4ORAB

Crystal structure of a human calcineurin mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
ASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/metal binding protein
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit be
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Homo sapiens
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4oraB00
1L7ZA 1LVCD 2Y4QA 1SCVA 3JTDC 4U8DA 1EL4A 4ORAB 1TNXA 2ZNEA 4ETOA 1NX1A 1GQMA 4M2OA 4OR9B 2LMUA 1CLLA 4UPGA 1F8HA 1QVIZ 1AJ5A 4JPZB 2M7NA 2KBIA 2Q4UA 1JWDA 1IG5A 1QVIY 1KQMB 1UWOA 1RTP1 2BE4A 1XYDA 2JT0A 2JULA 3AAJA 1A4PA 1N0YA 1TNWA 1XA5A 5KSZA 1EXRA 5K89A 2NCOA 1FPWA 1NX2A 1BLQA 1QS7A 2WNDA 4MVFA 1IQ5A 4F0ZB 2MJWB 2Y5IA 2KFGA 2MAZA 2KNEA 1M63B 1S5GY 4PHNA 1IWQA 1QV0A 2LP2A 4MZKA 1DVIA 2F33A 2KSPA 2NXQA 2OS8B 3CTNA 2CNPA 4PHMA 2L51A 1NPQA 2K2AA 1J55A 3BUMB 1KWOC 1AP4A 1SY9A 1PVBA 4DUQA 3HCMA 1KK7Y 2JT3A 2LC5A 3I5GB 5CSJA 5HKYA 3IQOA 1TIZA 1SCMB 4I5JA 3HX4A 3BUWB 4MN0A 1S26D 1PSRA 1Y1UA 5AXIA 2HF5A 4YGEB 1WRZA 2LE9B 2JT8A 2L2EA 2JOJA 1QTXA 1K94A 5CSIA 2E6WA 2WC8A 4ICBA 1KFXS 1OSAA 1SYMA 4ORCB 2BL0C 1DJXA 1HT9A 2KHNA 3MSEB 2KQ6A 1A03A 2OTGC 4IL1A 2ISDA 1F4OA 1CLMA 1OE9B 1S1EA 2KGRA 1K9PA 1MHOA 1WDCC 1G4YR 2O60A 2LM5A 1AK8A 1SMGA 2KYFA 4PCWA 2LCPA 3KHEA 3KPXA 3PSRA 3I5HC 1SBJA 1QX7A 1TN4A 3DD4A 1M46A 1NCXA 4NDDA 5I8NA 1L2OC 1R6PA 3BOWA 1F70A 2LHLA 2PRUA 1K93D 1XFWO 2LVVA 3FIAA 1ZUZA 1AHRA 1JBAA 3EKHA 2KAXA 2AUCA 1NX0A 2JXCA 2MLEC 3VRPA 2BBNA 2L98A 5CPVA 4NQGA 4YBHB 2WORA 5AEQA 1AJ4A 1Q80A 3LL8B 1H4BA 2PVBA 3BUXB 4GUKA 4I5LB 1OMDA 1TOPA 1UHKA 3NSKA 1H8BA 3BOWB 3CR5X 4OKHA 5KU1A 1NYAA 4YI8A 5AERA 2LMVA 5JJGA 1W7IB 2EC6C 4ZCVA 3OX5A 1CTRA 2L0PA 3BUNB 1OMVA 3EVVA 3K21A 1YVHA 3TZ1A 2V53A 3GOFA 3IQQA 1SR6B 1TRFA 1K96A 1B4CA 1UHNA 5BPJA 2M0RA 1BR1B 4HSZA 2Q91A 2BCBA 2FJUB 2K7CA 3TUYB 4NDBA 1UHJA 1YR5A 3ZWHA 4USLA 1DJYA 1B7TY 4M2QA 3ZNIA 2VRGA 1CB1A 1KCYA 