 1DJYA 2M0RA 4AQIA 3OP0A 2ZRTA 4MVFA 1TIZA 2LLSA 1DGVA 2F2PA 2LNKA 4YGCB 3FS7A 2H61A 3O78A 2MJWB 1BMOA 2WCEA 1CM1A 1R6PA 1S36A 3DVKA 4PE7A 2LMVA 5HYDA 1GGWA 1K8UA 5DKRA 4HREE 1K2HA 1IKUA 2KYFA 1SNLA 4P2YB 3IQOA 2G9BA 1CMGA 1OMDA 1CFPA 2LVVA 1SPYA 2CT9A 3D0YB 1SW8A 1JF2A 1FI5A 1JFKA 1LVCD 1F8HA 1IQ3A 3FWCA 1ZMZA 5AFPA 2KBIA 2LE9B 2HPSA 1EG4A 4YGBB 1CDNA 2KI4C 3AKBA 3PALA 1RTP1 1SR6B 2K61A 1J1EA 1SR6C 1SK6D 4YI8A 1B9AA 1EXRA 1KQMB 2BCAA 2M29A 1B8CA 3DF0B 1C07A 1TRFA 1QATA 5HLOA 3TUYC 1JC2A 2L0PA 5ER4X 1NP8A 1XK4A 2HF5A 4ZCUA 1IJ5A 1OOJA 1ZUZA 2PVBA 1IGVA 1K94A 1F70A 1N0YA 1K9PA 1HQVA 2E30A 2LCPA 2F8PA 3O4YA 1A2XA 1UUSA 3IQQA 3WHTB 2JT0A 3LL8B 1UP5A 4PE4A 1NX1A 1CDPA 3M0WA 4GPLB 3SG3A 2V53A 2VRGA 4PCWA 1UWOA 1KFUS 1KFXL 1RJVA 3BOWB 1DJZA 1GGZA 1CLMA 3SG6A 2JOJA 4I5LB 4A4CA 1QTXA 1TNXA 1B1GA 1CFFA 2COLB 2LC5A 3CR4X 1UHJA 5HKZA 1XK4C 4GFTA 1KK8C 4YI9A 1M63B 1CB1A 2MLEC 4MZJA 4C0LA 4PHKA 4ETOA 1IRJA 5DKQA 1YUUA 1QVIY 1KWOB 2I94A 3AAKA 1TN4A 3KO0A 2KSPA 1DJIA 2K7BA 1XYDA 1QJTA 4OVNF 1DVIA 2RGIA 4E68A 4TNCA 3CR5X 3WXAA 2JT3A 1YRTB 2M9GA 3CS1A 1XFVO 1LA0A 4PE0A 4PHJA 2GV5A 2MLFC 4OR9B 1ODBA 1ALVA 5CSJA 5KTYA 2JXCA 1JUOA 1RFJA 2AUCA 1NCZA 1EJ3A 1E8AA 3VRQA 3EK7A 3EK8A 2KGBC 1AJ5A 1F71A 4M2QA 1OZOA 2WNDA 5D7FA 4D1EA 4MN0A 1UHKA 5TNCA 2MBXA 1K9UA 1A29A 1V1GA 1SL9A 5DKNA 2KGRA 2QPTA 5ER5A 3PATA 4DS7A 1DJXA 3TDIA 1LXFC 1CFCA 2KAXA 2KOTA 1YURA 3BUNB 2MHHA 3EKJA 2SASA 2MRDA 3I5IC 4GGNA 1AVSA 3WNXB 2LLUA 4YGAA 1YRUB 1DJWA 1TNWA 3NSLA 2AAOA 2DOQA 3KF9A 5KU1A 1WLMA 1MR8A 2M1KB 3BYAA 1S26D 1SCVA 5JJGA 2I7AA 4MSPA 1F4OA 2JXLA 4DIRA 4QJ3B 3GK2A 2KYCA 1XO5A 3A8RA 4DRWA 3MSEB 2KI6C 3BUMB 3BUOB 3BXKA 4BY4A 1XFXO 1RWYA 4I5JA 3SJSA 1Y0VH 3NXAA 4WRIA 4U8DA 5PALA 1A03A 1QXPA 2K0JA 2OS8B 3KEVA 4ORBB 1MQ1A 2F2OA 1Q80A 1L2OB 1PVBA 3NSOA 4OKHA 4XJKB 2KFGA 2TN4A 2M7LA 2KDHA 3F45A 2KHNA 3CTNA 4M2OA 1A75B 1F4QA 2HQ8A 2LP2A 2O60A 1BLQA 1CKKA 5D69A 1B8RA 1KSMA 1DJHA 4ORAB 1S6IA 3DD4A 1M31A 3OB2B 4GUKA 1M39A 5AANA 3LK0A 2BCBA 1IQ5A 2CTNA 5HLVA 2JULA 2LVIA 3TS5C 2IS9A 1AP4A 2KAVA 4WQ2A 1WLZA 5I8NA 2ZN9A 4CFRA 3LCPC 2NCPA 1MF8B 1QASA 3TUYB 1OQPA 5K89A 1V1FA 1LKJA 2GGMA 2LM5A 2K8MB 5KSZA 2EC6B 1KK7Z 1VRKA 2BE4A 2PSRA 4I5NB 4ICBA 1ZOTB 1N65A 3SIAA 1B4CA 2M3WA 2M1UA 1YVHA 2P6BB 4GAOA 2WCFA 2OTGC 1FI6A 1MXLC 1C7WA 1IG5A 3ZNIA 1ALWA 4USLA 3HX4A 5AERA 3PLFB 3PN7B 1S6JA 5FYXA 1H4BA 2CBLA 2JNFA 1NWDA 2NXQA 1A75A 2BCXA 4GNKB 5G08A 4FTGA 2NZ0A 2BE6A 3EKHA 2JU0A 2KAYA 2KFHA 3QRXA 3TDZA 1J7QA 1BU3A 1TNPA 3VRRA 4XJKA 2K7CA 2PMYA 4L9MA 1EH2A 1PVAA 1UHIA 2LMTA 3DVJA 1S1EA 3TS5B 2R2IA 2PRUA 1NX3A 3C1VA 1XFYO 3BUWB 3SG7A 1F55A 4YBHB 2L51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5X A;  3CWG A;  1DF0 B;  1L2O C;  1NPQ A;  1YTZ C;  1J7R A;  1XFZ O;  1DTL A;  5HKY A;  2M97 A;  3FIA A;  4YGE B;  3KHE A;  2ZNE A;  1S5G Z;  1SMG A;  1QV0 A;  1IH0 A;  4MEW A;  1NCY A;  1YUT A;  1PK0 D;  3D0Y A;  2JTT A;  1X02 A;  2KI4 B;  3EVR A;  1REC A;  4MZL A;  4C0J A;  4GBA A;  4CFQ A;  2LHI A;  3WHU B;  2L98 A;  3ZWH A;  1CLL A;  5GQQ C;  2Q91 A;  2NLN A;  1NIW A;  4Q04 A;  1KFX S;  1DJG A;  1FW4 A;  1MUX A;  1PSB A;  2BKI B;  3D10 A;  4UPG A;  1PRW A;  1QS7 A;  1AUI B;  1W7J B;  1WRK A;  3BOW A;  1ZAC A;  1MXE A;  1M45 A;  3GK1 A;  3VGO A;  1JBA A;  4PDZ A;  2FCE A;  1OSA A;  3NSI A;  2LAN A;  2KFF A;  3I5F C;  1Y1X A;  2HET A;  2FOT A;  2FJU B;  2G2B A;  2B1U A;  3IF7 A;  1QX5 B;  2LV7 A;  1XA5 A;  4MRY A;  5JOL A;  5HKW A;  1JFJ A;  1TTX A;  2BBN A;  3I5G C;  1J7O