2I2RE

Crystal structure of the kchip1/kv4.3 t1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
GLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGAYTYPVLAEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily D member 3
publication title Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer
pubmed doi rcsb
source organism Rattus norvegicus
total genus 54
structure length 179
sequence length 179
chains with identical sequence F, G, H, M, N, O, P
ec nomenclature
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13202 EF-hand_5 EF hand
E PF13499 EF-hand_7 EF-hand domain pair
E PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i2rE00
1RROA 3TDUA 1ALVA 3CR4X 5FYXA 2Q91A 2LVJA 1CM4A 1KFXL 2B1UA 2JZIA 1WDCB 5B8IB 1A4PA 2K2FA 2G9BA 3NSOA 1QTXA 1CDLA 3GK2A 4XJKA 1IH0A 5I2QA 4YGEB 2LMVA 5AFPA 4P5OE 3QRXA 4MRXA 1UHIA 1UWOA 2K7BA 3D0YB 1A75B 1OZOA 5K89A 4YRUA 1F8HA 2OTGB 3GK4X 1QIVA 1QLSA 1MUXA 2OS8B 2OPOA 1FW4A 2GV5A 2LC5A 3M0WA 2LHLA 1DVIA 5HLOA 1A29A 1IWQA 2PRUA 2Y1NA 3ZNIA 2BECA 3DF0A 2F2OA 2O5GA 2ZNDA 4PALA 1JF2A 5HKWA 1NIWA 2KYCA 2M49B 1RTP1 3PN7C 3SIAA 1K9PA 1M63B 1J7OA 1YURA 2E30A 2JU0A 2LVVA 1CFFA 1RK9A 1KSOA 2RGIA 2WNDA 2VRGA 4QJ5B 3WXAA 1LINA 1SL7A 2HETA 2KHNA 1DF0A 1K8UA 2JC2A 1IJ5A 1HT9A 1OQPA 1RECA 2M3WA 5I2OA 4ZCVA 4XJKB 1GGZA 2JULA 3BQ3A 2V53A 2EGDA 4PDZA 1BMOA 2BCAA 2QACA 2A4JA 4OVNF 2NCOA 4PE4A 2K7OA 4USLA 5D7FA 1S5GY 1K93D 1S26D 1QJTA 3CTNA 1J7RA 2AUCA 3HX4A 1X02A 1R6PA 1IGVA 1GJYA 2L98A 3OP0A 1WRLA 1XYDA 1KFUL 1YR5A 2LMTA 1PULA 2L51A 2Q4UA 3VROA 3RLZA 1NSHA 1S5GZ 4DCKA 3DF0B 1KSMA 2H61C 1YUSA 2LP2A 1NX3A 2I94A 3A4UB 4OCIA 1QV0A 2PASA 3PALA 1NPQA 1J1EA 2I2RE 3I5GB 3BUOB 4NDCA 1WY9A 4CPVA 2OTGC 1JC2A 2KI6D 4CIDA 1D1OA 4CFQA 3GOFA 2EHBA 1DF0B 4M2PA 1KK8C 1S6JA 1B9AA 1K90D 1BODA 4CFRA 3LL8B 1MF8B 4MZLA 2CCMA 4XYNA 4PHMA 2M29A 4WQ3A 1EG3A 3MSEB 3NSKA 3EK7A 1L7ZA 5G08A 5CSFA 1NCXA 5AXIA 4MSPA 2CBLA 3LCPC 3CZTX 2D8NA 2F8PA 2JXLA 3PSRA 5DKRA 1M31A 4JWQA 1MXLC 1NYAA 2LP3A 5CSNA 1BOCA 2CNPA 1BG1A 1TNWA 5DKNA 1F55A 2H61A 2PSRA 1K9UA 1NX1A 3OB1B 2LLSA 4TNCA 2JTTA 3BUNB 1AJ5A 5I2LA 4PE1A 4GBAA 5HKYA 2ZRSA 1QASA 1K2HA 2QPTA 1LA3A 4C0JA 2O60A 4MZKA 1YUUA 4NDDA 1SL8A 4GNKB 1B4CA 1TRFA 3VRQA 1GQMA 1BT6A 1CFDA 4WRIA 5J3XA 2R2IA 1PSBA 1R2UA 1DJHA 1XA5A 4N1GA 2JRFA 1Y0VH 1CDNA 1CMFA 1DJXA 3GK1A 2IS9A 4NQGA 1NP8A 1ALWA 4C0LA 2JQ6A 3I5GC 5HKZA 4UPGA 1PALA 4AQIA 2KQ6A 1QXPA 3AKBA 2JPTA 3E3RA 3TDZA 1ZFSA 2LVKA 2LCPA 1WLZA 1KQMC 1QATA 1F54A 3OB2B 4JQ0D 4ORBB 2Y5IA 2K61A 5JOLA 4I5JA 3FS7A 4N5XA 1BLQA 1AHRA 2AMIA 1XVJA 1B8RA 2K8MB 1OE9B 1KQVA 4A4CA 3EK8A 4MRYA 4YGCB 1CFCA 1RWYA 4HREE 4DRWA 3TUYB 1XFWO 1XO5A 2LANA 1UURA 2PVBA 4HRHA 5F6TA 5KTYA 1EG4A 1TNQA 3JTDC 2ZFDA 5HLVA 3CR2A 3TS5C 4I5KA 2M97A 1JUOA 1QV1A 4YBHB 1KK8B 1ODBA 1XFYO 4MN0A 4GGNA 2L5XB 2JOJA 3JVTB 1MQ1A 1TCOB 2JNXA 2KYFA 4PE7A 2KNEA 4R1EA 2CT9A 3FWBA 2KFFA 3SG4A 2BCBA 3LK0A 2P6BB 1JFKA 1IRJA 2F33A 4PE0A 4PHJA 1OMVA 1CLLA 2M1KB 4E68A 5DKQA 1AP4A 2BL0C 1TNXA 1IG5A 3EVVA 4OR9B 1G4YR 1BU3A 1CLMA 1XFXO 1ZOTB 3DVEA 1DTLA 1S3PA 1SYMA 2LMUA 3SG7A 2MLEC 3SJSA 1YRUB 4C0KA 5KU1A 3BOWA 3KF9A 2HPSA 3I5IC 4M2OA 4PHKA 1MHOA 1QVIZ 3TZ1A 1DJGA 2ZKMX 1OSAA 2KAVA 5AEQA 1FI5A 1NCZA 2WOSA 3FWCA 4HRGA 5HYDA 3KPXA 2WCBA 1PK0D 2L4IA 1HQVA 2FCEA 4M2QA 2L0PA 2E6WA 1QX2A 1XK4C 2KI6C 4WQ2A 5CSJA 1A03A 3KO0A 1NX2A 2K7DA 3CS1A 2MHHA 4FQOA 3TUYC 1FF1A 1KQMB 3F45A 2BE4A 2Y4QA 1C7WA 2LLTA 1DGVA 1NUBA 2G2BA 2Y1MA 3PFVA 2LUXA 1J1DA 2WC8A 1PVBA 3I5HC 3JVTC 4PCWA 1KCYA 2KSPA 1OMRA 1S36A 2H2KA 1OZSA 1U5IA 3BOWB 4YGBB 3H4SE 4MZJA 1Y1AA 1CDMA 1CNPA 1UHJA 4GUKA 2F3ZA 2AAOA 1FI6A 1TIZA 2ISDA 3JTDB 3TS5B 2M7NA 1WRKA 3WHUB 2WORA 2MJWB 1QX5B 2MAZA 1YVLA 2BBNA 2LUCA 1CDPA 2CTNA 1F4OA 2F2PA 2LM5A 3I5FC 3OHMB 4JPZB 1XK4A 3A8RA 4OV2A 3SG6A 3BUXB 1RFJA 1LA0A 2BCXA 1TCFA 3IQQA 3NXAA 2JT0A 2COLB 4GAOA 1B47A 3KEVA 2M8UA 4QJ3B 1UP5A 2FCDA 3CR5X 4ORCB 1L2OC 2I18A 1JFJA 2BL0B 3PATA 1SKTA 4YGAA 2KQYA 4BY5A 4DS7A 1NX0A 3O4YA 2TN4A 1YVHA 2SCPA 1SCMC 3CGAA 5TNCA 4AOMA 3SG2A 1ZUZA 1JWDA 4Q04A 2KGBC 1M45A 1U5IB 2EC6C 1M39A 1N2DA 3I5IB 4CLNA 2KAXA 1GGWA 1DJZA 2PALA 1H8BA 1EL4A 1AVSA 2KFGA 2ZNEA 1Y6WA 1BR4B 1KK7Z 4OKHA 1Q80A 4I5NB 1TN4A 4DUQA 1E8AA 1CTRA 1UHHA 1B8LA 4ZCUA 1ZACA 1LVCD 1LXFC 2DOQA 2F3YA 4IL1A 3SG5A 1BJFA 1CB1A 1YUTA 3VRPA 2BKHB 2NLNA 4ICBA 1CM1A 4L9MA 1MWNA 3NSIA 1N0YA 1F70A 2LLUA 1W7IB 3TDIA 2BKIB 4AQJA 2JXCA 2PMYA 4MEWA 5IBWA 1J7PA 1KFXS 1Y1UA 3NSLA 4ORAB 1SBJA 2FJUB 3I5HB 2KI4C 1JBAA 1S1EA 4GPLB 2KAYA 5ER5A 1IKUA 3EKHA 1RJVA 2ZRTA 3CLNA 1BF5A 1JF0A 1SR6C 4MLWA 3IQOA 2L4HA 3OX5A 1AUIB 1B7TY 1W7JB 3HCMA 1FBVA 5GQQC 2M9GA 1TOPA 1MXEA 4BY4A 3EVUA 3ZWHA 2ZN8A 1SNLA 2I7AA 3EVRA 1QVIY 2K2AA 1TNPA 1CLBA 2KOTA 4A4BA 1Y1XA 1WRZA 1ZMZA 1B7TZ 3AKAA 2KGRA 3I5FB 1BR1B 1XFVO 2SASA 2KBMA 2HQWA 1J7QA 1B8CA 1K96A 1V1FA 5CPVA 2HQ8A 2KFHA 2HF5A 3DVMA 1SCVA 1QIWA 1J55A 3FIAA 1C7VA 1TTXA 1L2OB 3O6BA 1PSRA 1XFUO 1EXRA 4MBEA 1H4BA 1S6IA 1N65A 1SCMB 3BYAA 5CSIA 2M7LA 1KWOC 1SRAA 4U8DA 2EC6B 2JWWA 2NXQA 5PALA 3SIBA 1QX7A 1DJIA 3WHTB 1WLMA 1NWDA 4GGFC 1F71A 3AAKA 3CWGA 2K0JA 2BE6A 1NCYA 2LE9B 3SG3A 2M1UA 5BPJA 3KHEA 3O2PA 3PLFB 3WNXB 1EH2A 1WDCC 2M0RA 3RM1A 3EK4A 3DVJA 1SK6D 3LLEA 1KFUS 1UHNA 2LHIA 1DJYA 2JNFA 2KBIA 4P2YB 5I8NA 1F4QA 1K9KA 2CXJA 2ZN9A 1AJ4A 1OOJA 1CMGA 1M46A 1K94A 1K95A 2GGZA 1UUSA 1V1GA 1A2XA 2NCPA 1QLKA 4PHNA 4YI8A 3DVKA 1OMDA 2FOTA 2OS8C 1AK8A 2MLFC 4N1FA 1LKJA 1SY9A 1IQ3A 4DIRA 2LVIA 1YRTB 2KI4B 1DJWA 1SMGA 4I5LB 1G33A 3LK1A 1SR6B 3D10A 1G8IA 2WCFA 3ICBA 3BUWB 1PVAA 1SW8A 4GGFA 1DT7B 2NZ0A 2JT8A 5D69A 3K21A 4GFTA 1JSAA 2LAPA 2LV7A 1PRWA 4YGDB 1B1GA 2JTZA 1QS7A 1CKKA 5KSZA 1IJ6A 1DMOA 3O78A 4MVFA 1KK7Y 5AERA 4NDBA 2K7CA 4HSZA 1XFZO 1YX7A 1MR8A 1EJ3A 2L2EA 3EKJA 3PN7B 3D0YA 1UHKA 4FTGA 1A75A 2MA2A 4YI9A 1YTZC 2MRDA 2LNKA 2KDHA 1IQ5A 1SPYA 2MBXA 3BUMB 3C1VA 3VGOA 5JJGA 1CFPA 1VRKA 3BXKA 1SL9A 3DD4A 3VRRA 3OX6A 5ER4X 1FPWA 2L50A 2WCEA 2JT3A 3AAJA 2GGMA 4F0ZB 1C07A 3PM8A 3VRNA 2BBMA 1S6CA 1KWOB 4QJ4B 4ETOA 1YX8A 5AANA 1DGUA 4D1EA 3IF7A