3DVEA 4CIDA 5GQQC 1G8IA 2JU0A 3PN7C 1J7OA 1BR4B 1QX5B 1XFUO 3H4SE 1PALA 2I94A 1JSAA 1YUSA 1XVJA 4GGFA 1C7WA 1BT6A 2BECA 1M39A 1QJTA 3EK7A 1EJ3A 2QACA 3BYAA 3LK0A 2JTTA 1ALVA 1J1DA 1LKJA 1NP8A 1RROA 2Y1NA 3RLZA 1J7RA 2KGBC 2M9GA 4R1EA 4OVNF 3ICBA 5CSNA 1JUOA 3LLEA 1K2HA 3CZTX 1CMFA 1K9UA 4YGDB 5HLOA 1PRWA 1CFFA 1CM1A 1MUXA 1JF2A 4MBEA 2PSRA 3OP0A 1BOCA 1XO5A 2LVIA 2BCAA 3I5IC 4PE0A 4FQOA 4C0JA 1NCYA 4DS7A 2MBXA 1GGWA 1NIWA 5AANA 3PALA 3CGAA 1J7PA 1SL7A 2EC6B 2LV7A 2LUXA 4GGNA 1PVAA 4BY4A 1A75A 4AOMA 3VROA 1EH2A 1YURA 2PASA 1RK9A 5D7FA 1YX8A 1DGVA 4E68A 3BXKA 1Y0VH 4M2PA 4PHJA 2M1UA 3KEVA 2KI6C 2NLNA 1MXLC 2M97A 4TNCA 1YUUA 1KSMA 1KFUL 4ORBB 3SJSA 1A75B 4DIRA 2MHHA 3NSLA 1JFKA 1CDNA 2TN4A 3EVUA 2M3WA 3TDZA 1DGUA 5FYXA 5HKZA 4HRHA 2ZFDA 2CCMA 3SIAA 1WY9A 4WQ2A 3A8RA 3VRRA 4YGAA 2LMTA 4BY5A 4WRIA 1KQVA 4CPVA 3QRXA 3NSIA 1CFDA 1B47A 1S3PA 1TNPA 1VRKA 1MR8A 2WCEA 3EK8A 3D0YA 2JZIA 4MZJA 3E3RA 3JTDB 3SIBA 1CDPA 3JVTC 2KAVA 3PFVA 1TNQA 4DCKA 4A4CA 1Y1AA 4N1GA 1N2DA 3I5IB 1QLKA 3C1VA 3SG3A 2D8NA 3O78A 5G08A 1WLZA 1F4QA 1AVSA 1F71A 3IF7A 1IH0A 2GGMA 2JXLA 3D0YB 3O2PA 1DF0A 3I5FC 5HYDA 1SK6D 2WCBA 1SKTA 4GBAA 2H61C 3SG7A 2MRDA 1BU3A 4C0KA 4YGBB 1UHIA 2KBMA 3O6BA 1YUTA 2LLUA 2ZN8A 2I18A 1NCZA 4JWQA 1W7JB 4QJ4B 2KI4C 3DVMA 1FI5A 1DF0B 2F3YA 1XFXO 3KF9A 3TDIA 1MXEA 1MWNA 4CFRA 1KWOB 1IJ5A 2JNFA 1QLSA 3A4UB 3DF0A 1DMOA 2JQ6A 1DTLA 2BBMA 2WCFA 1SPYA 2GV5A 4L9MA 5HLVA 1F55A 2AAOA 1XFZO 2JPTA 1PULA 2QPTA 3CLNA 1CLBA 4DRWA 1LA3A 2SCPA 2JWWA 2BKIB 5KTYA 3KO0A 1LA0A 2CBLA 2BL0B 2LHIA 1LINA 2HQWA 1MF8B 3BUOB 4OCIA 2H61A 2JRFA 2OTGB 4I5NB 5ER5A 4MZLA 3CR2A 1Y6WA 1K95A 3PLFB 1KQMC 2LUCA 5D69A 2ZRSA 3SG2A 3WHUB 4AQJA 2HPSA 3TDUA 1WDCB 1R2UA 2F3ZA 1YX7A 1CM4A 1LXFC 5I2OA 4PHKA 2MLFC 1J7QA 2Y1MA 2LVJA 3I5FB 4AQIA 2M7LA 3I5HB 1S6JA 2LNKA 1DJGA 1ZACA 2L5XB 3AAKA 3NSOA 2JTZA 5HKWA 3VRQA 1B8LA 1L2OB 2A4JA 4P5OE 1IQ3A 3AKAA 1RWYA 1TTXA 3WXAA 