A;  2CNP A;  3KPX A;  1GJY A;  2Y1N A;  3LLE A;  1UHH A;  4BY5 A;  3ICB A;  3PN7 C;  1DMO A;  1EL4 A;  1YX8 A;  2WCB A;  3VRP A;  2QAC A;  2BKH B;  4MRX A;  5CSF A;  1XVJ A;  2A4J A;  1FF1 A;  1YUS A;  1B7T Y;  2ZND A;  1SL8 A;  3DF0 A;  4JPZ B;  1L7Z A;  2F3Z A;  2Y1M A;  3PFV A;  1Y1A A;  1UUR A;  2EC6 C;  2BL0 B;  3JVT B;  5I2Q A;  2K2A A;  2LMU A;  1AJ4 A;  2L4I A;  2BBM A;  1MHO A;  1N2D A;  4PAL A;  1LIN A;  1CLB A;  2O5G A;  3OX5 A;  3FWB A;  3CR2 A;  3LK1 A;  3JTD B;  2LUC A;  1PAL A;  1LA3 A;  4HRH A;  1TOP A;  3E3R A;  2ZKM X;  2GGZ A;  1B8L A;  2KBM A;  1RK9 A;  4AQJ A;  3O2P A;  1S5G Y;  4PHM A;  4MLW A;  1KK7 Y;  4HRG A;  4AOM A;  2H61 C;  4CLN A;  2BEC A;  4N1F A;  3NSK A;  4NQG A;  3SG2 A;  1G8I A;  4PHN A;  4NDB A;  1AHR A;  3EVU A;  3BUX B;  4M2P A;  1C7V A;  4N1G A;  4P5O E;  3VRN A;  1WDC C;  3O6B A;  3K21 A;  4JQ0 D;  2OS8 C;  5I2L A;  1CNP A;  2F33 A;  5CPV A;  3SG4 A;  1SRA A;  1NYA A;  2M7N A;  1DT7 B;  4MZK A;  4CPV A;  3PSR A;  1R2U A;  4I5K A;  1JWD A;  1QLK A;  2EGD A;  2JC2 A;  2JNX A;  2SCP A;  3I5I B;  2KQ6 A;  3RLZ A;  3HCM A;  1YR5 A;  1W7I B;  1Y1U A;  1BR4 B;  1QIV A;  4F0Z B;  3JTD C;  1QLS A;  1A4P A;  1KSO A;  2CCM A;  3BQ3 A;  1SKT A;  4GGF A;  1SL7 A;  1XFU O;  2JWW A;  2NCO A;  2F3Y A;  2LUX A;  1WRL A;  2M8U A;  1CFD A;  2JZI A;  3TDU A;  1F54 A;  3EVV A;  2LHL A;  1JSA A;  2JTZ A;  1NX2 A;  1KQV A;  1K9K A;  2PAL A;  4JWQ A;  5IBW A;  1G33 A;  4IL1 A;  1OMV A;  2LVJ A;  1BG1 A;  1WDC B;  2KI6 D;  3OHM B;  2ZFD A;  2FCD A;  3I5H B;  3I5H C;  1AK8 A;  2I2R E;  1M46 A;  1WY9 A;  1B47 A;  1TNQ A;  1MWN A;  4C0K A;  1BJF A;  4NDD A;  1GQM A;  1UHN A;  2Y5I A;  1CTR A;  2OTG B;  1WRZ A;  2JQ6 A;  1YVL A;  4OV2 A;  1BR1 B;  4QJ5 B;  1U5I A;  1RRO A;  2WOS A;  2ISD A;  4MBE A;  2OPO A;  2ZN8 A;  4WQ3 A;  5F6T A;  1HT9 A;  1FPW A;  4HSZ A;  1NCX A;  4YGD B;  2PAS A;  3RM1 A;  2L5X B;  3PM8 A;  1S6C A;  1D1O A;  1QV1 A;  2WOR A;  2K7D A;  2BL0 C;  3JVT C;  4PE1 A;  1S3P A;  4XYN A;  5J3X A;  4DCK A;  1DGU A;  1BF5 A;  5AXI A;  1CMF A;  2H2K A;  4OCI A;  1KCY A;  2CXJ A;  1J1D A;  2JT8 A;  4DUQ A;  2MAZ A;  5AEQ A;  2I18 A;  3A4U B;  1OZS A;  2KNE A;  5CSN A;  1OMR A;  3CGA A;  3AKA A;  1NUB A;  4NDC A;  1Y6W A;  1BOD A;  2K7O A;  2E6W A;  2MA2 A;  4GGF C;  2L2E A;  1KFU L;  1IWQ A;  1EG3 A;  2LAP A;  2LP3 A;  3I5G B;  1SCM B;  3OX6 A;  3AAJ A;  1BT6 A;  1QVI Z;  3CLN A;  1J55 A;  3DVE A;  3VRO A;  1H8B A;  2EHB A;  3EK4 A;  1TCO B;  4R1E A;  3SIB A;  1QX7 A;  2K2F A;  4FQO A;  3TZ1 A;  5I2O A;  3CZT X;  3SG5 A;  4QJ4 B;  1KK8 B;  4ZCV A;  3OB1 B;  3GOF A;  3GK4 X;  1QIW A;  1PSR A;  1QX2 A;  1OE9 B;  2JPT A;  2KQY A;  4YRU A;  1SY9 A;  3DVM A;  2HQW A;  4A4B A;  3H4S E;  1B7T Z;  1KWO C;  5B8I B;  2LVK A;  2JRF A;  1IJ6 A;  1PUL A;  1ZFS A;  4ORC B;  1BOC A;  1SYM A;  2D8N A;  1K96 A;  3I5F B;  1K93 D;  1NX0 A;  1SBJ A;  2M49 B;  1NSH A;  5CSI A;  4CID A;  1CM4 A;  2WC8 A;  1FBV A;  1CDL A;  1G4Y R;  1JF0 A;  2L4H A;  1SCM C;  1U5I B;  2Y4Q A;  5BPJ A;  2AMI A;  2ZRS A;  1K95 A;  2Q4U A;  1DF0 A;  1XFW O;  2L50 A;  1TCF A;  1CDM A;  1YX7 A;  1J7P A;  1K90 D;  2LLT A;  1KQM C;  1DJY A;  2M0R A;  4AQI A;  3OP0 A;  2ZRT A;  4MVF A;  1TIZ A;  2LLS A;  1DGV A;  2F2P A;  2LNK A;  4YGC B;  3FS7 A;  2H61 A;  3O78 A;  2MJW B;  1BMO A;  2WCE A;  1CM1 A;  1R6P A;  1S36 A;  3DVK A;  4PE7 A;  2LMV A;  5HYD A;  1GGW A;  1K8U A;  5DKR A;  4HRE E;  1K2H A;  1IKU A;  2KYF A;  1SNL A;  