chains in the Genus database with same CATH superfamily
3DXLA 1RROA 3TDUA 1ALVA 1TWOA 3CR4X 5FYXA 2Q91A 2LVJA 1CM4A 1KFXL 2GTEA 2B1UA 2JZIA 1WDCB 5B8IB 1A4PA 2K2FA 2G9BA 1OOIX 1QTXA 1CDLA 3GK2A 3FE6A 3NSOA 4XJKA 3DYEA 5I2QA 4YGEB 1IH0A 2LMVA 5AFPA 4P5OE 3QRXA 4MRXA 1UHIA 1UWOA 1OOFA 2K7BA 3D0YB 1A75B 1OOGA 1OZOA 4YRUA 5K89A 1F8HA 1SSEB 2OTGB 3GK4X 1QIVA 1QLSA 1MUXA 1DEKA 2OS8B 3UO9A 2OPOA 1FW4A 2GV5A 2LC5A 3M0WA 2LHLA 1DVIA 5HLOA 1A29A 1IWQA 2PRUA 2Y1NA 3ZNIA 2BECA 3DF0A 2F2OA 3RZSA 3CYZA 2O5GA 2ZNDA 4PALA 1JF2A 5HKWA 1NIWA 2KYCA 2M49B 1RTP1 3PN7C 3SIAA 1K9PA 1M63B 1J7OA 1YURA 2E30A 2JU0A 2LVVA 1CFFA 1RK9A 1KSOA 2RGIA 2WNDA 2VRGA 4QJ5B 3WXAA 1LINA 1SL7A 2HETA 2KHNA 1DF0A 1K8UA 2JC2A 1IJ5A 1HT9A 1OQPA 1RECA 1XFRA 2M3WA 5I2OA 4ZCVA 4XJKB 1GGZA 2JULA 3BQ3A 2V53A 2EGDA 4PDZA 1BMOA 2BCAA 2QACA 2A4JA 4OVNF 2NCOA 2PQLA 2K7OA 4PE4A 4USLA 5D7FA 1S5GY 2WCMA 1K93D 1GM0A 1S26D 1QJTA 3CTNA 1J7RA 2AUCA 1TUZA 3EG5B 3HX4A 3UNWA 1X02A 1R6PA 1IGVA 1GJYA 2L98A 3OP0A 3BFBA 1WRLA 1XYDA 1KFUL 1YR5A 2LMTA 3S0DA 1PULA 2L51A 2Q4UA 3VROA 3L47A 3RLZA 1NSHA 3D73A 1S5GZ 4DCKA 3DF0B 1KSMA 2H61C 1YUSA 2LP2A 1DELA 3D76A 1NX3A 2I94A 3A4UB 4OCIA 1QV0A 2PASA 3PALA 1NPQA 1J1EA 2KPHA 2I2RE 5I94A 3I5GB 3BUOB 4NDCA 1WY9A 4CPVA 2OTGC 1JC2A 2KI6D 4CIDA 1D1OA 3R72A 4CFQA 3GOFA 2EHBA 1DF0B 4M2PA 1KK8C 1S6JA 1B9AA 1K90D 1BODA 4CFRA 3LL8B 1MF8B 4MZLA 2CCMA 2KLEA 4XYNA 3O4XA 4PHMA 2M29A 4WQ3A 1EG3A 3MSEB 2PYQA 3NSKA 3EK7A 1L7ZA 5G08A 2FJYA 5CSFA 1NCXA 3D77A 1ORGA 4MSPA 2CBLA 5AXIA 3LCPC 3CZTX 1IIOA 2D8NA 2F8PA 3S0BA 2JXLA 3PSRA 3NHTA 5DKRA 1M31A 4JWQA 1MXLC 1NYAA 2LP3A 5CSNA 1BOCA 2CNPA 1BG1A 1TNWA 5DKNA 1F55A 2H61A 3BFAA 4INWA 4IJ7A 2PSRA 1K9UA 1NX1A 3OB1B 2LLSA 4TNCA 2JTTA 3BUNB 1AJ5A 5I2LA 4PE1A 4GBAA 5HKYA 2ZRSA 1QASA 1K2HA 2QPTA 1LA3A 4C0JA 2O60A 4MZKA 1YUUA 4NDDA 1SL8A 4GNKB 1B4CA 1TRFA 3VRQA 1GQMA 1BT6A 1CFDA 4WRIA 5J3XA 2R2IA 1PSBA 1R2UA 1DJHA 1XA5A 4N1GA 2JRFA 1Y0VH 1CDNA 1CMFA 1DJXA 3GK1A 2IS9A 4NQGA 1NP8A 1QWVA 3VB1A 1ALWA 2WC6A 2JQ6A 3CABA 4C0LA 3I5GC 5FI7A 5HKZA 1PALA 4AQIA 2KQ6A 4UPGA 1QXPA 3AKBA 2JPTA 3E3RA 3TDZA 3S0FA 1ZFSA 2LVKA 2LCPA 1WLZA 3SS4A 1KQMC 3IVTA 1QATA 1F54A 2QDIA 2ERBA 3OB2B 4JQ0D 4ORBB 2Y5IA 2K61A 5JOLA 4I5JA 3FS7A 4N5XA 1BLQA 1AHRA 3SS3A 3L4AA 2AMIA 1XVJA 1B8RA 2K8MB 1OE9B 3K1EA 1KQVA 3SS5A 4A4CA 3EK8A 4MRYA 4YGCB 1CFCA 2L2CA 1RWYA 3B86A 1Z2CB 2P70A 3B7AA 3CDNA 4HREE 3TUYB 4DRWA 1XFWO 1XO5A 2LANA 1UURA 2PVBA 3QMEA 4HRHA 5F6TA 1EG4A 1TNQA 5KTYA 3JTDC 2ZFDA 5HLVA 3CR2A 3TS5C 3PM2A 4I5KA 2M97A 1JUOA 1QV1A 4YBHB 1KK8B 1ODBA 1XFYO 4MN0A 4GGNA 2L5YA 2L5XB 2H8VA 2JOJA 3JVTB 1MQ1A 1TCOB 2JNXA 2KYFA 4PE7A 2KNEA 4R1EA 2CT9A 3FWBA 2KFFA 3SG4A 2BCBA 3LK0A 2P6BB 1JFKA 1IRJA 2F33A 4PE0A 4PHJA 1OMVA 1CLLA 2M1KB 4E68A 5DKQA 5FI2A 1AP4A 2BNXA 2BL0C 1TNXA 1IG5A 3EVVA 4OR9B 1G4YR 1BU3A 1CLMA 1XFXO 1ZOTB 3DVEA 1DTLA 1S3PA 1SYMA 2LMUA 3SG7A 1C3YA 2MLEC 3SJSA 1YRUB 4C0KA 5KU1A 3BOWA 3KF9A 2WCJA 2HPSA 3I5IC 4M2OA 4PHKA 1MHOA 1QVIZ 3TZ1A 1DJGA 2ZKMX 1OSAA 2KAVA 5AEQA 1FI5A 1NCZA 2WOSA 3PJIA 3FWCA 4HRGA 5HYDA 3KPXA 2WCBA 1TUJA 1PK0D 2L4IA 1HQVA 2FCEA 4M2QA 2L0PA 2E6WA 1QX2A 1XK4C 2KI6C 4WQ2A 5CSJA 1A03A 3KO0A 1NX2A 3DY9A 2K7DA 3CS1A 2MHHA 4FQOA 3TUYC 1FF1A 1OW4A 1KQMB 2YGUA 3F45A 2BE4A 2Y4QA 1C7WA 3CZ1A 1OOHA 2LLTA 1DGVA 3BJHA 1Z4HA 1NUBA 2G2BA 2Y1MA 3PFVA 2LUXA 1J1DA 2WC8A 1PVBA 3I5HC 3JVTC 4PCWA 1KCYA 2KSPA 1OMRA 1S36A 5HL1A 2H2KA 1OZSA 1U5IA 3BOWB 4YGBB 3H4SE 4MZJA 1Y1AA 1CDMA 1CNPA 1UHJA 2QEHA 4GUKA 2F3ZA 2AAOA 1FI6A 1TIZA 2ISDA 3JTDB 3TS5B 2M7NA 1WRKA 3WHUB 2WORA 2MJWB 1QX5B 2MAZA 1YVLA 2BBNA 2LUCA 1CDPA 2CTNA 1F4OA 2F2PA 2LM5A 4PT1A 3I5FC 3OHMB 4JPZB 1XK4A 3A8RA 4OV2A 3SG6A 3BUXB 1RFJA 1LA0A 2BCXA 1TCFA 3IQQA 3NXAA 5EL2A 1C3ZA 2JT0A 2COLB 4GAOA 1B47A 2QEVA 3KEVA 2M8UA 4OZDA 4QJ3B 1UP5A 2FCDA 3CR5X 4ORCB 1L2OC 2I18A 1JFJA 1DC1A 2BL0B 3PATA 1SKTA 4YGAA 2KQYA 4BY5A 4DS7A 1NX0A 3O4YA 2TN4A 1YVHA 2SCPA 1SCMC 3CGAA 5TNCA 4AOMA 3SG2A 1ZUZA 1JWDA 4Q04A 2KGBC 1M45A 1U5IB 2EC6C 1M39A 1N2DA 3I5IB 4CLNA 2KAXA 1GGWA 1DJZA 2PALA 1H8BA 1EL4A 1AVSA 2KFGA 2ZNEA 2QEOA 1Y6WA 1BR4B 1KK7Z 3FE8A 4OKHA 1Q80A 4I5NB 1TN4A 4DUQA 1E8AA 1CTRA 4FQTA 1UHHA 1B8LA 4ZCUA 1ZACA 1LVCD 1LXFC 2DOQA 2F3YA 4IL1A 3SG5A 1BJFA 1CB1A 1YUTA 3VRPA 2BKHB 2NLNA 4ICBA 1CM1A 4L9MA 1MWNA 3NSIA 1N0YA 3Q8IA 1F70A 2LLUA 1W7IB 3TDIA 2BKIB 2WCLA 4INXA 4AQJA 2KLDA 2JXCA 2WCKA 2PMYA 4MEWA 5IBWA 1J7PA 4KYNA 1KFXS 1Y1UA 3NSLA 4ORAB 1SBJA 2FJUB 3I5HB 2KI4C 1JBAA 1S1EA 4GPLB 2KAYA 5ER5A 1IKUA 3EKHA 3N7HA 1RJVA 2ZRTA 3CLNA 1BF5A 1JF0A 1SR6C 4MLWA 3IQOA 2L4HA 3OX5A 1AUIB 1B7TY 1W7JB 3HCMA 1FBVA 2BAPA 5GQQC 2M9GA 1TOPA 1MXEA 4BY4A 3EVUA 3ZWHA 2ZN8A 1SNLA 2I7AA 3EVRA 1QVIY 2K2AA 1TNPA 1CLBA 2KOTA 4A4BA 1Y1XA 3L4LA 1WRZA 1ZMZA 1B7TZ 3AKAA 2KGRA 3I5FB 4JKTA 1BR1B 1XFVO 