1XFVO 3GK2A 1QIWA 1CMGA 4MRYA 1DJWA 1U5IA 1KFUS 1YVLA 4QJ3B 2P6BB 2OS8C 2F8PA 4GPLB 2F2PA 1TCFA 2L50A 3EKJA 5CSFA 2AMIA 1QIVA 2BE6A 4FTGA 5B8IB 1ALWA 1UUSA 1NX3A 1CDMA 1YRTB 3I5GC 1DJHA 2K0JA 1BG1A 2CT9A 1IKUA 1IGVA 1U5IB 2KDHA 2NCPA 1CFPA 3FWBA 2ZKMX 4GAOA 5ER4X 1JFJA 1UHHA 4A4BA 3EK4A 2LLTA 1IJ6A 1YTZC 1KK8C 3DVJA 3FS7A 2LP3A 1SW8A 4PE7A 2ZNDA 1C07A 4C0LA 2JC2A 1TCOB 2K2FA 1K90D 1FW4A 2ZRTA 2EHBA 3OHMB 1E8AA 3O4YA 1EG3A 1ZFSA 3OX6A 1RJVA 1XK4C 4GNKB 3PN7B 1N65A 1D1OA 2K7BA 3AKBA 2KQYA 2M1KB 2BKHB 2PALA 2LANA 2G2BA 2COLB 1X02A 1DT7B 3RM1A 1RECA 2I7AA 4P2YB 1S5GZ 4HREE 1WLMA 1CNPA 1A29A 1WRLA 1S6IA 2K7OA 4PE4A 1A2XA 3CR4X 1ZMZA 4JQ0D 5I2QA 4PALA 1WRKA 1BODA 2KOTA 1B8CA 1V1GA 2WOSA 1DJIA 1BF5A 1B9AA 2IS9A 1NSHA 2SASA 3BQ3A 4QJ5B 1F54A 1KK7Z 1OZSA 2RGIA 1OOJA 1KSOA 1J1EA 4GFTA 5PALA 4N1FA 4NDCA 4ZCUA 3LCPC 1OZOA 2FCEA 1MQ1A 2NZ0A 3SG5A 2K8MB 2LAPA 3F45A 1SR6C 5IBWA 1PK0D 4YRUA 1XK4A 3WNXB 3M0WA 1ODBA 4MLWA 3TUYC 3VRNA 1KK8B 2KAYA 2KI6D 1SL9A 1CKKA 1S36A 5TNCA 1UP5A 4YGCB 1YRUB 3TS5C 2FOTA 3DVKA 1CFCA 2LLSA 1FF1A 1M45A 3D10A 1PSBA 1GJYA 2CXJA 1JC2A 1NWDA 2H2KA 1SNLA 5DKNA 3CS1A 1CDLA 1OQPA 1SRAA 5I2LA 1QXPA 2OPOA 5AFPA 2B1UA 1IRJA 1DJZA 2GGZA 3SG4A 5DKRA 2E30A 2MA2A 2HQ8A 1C7VA 1EG4A 1ZOTB 3PATA 2F2OA 2JNXA 1QX2A 3NXAA 4PDZA 4YI9A 3SG6A 1KFXL 3CWGA 1FBVA 1K8UA 1XFYO 3GK4X 5DKQA 3DF0B 4GGFC 2O5GA 2CTNA 3JVTB 5F6TA 1S6CA 2KFFA 4XYNA 1BJFA 2G9BA 4CLNA 3OB2B 1B1GA 1QASA 1JF0A 3OB1B 4N5XA 3GK1A 4OV2A 1QV1A 4PE1A 2L4HA 2K7DA 4WQ3A 2M49B 4XJKA 3FWCA 1AUIB 4MRXA 2I2RE 1OMRA 4D1EA 2EGDA 1B8RA 2R2IA 1UURA 3EVRA 2ZN9A 2BCXA 2LVKA 1K9KA 1HQVA 2M8UA 2KYCA 4HRGA 1B7TZ 1M31A 1SL8A 1V1FA 4Q04A 4XJKB 2L4IA 1NUBA 2KI4B 1QATA 5J3XA 2K61A 1GGZA 2PMYA 5JOLA 3TS5B 3LK1A 1RFJA 1Y1XA 3PM8A 2HETA 1FI6A 2M29A 1G33A 4CFQA 4I5KA 1SCMC 1BMOA 2KFHA 3WHTB 2FCDA 4MEWA 2DOQA 3VGOA 4MSPA
chains in the Genus database with same CATH superfamily