4P2Y B;  3IQO A;  2G9B A;  1CMG A;  1OMD A;  1CFP A;  2LVV A;  1SPY A;  2CT9 A;  3D0Y B;  1SW8 A;  1JF2 A;  1FI5 A;  1JFK A;  1LVC D;  1F8H A;  1IQ3 A;  3FWC A;  1ZMZ A;  5AFP A;  2KBI A;  2LE9 B;  2HPS A;  1EG4 A;  4YGB B;  1CDN A;  2KI4 C;  3AKB A;  3PAL A;  1RTP 1;  1SR6 B;  2K61 A;  1J1E A;  1SR6 C;  1SK6 D;  4YI8 A;  1B9A A;  1EXR A;  1KQM B;  2BCA A;  2M29 A;  1B8C A;  3DF0 B;  1C07 A;  1TRF A;  1QAT A;  5HLO A;  3TUY C;  1JC2 A;  2L0P A;  5ER4 X;  1NP8 A;  1XK4 A;  2HF5 A;  4ZCU A;  1IJ5 A;  1OOJ A;  1ZUZ A;  2PVB A;  1IGV A;  1K94 A;  1F70 A;  1N0Y A;  1K9P A;  1HQV A;  2E30 A;  2LCP A;  2F8P A;  3O4Y A;  1A2X A;  1UUS A;  3IQQ A;  3WHT B;  2JT0 A;  3LL8 B;  1UP5 A;  4PE4 A;  1NX1 A;  1CDP A;  3M0W A;  4GPL B;  3SG3 A;  2V53 A;  2VRG A;  4PCW A;  1UWO A;  1KFU S;  1KFX L;  1RJV A;  3BOW B;  1DJZ A;  1GGZ A;  1CLM A;  3SG6 A;  2JOJ A;  4I5L B;  4A4C A;  1QTX A;  1TNX A;  1B1G A;  1CFF A;  2COL B;  2LC5 A;  3CR4 X;  1UHJ A;  5HKZ A;  1XK4 C;  4GFT A;  1KK8 C;  4YI9 A;  1M63 B;  1CB1 A;  2MLE C;  4MZJ A;  4C0L A;  4PHK A;  4ETO A;  1IRJ A;  5DKQ A;  1YUU A;  1QVI Y;  1KWO B;  2I94 A;  3AAK A;  1TN4 A;  3KO0 A;  2KSP A;  1DJI A;  2K7B A;  1XYD A;  1QJT A;  4OVN F;  1DVI A;  2RGI A;  4E68 A;  4TNC A;  3CR5 X;  3WXA A;  2JT3 A;  1YRT B;  2M9G A;  3CS1 A;  1XFV O;  1LA0 A;  4PE0 A;  4PHJ A;  2GV5 A;  2MLF C;  4OR9 B;  1ODB A;  1ALV A;  5CSJ A;  5KTY A;  2JXC A;  1JUO A;  1RFJ A;  2AUC A;  1NCZ A;  1EJ3 A;  1E8A A;  3VRQ A;  3EK7 A;  3EK8 A;  2KGB C;  1AJ5 A;  1F71 A;  4M2Q A;  1OZO A;  2WND A;  5D7F A;  4D1E A;  4MN0 A;  1UHK A;  5TNC A;  2MBX A;  1K9U A;  1A29 A;  1V1G A;  1SL9 A;  5DKN A;  2KGR A;  2QPT A;  5ER5 A;  3PAT A;  4DS7 A;  1DJX A;  3TDI A;  1LXF C;  1CFC A;  2KAX A;  2KOT A;  1YUR A;  3BUN B;  2MHH A;  3EKJ A;  2SAS A;  2MRD A;  3I5I C;  4GGN A;  1AVS A;  3WNX B;  2LLU A;  4YGA A;  1YRU B;  1DJW A;  1TNW A;  3NSL A;  2AAO A;  2DOQ A;  3KF9 A;  5KU1 A;  1WLM A;  1MR8 A;  2M1K B;  3BYA A;  1S26 D;  1SCV A;  5JJG A;  2I7A A;  4MSP A;  1F4O A;  2JXL A;  4DIR A;  4QJ3 B;  3GK2 A;  2KYC A;  1XO5 A;  3A8R A;  4DRW A;  3MSE B;  2KI6 C;  3BUM B;  3BUO B;  3BXK A;  4BY4 A;  1XFX O;  1RWY A;  4I5J A;  3SJS A;  1Y0V H;  3NXA A;  4WRI A;  4U8D A;  5PAL A;  1A03 A;  1QXP A;  2K0J A;  2OS8 B;  3KEV A;  4ORB B;  1MQ1 A;  2F2O A;  1Q80 A;  1L2O B;  1PVB A;  3NSO A;  4OKH A;  4XJK B;  2KFG A;  2TN4 A;  2M7L A;  2KDH A;  3F45 A;  2KHN A;  3CTN A;  4M2O A;  1A75 B;  1F4Q A;  2HQ8 A;  2LP2 A;  2O60 A;  1BLQ A;  1CKK A;  5D69 A;  1B8R A;  1KSM A;  1DJH A;  4ORA B;  1S6I A;  3DD4 A;  1M31 A;  3OB2 B;  4GUK A;  1M39 A;  5AAN A;  3LK0 A;  2BCB A;  1IQ5 A;  2CTN A;  5HLV A;  2JUL A;  2LVI A;  3TS5 C;  2IS9 A;  1AP4 A;  2KAV A;  4WQ2 A;  1WLZ A;  5I8N A;  2ZN9 A;  4CFR A;  3LCP C;  2NCP A;  1MF8 B;  1QAS A;  3TUY B;  1OQP A;  5K89 A;  1V1F A;  1LKJ A;  2GGM A;  2LM5 A;  2K8M B;  5KSZ A;  2EC6 B;  1KK7 Z;  1VRK A;  2BE4 A;  2PSR A;  4I5N B;  4ICB A;  1ZOT B;  1N65 A;  3SIA A;  1B4C A;  2M3W A;  2M1U A;  1YVH A;  2P6B B;  4GAO A;  2WCF A;  2OTG C;  1FI6 A;  1MXL C;  1C7W A;  1IG5 A;  3ZNI A;  1ALW A;  4USL A;  3HX4 A;  5AER A;  3PLF B;  3PN7 B;  1S6J A;  5FYX A;  1H4B A;  2CBL A;  2JNF A;  1NWD A;  2NXQ A;  1A75 A;  2BCX A;  4GNK B;  5G08 A;  4FTG A;  2NZ0 A;  2BE6 A;  3EKH A;  2JU0 A;  2KAY A;  2KFH A;  3QRX A;  3TDZ A;  1J7Q A;  1BU3 A;  1TNP A;  3VRR A;  4XJK A;  2K7C A;  2PMY A;  4L9M A;  1EH2 A;  1PVA A;  1UHI A;  2LMT A;  3DVJ A;  1S1E A;  3TS5 B;  2R2I A;  2PRU A;  1NX3 A;  3C1V A;  1XFY O;  3BUW B;  3SG7 A;  1F55 A;  4YBH B;  2L51 A; 