2SASA 2KBMA 1P28A 2HQWA 1J7QA 1B8CA 1K96A 1V1FA 5CPVA 3S0EA 2HQ8A 2KFHA 3NGVA 2HF5A 3DVMA 1SCVA 1QIWA 1J55A 3FIAA 3R1OA 1C7VA 2JPOA 1TTXA 1L2OB 3O6BA 1PSRA 2QEBA 1XFUO 1EXRA 3CZ2A 4MBEA 1H4BA 2WC5A 1S6IA 3B87A 1N65A 1SCMB 3BYAA 5CSIA 2M7LA 1KWOC 2P71A 1SRAA 4U8DA 2EC6B 2JWWA 1W9ZA 2NXQA 5PALA 3SIBA 1QX7A 1DJIA 3WHTB 1WLMA 1NWDA 4GGFC 1F71A 3AAKA 3CWGA 2K0JA 2BE6A 1NCYA 2LE9B 3SG3A 2M1UA 5BPJA 3KHEA 3O2PA 3PLFB 3WNXB 1EH2A 1WDCC 2M0RA 3RM1A 3EK4A 3DVJA 3FE9A 1SK6D 3LLEA 1KFUS 1UHNA 2K60A 2LHIA 3D75A 1DJYA 2JNFA 2KBIA 4P2YB 5I8NA 1F4QA 1K9KA 2CXJA 2ZN9A 5FI6A 1AJ4A 1OOJA 1CMGA 1M46A 1K94A 1K95A 2GGZA 1UUSA 1V1GA 1A2XA 2NCPA 1QLKA 4PHNA 4YI8A 3DVKA 1OMDA 2FOTA 2OS8C 1AK8A 2MLFC 4N1FA 1LKJA 1SY9A 1IQ3A 3D78A 3OGNA 4DIRA 2LVIA 1YRTB 2KI4B 1DJWA 1SMGA 3OBVA 4I5LB 1G33A 3LK1A 5D3OA 1SR6B 3D10A 1G8IA 2WCFA 3ICBA 3BUWB 1PVAA 1SW8A 4GGFA 1DT7B 2NZ0A 3V2LA 1LS8A 2JT8A 3BFHA 5D69A 4JD9A 3K21A 4GFTA 1JSAA 2LAPA 2LV7A 1PRWA 4YGDB 1B1GA 2JTZA 1QS7A 5DICA 1CKKA 5KSZA 3DZTA 3B6XA 1IJ6A 2WCHA 1DMOA 3O78A 4MVFA 1KK7Y 5AERA 4NDBA 3NHIA 2K7CA 4HSZA 1XFZO 1YX7A 1MR8A 1EJ3A 2L2EA 3EKJA 1DQEA 3PN7B 3D0YA 1UHKA 4FTGA 1A75A 2MA2A 4YI9A 1YTZC 2MRDA 2LNKA 1T14A 3CZ0A 2KDHA 1IQ5A 1SPYA 2MBXA 3BUMB 3C1VA 3R1VA 3VGOA 4F7FA 5JJGA 3S0AA 1CFPA 1VRKA 3BXKA 1SL9A 3DD4A 3VRRA 3OX6A 5ER4X 1FPWA 2L50A 2WCEA 2JT3A 3AAJA 2GGMA 4F0ZB 1C07A 3B88A 3PM8A 3VRNA 2BBMA 3S0GA 1S6CA 1KWOB 3R1PA 4QJ4B 4ETOA 1YX8A 5AANA 1DGUA 4D1EA 3D74A 3IF7A
chains in the Genus database with same CATH topology
1RROA 3TDUA 1ALVA 3CR4X 5FYXA 2Q91A 2LVJA 1CM4A 1KFXL 2B1UA 2JZIA 1WDCB 5B8IB 1A4PA 2K2FA 2G9BA 3NSOA 1QTXA 1CDLA 3GK2A 4XJKA 1IH0A 5I2QA 4YGEB 2LMVA 5AFPA 4P5OE 3QRXA 4MRXA 1UHIA 1UWOA 2K7BA 3D0YB 1A75B 1OZOA 5K89A 4YRUA 1F8HA 2OTGB 3GK4X 1QIVA 1QLSA 1MUXA 2OS8B 2OPOA 1FW4A 2GV5A 2LC5A 3M0WA 2LHLA 1DVIA 5HLOA 1A29A 1IWQA 2PRUA 2Y1NA 3ZNIA 2BECA 3DF0A 2F2OA 2O5GA 2ZNDA 4PALA 1JF2A 5HKWA 1NIWA 2KYCA 2M49B 1RTP1 3PN7C 3SIAA 1K9PA 1M63B 1J7OA 1YURA 2E30A 2JU0A 2LVVA 1CFFA 1RK9A 1KSOA 2RGIA 2WNDA 2VRGA 4QJ5B 3WXAA 1LINA 1SL7A 2HETA 2KHNA 1DF0A 1K8UA 2JC2A 1IJ5A 1HT9A 1OQPA 1RECA 2M3WA 5I2OA 4ZCVA 4XJKB 1GGZA 2JULA 3BQ3A 2V53A 2EGDA 4PDZA 1BMOA 2BCAA 2QACA 2A4JA 4OVNF 2NCOA 4PE4A 2K7OA 4USLA 5D7FA 1S5GY 1K93D 1S26D 1QJTA 3CTNA 1J7RA 2AUCA 3HX4A 1X02A 1R6PA 1IGVA 1GJYA 2L98A 3OP0A 1WRLA 1XYDA 1KFUL 1YR5A 2LMTA 1PULA 2L51A 2Q4UA 3VROA 3RLZA 1NSHA 1S5GZ 4DCKA 3DF0B 1KSMA 2H61C 1YUSA 2LP2A 1NX3A 2I94A 3A4UB 4OCIA 1QV0A 2PASA 3PALA 1NPQA 1J1EA 2I2RE 3I5GB 3BUOB 4NDCA 1WY9A 4CPVA 2OTGC 1JC2A 2KI6D 4CIDA 1D1OA 4CFQA 3GOFA 2EHBA 1DF0B 4M2PA 1KK8C 1S6JA 1B9AA 1K90D 1BODA 4CFRA 3LL8B 1MF8B 4MZLA 2CCMA 4XYNA 4PHMA 2M29A 4WQ3A 1EG3A 3MSEB 3NSKA 3EK7A 1L7ZA 5G08A 5CSFA 1NCXA 5AXIA 4MSPA 2CBLA 3LCPC 3CZTX 2D8NA 2F8PA 2JXLA 3PSRA 5DKRA 1M31A 4JWQA 1MXLC 1NYAA 2LP3A 5CSNA 1BOCA 2CNPA 1BG1A 1TNWA 5DKNA 1F55A 2H61A 2PSRA 1K9UA 1NX1A 3OB1B 2LLSA 4TNCA 2JTTA 3BUNB 1AJ5A 5I2LA 4PE1A 4GBAA 5HKYA 2ZRSA 1QASA 1K2HA 2QPTA 1LA3A 4C0JA 2O60A 4MZKA 1YUUA 4NDDA 1SL8A 4GNKB 1B4CA 1TRFA 3VRQA 1GQMA 1BT6A 1CFDA 4WRIA 5J3XA 2R2IA 1PSBA 1R2UA 1DJHA 1XA5A 4N1GA 2JRFA 1Y0VH 1CDNA 1CMFA 1DJXA 3GK1A 2IS9A 4NQGA 1NP8A 1ALWA 4C0LA 2JQ6A 3I5GC 5HKZA 4UPGA 1PALA 4AQIA 2KQ6A 1QXPA 3AKBA 2JPTA 3E3RA 3TDZA 1ZFSA 2LVKA 2LCPA 1WLZA 1KQMC 1QATA 1F54A 3OB2B 4JQ0D 4ORBB 2Y5IA 2K61A 5JOLA 4I5JA 3FS7A 4N5XA 1BLQA 1AHRA 2AMIA 1XVJA 1B8RA 2K8MB 1OE9B 1KQVA 4A4CA 3EK8A 4MRYA 4YGCB 1CFCA 1RWYA 4HREE 4DRWA 3TUYB 1XFWO 1XO5A 2LANA 1UURA 2PVBA 4HRHA 5F6TA 5KTYA 1EG4A 1TNQA 3JTDC 2ZFDA 5HLVA 3CR2A 3TS5C 4I5KA 2M97A 1JUOA 1QV1A 4YBHB 1KK8B 1ODBA 1XFYO 4MN0A 4GGNA 2L5XB 2JOJA 3JVTB 1MQ1A 1TCOB 2JNXA 2KYFA 4PE7A 2KNEA 4R1EA 2CT9A 3FWBA 2KFFA 3SG4A 2BCBA 3LK0A 2P6BB 1JFKA 1IRJA 2F33A 4PE0A 4PHJA 1OMVA 1CLLA 2M1KB 4E68A 5DKQA 1AP4A 2BL0C 1TNXA 1IG5A 3EVVA 4OR9B 1G4YR 1BU3A 1CLMA 1XFXO 1ZOTB 3DVEA 1DTLA 1S3PA 1SYMA 2LMUA 3SG7A 2MLEC 3SJSA 1YRUB 4C0KA 5KU1A 3BOWA 3KF9A 2HPSA 3I5IC 4M2OA 4PHKA 1MHOA 1QVIZ 3TZ1A 1DJGA 2ZKMX 1OSAA 2KAVA 5AEQA 1FI5A 1NCZA 2WOSA 3FWCA 4HRGA 5HYDA 3KPXA 2WCBA 1PK0D 2L4IA 1HQVA 2FCEA 4M2QA 2L0PA 2E6WA 1QX2A 1XK4C 2KI6C 4WQ2A 5CSJA 1A03A 3KO0A 1NX2A 2K7DA 3CS1A 2MHHA 4FQOA 3TUYC 1FF1A 1KQMB 3F45A 2BE4A 2Y4QA 1C7WA 2LLTA 1DGVA 1NUBA 2G2BA 2Y1MA 3PFVA 2LUXA 1J1DA 2WC8A 1PVBA 3I5HC 3JVTC 4PCWA 1KCYA 2KSPA 1OMRA 1S36A 2H2KA 1OZSA 1U5IA 3BOWB 4YGBB 3H4SE 4MZJA 1Y1AA 1CDMA 1CNPA 1UHJA 4GUKA 2F3ZA 2AAOA 1FI6A 1TIZA 2ISDA 3JTDB 3TS5B 2M7NA 1WRKA 3WHUB 2WORA 2MJWB 1QX5B 2MAZA 1YVLA 2BBNA 2LUCA 1CDPA 2CTNA 1F4OA 2F2PA 2LM5A 3I5FC 3OHMB 4JPZB 1XK4A 3A8RA 4OV2A 3SG6A 3BUXB 1RFJA 1LA0A 2BCXA 1TCFA 3IQQA 3NXAA 2JT0A 2COLB 4GAOA 1B47A 3KEVA 2M8UA 4QJ3B 1UP5A 2FCDA 3CR5X 4ORCB 1L2OC 2I18A 1JFJA 2BL0B 3PATA 1SKTA 4YGAA 2KQYA 4BY5A 4DS7A 1NX0A 3O4YA 2TN4A 1YVHA 2SCPA 1SCMC 3CGAA 5TNCA 4AOMA 3SG2A 1ZUZA 1JWDA 4Q04A 2KGBC 1M45A 1U5IB 2EC6C 1M39A 1N2DA 3I5IB 4CLNA 2KAXA 1GGWA 1DJZA 2PALA 1H8BA 1EL4A 1AVSA 2KFGA 2ZNEA 1Y6WA 1BR4B 1KK7Z 4OKHA 1Q80A 4I5NB 1TN4A 4DUQA 1E8AA 1CTRA 1UHHA 1B8LA 4ZCUA 1ZACA 1LVCD 1LXFC 2DOQA 2F3YA 4IL1A 3SG5A 1BJFA 1CB1A 1YUTA 3VRPA 2BKHB 2NLNA 4ICBA 1CM1A 4L9MA 1MWNA 3NSIA 1N0YA 1F70A 2LLUA 1W7IB 3TDIA 2BKIB 4AQJA 2JXCA 2PMYA 4MEWA 5IBWA 1J7PA 1KFXS 1Y1UA 3NSLA 4ORAB 1SBJA 2FJUB 3I5HB 2KI4C 1JBAA 1S1EA 4GPLB 2KAYA 5ER5A 1IKUA 3EKHA 1RJVA 2ZRTA 3CLNA 1BF5A 