1L7ZA 1LVCD 2Y4QA 1SCVA 3JTDC 4U8DA 1EL4A 4ORAB 1TNXA 2ZNEA 4ETOA 1NX1A 1GQMA 4M2OA 4OR9B 2WCKA 2LMUA 1CLLA 4UPGA 1F8HA 1QVIZ 1AJ5A 4JPZB 2M7NA 2KBIA 2Q4UA 3K1EA 1JWDA 1IG5A 1QVIY 1KQMB 1UWOA 1RTP1 2BE4A 1XYDA 3B6XA 2JT0A 2JULA 3OBVA 3AAJA 1A4PA 1N0YA 1TNWA 1XA5A 1Z2CB 5KSZA 1EXRA 5K89A 2NCOA 1FPWA 1NX2A 1BLQA 1QS7A 2WNDA 4MVFA 1IQ5A 3D78A 4F0ZB 2MJWB 2Y5IA 2KFGA 2MAZA 2KNEA 1M63B 1S5GY 4PHNA 3RZSA 1IWQA 1OOHA 1QV0A 1TWOA 2LP2A 4MZKA 1DVIA 2F33A 2KSPA 2NXQA 2OS8B 3CTNA 2CNPA 4PHMA 2L51A 3CABA 1NPQA 2K2AA 1J55A 3BUMB 1KWOC 1AP4A 1SY9A 1PVBA 1OOFA 4DUQA 3HCMA 1KK7Y 2JT3A 2L2CA 2LC5A 3I5GB 5CSJA 5HKYA 3IQOA 1TIZA 1SCMB 2BNXA 4I5JA 3HX4A 3BUWB 4MN0A 1S26D 1PSRA 1Y1UA 5AXIA 2HF5A 4YGEB 1WRZA 2LE9B 2JT8A 2L2EA 2JOJA 1QTXA 1K94A 1OOGA 3BJHA 5CSIA 2E6WA 2WC8A 4ICBA 1KFXS 1OSAA 1SYMA 4ORCB 2BL0C 1DJXA 1HT9A 2KHNA 3MSEB 2KQ6A 1A03A 5D3OA 2OTGC 4IL1A 2ISDA 1F4OA 1CLMA 1OE9B 1S1EA 2KGRA 1K9PA 1MHOA 1WDCC 2QEVA 1G4YR 2O60A 3B86A 2LM5A 1AK8A 1DEKA 1SMGA 2KYFA 4PCWA 2KLDA 2LCPA 3KHEA 3KPXA 3PSRA 3I5HC 3FE8A 1SBJA 1QX7A 1TN4A 3DD4A 1M46A 1NCXA 4NDDA 5I8NA 1L2OC 1R6PA 3BOWA 1F70A 2LHLA 2PRUA 1OOIX 1K93D 1XFWO 2ERBA 2LVVA 1ZUZA 1AHRA 3FIAA 1JBAA 3EKHA 2KAXA 2AUCA 1NX0A 2JXCA 2MLEC 3VRPA 2BBNA 2L98A 5CPVA 4NQGA 4YBHB 2WORA 5AEQA 3D74A 1AJ4A 1Q80A 3LL8B 3Q8IA 1H4BA 2PVBA 3BUXB 4GUKA 4I5LB 1OMDA 1TOPA 1UHKA 3NSKA 1H8BA 3BOWB 3CR5X 3CZ0A 4OKHA 1NYAA 4YI8A 5AERA 2LMVA 5JJGA 1W7IB 2EC6C 4ZCVA 3OX5A 1CTRA 2L0PA 3BUNB 1OMVA 3EVVA 3K21A 1YVHA 3TZ1A 2V53A 3GOFA 3IQQA 3V2LA 1SR6B 1TRFA 1K96A 1B4CA 1UHNA 5BPJA 2M0RA 1BR1B 4HSZA 2Q91A 2BCBA 2FJUB 2K7CA 3TUYB 5I94A 4NDBA 1UHJA 3R1PA 1YR5A 3O4XA 1DC1A 5FI6A 3ZWHA 2QEHA 4USLA 1DJYA 1B7TY 4M2QA 3ZNIA 2VRGA 1CB1A 1KCYA 3DVEA 4CIDA 5GQQC 1G8IA 2JU0A 3PN7C 4FQTA 1J7OA 1BR4B 3B87A 1QX5B 1XFUO 3H4SE 1PALA 2I94A 4OZDA 1YUSA 1JSAA 1XVJA 4GGFA 1C7WA 2PYQA 1BT6A 2BECA 1M39A 1QJTA 3EK7A 1EJ3A 2QACA 