#chains in the Genus database with same CATH topology
 4N5X A;  3BFB A;  3CWG A;  1DF0 B;  1L2O C;  1NPQ A;  1YTZ C;  1J7R A;  1XFZ O;  1DTL A;  5HKY A;  2M97 A;  3FIA A;  3SS5 A;  4YGE B;  3KHE A;  2ZNE A;  1S5G Z;  1SMG A;  1QV0 A;  1IH0 A;  4MEW A;  1NCY A;  1YUT A;  1PK0 D;  3D0Y A;  1OOI X;  2JTT A;  1X02 A;  2KI4 B;  2P71 A;  3EVR A;  3D73 A;  1REC A;  4MZL A;  4C0J A;  4GBA A;  4CFQ A;  2LHI A;  3WHU B;  2L98 A;  3ZWH A;  1CLL A;  5GQQ C;  2Q91 A;  2NLN A;  4IJ7 A;  1NIW A;  4Q04 A;  1KFX S;  1DJG A;  1FW4 A;  1MUX A;  1PSB A;  2BKI B;  2WCK A;  3D10 A;  4UPG A;  1PRW A;  1QS7 A;  1AUI B;  1W7J B;  1WRK A;  3BOW A;  1ZAC A;  1MXE A;  1M45 A;  3GK1 A;  3VGO A;  2L2C A;  1JBA A;  4PDZ A;  2FCE A;  1OSA A;  3NSI A;  2LAN A;  2KFF A;  3I5F C;  1Y1X A;  2HET A;  2FOT A;  2FJU B;  2G2B A;  2B1U A;  3IF7 A;  1QX5 B;  2LV7 A;  1XA5 A;  3PJI A;  4MRY A;  5JOL A;  5HKW A;  3S0E A;  1TTX A;  2BBN A;  3I5G C;  1J7O A;  2CNP A;  1JFJ A;  3KPX A;  1GJY A;  3D78 A;  2Y1N A;  3LLE A;  1UHH A;  2H8V A;  3ICB A;  4BY5 A;  3PN7 C;  1DMO A;  1EL4 A;  1YX8 A;  2WCB A;  3VRP A;  2QAC A;  2BKH B;  4MRX A;  3CZ0 A;  5CSF A;  1XVJ A;  2A4J A;  1FF1 A;  1P28 A;  1B7T Y;  1YUS A;  2ZND A;  1SL8 A;  3DF0 A;  4JPZ B;  1L7Z A;  2F3Z A;  2Y1M A;  3PFV A;  1Y1A A;  1UUR A;  2EC6 C;  4INX A;  2BL0 B;  3JVT B;  5I2Q A;  2K2A A;  2LMU A;  1AJ4 A;  2L4I A;  2BBM A;  3NGV A;  1MHO A;  3BFH A;  3B7A A;  1N2D A;  4PAL A;  1LIN A;  1CLB A;  2O5G A;  3OX5 A;  3FWB A;  3CR2 A;  3LK1 A;  3JTD B;  2LUC A;  1PAL A;  1DC1 A;  1LA3 A;  4HRH A;  1TOP A;  3E3R A;  2ZKM X;  2GGZ A;  1B8L A;  2KBM A;  1RK9 A;  4AQJ A;  3O2P A;  1S5G Y;  4PHM A;  2WC5 A;  4MLW A;  1KK7 Y;  4HRG A;  4AOM A;  2H61 C;  4CLN A;  2BEC A;  4N1F A;  3NSK A;  4NQG A;  3SG2 A;  1OOG A;  1G8I A;  4PHN A;  3NHI A;  1AHR A;  3Q8I A;  3EVU A;  4NDB A;  3BUX B;  4M2P A;  1C7V A;  4N1G A;  4P5O E;  3VRN A;  1GM0 A;  2WCH A;  1WDC C;  3O6B A;  3K21 A;  4JQ0 D;  2OS8 C;  5I2L A;  1CNP A;  2F33 A;  5CPV A;  3SG4 A;  1SRA A;  2KLD A;  1NYA A;  3B86 A;  2M7N A;  1DT7 B;  4MZK A;  4CPV A;  3PSR A;  1R2U A;  3UNW A;  4I5K A;  1JWD A;  1QLK A;  2EGD A;  2JC2 A;  2JNX A;  2SCP A;  3I5I B;  2KQ6 A;  3RLZ A;  3HCM A;  1YR5 A;  1W7I B;  1Y1U A;  1W9Z A;  1BR4 B;  2QDI A;  1QIV A;  4F0Z B;  3JTD C;  3B6X A;  1QLS A;  1A4P A;  1KSO A;  2CCM A;  3BQ3 A;  1SKT A;  4GGF A;  1SL7 A;  1XFU O;  3S0D A;  3S0B A;  2JWW A;  2NCO A;  2F3Y A;  3DZT A;  2LUX A;  1WRL A;  2M8U A;  1CFD A;  2JZI A;  3TDU A;  1TWO A;  3EVV A;  1F54 A;  3S0F A;  1OOF A;  2LHL A;  3B87 A;  1JSA A;  2JTZ A;  1NX2 A;  1KQV A;  1K9K A;  2PAL A;  4JWQ A;  5IBW A;  1G33 A;  4FQT A;  1DEK A;  2WCL A;  1OMV A;  2LVJ A;  4IL1 A;  1BG1 A;  1WDC B;  2KI6 D;  3OHM B;  2ZFD A;  2FCD A;  3I5H B;  3I5H C;  1AK8 A;  2I2R E;  1M46 A;  1WY9 A;  1B47 A;  1TNQ A;  5DIC A;  1MWN A;  4C0K A;  1BJF A;  3CZ2 A;  4NDD A;  1GQM A;  1UHN A;  2Y5I A;  1CTR A;  2OTG B;  1WRZ A;  2JQ6 A;  1YVL A;  4OV2 A;  1BR1 B;  4QJ5 B;  2ERB A;  1U5I A;  1RRO A;  3OGN A;  2WOS A;  2ISD A;  4MBE A;  2OPO A;  2ZN8 A;  4WQ3 A;  5F6T A;  1HT9 A;  1FPW A;  4HSZ A;  1NCX A;  4YGD B;  1GGW A;  2PAS A;  3DYE A;  3RM1 A;  1C3Y A;  2L5X B;  3PM8 A;  1S6C A;  1D1O A;  1QV1 A;  2WOR A;  2K7D A;  2BL0 C;  3JVT C;  4PE1 A;  1T14 A;  1S3P A;  4XYN