1JF0A 1SR6C 4MLWA 3IQOA 2L4HA 3OX5A 1AUIB 1B7TY 1W7JB 3HCMA 1FBVA 5GQQC 2M9GA 1TOPA 1MXEA 4BY4A 3EVUA 3ZWHA 2ZN8A 1SNLA 2I7AA 3EVRA 1QVIY 2K2AA 1TNPA 1CLBA 2KOTA 4A4BA 1Y1XA 1WRZA 1ZMZA 1B7TZ 3AKAA 2KGRA 3I5FB 1BR1B 1XFVO 2SASA 2KBMA 2HQWA 1J7QA 1B8CA 1K96A 1V1FA 5CPVA 2HQ8A 2KFHA 2HF5A 3DVMA 1SCVA 1QIWA 1J55A 3FIAA 1C7VA 1TTXA 1L2OB 3O6BA 1PSRA 1XFUO 1EXRA 4MBEA 1H4BA 1S6IA 1N65A 1SCMB 3BYAA 5CSIA 2M7LA 1KWOC 1SRAA 4U8DA 2EC6B 2JWWA 2NXQA 5PALA 3SIBA 1QX7A 1DJIA 3WHTB 1WLMA 1NWDA 4GGFC 1F71A 3AAKA 3CWGA 2K0JA 2BE6A 1NCYA 2LE9B 3SG3A 2M1UA 5BPJA 3KHEA 3O2PA 3PLFB 3WNXB 1EH2A 1WDCC 2M0RA 3RM1A 3EK4A 3DVJA 1SK6D 3LLEA 1KFUS 1UHNA 2LHIA 1DJYA 2JNFA 2KBIA 4P2YB 5I8NA 1F4QA 1K9KA 2CXJA 2ZN9A 1AJ4A 1OOJA 1CMGA 1M46A 1K94A 1K95A 2GGZA 1UUSA 1V1GA 1A2XA 2NCPA 1QLKA 4PHNA 4YI8A 3DVKA 1OMDA 2FOTA 2OS8C 1AK8A 2MLFC 4N1FA 1LKJA 1SY9A 1IQ3A 4DIRA 2LVIA 1YRTB 2KI4B 1DJWA 1SMGA 4I5LB 1G33A 3LK1A 1SR6B 3D10A 1G8IA 2WCFA 3ICBA 3BUWB 1PVAA 1SW8A 4GGFA 1DT7B 2NZ0A 2JT8A 5D69A 3K21A 4GFTA 1JSAA 2LAPA 2LV7A 1PRWA 4YGDB 1B1GA 2JTZA 1QS7A 1CKKA 5KSZA 1IJ6A 1DMOA 3O78A 4MVFA 1KK7Y 5AERA 4NDBA 2K7CA 4HSZA 1XFZO 1YX7A 1MR8A 1EJ3A 2L2EA 3EKJA 3PN7B 3D0YA 1UHKA 4FTGA 1A75A 2MA2A 4YI9A 1YTZC 2MRDA 2LNKA 2KDHA 1IQ5A 1SPYA 2MBXA 3BUMB 3C1VA 3VGOA 5JJGA 1CFPA 1VRKA 3BXKA 1SL9A 3DD4A 3VRRA 3OX6A 5ER4X 1FPWA 2L50A 2WCEA 2JT3A 3AAJA 2GGMA 4F0ZB 1C07A 3PM8A 3VRNA 2BBMA 1S6CA 1KWOB 4QJ4B 4ETOA 1YX8A 5AANA 1DGUA 4D1EA 3IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRO A;  3TDU A;  1ALV A;  3CR4 X;  5FYX A;  2Q91 A;  2LVJ A;  1CM4 A;  1KFX L;  2B1U A;  2JZI A;  1WDC B;  5B8I B;  1A4P A;  2K2F A;  2G9B A;  3NSO A;  1QTX A;  1CDL A;  3GK2 A;  4XJK A;  1IH0 A;  5I2Q A;  4YGE B;  2LMV A;  5AFP A;  4P5O E;  3QRX A;  4MRX A;  1UHI A;  1UWO A;  2K7B A;  3D0Y B;  1A75 B;  1OZO A;  5K89 A;  4YRU A;  1F8H A;  2OTG B;  3GK4 X;  1QIV A;  1QLS A;  1MUX A;  2OS8 B;  2OPO A;  1FW4 A;  2GV5 A;  2LC5 A;  3M0W A;  2LHL A;  1DVI A;  5HLO A;  1A29 A;  1IWQ A;  2PRU A;  2Y1N A;  3ZNI A;  2BEC A;  3DF0 A;  2F2O A;  2O5G A;  2ZND A;  4PAL A;  1JF2 A;  5HKW A;  1NIW A;  2KYC A;  2M49 B;  1RTP 1;  3PN7 C;  3SIA A;  1K9P A;  1M63 B;  1J7O A;  1YUR A;  2E30 A;  2JU0 A;  2LVV A;  1CFF A;  1RK9 A;  1KSO A;  2RGI A;  2WND A;  2VRG A;  4QJ5 B;  3WXA A;  1LIN A;  1SL7 A;  2HET A;  2KHN A;  1DF0 A;  1K8U A;  2JC2 A;  1IJ5 A;  1HT9 A;  1OQP A;  1REC A;  2M3W A;  5I2O A;  4ZCV A;  4XJK B;  1GGZ A;  2JUL A;  3BQ3 A;  2V53 A;  2EGD A;  4PDZ A;  1BMO A;  2BCA A;  2QAC A;  2A4J A;  4OVN F;  2NCO A;  4PE4 A;  2K7O A;  4USL A;  5D7F A;  1S5G Y;  1K93 D;  1S26 D;  1QJT A;  3CTN A;  1J7R A;  2AUC A;  3HX4 A;  1X02 A;  1R6P A;  1IGV A;  1GJY A;  2L98 A;  3OP0 A;  1WRL A;  1XYD A;  1KFU L;  1YR5 A;  2LMT A;  1PUL A;  2L51 A;  2Q4U A;  3VRO A;  3RLZ A;  1NSH A;  1S5G Z;  4DCK A;  3DF0 B;  1KSM A;  2H61 C;  1YUS A;  2LP2 A;  1NX3 A;  2I94 A;  3A4U B;  4OCI A;  1QV0 A;  2PAS A;  3PAL A;  1NPQ A;  1J1E A;  2I2R E;  3I5G B;  3BUO B;  4NDC A;  1WY9 A;  4CPV A;  2OTG C;  1JC2 A;  2KI6 D;  4CID A;  1D1O A;  4CFQ A;  3GOF A;  2EHB A;  1DF0 B;  4M2P A;  1KK8 C;  1S6J A;  1B9A A;  1K90 D;  1BOD A;  4CFR A;  3LL8 B;  1MF8 B;  4MZL A;  2CCM A;  4XYN A;  4PHM A;  2M29 A;  4WQ3 A;  1EG3 A;  3MSE B;  3NSK A;  3EK7 A;  1L7Z A;  5G08 A;  5CSF A;  1NCX A;  5AXI A;  4MSP A;  2CBL A;  3LCP C;  3CZT X;  2D8N A;  2F8P A;  2JXL A;  3PSR A;  5DKR A;  1M31 A;  4JWQ A;  1MXL C;  1NYA A;  2LP3 A;  5CSN A;  1BOC A;  2CNP A;  1BG1 A;  1TNW A;  5DKN A;  1F55 A;  2H61 A;  2PSR A;  1K9U A;  1NX1 A;  3OB1 B;  2LLS A;  4TNC A;  2JTT A;  3BUN B;  1AJ5 A;  5I2L A;  4PE1 A;  4GBA A;  5HKY A;  2ZRS A;  1QAS A;  1K2H A;  2QPT A;  1LA3 A;  4C0J A;  2O60 A;  4MZK A;  1YUU A;  4NDD A;  1SL8 A;  4GNK B;  1B4C A;  1TRF A;  3VRQ A;  1GQM A;  1BT6 A;  1CFD A;  4WRI A;  5J3X A;  2R2I A;  1PSB A;  1R2U A;  1DJH A;  1XA5 A;  4N1G A;  2JRF A;  1Y0V H;  1CDN A;  1CMF A;  1DJX A;  3GK1 A;  2IS9 A;  4NQG A;  1NP8 A;  1ALW A;  4C0L A;  2JQ6 A;  3I5G C;  5HKZ A;  4UPG A;  1PAL A;  4AQI A;  2KQ6 A;  1QXP A;  3AKB A;  2JPT A;  3E3R A;  3TDZ A;  1ZFS A;  2LVK A;  2LCP A;  1WLZ A;  1KQM C;  1QAT A;  1F54 A;  3OB2 B;  4JQ0 D;  4ORB B;  2Y5I A;  2K61 A;  5JOL A;  4I5J A;  3FS7 A;  4N5X A;  1BLQ A;  1AHR A;  2AMI A;  1XVJ A;  1B8R A;  2K8M B;  1OE9 B;  1KQV A;  4A4C A;  3EK8 A;  4MRY A;  4YGC B;  1CFC A;  1RWY A;  4HRE E;  4DRW A;  3TUY B;  1XFW O;  1XO5 A;  2LAN A;  1UUR A;  2PVB A;  4HRH A;  5F6T A;  5KTY A;  1EG4 A;  1TNQ A;  3JTD C;  2ZFD A;  5HLV A;  3CR2 A;  3TS5 C;  4I5K A;  2M97 A;  1JUO A;  1QV1 A;  4YBH B;  1KK8 B;  1ODB A;  1XFY O;  4MN0 A;  4GGN A;  2L5X B;  2JOJ A;  3JVT B;  1MQ1 A;  1TCO B;  2JNX A;  2KYF A;  4PE7 A;  2KNE A;  4R1E A;  2CT9 A;  3FWB A;  2KFF A;  3SG4 A;  2BCB A;  3LK0 A;  2P6B B;  1JFK A;  1IRJ A;  2F33 A;  4PE0 A;  4PHJ A;  1OMV A;  1CLL A;  2M1K B;  4E68 A;  5DKQ A;  1AP4 A;  2BL0 C;  1TNX A;  1IG5 A;  3EVV A;  4OR9 B;  1G4Y R;  1BU3 A;  1CLM A;  1XFX O;  1ZOT B;  3DVE A;  1DTL A;  1S3P A;  1SYM A;  2LMU A;  3SG7 A;  2MLE C;  3SJS A;  1YRU B;  4C0K A;  5KU1 A;  3BOW A;  3KF9 A;  2HPS A;  3I5I C;  4M2O A;  4PHK A;  1MHO A;  1QVI Z;  3TZ1 A;  1DJG A;  2ZKM X;  1OSA A;  2KAV A;  5AEQ A;  1FI5 A;  1NCZ A;  2WOS A;  3FWC A;  4HRG A;  5HYD A;  3KPX A;  2WCB A;  1PK0 D;  