3BYAA 3LK0A 2JTTA 1ALVA 5FI7A 1J1DA 1LKJA 1NP8A 1RROA 2Y1NA 3RLZA 1J7RA 2KGBC 2M9GA 4R1EA 4OVNF 3ICBA 5CSNA 1JUOA 3LLEA 1K2HA 3CZTX 1CMFA 1K9UA 4YGDB 5HLOA 1PRWA 1CFFA 3B7AA 1CM1A 1MUXA 1JF2A 3OGNA 4MBEA 2JPOA 2PSRA 3OP0A 1BOCA 1XO5A 2LVIA 2BCAA 3I5IC 4PE0A 4FQOA 4C0JA 1NCYA 4DS7A 2MBXA 1GGWA 1NIWA 5AANA 3PALA 3CGAA 1J7PA 1SL7A 2EC6B 2LV7A 1IIOA 1TUJA 2LUXA 3R72A 4GGNA 1PVAA 2KLEA 1A75A 4AOMA 4BY4A 3D76A 3VROA 1YURA 2PASA 1RK9A 1EH2A 5D7FA 1YX8A 1DGVA 4E68A 3BXKA 1C3ZA 1Y0VH 2GTEA 4M2PA 4PHJA 4JKTA 2M1UA 3KEVA 2KI6C 2NLNA 1MXLC 2H8VA 2M97A 2WC6A 2WCLA 4TNCA 1YUUA 1KSMA 1KFUL 4ORBB 3SJSA 1A75B 4DIRA 2MHHA 3NHIA 3NSLA 1JFKA 1CDNA 2TN4A 3EVUA 2M3WA 3TDZA 1DGUA 5FYXA 5HKZA 4HRHA 2ZFDA 2CCMA 3SIAA 1WY9A 4WQ2A 3A8RA 3VRRA 3S0GA 4YGAA 2LMTA 3VB1A 4BY5A 4WRIA 1KQVA 4CPVA 3QRXA 3NSIA 1CFDA 1B47A 1S3PA 1TNPA 1VRKA 1MR8A 2WCEA 3EK8A 3D0YA 2JZIA 4MZJA 3E3RA 3JTDB 3SIBA 1CDPA 2WCMA 3JVTC 2KAVA 3PFVA 1TNQA 4DCKA 3PM2A 4A4CA 1Y1AA 4N1GA 1N2DA 3I5IB 1QLKA 3C1VA 3SG3A 2D8NA 3O78A 5G08A 1WLZA 2YGUA 1F4QA 1AVSA 1F71A 3IF7A 1IH0A 2GGMA 2JXLA 3D0YB 3O2PA 3S0EA 3CYZA 1DF0A 3I5FC 5HYDA 1SK6D 2WCBA 1SKTA 4GBAA 2H61C 2KPHA 3SG7A 2MRDA 1BU3A 4C0KA 4YGBB 1GM0A 1UHIA 2KBMA 3O6BA 1YUTA 2LLUA 2ZN8A 2I18A 1NCZA 4JWQA 1W7JB 4QJ4B 2KI4C 3SS5A 3DVMA 1FI5A 1DF0B 3BFHA 2F3YA 1XFXO 3KF9A 3TDIA 2P70A 1MXEA 1MWNA 4CFRA 3NGVA 1KWOB 1IJ5A 2JNFA 1QLSA 3A4UB 2WCHA 3DF0A 5ER5A 1DMOA 3SS4A 2JQ6A 1DTLA 2BBMA 2WCFA 1SPYA 2GV5A 4L9MA 5HLVA 1F55A 2AAOA 4F7FA 1XFZO 2JPTA 1PULA 2QPTA 3CLNA 1CLBA 4DRWA 1LA3A 2SCPA 2JWWA 3QMEA 1W9ZA 3FE9A 2BKIB 3UO9A 5KTYA 3KO0A 1LA0A 2CBLA 2QEBA 2BL0B 2LHIA 1LINA 2HQWA 1MF8B 3BUOB 3BFBA 2H61A 1P28A 2JRFA 2OTGB 4I5NB 4OCIA 4MZLA 3CR2A 1Y6WA 4PT1A 1K95A 3PLFB 1KQMC 2LUCA 5D69A 2ZRSA 3SG2A 3WHUB 4AQJA 2HPSA 5EL2A 3TDUA 1WDCB 1R2UA 2F3ZA 1YX7A 1CM4A 1LXFC 5I2OA 4PHKA 2MLFC 1J7QA 2Y1MA 2LVJA 3I5FB 3S0BA 1XFRA 2M7LA 2L5YA 3I5HB 