A;  5J3X A;  4DCK A;  1DGU A;  1BF5 A;  5AXI A;  1ORG A;  1SSE B;  1CMF A;  2H2K A;  4OCI A;  1KCY A;  2CXJ A;  1J1D A;  1DEL A;  2JT8 A;  4DUQ A;  2MAZ A;  5AEQ A;  2I18 A;  3A4U B;  1OZS A;  2KNE A;  5CSN A;  1OMR A;  3CGA A;  3AKA A;  1NUB A;  2BAP A;  4NDC A;  1Y6W A;  3D76 A;  2K7O A;  2E6W A;  1BOD A;  2MA2 A;  4GGF C;  2L2E A;  1KFU L;  1IWQ A;  1EG3 A;  2LAP A;  2LP3 A;  3I5G B;  3R72 A;  1Z4H A;  1SCM B;  3OX6 A;  3AAJ A;  1BT6 A;  1QVI Z;  1TUJ A;  1J55 A;  3CLN A;  3DVE A;  3VRO A;  1H8B A;  2EHB A;  3EK4 A;  1TCO B;  4R1E A;  3SIB A;  1QX7 A;  2K2F A;  4FQO A;  3TZ1 A;  5I2O A;  3CZT X;  3SG5 A;  3N7H A;  4QJ4 B;  1KK8 B;  4ZCV A;  3OB1 B;  3GOF A;  3GK4 X;  1QIW A;  1PSR A;  3BFA A;  1QX2 A;  1OE9 B;  2JPT A;  2KQY A;  2QEB A;  4YRU A;  1SY9 A;  3DVM A;  2HQW A;  4A4B A;  3H4S E;  1B7T Z;  1KWO C;  1C3Z A;  2LVK A;  3OBV A;  5B8I B;  3S0G A;  2JRF A;  1IJ6 A;  1PUL A;  1ZFS A;  4ORC B;  1BOC A;  2QEO A;  1SYM A;  3D74 A;  2D8N A;  4PT1 A;  1K96 A;  1TUZ A;  3I5F B;  1K93 D;  1NX0 A;  1SBJ A;  2M49 B;  1Z2C B;  1NSH A;  5CSI A;  4CID A;  1CM4 A;  2WC8 A;  1FBV A;  1CDL A;  1G4Y R;  1JF0 A;  2L4H A;  1SCM C;  1U5I B;  2Y4Q A;  5BPJ A;  2AMI A;  2ZRS A;  1K95 A;  2Q4U A;  1DF0 A;  1XFW O;  2L50 A;  1TCF A;  1CDM A;  3RZS A;  2KLE A;  1YX7 A;  4KYN A;  1J7P A;  1K90 D;  2LLT A;  1KQM C;  1DJY A;  2M0R A;  4AQI A;  3OP0 A;  2ZRT A;  4MVF A;  1TIZ A;  2LLS A;  1DGV A;  2F2P A;  2LNK A;  3SS3 A;  4YGC B;  3FS7 A;  2H61 A;  3O78 A;  5FI2 A;  2MJW B;  1BMO A;  2WCE A;  1CM1 A;  1R6P A;  1S36 A;  3DVK A;  4PE7 A;  2LMV A;  5HYD A;  3R1P A;  2WCJ A;  1K8U A;  5DKR A;  4HRE E;  1K2H A;  2K60 A;  2KYF A;  1IKU A;  1SNL A;  4P2Y B;  3IQO A;  2G9B A;  1CMG A;  1OMD A;  2QEV A;  1CFP A;  2LVV A;  1SPY A;  2CT9 A;  3D0Y B;  1SW8 A;  1JF2 A;  1FI5 A;  1JFK A;  1LVC D;  1F8H A;  1IQ3 A;  3FWC A;  1ZMZ A;  5AFP A;  2KBI A;  2LE9 B;  2HPS A;  1EG4 A;  4YGB B;  1CDN A;  2KI4 C;  3AKB A;  3PAL A;  1RTP 1;  1SR6 B;  2K61 A;  1QWV A;  1J1E A;  1SR6 C;  1SK6 D;  4YI8 A;  1B9A A;  1EXR A;  1KQM B;  2BCA A;  2M29 A;  1B8C A;  3DF0 B;  1C07 A;  1TRF A;  1QAT A;  5HLO A;  1LS8 A;  3TUY C;  1JC2 A;  2L0P A;  5ER4 X;  2QEH A;  1NP8 A;  1XK4 A;  2HF5 A;  2GTE A;  3FE6 A;  1IJ5 A;  1OOJ A;  1ZUZ A;  4ZCU A;  2PVB A;  5I94 A;  1IGV A;  1K94 A;  1F70 A;  1N0Y A;  1K9P A;  1HQV A;  2E30 A;  2LCP A;  2F8P A;  2KPH A;  1A2X A;  1UUS A;  3IQQ A;  3NHT A;  3O4Y A;  3WHT B;  2JT0 A;  3D75 A;  3LL8 B;  1UP5 A;  4PE4 A;  1NX1 A;  1CDP A;  3M0W A;  4GPL B;  3SG3 A;  2V53 A;  2VRG A;  4PCW A;  1UWO A;  1KFU S;  1KFX L;  1RJV A;  3BOW B;  4F7F A;  1DJZ A;  1GGZ A;  1CLM A;  3SG6 A;  2JOJ A;  4I5L B;  4A4C A;  1QTX A;  1TNX A;  1B1G A;  1CFF A;  2COL B;  2LC5 A;  3CR4 X;  1UHJ A;  5HKZ A;  3IVT A;  1XK4 C;  4GFT A;  1KK8 C;  3VB1 A;  4OZD A;  4YI9 A;  1M63 B;  3QME A;  1CB1 A;  2MLE C;  4MZJ A;  4C0L A;  4PHK A;  4ETO A;  1IRJ A;  5DKQ A;  1YUU A;  1QVI Y;  1KWO B;  2I94 A;  3AAK A;  1TN4 A;  3KO0 A;  2KSP A;  1DJI A;  1XFR A;  2K7B A;  1XYD A;  2WC6 A;  1QJT A;  4OVN F;  1DVI A;  2RGI A;  3UO9 A;  4E68 A;  4TNC A;  3CR5 X;  4INW A;  3FE8 A;  3WXA A;  2JT3 A;  1YRT B;  2M9G A;  3CS1 A;  1XFV O;  1LA0 A;  4PE0 A;  4PHJ A;  2GV5 A;  2MLF C;  4OR9 B;  1ODB A;  1ALV A;  5CSJ A;  3V2L A;  5KTY A;  2JXC A;  1JUO A;  1RFJ A;  2AUC A;  1NCZ A;  1EJ3 A;  1E8A A;  3VRQ A;  3EK7 A;  1OW4 A;  3EK8 A;  2KGB C;  3SS4 A;  5D3O A;  1AJ5 A;  1F71 A;  