2L4I A;  1HQV A;  2FCE A;  4M2Q A;  2L0P A;  2E6W A;  1QX2 A;  1XK4 C;  2KI6 C;  4WQ2 A;  5CSJ A;  1A03 A;  3KO0 A;  1NX2 A;  2K7D A;  3CS1 A;  2MHH A;  4FQO A;  3TUY C;  1FF1 A;  1KQM B;  3F45 A;  2BE4 A;  2Y4Q A;  1C7W A;  2LLT A;  1DGV A;  1NUB A;  2G2B A;  2Y1M A;  3PFV A;  2LUX A;  1J1D A;  2WC8 A;  1PVB A;  3I5H C;  3JVT C;  4PCW A;  1KCY A;  2KSP A;  1OMR A;  1S36 A;  2H2K A;  1OZS A;  1U5I A;  3BOW B;  4YGB B;  3H4S E;  4MZJ A;  1Y1A A;  1CDM A;  1CNP A;  1UHJ A;  4GUK A;  2F3Z A;  2AAO A;  1FI6 A;  1TIZ A;  2ISD A;  3JTD B;  3TS5 B;  2M7N A;  1WRK A;  3WHU B;  2WOR A;  2MJW B;  1QX5 B;  2MAZ A;  1YVL A;  2BBN A;  2LUC A;  1CDP A;  2CTN A;  1F4O A;  2F2P A;  2LM5 A;  3I5F C;  3OHM B;  4JPZ B;  1XK4 A;  3A8R A;  4OV2 A;  3SG6 A;  3BUX B;  1RFJ A;  1LA0 A;  2BCX A;  1TCF A;  3IQQ A;  3NXA A;  2JT0 A;  2COL B;  4GAO A;  1B47 A;  3KEV A;  2M8U A;  4QJ3 B;  1UP5 A;  2FCD A;  3CR5 X;  4ORC B;  1L2O C;  2I18 A;  1JFJ A;  2BL0 B;  3PAT A;  1SKT A;  4YGA A;  2KQY A;  4BY5 A;  4DS7 A;  1NX0 A;  3O4Y A;  2TN4 A;  1YVH A;  2SCP A;  1SCM C;  3CGA A;  5TNC A;  4AOM A;  3SG2 A;  1ZUZ A;  1JWD A;  4Q04 A;  2KGB C;  1M45 A;  1U5I B;  2EC6 C;  1M39 A;  1N2D A;  3I5I B;  4CLN A;  2KAX A;  1GGW A;  1DJZ A;  2PAL A;  1H8B A;  1EL4 A;  1AVS A;  2KFG A;  2ZNE A;  1Y6W A;  1BR4 B;  1KK7 Z;  4OKH A;  1Q80 A;  4I5N B;  1TN4 A;  4DUQ A;  1E8A A;  1CTR A;  1UHH A;  1B8L A;  4ZCU A;  1ZAC A;  1LVC D;  1LXF C;  2DOQ A;  2F3Y A;  4IL1 A;  3SG5 A;  1BJF A;  1CB1 A;  1YUT A;  3VRP A;  2BKH B;  2NLN A;  4ICB A;  1CM1 A;  4L9M A;  1MWN A;  3NSI A;  1N0Y A;  1F70 A;  2LLU A;  1W7I B;  3TDI A;  2BKI B;  4AQJ A;  2JXC A;  2PMY A;  4MEW A;  5IBW A;  1J7P A;  1KFX S;  1Y1U A;  3NSL A;  4ORA B;  1SBJ A;  2FJU B;  3I5H B;  2KI4 C;  1JBA A;  1S1E A;  4GPL B;  2KAY A;  5ER5 A;  1IKU A;  3EKH A;  1RJV A;  2ZRT A;  3CLN A;  1BF5 A;  1JF0 A;  1SR6 C;  4MLW A;  3IQO A;  2L4H A;  3OX5 A;  1AUI B;  1B7T Y;  1W7J B;  3HCM A;  1FBV A;  5GQQ C;  2M9G A;  1TOP A;  1MXE A;  4BY4 A;  3EVU A;  3ZWH A;  2ZN8 A;  1SNL A;  2I7A A;  3EVR A;  1QVI Y;  2K2A A;  1TNP A;  1CLB A;  2KOT A;  4A4B A;  1Y1X A;  1WRZ A;  1ZMZ A;  1B7T Z;  3AKA A;  2KGR A;  3I5F B;  1BR1 B;  1XFV O;  2SAS A;  2KBM A;  2HQW A;  1J7Q A;  1B8C A;  1K96 A;  1V1F A;  5CPV A;  2HQ8 A;  2KFH A;  2HF5 A;  3DVM A;  1SCV A;  1QIW A;  1J55 A;  3FIA A;  1C7V A;  1TTX A;  1L2O B;  3O6B A;  1PSR A;  1XFU O;  1EXR A;  4MBE A;  1H4B A;  1S6I A;  1N65 A;  1SCM B;  3BYA A;  5CSI A;  2M7L A;  1KWO C;  1SRA A;  4U8D A;  2EC6 B;  2JWW A;  2NXQ A;  5PAL A;  3SIB A;  1QX7 A;  1DJI A;  3WHT B;  1WLM A;  1NWD A;  4GGF C;  1F71 A;  3AAK A;  3CWG A;  2K0J A;  2BE6 A;  1NCY A;  2LE9 B;  3SG3 A;  2M1U A;  5BPJ A;  3KHE A;  3O2P A;  3PLF B;  3WNX B;  1EH2 A;  1WDC C;  2M0R A;  3RM1 A;  3EK4 A;  3DVJ A;  1SK6 D;  3LLE A;  1KFU S;  1UHN A;  2LHI A;  1DJY A;  2JNF A;  2KBI A;  4P2Y B;  5I8N A;  1F4Q A;  1K9K A;  2CXJ A;  2ZN9 A;  1AJ4 A;  1OOJ A;  1CMG A;  1M46 A;  1K94 A;  1K95 A;  2GGZ A;  1UUS A;  1V1G A;  1A2X A;  2NCP A;  1QLK A;  4PHN A;  4YI8 A;  3DVK A;  1OMD A;  2FOT A;  2OS8 C;  1AK8 A;  2MLF C;  4N1F A;  1LKJ A;  1SY9 A;  1IQ3 A;  4DIR A;  2LVI A;  1YRT B;  2KI4 B;  1DJW A;  1SMG A;  4I5L B;  1G33 A;  3LK1 A;  1SR6 B;  3D10 A;  1G8I A;  2WCF A;  3ICB A;  3BUW B;  1PVA A;  1SW8 A;  4GGF A;  1DT7 B;  2NZ0 A;  2JT8 A;  5D69 A;  3K21 A;  4GFT A;  1JSA A;  2LAP A;  2LV7 A;  1PRW A;  4YGD B;  1B1G A;  2JTZ A;  1QS7 A;  1CKK A;  5KSZ A;  1IJ6 A;  1DMO A;  3O78 A;  4MVF A;  1KK7 Y;  5AER A;  4NDB A;  2K7C A;  4HSZ A;  1XFZ O;  1YX7 A;  1MR8 A;  1EJ3 A;  2L2E A;  3EKJ A;  3PN7 B;  3D0Y A;  1UHK A;  4FTG A;  1A75 A;  2MA2 A;  4YI9 A;  1YTZ C;  2MRD A;  2LNK A;  2KDH A;  1IQ5 A;  1SPY A;  2MBX A;  3BUM B;  3C1V A;  3VGO A;  5JJG A;  1CFP A;  1VRK A;  3BXK A;  1SL9 A;  3DD4 A;  3VRR A;  3OX6 A;  5ER4 X;  1FPW A;  2L50 A;  2WCE A;  2JT3 A;  3AAJ A;  2GGM A;  4F0Z B;  1C07 A;  3PM8 A;  3VRN A;  2BBM A;  1S6C A;  1KWO B;  4QJ4 B;  4ETO A;  1YX8 A;  5AAN A;  1DGU A;  4D1E A;  3IF7 A; 
#chains in the Genus database with same CATH topology
 3DXL A;  1RRO A;  3TDU A;  1ALV A;  1TWO A;  3CR4 X;  5FYX A;  2Q91 A;  2LVJ A;  1CM4 A;  1KFX L;  2GTE A;  2B1U A;  2JZI A;  1WDC B;  5B8I B;  1A4P A;  2K2F A;  2G9B A;  1OOI X;  1QTX A;  1CDL A;  3GK2 A;  3FE6 A;  3NSO A;  4XJK A;  3DYE A;  5I2Q A;  4YGE B;  1IH0 A;  2LMV A;  5AFP A;  4P5O E;  3QRX A;  4MRX A;  1UHI A;  1UWO A;  1OOF A;  2K7B A;  3D0Y B;  1A75 B;  1OOG A;  1OZO A;  4YRU A;  5K89 A;  1F8H A;  1SSE B;  2OTG B;  3GK4 X;  1QIV A;  1QLS A;  1MUX A;  1DEK A;  2OS8 B;  3UO9 A;  2OPO A;  1FW4 A;  2GV5 A;  2LC5 A;  3M0W A;  2LHL A;  1DVI A;  5HLO A;  1A29 A;  1IWQ A;  2PRU A;  2Y1N A;  3ZNI A;  2BEC A;  3DF0 A;  2F2O A;  3RZS A;  3CYZ A;  2O5G A;  2ZND A;  4PAL A;  1JF2 A;  5HKW A;  1NIW A;  2KYC A;  2M49 B;  1RTP 1;  3PN7 C;  3SIA A;  1K9P A;  1M63 B;  1J7O A;  1YUR A;  2E30 A;  2JU0 A;  2LVV A;  1CFF A;  1RK9 A;  1KSO A;  2RGI A;  2WND A;  2VRG A;  4QJ5 B;  3WXA A;  1LIN A;  1SL7 A;  2HET A;  2KHN A;  1DF0 A;  1K8U A;  2JC2 A;  1IJ5 A;  1HT9 A;  1OQP A;  1REC A;  1XFR A;  2M3W A;  5I2O A;  4ZCV A;  4XJK B;  1GGZ A;  2JUL A;  3BQ3 A;  2V53 A;  2EGD A;  4PDZ A;  1BMO A;  2BCA A;  2QAC A;  2A4J A;  4OVN F;  2NCO A;  2PQL A;  2K7O