4INXA 1S6JA 4AQIA 2LNKA 1DJGA 3IVTA 1ZACA 2L5XB 3AAKA 3NSOA 2JTZA 5HKWA 3VRQA 1B8LA 1L2OB 2A4JA 4P5OE 1IQ3A 3AKAA 1RWYA 1TTXA 3WXAA 1XFVO 3GK2A 1QIWA 5KU1A 1CMGA 4MRYA 1DJWA 1U5IA 1KFUS 1YVLA 4QJ3B 2P6BB 2OS8C 2F8PA 5HL1A 4GPLB 2F2PA 1TCFA 2L50A 3EKJA 5CSFA 2P71A 2AMIA 1QIVA 2BE6A 4FTGA 5B8IB 3UNWA 1ALWA 1UUSA 1NX3A 1CDMA 1YRTB 3D77A 3I5GC 1DJHA 2K0JA 1BG1A 2CT9A 1IKUA 1IGVA 1U5IB 2KDHA 2NCPA 1CFPA 3DZTA 3FWBA 3S0FA 2ZKMX 3R1VA 4GAOA 5ER4X 4KYNA 1JFJA 1UHHA 4A4BA 3L4LA 3EK4A 1C3YA 2LLTA 1DQEA 1LS8A 1IJ6A 1YTZC 1KK8C 3DVJA 3FS7A 2LP3A 1SW8A 3B88A 4PE7A 2ZNDA 1C07A 4C0LA 2JC2A 1TCOB 2K2FA 1K90D 1FW4A 2ZRTA 2EHBA 3OHMB 1E8AA 3O4YA 1EG3A 1OW4A 1ZFSA 3OX6A 1RJVA 1XK4C 4GNKB 3PN7B 1N65A 2QEOA 2K7BA 3AKBA 2KQYA 2M1KB 2BAPA 3EG5B 1D1OA 2BKHB 2PALA 2LANA 2G2BA 2COLB 1X02A 2WC5A 1DT7B 1ORGA 3RM1A 3S0AA 1RECA 2I7AA 4P2YB 1S5GZ 4HREE 1WLMA 1CNPA 1A29A 1WRLA 1S6IA 2K7OA 4PE4A 2WCJA 4IJ7A 1A2XA 3CR4X 1ZMZA 4JQ0D 5I2QA 3CZ1A 4PALA 1WRKA 1BODA 2KOTA 1B8CA 1V1GA 2WOSA 1DJIA 1BF5A 1B9AA 2IS9A 1NSHA 2SASA 3BQ3A 4QJ5B 1F54A 1KK7Z 1OZSA 2RGIA 2FJYA 1OOJA 1KSOA 1J1EA 4GFTA 5PALA 4N1FA 4NDCA 4ZCUA 3LCPC 1OZOA 2FCEA 4JD9A 1MQ1A 2NZ0A 3SG5A 2K8MB 2LAPA 3F45A 1SR6C 3DY9A 1PK0D 5IBWA 4YRUA 1XK4A 3L4AA 1QWVA 2K60A 3WNXB 4INWA 3M0WA 1ODBA 4MLWA 3TUYC 3VRNA 1KK8B 3CZ2A 2KAYA 2KI6D 1SL9A 1CKKA 1S36A 3CDNA 5TNCA 1UP5A 4YGCB 1YRUB 3TS5C 2FOTA 3DVKA 1CFCA 2LLSA 1FF1A 1M45A 3D10A 1PSBA 1GJYA 2CXJA 1JC2A 3D75A 1SSEB 1NWDA 2H2KA 1SNLA 3BFAA 3CS1A 5DKNA 1CDLA 1OQPA 1SRAA 3D73A 5I2LA 1QXPA 2OPOA 5AFPA 2B1UA 3DYEA 1IRJA 5DICA 1DJZA 2GGZA 3SG4A 5DKRA 2E30A 2MA2A 2HQ8A 1C7VA 1EG4A 1ZOTB 3PATA 2F2OA 2JNXA 3R1OA 1QX2A 3NXAA 4PDZA 4YI9A 3SG6A 1KFXL 3CWGA 1FBVA 1K8UA 2QDIA 1XFYO 3GK4X 3DXLA 3PJIA 3DF0B 4GGFC 2O5GA 5DKQA 2CTNA 5FI2A 3JVTB 5F6TA 1S6CA 2KFFA 4XYNA 1BJFA 2G9BA 4CLNA 3L47A 3SS3A 3OB2B 1B1GA 1QASA 1JF0A 3OB1B 4N5XA 3S0DA 3GK1A 3N7HA 4OV2A 1QV1A 