4M2Q A;  1DQE A;  2JPO A;  1OZO A;  2WND A;  5D7F A;  3K1E A;  4D1E A;  4MN0 A;  1UHK A;  5TNC A;  2MBX A;  1K9U A;  3PM2 A;  1A29 A;  1V1G A;  1SL9 A;  5DKN A;  2KGR A;  2QPT A;  5ER5 A;  3PAT A;  4DS7 A;  1DJX A;  3TDI A;  1LXF C;  3L4L A;  1CFC A;  2KAX A;  2KOT A;  3D77 A;  1YUR A;  3BUN B;  2MHH A;  3EKJ A;  2SAS A;  2MRD A;  3I5I C;  4GGN A;  1AVS A;  3WNX B;  1OOH A;  2LLU A;  4YGA A;  1YRU B;  1DJW A;  1TNW A;  3NSL A;  2P70 A;  2AAO A;  2DOQ A;  3KF9 A;  5KU1 A;  1WLM A;  1MR8 A;  2M1K B;  3BYA A;  1S26 D;  3EG5 B;  1SCV A;  5JJG A;  2I7A A;  4MSP A;  1F4O A;  2JXL A;  4DIR A;  4QJ3 B;  3GK2 A;  2KYC A;  1XO5 A;  3A8R A;  4DRW A;  3MSE B;  2KI6 C;  3BUM B;  3BUO B;  3BXK A;  4BY4 A;  1XFX O;  1RWY A;  4I5J A;  3SJS A;  5FI6 A;  4JKT A;  3R1V A;  1Y0V H;  3BJH A;  3NXA A;  4WRI A;  4U8D A;  5PAL A;  1A03 A;  1QXP A;  2K0J A;  2OS8 B;  3KEV A;  4ORB B;  1MQ1 A;  2F2O A;  1Q80 A;  2YGU A;  1L2O B;  1PVB A;  3NSO A;  4OKH A;  4XJK B;  1IIO A;  2KFG A;  2L5Y A;  2TN4 A;  2M7L A;  2KDH A;  3F45 A;  2KHN A;  3CTN A;  4M2O A;  1A75 B;  1F4Q A;  2BNX A;  2HQ8 A;  2LP2 A;  2O60 A;  3O4X A;  1BLQ A;  5D69 A;  1CKK A;  1B8R A;  1KSM A;  1DJH A;  4ORA B;  1S6I A;  3DD4 A;  5FI7 A;  1M31 A;  3OB2 B;  4GUK A;  1M39 A;  5AAN A;  3L4A A;  3LK0 A;  2BCB A;  1IQ5 A;  2CTN A;  5HLV A;  3S0A A;  2JUL A;  2LVI A;  3TS5 C;  2IS9 A;  1AP4 A;  2KAV A;  4WQ2 A;  1WLZ A;  5I8N A;  2ZN9 A;  4CFR A;  3LCP C;  3CYZ A;  2NCP A;  1MF8 B;  1QAS A;  3TUY B;  1OQP A;  5K89 A;  1V1F A;  1LKJ A;  2GGM A;  2LM5 A;  2FJY A;  2K8M B;  5KSZ A;  2PQL A;  2EC6 B;  1KK7 Z;  1VRK A;  2BE4 A;  2PSR A;  3R1O A;  4ICB A;  4I5N B;  1ZOT B;  1N65 A;  3SIA A;  1B4C A;  2M3W A;  2M1U A;  1YVH A;  2P6B B;  3B88 A;  3DY9 A;  4GAO A;  2WCF A;  2OTG C;  1FI6 A;  1MXL C;  1C7W A;  1IG5 A;  3CAB A;  4JD9 A;  3ZNI A;  1ALW A;  2WCM A;  3HX4 A;  4USL A;  5AER A;  3PLF B;  3PN7 B;  1S6J A;  3L47 A;  5FYX A;  1H4B A;  2CBL A;  2JNF A;  1NWD A;  2NXQ A;  1A75 A;  2BCX A;  4GNK B;  5G08 A;  4FTG A;  2NZ0 A;  2BE6 A;  3EKH A;  5HL1 A;  2JU0 A;  3DXL A;  2KAY A;  2KFH A;  3QRX A;  3TDZ A;  3CZ1 A;  1J7Q A;  3CDN A;  1BU3 A;  1TNP A;  3VRR A;  4XJK A;  2K7C A;  2PMY A;  4L9M A;  2PYQ A;  1PVA A;  1UHI A;  2LMT A;  3FE9 A;  3DVJ A;  1EH2 A;  1S1E A;  1F55 A;  3TS5 B;  2R2I A;  2PRU A;  1NX3 A;  3C1V A;  1XFY O;  3BUW B;  3SG7 A;  5EL2 A;  4YBH B;  2L51 A; 
#chains in the Genus database with same CATH homology
 4N5X A;  3CWG A;  1DF0 B;  1L2O C;  1NPQ A;  1YTZ C;  1J7R A;  1XFZ O;  1DTL A;  5HKY A;  2M97 A;  3FIA A;  4YGE B;  3KHE A;  2ZNE A;  1S5G Z;  1SMG A;  1QV0 A;  1IH0 A;  4MEW A;  1NCY A;  1YUT A;  1PK0 D;  3D0Y A;  2JTT A;  1X02 A;  2KI4 B;  3EVR A;  1REC A;  4MZL A;  4C0J A;  4GBA A;  4CFQ A;  2LHI A;  3WHU B;  2L98 A;  3ZWH A;  1CLL A;  5GQQ C;  2Q91 A;  2NLN A;  1NIW A;  4Q04 A;  1KFX S;  1DJG A;  1FW4 A;  1MUX A;  1PSB A;  2BKI B;  3D10 A;  4UPG A;  1PRW A;  1QS7 A;  1AUI B;  1W7J B;  1WRK A;  3BOW A;  1ZAC A;  1MXE A;  1M45 A;  3GK1 A;  3VGO A;  1JBA A;  4PDZ A;  2FCE A;  1OSA A;  3NSI A;  2LAN A;  2KFF A;  3I5F C;  1Y1X A;  2HET A;  2FOT A;  2FJU B;  2G2B A;  2B1U A;  3IF7 A;  1QX5 B;  2LV7 A;  1XA5 A;  4MRY A;  5JOL A;  5HKW A;  1JFJ A;  1TTX A;  2BBN A;  3I5G C;  1J7O A;  2CNP A;  3KPX A;  1GJY A;  2Y1N A;  3LLE A;  1UHH A;  4BY5 A;  3ICB A;  3PN7 C;  1DMO A;  1EL4 A;  1YX8 A;  2WCB A;  3VRP A;  2QAC A;  2BKH B;  4MRX A;  5CSF A;  1XVJ A;  2A4J