A;  4PE4 A;  4USL A;  5D7F A;  1S5G Y;  2WCM A;  1K93 D;  1GM0 A;  1S26 D;  1QJT A;  3CTN A;  1J7R A;  2AUC A;  1TUZ A;  3EG5 B;  3HX4 A;  3UNW A;  1X02 A;  1R6P A;  1IGV A;  1GJY A;  2L98 A;  3OP0 A;  3BFB A;  1WRL A;  1XYD A;  1KFU L;  1YR5 A;  2LMT A;  3S0D A;  1PUL A;  2L51 A;  2Q4U A;  3VRO A;  3L47 A;  3RLZ A;  1NSH A;  3D73 A;  1S5G Z;  4DCK A;  3DF0 B;  1KSM A;  2H61 C;  1YUS A;  2LP2 A;  1DEL A;  3D76 A;  1NX3 A;  2I94 A;  3A4U B;  4OCI A;  1QV0 A;  2PAS A;  3PAL A;  1NPQ A;  1J1E A;  2KPH A;  2I2R E;  5I94 A;  3I5G B;  3BUO B;  4NDC A;  1WY9 A;  4CPV A;  2OTG C;  1JC2 A;  2KI6 D;  4CID A;  1D1O A;  3R72 A;  4CFQ A;  3GOF A;  2EHB A;  1DF0 B;  4M2P A;  1KK8 C;  1S6J A;  1B9A A;  1K90 D;  1BOD A;  4CFR A;  3LL8 B;  1MF8 B;  4MZL A;  2CCM A;  2KLE A;  4XYN A;  3O4X A;  4PHM A;  2M29 A;  4WQ3 A;  1EG3 A;  3MSE B;  2PYQ A;  3NSK A;  3EK7 A;  1L7Z A;  5G08 A;  2FJY A;  5CSF A;  1NCX A;  3D77 A;  1ORG A;  4MSP A;  2CBL A;  5AXI A;  3LCP C;  3CZT X;  1IIO A;  2D8N A;  2F8P A;  3S0B A;  2JXL A;  3PSR A;  3NHT A;  5DKR A;  1M31 A;  4JWQ A;  1MXL C;  1NYA A;  2LP3 A;  5CSN A;  1BOC A;  2CNP A;  1BG1 A;  1TNW A;  5DKN A;  1F55 A;  2H61 A;  3BFA A;  4INW A;  4IJ7 A;  2PSR A;  1K9U A;  1NX1 A;  3OB1 B;  2LLS A;  4TNC A;  2JTT A;  3BUN B;  1AJ5 A;  5I2L A;  4PE1 A;  4GBA A;  5HKY A;  2ZRS A;  1QAS A;  1K2H A;  2QPT A;  1LA3 A;  4C0J A;  2O60 A;  4MZK A;  1YUU A;  4NDD A;  1SL8 A;  4GNK B;  1B4C A;  1TRF A;  3VRQ A;  1GQM A;  1BT6 A;  1CFD A;  4WRI A;  5J3X A;  2R2I A;  1PSB A;  1R2U A;  1DJH A;  1XA5 A;  4N1G A;  2JRF A;  1Y0V H;  1CDN A;  1CMF A;  1DJX A;  3GK1 A;  2IS9 A;  4NQG A;  1NP8 A;  1QWV A;  3VB1 A;  1ALW A;  2WC6 A;  2JQ6 A;  3CAB A;  4C0L A;  3I5G C;  5FI7 A;  5HKZ A;  1PAL A;  4AQI A;  2KQ6 A;  4UPG A;  1QXP A;  3AKB A;  2JPT A;  3E3R A;  3TDZ A;  3S0F A;  1ZFS A;  2LVK A;  2LCP A;  1WLZ A;  3SS4 A;  1KQM C;  3IVT A;  1QAT A;  1F54 A;  2QDI A;  2ERB A;  3OB2 B;  4JQ0 D;  4ORB B;  2Y5I A;  2K61 A;  5JOL A;  4I5J A;  3FS7 A;  4N5X A;  1BLQ A;  1AHR A;  3SS3 A;  3L4A A;  2AMI A;  1XVJ A;  1B8R A;  2K8M B;  1OE9 B;  3K1E A;  1KQV A;  3SS5 A;  4A4C A;  3EK8 A;  4MRY A;  4YGC B;  1CFC A;  2L2C A;  1RWY A;  3B86 A;  1Z2C B;  2P70 A;  3B7A A;  3CDN A;  4HRE E;  3TUY B;  4DRW A;  1XFW O;  1XO5 A;  2LAN A;  1UUR A;  2PVB A;  3QME A;  4HRH A;  5F6T A;  1EG4 A;  1TNQ A;  5KTY A;  3JTD C;  2ZFD A;  5HLV A;  3CR2 A;  3TS5 C;  3PM2 A;  4I5K A;  2M97 A;  1JUO A;  1QV1 A;  4YBH B;  1KK8 B;  1ODB A;  1XFY O;  4MN0 A;  4GGN A;  2L5Y A;  2L5X B;  2H8V A;  2JOJ A;  3JVT B;  1MQ1 A;  1TCO B;  2JNX A;  2KYF A;  4PE7 A;  2KNE A;  4R1E A;  2CT9 A;  3FWB A;  2KFF A;  3SG4 A;  2BCB A;  3LK0 A;  2P6B B;  1JFK A;  1IRJ A;  2F33 A;  4PE0 A;  4PHJ A;  1OMV A;  1CLL A;  2M1K B;  4E68 A;  5DKQ A;  5FI2 A;  1AP4 A;  2BNX A;  2BL0 C;  1TNX A;  1IG5 A;  3EVV A;  4OR9 B;  1G4Y R;  1BU3 A;  1CLM A;  1XFX O;  1ZOT B;  3DVE A;  1DTL A;  1S3P A;  1SYM A;  2LMU A;  3SG7 A;  1C3Y A;  2MLE C;  3SJS A;  1YRU B;  4C0K A;  5KU1 A;  3BOW A;  3KF9 A;  2WCJ A;  2HPS A;  3I5I C;  4M2O A;  4PHK A;  1MHO A;  1QVI Z;  3TZ1 A;  1DJG A;  2ZKM X;  1OSA A;  2KAV A;  5AEQ A;  1FI5 A;  1NCZ A;  2WOS A;  3PJI A;  3FWC A;  4HRG A;  5HYD A;  3KPX A;  2WCB A;  1TUJ A;  1PK0 D;  2L4I A;  1HQV A;  2FCE A;  4M2Q A;  2L0P A;  2E6W A;  1QX2 A;  1XK4 C;  2KI6 C;  4WQ2 A;  5CSJ A;  1A03 A;  3KO0 A;  1NX2 A;  3DY9 A;  2K7D A;  3CS1 A;  2MHH A;  4FQO A;  3TUY C;  1FF1 A;  1OW4 A;  1KQM B;  2YGU A;  3F45 A;  2BE4 A;  2Y4Q A;  1C7W A;  3CZ1 A;  1OOH A;  2LLT A;  1DGV A;  3BJH A;  1Z4H A;  1NUB A;  2G2B A;  2Y1M A;  3PFV A;  2LUX A;  1J1D A;  2WC8 A;  1PVB A;  3I5H C;  3JVT C;  4PCW A;  1KCY A;  2KSP A;  1OMR A;  1S36 A;  5HL1 A;  2H2K A;  1OZS A;  1U5I A;  3BOW B;  4YGB B;  3H4S E;  4MZJ A;  1Y1A A;  1CDM A;  1CNP A;  1UHJ A;  2QEH A;  4GUK A;  2F3Z A;  2AAO A;  1FI6 A;  1TIZ A;  2ISD A;  3JTD B;  3TS5 B;  2M7N A;  1WRK A;  3WHU B;  2WOR A;  2MJW B;  1QX5 B;  2MAZ A;  1YVL A;  2BBN A;  2LUC A;  1CDP A;  2CTN A;  1F4O A;  2F2P A;  2LM5 A;  4PT1 A;  3I5F C;  3OHM B;  4JPZ B;  1XK4 A;  3A8R A;  4OV2 A;  3SG6 A;  3BUX B;  1RFJ A;  1LA0 A;  2BCX A;  1TCF A;  3IQQ A;  3NXA A;  5EL2 A;  1C3Z A;  2JT0 A;  2COL B;  4GAO A;  1B47 A;  2QEV A;  3KEV A;  2M8U A;  4OZD A;  4QJ3 B;  1UP5 A;  2FCD A;  3CR5 X;  4ORC B;  1L2O C;  2I18 A;  1JFJ A;  1DC1 A;  2BL0 B;  3PAT A;  1SKT A;  4YGA A;  2KQY A;  4BY5 A;  4DS7 A;  1NX0 A;  3O4Y A;  2TN4 A;  1YVH A;  2SCP A;  1SCM C;  3CGA A;  5TNC A;  4AOM A;  3SG2 A;  1ZUZ A;  1JWD A;  4Q04 A;  2KGB C;  1M45 A;  1U5I B;  2EC6 C;  1M39 A;  1N2D A;  3I5I B;  4CLN A;  2KAX A;  1GGW A;  1DJZ A;  2PAL A;  1H8B A;  1EL4 A;  1AVS A;  2KFG A;  2ZNE A;  2QEO A;  1Y6W A;  1BR4 B;  1KK7 Z;  3FE8 A;  4OKH A;  1Q80 A;  4I5N B;  1TN4 A;  4DUQ A;  1E8A A;  1CTR A;  4FQT A;  1UHH A;  1B8L A;  4ZCU A;  1ZAC A;  1LVC D;  1LXF C;  2DOQ A;  2F3Y A;  4IL1 A;  3SG5 A;  1BJF A;  1CB1 A;  1YUT A;  3VRP A;  2BKH B;  2NLN A;  4ICB A;  1CM1 A;  4L9M A;  1MWN A;  3NSI A;  1N0Y A;  3Q8I A;  1F70 A;  2LLU A;  1W7I B;  3TDI A;  2BKI B;  2WCL A;  4INX A;  4AQJ A;  2KLD A;  2JXC A;  2WCK A;  2PMY A;  4MEW A;  5IBW A;  1J7P A;  4KYN A;  1KFX S;  1Y1U A;  3NSL A;  4ORA B;  1SBJ A;  2FJU B;  3I5H B;  2KI4 C;  1JBA A;  1S1E A;  4GPL B;  