4PE1A 2L4HA 2K7DA 4WQ3A 2M49B 4XJKA 3FWCA 1AUIB 4MRXA 2I2RE 1OMRA 4D1EA 1Z4HA 1T14A 2EGDA 1B8RA 1DELA 2R2IA 1UURA 3EVRA 2ZN9A 2BCXA 2LVKA 2PQLA 1K9KA 1HQVA 2M8UA 2KYCA 4HRGA 1B7TZ 1M31A 1SL8A 1V1FA 4Q04A 4XJKB 2L4IA 1NUBA 2KI4B 1QATA 5J3XA 2K61A 1GGZA 2PMYA 5JOLA 3TS5B 3LK1A 1RFJA 1Y1XA 3PM8A 2HETA 1FI6A 3FE6A 3NHTA 2M29A 1G33A 4CFQA 4I5KA 1SCMC 1BMOA 1TUZA 2KFHA 2FCDA 3WHTB 4MEWA 2DOQA 3VGOA 4MSPA
chains in the Genus database with same CATH topology
1L7ZA 1LVCD 2Y4QA 1SCVA 3JTDC 4U8DA 1EL4A 4ORAB 1TNXA 2ZNEA 4ETOA 1NX1A 1GQMA 4M2OA 4OR9B 2LMUA 1CLLA 4UPGA 1F8HA 1QVIZ 1AJ5A 4JPZB 2M7NA 2KBIA 2Q4UA 1JWDA 1IG5A 1QVIY 1KQMB 1UWOA 1RTP1 2BE4A 1XYDA 2JT0A 2JULA 3AAJA 1A4PA 1N0YA 1TNWA 1XA5A 5KSZA 1EXRA 5K89A 2NCOA 1FPWA 1NX2A 1BLQA 1QS7A 2WNDA 4MVFA 1IQ5A 4F0ZB 2MJWB 2Y5IA 2KFGA 2MAZA 2KNEA 1M63B 1S5GY 4PHNA 1IWQA 1QV0A 2LP2A 4MZKA 1DVIA 2F33A 2KSPA 2NXQA 2OS8B 3CTNA 2CNPA 4PHMA 2L51A 1NPQA 2K2AA 1J55A 3BUMB 1KWOC 1AP4A 1SY9A 1PVBA 4DUQA 3HCMA 1KK7Y 2JT3A 2LC5A 3I5GB 5CSJA 5HKYA 3IQOA 1TIZA 1SCMB 4I5JA 3HX4A 3BUWB 4MN0A 1S26D 1PSRA 1Y1UA 5AXIA 2HF5A 4YGEB 1WRZA 2LE9B 2JT8A 2L2EA 2JOJA 1QTXA 1K94A 5CSIA 2E6WA 2WC8A 4ICBA 1KFXS 1OSAA 1SYMA 4ORCB 2BL0C 1DJXA 1HT9A 2KHNA 3MSEB 2KQ6A 1A03A 2OTGC 4IL1A 2ISDA 1F4OA 1CLMA 1OE9B 1S1EA 2KGRA 1K9PA 1MHOA 1WDCC 1G4YR 2O60A 2LM5A 1AK8A 1SMGA 2KYFA 4PCWA 2LCPA 3KHEA 3KPXA 3PSRA 3I5HC 1SBJA 1QX7A 1TN4A 3DD4A 1M46A 1NCXA 4NDDA 5I8NA 1L2OC 1R6PA 3BOWA 1F70A 2LHLA 2PRUA 1K93D 1XFWO 2LVVA 3FIAA 1ZUZA 1AHRA 1JBAA 3EKHA 2KAXA 2AUCA 1NX0A 2JXCA 2MLEC 3VRPA 2BBNA 2L98A 5CPVA 4NQGA 4YBHB 2WORA 5AEQA 1AJ4A 1Q80A 3LL8B 1H4BA 2PVBA 3BUXB 4GUKA 4I5LB 1OMDA 1TOPA 1UHKA 3NSKA 1H8BA 3BOWB 3CR5X 4OKHA 5KU1A 1NYAA 4YI8A 5AERA 2LMVA 5JJGA 1W7IB 2EC6C 4ZCVA 3OX5A 1CTRA 2L0PA 3BUNB 1OMVA 3EVVA 3K21A 1YVHA 3TZ1A 2V53A 3GOFA 3IQQA 1SR6B 1TRFA 1K96A 1B4CA 1UHNA 5BPJA 2M0RA 1BR1B 4HSZA 2Q91A 2BCBA 