A;  1FF1 A;  1YUS A;  1B7T Y;  2ZND A;  1SL8 A;  3DF0 A;  4JPZ B;  1L7Z A;  2F3Z A;  2Y1M A;  3PFV A;  1Y1A A;  1UUR A;  2EC6 C;  2BL0 B;  3JVT B;  5I2Q A;  2K2A A;  2LMU A;  1AJ4 A;  2L4I A;  2BBM A;  1MHO A;  1N2D A;  4PAL A;  1LIN A;  1CLB A;  2O5G A;  3OX5 A;  3FWB A;  3CR2 A;  3LK1 A;  3JTD B;  2LUC A;  1PAL A;  1LA3 A;  4HRH A;  1TOP A;  3E3R A;  2ZKM X;  2GGZ A;  1B8L A;  2KBM A;  1RK9 A;  4AQJ A;  3O2P A;  1S5G Y;  4PHM A;  4MLW A;  1KK7 Y;  4HRG A;  4AOM A;  2H61 C;  4CLN A;  2BEC A;  4N1F A;  3NSK A;  4NQG A;  3SG2 A;  1G8I A;  4PHN A;  4NDB A;  1AHR A;  3EVU A;  3BUX B;  4M2P A;  1C7V A;  4N1G A;  4P5O E;  3VRN A;  1WDC C;  3O6B A;  3K21 A;  4JQ0 D;  2OS8 C;  5I2L A;  1CNP A;  2F33 A;  5CPV A;  3SG4 A;  1SRA A;  1NYA A;  2M7N A;  1DT7 B;  4MZK A;  4CPV A;  3PSR A;  1R2U A;  4I5K A;  1JWD A;  1QLK A;  2EGD A;  2JC2 A;  2JNX A;  2SCP A;  3I5I B;  2KQ6 A;  3RLZ A;  3HCM A;  1YR5 A;  1W7I B;  1Y1U A;  1BR4 B;  1QIV A;  4F0Z B;  3JTD C;  1QLS A;  1A4P A;  1KSO A;  2CCM A;  3BQ3 A;  1SKT A;  4GGF A;  1SL7 A;  1XFU O;  2JWW A;  2NCO A;  2F3Y A;  2LUX A;  1WRL A;  2M8U A;  1CFD A;  2JZI A;  3TDU A;  1F54 A;  3EVV A;  2LHL A;  1JSA A;  2JTZ A;  1NX2 A;  1KQV A;  1K9K A;  2PAL A;  4JWQ A;  5IBW A;  1G33 A;  4IL1 A;  1OMV A;  2LVJ A;  1BG1 A;  1WDC B;  2KI6 D;  3OHM B;  2ZFD A;  2FCD A;  3I5H B;  3I5H C;  1AK8 A;  2I2R E;  1M46 A;  1WY9 A;  1B47 A;  1TNQ A;  1MWN A;  4C0K A;  1BJF A;  4NDD A;  1GQM A;  1UHN A;  2Y5I A;  1CTR A;  2OTG B;  1WRZ A;  2JQ6 A;  1YVL A;  4OV2 A;  1BR1 B;  4QJ5 B;  1U5I A;  1RRO A;  2WOS A;  2ISD A;  4MBE A;  2OPO A;  2ZN8 A;  4WQ3 A;  5F6T A;  1HT9 A;  1FPW A;  4HSZ A;  1NCX A;  4YGD B;  2PAS A;  3RM1 A;  2L5X B;  3PM8 A;  1S6C A;  1D1O A;  1QV1 A;  2WOR A;  2K7D A;  2BL0 C;  3JVT C;  4PE1 A;  1S3P A;  4XYN A;  5J3X A;  4DCK A;  1DGU A;  1BF5 A;  5AXI A;  1CMF A;  2H2K A;  4OCI A;  1KCY A;  2CXJ A;  1J1D A;  2JT8 A;  4DUQ A;  2MAZ A;  5AEQ A;  2I18 A;  3A4U B;  1OZS A;  2KNE A;  5CSN A;  1OMR A;  3CGA A;  3AKA A;  1NUB A;  4NDC A;  1Y6W A;  1BOD A;  2K7O A;  2E6W A;  2MA2 A;  4GGF C;  2L2E A;  1KFU L;  1IWQ A;  1EG3 A;  2LAP A;  2LP3 A;  3I5G B;  1SCM B;  3OX6 A;  3AAJ A;  1BT6 A;  1QVI Z;  3CLN A;  1J55 A;  3DVE A;  3VRO A;  1H8B A;  2EHB A;  3EK4 A;  1TCO B;  4R1E A;  3SIB A;  1QX7 A;  2K2F A;  4FQO A;  3TZ1 A;  5I2O A;  3CZT X;  3SG5 A;  4QJ4 B;  1KK8 B;  4ZCV A;  3OB1 B;  3GOF A;  3GK4 X;  1QIW A;  1PSR A;  1QX2 A;  1OE9 B;  2JPT A;  2KQY A;  4YRU A;  1SY9 A;  3DVM A;  2HQW A;  4A4B A;  3H4S E;  1B7T Z;  1KWO C;  5B8I B;  2LVK A;  2JRF A;  1IJ6 A;  1PUL A;  1ZFS A;  4ORC B;  1BOC A;  1SYM A;  2D8N A;  1K96 A;  3I5F B;  1K93 D;  1NX0 A;  1SBJ A;  2M49 B;  1NSH A;  5CSI A;  4CID A;  1CM4 A;  2WC8 A;  1FBV A;  1CDL A;  1G4Y R;  1JF0 A;  2L4H A;  1SCM C;  1U5I B;  2Y4Q A;  5BPJ A;  2AMI A;  2ZRS A;  1K95 A;  2Q4U A;  1DF0 A;  1XFW O;  2L50 A;  1TCF A;  1CDM A;  1YX7 A;  1J7P A;  1K90 D;  2LLT A;  1KQM C;  1DJY A;  2M0R A;  4AQI A;  3OP0 A;  2ZRT A;  4MVF A;  1TIZ A;  2LLS A;  1DGV A;  2F2P A;  2LNK A;  4YGC B;  3FS7 A;  2H61 A;  3O78 A;  2MJW B;  1BMO A;  2WCE A;  1CM1 A;  1R6P A;  1S36 A;  3DVK A;  4PE7 A;  2LMV A;  5HYD A;  1GGW A;  1K8U A;  5DKR A;  4HRE E;  1K2H A;  1IKU A;  2KYF A;  1SNL A;  4P2Y B;  3IQO A;  2G9B A;  1CMG A;  1OMD A;  1CFP A;  2LVV A;  1SPY A;  2CT9 A;  3D0Y B;  1SW8 A;  1JF2 A;  1FI5 A;  1JFK A;  1LVC D;  1F8H A;  1IQ3 A;  3FWC A;  1ZMZ A;  5AFP A;  