2KAY A;  5ER5 A;  1IKU A;  3EKH A;  3N7H A;  1RJV A;  2ZRT A;  3CLN A;  1BF5 A;  1JF0 A;  1SR6 C;  4MLW A;  3IQO A;  2L4H A;  3OX5 A;  1AUI B;  1B7T Y;  1W7J B;  3HCM A;  1FBV A;  2BAP A;  5GQQ C;  2M9G A;  1TOP A;  1MXE A;  4BY4 A;  3EVU A;  3ZWH A;  2ZN8 A;  1SNL A;  2I7A A;  3EVR A;  1QVI Y;  2K2A A;  1TNP A;  1CLB A;  2KOT A;  4A4B A;  1Y1X A;  3L4L A;  1WRZ A;  1ZMZ A;  1B7T Z;  3AKA A;  2KGR A;  3I5F B;  4JKT A;  1BR1 B;  1XFV O;  2SAS A;  2KBM A;  1P28 A;  2HQW A;  1J7Q A;  1B8C A;  1K96 A;  1V1F A;  5CPV A;  3S0E A;  2HQ8 A;  2KFH A;  3NGV A;  2HF5 A;  3DVM A;  1SCV A;  1QIW A;  1J55 A;  3FIA A;  3R1O A;  1C7V A;  2JPO A;  1TTX A;  1L2O B;  3O6B A;  1PSR A;  2QEB A;  1XFU O;  1EXR A;  3CZ2 A;  4MBE A;  1H4B A;  2WC5 A;  1S6I A;  3B87 A;  1N65 A;  1SCM B;  3BYA A;  5CSI A;  2M7L A;  1KWO C;  2P71 A;  1SRA A;  4U8D A;  2EC6 B;  2JWW A;  1W9Z A;  2NXQ A;  5PAL A;  3SIB A;  1QX7 A;  1DJI A;  3WHT B;  1WLM A;  1NWD A;  4GGF C;  1F71 A;  3AAK A;  3CWG A;  2K0J A;  2BE6 A;  1NCY A;  2LE9 B;  3SG3 A;  2M1U A;  5BPJ A;  3KHE A;  3O2P A;  3PLF B;  3WNX B;  1EH2 A;  1WDC C;  2M0R A;  3RM1 A;  3EK4 A;  3DVJ A;  3FE9 A;  1SK6 D;  3LLE A;  1KFU S;  1UHN A;  2K60 A;  2LHI A;  3D75 A;  1DJY A;  2JNF A;  2KBI A;  4P2Y B;  5I8N A;  1F4Q A;  1K9K A;  2CXJ A;  2ZN9 A;  5FI6 A;  1AJ4 A;  1OOJ A;  1CMG A;  1M46 A;  1K94 A;  1K95 A;  2GGZ A;  1UUS A;  1V1G A;  1A2X A;  2NCP A;  1QLK A;  4PHN A;  4YI8 A;  3DVK A;  1OMD A;  2FOT A;  2OS8 C;  1AK8 A;  2MLF C;  4N1F A;  1LKJ A;  1SY9 A;  1IQ3 A;  3D78 A;  3OGN A;  4DIR A;  2LVI A;  1YRT B;  2KI4 B;  1DJW A;  1SMG A;  3OBV A;  4I5L B;  1G33 A;  3LK1 A;  5D3O A;  1SR6 B;  3D10 A;  1G8I A;  2WCF A;  3ICB A;  3BUW B;  1PVA A;  1SW8 A;  4GGF A;  1DT7 B;  2NZ0 A;  3V2L A;  1LS8 A;  2JT8 A;  3BFH A;  5D69 A;  4JD9 A;  3K21 A;  4GFT A;  1JSA A;  2LAP A;  2LV7 A;  1PRW A;  4YGD B;  1B1G A;  2JTZ A;  1QS7 A;  5DIC A;  1CKK A;  5KSZ A;  3DZT A;  3B6X A;  1IJ6 A;  2WCH A;  1DMO A;  3O78 A;  4MVF A;  1KK7 Y;  5AER A;  4NDB A;  3NHI A;  2K7C A;  4HSZ A;  1XFZ O;  1YX7 A;  1MR8 A;  1EJ3 A;  2L2E A;  3EKJ A;  1DQE A;  3PN7 B;  3D0Y A;  1UHK A;  4FTG A;  1A75 A;  2MA2 A;  4YI9 A;  1YTZ C;  2MRD A;  2LNK A;  1T14 A;  3CZ0 A;  2KDH A;  1IQ5 A;  1SPY A;  2MBX A;  3BUM B;  3C1V A;  3R1V A;  3VGO A;  4F7F A;  5JJG A;  3S0A A;  1CFP A;  1VRK A;  3BXK A;  1SL9 A;  3DD4 A;  3VRR A;  3OX6 A;  5ER4 X;  1FPW A;  2L50 A;  2WCE A;  2JT3 A;  3AAJ A;  2GGM A;  4F0Z B;  1C07 A;  3B88 A;  3PM8 A;  3VRN A;  2BBM A;  3S0G A;  1S6C A;  1KWO B;  3R1P A;  4QJ4 B;  4ETO A;  1YX8 A;  5AAN A;  1DGU A;  4D1E A;  3D74 A;  3IF7 A; 
#chains in the Genus database with same CATH homology
 1RRO A;  3TDU A;  1ALV A;  3CR4 X;  5FYX A;  2Q91 A;  2LVJ A;  1CM4 A;  1KFX L;  2B1U A;  2JZI A;  1WDC B;  5B8I B;  1A4P A;  2K2F A;  2G9B A;  3NSO A;  1QTX A;  1CDL A;  3GK2 A;  4XJK A;  1IH0 A;  5I2Q A;  4YGE B;  2LMV A;  5AFP A;  4P5O E;  3QRX A;  4MRX A;  1UHI A;  1UWO A;  2K7B A;  3D0Y B;  1A75 B;  1OZO A;  5K89 A;  4YRU A;  1F8H A;  2OTG B;  3GK4 X;  1QIV A;  1QLS A;  1MUX A;  2OS8 B;  2OPO A;  1FW4 A;  2GV5 A;  2LC5 A;  3M0W A;  2LHL A;  1DVI A;  5HLO A;  1A29 A;  1IWQ A;  2PRU A;  2Y1N A;  3ZNI A;  2BEC A;  3DF0 A;  2F2O A;  2O5G A;  2ZND A;  4PAL A;  1JF2 A;  5HKW A;  1NIW A;  2KYC A;  2M49 B;  1RTP 1;  3PN7 C;  3SIA A;  1K9P A;  1M63 B;  1J7O A;  1YUR A;  2E30 A;  2JU0 A;  2LVV A;  1CFF A;  1RK9 A;  1KSO A;  2RGI A;  2WND A;  2VRG A;  4QJ5 B;  3WXA A;  1LIN A;  1SL7 A;  2HET A;  2KHN A;  1DF0 A;  1K8U A;  2JC2 A;  1IJ5 A;  1HT9 A;  1OQP A;  1REC A;  2M3W A;  5I2O A;  4ZCV A;  4XJK B;  1GGZ A;  2JUL A;  3BQ3 A;  2V53 A;  2EGD A;  4PDZ A;  1BMO A;  2BCA A;  2QAC A;  2A4J A;  4OVN F;  2NCO A;  4PE4 A;  2K7O A;  4USL A;  5D7F A;  1S5G Y;  1K93 D;  1S26 D;  1QJT A;  3CTN A;  1J7R A;  2AUC A;  3HX4 A;  1X02 A;  1R6P A;  1IGV A;  1GJY A;  2L98 A;  3OP0 A;  1WRL A;  1XYD A;  1KFU L;  1YR5 A;  2LMT A;  1PUL A;  2L51 A;  2Q4U A;  3VRO A;  3RLZ A;  1NSH A;  1S5G Z;  4DCK A;  3DF0 B;  1KSM A;  2H61 C;  1YUS A;  2LP2 A;  1NX3 A;  2I94 A;  3A4U B;  4OCI A;  1QV0 A;  2PAS A;  3PAL A;  1NPQ A;  1J1E A;  2I2R E;  3I5G B;  3BUO B;  4NDC A;  1WY9 A;  4CPV A;  2OTG C;  1JC2 A;  2KI6 D;  4CID A;  1D1O A;  4CFQ A;  3GOF A;  2EHB A;  1DF0 B;  4M2P A;  1KK8 C;  1S6J A;  1B9A A;  1K90 D;  1BOD A;  4CFR A;  3LL8 B;  1MF8 B;  4MZL A;  2CCM A;  4XYN A;  4PHM A;  2M29 A;  4WQ3 A;  1EG3 A;  3MSE B;  3NSK A;  3EK7 A;  1L7Z A;  5G08 A;  5CSF A;  1NCX A;  5AXI A;  4MSP A;  2CBL A;  3LCP C;  3CZT X;  2D8N A;  2F8P A;  2JXL A;  3PSR A;  5DKR A;  1M31 A;  4JWQ A;  1MXL C;  1NYA A;  2LP3 A;  5CSN A;  1BOC A;  2CNP A;  1BG1 A;  1TNW A;  5DKN A;  1F55 A;  2H61 A;  2PSR A;  1K9U A;  1NX1 A;  3OB1 B;  2LLS A;  4TNC A;  2JTT A;  3BUN B;  1AJ5 A;  5I2L A;  4PE1 A;  4GBA A;  5HKY A;  2ZRS A;  1QAS A;  1K2H A;  2QPT A;  1LA3 A;  4C0J A;  2O60 A;  4MZK A;  1YUU A;  4NDD A;  1SL8 A;  4GNK B;  1B4C A;  1TRF A;  3VRQ A;  1GQM A;  1BT6 A;  1CFD A;  4WRI A;  5J3X A;  2R2I A;  1PSB A;  1R2U A;  1DJH A;  1XA5 A;  4N1G A;  2JRF A;  1Y0V H;  1CDN A;  1CMF A;  1DJX A;  3GK1 A;  2IS9 A;  4NQG A;  1NP8 A;  1ALW A;  4C0L A;  2JQ6 A;  3I5G C;  5HKZ A;  4UPG A;  1PAL A;  4AQI A;  2KQ6 A;  1QXP A;  3AKB A;  2JPT A;  3E3R A;  3TDZ A;  1ZFS A;  2LVK A;  2LCP A;  1WLZ A;  1KQM C;  1QAT A;  1F54 A;  3OB2 B;  4JQ0 D;  4ORB B;  2Y5I A;  2K61 A;  5JOL A;  4I5J A;  3FS7 A;  4N5X A;  1BLQ A;  1AHR A;  2AMI A;  1XVJ A;  1B8R A;  2K8M B;  1OE9 B;  1KQV A;  4A4C A;  3EK8 A;  4MRY A;  4YGC B;  1CFC A;  1RWY A;  4HRE E;  4DRW A;  3TUY B;  1XFW O;  1XO5 A;  2LAN A;  1UUR A;  2PVB A;  4HRH A;  5F6T A;  5KTY A;  1EG4 A;  1TNQ A;  3JTD C;  2ZFD A;  5HLV A;  3CR2 A;  3TS5 C;  4I5K A;  2M97 A;  1JUO A;  1QV1 A;  4YBH B;  1KK8 B;  1ODB A;  1XFY O;  4MN0 A;  4GGN A;  2L5X B;  2JOJ A;  3JVT B;  1MQ1 A;  1TCO B;  2JNX A;  2KYF A;  4PE7 A;  2KNE A;  4R1E A;  2CT9 A;  3FWB A;  2KFF A;  3SG4 A;  2BCB A;  3LK0 A;  2P6B B;  1JFK A;  1IRJ A;  2F33 A;  4PE0 A;  4PHJ A;  1OMV A;  1CLL A;  2M1K B;  4E68 A;  5DKQ A;  1AP4 A;  2BL0 C;  1TNX A;  1IG5 A;  3EVV A;  4OR9 B;  1G4Y R;  1BU3 A;  1CLM A;  1XFX O;  1ZOT B;  3DVE A;  1DTL A;  1S3P A;  1SYM A;  2LMU A;  3SG7 A;  2MLE C;  3SJS A;  1YRU B;  4C0K A;  5KU1 A;  3BOW A;  3KF9 A;  2HPS A;  3I5I C;  4M2O A;  4PHK A;  1MHO A;  1QVI Z;  3TZ1 A;  1DJG A;  2ZKM X;  1OSA A;  2KAV A;  5AEQ A;  1FI5 A;  1NCZ A;  2WOS A;  3FWC A;  4HRG A;  5HYD A;  3KPX A;  2WCB A;  1PK0 D;  2L4I A;  1HQV A;  2FCE A;  4M2Q A;  2L0P A;  2E6W A;  1QX2 A;  1XK4 C;  2KI6 C;  4WQ2 A;  5CSJ A;  1A03 A;  3KO0 A;  1NX2 A;  2K7D A;  3CS1 A;  2MHH A;  4FQO A;  3TUY C;  1FF1 A;  1KQM B;  3F45 A;  2BE4 A;  2Y4Q A;  1C7W A;  2LLT A;  1DGV A;  1NUB A;  2G2B A;  2Y1M A;  3PFV A;  2LUX A;  1J1D A;  2WC8 A;  1PVB A;  3I5H C;  3JVT C;  4PCW A;  1KCY A;  2KSP A;  1OMR A;  1S36 A;  2H2K A;  1OZS A;  1U5I A;  3BOW B;  4YGB B;  3H4S E;  4MZJ A;  1Y1A A;  1CDM A;  1CNP A;  1UHJ A;  4GUK A;  2F3Z A;  2AAO A;  1FI6 A;  1TIZ A;  2ISD A;  3JTD B;  3TS5 B;  2M7N A;  1WRK A;  3WHU B;  2WOR A;  2MJW B;  1QX5 B;  2MAZ A;  1YVL A;  2BBN A;  2LUC A;  1CDP A;  2CTN A;  1F4O A;  2F2P A;  2LM5 A;  3I5F C;  3OHM B;  4JPZ B;  1XK4 A;  3A8R A;  4OV2 A;  3SG6 A;  3BUX B;  1RFJ A;  1LA0 A;  2BCX A;  1TCF A;  3IQQ A;  3NXA A;  2JT0 A;  2COL B;  4GAO A;  1B47 A;  3KEV A;  2M8U A;  4QJ3 B;  1UP5 A;  2FCD A;  3CR5 X;  4ORC B;  1L2O C;  2I18 A;  1JFJ A;  2BL0 B;  3PAT A;  1SKT A;  4YGA A;  2KQY A;  4BY5 A;  4DS7 A;  1NX0 A;  3O4Y A;  2TN4 A;  1YVH A;  2SCP A;  1SCM C;  3CGA A;  5TNC A;  4AOM A;  3SG2 A;  1ZUZ A;  1JWD A;  4Q04 A;  2KGB C;  1M45 A;  1U5I B;  2EC6 C;  1M39 A;  1N2D A;  3I5I B;  4CLN A;  2KAX A;  1GGW A;  1DJZ A;  2PAL A;  1H8B A;  1EL4 A;  1AVS A;  2KFG A;  2ZNE A;  1Y6W A;  1BR4 B;  1KK7 Z;  4OKH A;  1Q80 A;  4I5N B;  1TN4 A;  4DUQ A;  1E8A A;  1CTR A;  1UHH A;  1B8L A;  4ZCU A;  1ZAC A;  1LVC D;  1LXF C;  2DOQ A;  2F3Y A;  4IL1 A;  3SG5 A;  1BJF A;  1CB1 A;  1YUT A;  3VRP A;  2BKH B;  2NLN A;  4ICB A;  1CM1 A;  4L9M A;  1MWN A;  3NSI A;  1N0Y A;  1F70 A;  2LLU A;  1W7I B;  3TDI A;  2BKI B;  4AQJ A;  2JXC A;  2PMY A;  4MEW A;  5IBW A;  1J7P A;  1KFX S;  1Y1U A;  3NSL A;  4ORA B;  1SBJ A;  2FJU B;  3I5H B;  2KI4 C;  1JBA A;  1S1E A;  4GPL B;  2KAY A;  5ER5 A;  1IKU A;  3EKH A;  1RJV A;  2ZRT A;  3CLN A;  1BF5 A;  1JF0 A;  1SR6 C;  4MLW A;  3IQO A;  2L4H A;  3OX5 A;  1AUI B;  1B7T Y;  1W7J B;  3HCM A;  1FBV A;  5GQQ C;  2M9G A;  1TOP A;  1MXE A;  4BY4 A;  3EVU A;  3ZWH A;  2ZN8 A;  1SNL A;  2I7A A;  3EVR A;  1QVI Y;  2K2A A;  1TNP A;  1CLB A;  2KOT A;  4A4B A;  1Y1X A;  1WRZ A;  1ZMZ A;  1B7T Z;  3AKA A;  2KGR A;  3I5F B;  1BR1 B;  1XFV O;  2SAS A;  2KBM A;  2HQW A;  1J7Q A;  1B8C A;  1K96 A;  1V1F A;  5CPV A;  2HQ8 A;  2KFH A;  2HF5 A;  3DVM A;  1SCV A;  1QIW A;  1J55 A;  3FIA A;  1C7V A;  1TTX A;  1L2O B;  3O6B A;  1PSR A;  1XFU O;  1EXR A;  4MBE A;  1H4B A;  1S6I A;  1N65 A;  1SCM B;  3BYA A;  5CSI A;  2M7L A;  1KWO C;  1SRA A;  4U8D A;  2EC6 B;  2JWW A;  2NXQ A;  5PAL A;  3SIB A;  1QX7 A;  1DJI A;  3WHT B;  1WLM A;  1NWD A;  4GGF C;  1F71 A;  3AAK A;  3CWG A;  2K0J A;  2BE6 A;  1NCY A;  2LE9 B;  3SG3 A;  2M1U A;  5BPJ A;  3KHE A;  3O2P A;  3PLF B;  3WNX B;  1EH2 A;  1WDC C;  2M0R A;  3RM1 A;  3EK4 A;  3DVJ A;  1SK6 D;  3LLE A;  1KFU S;  1UHN A;  2LHI A;  1DJY A;  2JNF A;  2KBI A;  4P2Y B;  5I8N A;  1F4Q A;  1K9K A;  2CXJ A;  2ZN9 A;  1AJ4 A;  1OOJ A;  1CMG A;  1M46 A;  1K94 A;  1K95 A;  2GGZ A;  1UUS A;  1V1G A;  1A2X A;  2NCP A;  1QLK A;  4PHN A;  4YI8 A;  3DVK A;  1OMD A;  2FOT A;  2OS8 C;  1AK8 A;  2MLF C;  4N1F A;  1LKJ A;  1SY9 A;  1IQ3 A;  4DIR A;  2LVI A;  1YRT B;  2KI4 B;  1DJW A;  1SMG A;  4I5L B;  1G33 A;  3LK1 A;  1SR6 B;  3D10 A;  1G8I A;  2WCF A;  3ICB A;  3BUW B;  1PVA A;  1SW8 A;  4GGF A;  1DT7 B;  2NZ0 A;  2JT8 A;  5D69 A;  3K21 A;  4GFT A;  1JSA A;  2LAP A;  2LV7 A;  1PRW A;  4YGD B;  1B1G A;  2JTZ A;  1QS7 A;  1CKK A;  5KSZ A;  1IJ6 A;  1DMO A;  3O78 A;  4MVF A;  1KK7 Y;  5AER A;  4NDB A;  2K7C A;  4HSZ A;  1XFZ O;  1YX7 A;  1MR8 A;  1EJ3 A;  2L2E A;  3EKJ A;  3PN7 B;  3D0Y A;  1UHK A;  4FTG A;  1A75 A;  2MA2 A;  4YI9 A;  1YTZ C;  2MRD A;  2LNK A;  2KDH A;  1IQ5 A;  1SPY A;  2MBX A;  3BUM B;  3C1V A;  3VGO A;  5JJG A;  1CFP A;  1VRK A;  3BXK A;  1SL9 A;  3DD4 A;  3VRR A;  3OX6 A;  5ER4 X;  1FPW A;  2L50 A;  2WCE A;  2JT3 A;  3AAJ A;  2GGM A;  4F0Z B;  1C07 A;  3PM8 A;  3VRN A;  2BBM A;  1S6C A;  1KWO B;  4QJ4 B;  4ETO A;  1YX8 A;  5AAN A;  1DGU A;  4D1E A;  3IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...