2KBI A;  2LE9 B;  2HPS A;  1EG4 A;  4YGB B;  1CDN A;  2KI4 C;  3AKB A;  3PAL A;  1RTP 1;  1SR6 B;  2K61 A;  1J1E A;  1SR6 C;  1SK6 D;  4YI8 A;  1B9A A;  1EXR A;  1KQM B;  2BCA A;  2M29 A;  1B8C A;  3DF0 B;  1C07 A;  1TRF A;  1QAT A;  5HLO A;  3TUY C;  1JC2 A;  2L0P A;  5ER4 X;  1NP8 A;  1XK4 A;  2HF5 A;  4ZCU A;  1IJ5 A;  1OOJ A;  1ZUZ A;  2PVB A;  1IGV A;  1K94 A;  1F70 A;  1N0Y A;  1K9P A;  1HQV A;  2E30 A;  2LCP A;  2F8P A;  3O4Y A;  1A2X A;  1UUS A;  3IQQ A;  3WHT B;  2JT0 A;  3LL8 B;  1UP5 A;  4PE4 A;  1NX1 A;  1CDP A;  3M0W A;  4GPL B;  3SG3 A;  2V53 A;  2VRG A;  4PCW A;  1UWO A;  1KFU S;  1KFX L;  1RJV A;  3BOW B;  1DJZ A;  1GGZ A;  1CLM A;  3SG6 A;  2JOJ A;  4I5L B;  4A4C A;  1QTX A;  1TNX A;  1B1G A;  1CFF A;  2COL B;  2LC5 A;  3CR4 X;  1UHJ A;  5HKZ A;  1XK4 C;  4GFT A;  1KK8 C;  4YI9 A;  1M63 B;  1CB1 A;  2MLE C;  4MZJ A;  4C0L A;  4PHK A;  4ETO A;  1IRJ A;  5DKQ A;  1YUU A;  1QVI Y;  1KWO B;  2I94 A;  3AAK A;  1TN4 A;  3KO0 A;  2KSP A;  1DJI A;  2K7B A;  1XYD A;  1QJT A;  4OVN F;  1DVI A;  2RGI A;  4E68 A;  4TNC A;  3CR5 X;  3WXA A;  2JT3 A;  1YRT B;  2M9G A;  3CS1 A;  1XFV O;  1LA0 A;  4PE0 A;  4PHJ A;  2GV5 A;  2MLF C;  4OR9 B;  1ODB A;  1ALV A;  5CSJ A;  5KTY A;  2JXC A;  1JUO A;  1RFJ A;  2AUC A;  1NCZ A;  1EJ3 A;  1E8A A;  3VRQ A;  3EK7 A;  3EK8 A;  2KGB C;  1AJ5 A;  1F71 A;  4M2Q A;  1OZO A;  2WND A;  5D7F A;  4D1E A;  4MN0 A;  1UHK A;  5TNC A;  2MBX A;  1K9U A;  1A29 A;  1V1G A;  1SL9 A;  5DKN A;  2KGR A;  2QPT A;  5ER5 A;  3PAT A;  4DS7 A;  1DJX A;  3TDI A;  1LXF C;  1CFC A;  2KAX A;  2KOT A;  1YUR A;  3BUN B;  2MHH A;  3EKJ A;  2SAS A;  2MRD A;  3I5I C;  4GGN A;  1AVS A;  3WNX B;  2LLU A;  4YGA A;  1YRU B;  1DJW A;  1TNW A;  3NSL A;  2AAO A;  2DOQ A;  3KF9 A;  5KU1 A;  1WLM A;  1MR8 A;  2M1K B;  3BYA A;  1S26 D;  1SCV A;  5JJG A;  2I7A A;  4MSP A;  1F4O A;  2JXL A;  4DIR A;  4QJ3 B;  3GK2 A;  2KYC A;  1XO5 A;  3A8R A;  4DRW A;  3MSE B;  2KI6 C;  3BUM B;  3BUO B;  3BXK A;  4BY4 A;  1XFX O;  1RWY A;  4I5J A;  3SJS A;  1Y0V H;  3NXA A;  4WRI A;  4U8D A;  5PAL A;  1A03 A;  1QXP A;  2K0J A;  2OS8 B;  3KEV A;  4ORB B;  1MQ1 A;  2F2O A;  1Q80 A;  1L2O B;  1PVB A;  3NSO A;  4OKH A;  4XJK B;  2KFG A;  2TN4 A;  2M7L A;  2KDH A;  3F45 A;  2KHN A;  3CTN A;  4M2O A;  1A75 B;  1F4Q A;  2HQ8 A;  2LP2 A;  2O60 A;  1BLQ A;  1CKK A;  5D69 A;  1B8R A;  1KSM A;  1DJH A;  4ORA B;  1S6I A;  3DD4 A;  1M31 A;  3OB2 B;  4GUK A;  1M39 A;  5AAN A;  3LK0 A;  2BCB A;  1IQ5 A;  2CTN A;  5HLV A;  2JUL A;  2LVI A;  3TS5 C;  2IS9 A;  1AP4 A;  2KAV A;  4WQ2 A;  1WLZ A;  5I8N A;  2ZN9 A;  4CFR A;  3LCP C;  2NCP A;  1MF8 B;  1QAS A;  3TUY B;  1OQP A;  5K89 A;  1V1F A;  1LKJ A;  2GGM A;  2LM5 A;  2K8M B;  5KSZ A;  2EC6 B;  1KK7 Z;  1VRK A;  2BE4 A;  2PSR A;  4I5N B;  4ICB A;  1ZOT B;  1N65 A;  3SIA A;  1B4C A;  2M3W A;  2M1U A;  1YVH A;  2P6B B;  4GAO A;  2WCF A;  2OTG C;  1FI6 A;  1MXL C;  1C7W A;  1IG5 A;  3ZNI A;  1ALW A;  4USL A;  3HX4 A;  5AER A;  3PLF B;  3PN7 B;  1S6J A;  5FYX A;  1H4B A;  2CBL A;  2JNF A;  1NWD A;  2NXQ A;  1A75 A;  2BCX A;  4GNK B;  5G08 A;  4FTG A;  2NZ0 A;  2BE6 A;  3EKH A;  2JU0 A;  2KAY A;  2KFH A;  3QRX A;  3TDZ A;  1J7Q A;  1BU3 A;  1TNP A;  3VRR A;  4XJK A;  2K7C A;  2PMY A;  4L9M A;  1EH2 A;  1PVA A;  1UHI A;  2LMT A;  3DVJ A;  1S1E A;  3TS5 B;  2R2I A;  2PRU A;  1NX3 A;  3C1V A;  1XFY O;  3BUW B;  3SG7 A;  1F55 A;  4YBH B;  2L51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...