2FJUB 2K7CA 3TUYB 4NDBA 1UHJA 1YR5A 3ZWHA 4USLA 1DJYA 1B7TY 4M2QA 3ZNIA 2VRGA 1CB1A 1KCYA 3DVEA 4CIDA 5GQQC 1G8IA 2JU0A 3PN7C 1J7OA 1BR4B 1QX5B 1XFUO 3H4SE 1PALA 2I94A 1JSAA 1YUSA 1XVJA 4GGFA 1C7WA 1BT6A 2BECA 1M39A 1QJTA 3EK7A 1EJ3A 2QACA 3BYAA 3LK0A 2JTTA 1ALVA 1J1DA 1LKJA 1NP8A 1RROA 2Y1NA 3RLZA 1J7RA 2KGBC 2M9GA 4R1EA 4OVNF 3ICBA 5CSNA 1JUOA 3LLEA 1K2HA 3CZTX 1CMFA 1K9UA 4YGDB 5HLOA 1PRWA 1CFFA 1CM1A 1MUXA 1JF2A 4MBEA 2PSRA 3OP0A 1BOCA 1XO5A 2LVIA 2BCAA 3I5IC 4PE0A 4FQOA 4C0JA 1NCYA 4DS7A 2MBXA 1GGWA 1NIWA 5AANA 3PALA 3CGAA 1J7PA 1SL7A 2EC6B 2LV7A 2LUXA 4GGNA 1PVAA 4BY4A 1A75A 4AOMA 3VROA 1EH2A 1YURA 2PASA 1RK9A 5D7FA 1YX8A 1DGVA 4E68A 3BXKA 1Y0VH 4M2PA 4PHJA 2M1UA 3KEVA 2KI6C 2NLNA 1MXLC 2M97A 4TNCA 1YUUA 1KSMA 1KFUL 4ORBB 3SJSA 1A75B 4DIRA 2MHHA 3NSLA 1JFKA 1CDNA 2TN4A 3EVUA 2M3WA 3TDZA 1DGUA 5FYXA 5HKZA 4HRHA 2ZFDA 2CCMA 3SIAA 1WY9A 4WQ2A 3A8RA 3VRRA 4YGAA 2LMTA 4BY5A 4WRIA 1KQVA 4CPVA 3QRXA 3NSIA 1CFDA 1B47A 1S3PA 1TNPA 1VRKA 1MR8A 2WCEA 3EK8A 3D0YA 2JZIA 4MZJA 3E3RA 3JTDB 3SIBA 1CDPA 3JVTC 2KAVA 3PFVA 1TNQA 4DCKA 4A4CA 1Y1AA 4N1GA 1N2DA 3I5IB 1QLKA 3C1VA 3SG3A 2D8NA 3O78A 5G08A 1WLZA 1F4QA 1AVSA 1F71A 3IF7A 1IH0A 2GGMA 2JXLA 3D0YB 3O2PA 1DF0A 3I5FC 5HYDA 1SK6D 2WCBA 1SKTA 4GBAA 2H61C 3SG7A 2MRDA 1BU3A 4C0KA 4YGBB 1UHIA 2KBMA 3O6BA 1YUTA 2LLUA 2ZN8A 2I18A 1NCZA 4JWQA 1W7JB 4QJ4B 2KI4C 3DVMA 1FI5A 1DF0B 2F3YA 1XFXO 3KF9A 3TDIA 1MXEA 1MWNA 4CFRA 1KWOB 1IJ5A 2JNFA 1QLSA 3A4UB 3DF0A 1DMOA 2JQ6A 1DTLA 2BBMA 2WCFA 1SPYA 2GV5A 4L9MA 5HLVA 1F55A 2AAOA 1XFZO 2JPTA 1PULA 2QPTA 3CLNA 1CLBA 4DRWA 1LA3A 2SCPA 2JWWA 2BKIB 5KTYA 3KO0A 1LA0A 2CBLA 2BL0B 2LHIA 1LINA 2HQWA 1MF8B 3BUOB 4OCIA 2H61A 2JRFA 2OTGB 4I5NB 5ER5A 4MZLA 3CR2A 1Y6WA 1K95A 3PLFB 1KQMC 2LUCA 5D69A 2ZRSA 3SG2A 3WHUB 4AQJA 2HPSA 3TDUA 1WDCB 1R2UA 2F3ZA 1YX7A 1CM4A 1LXFC 5I2OA 4PHKA 2MLFC 1J7QA 2Y1MA 2LVJA 3I5FB 4AQIA 2M7LA 3I5HB 1S6JA 2LNKA 1DJGA 1ZACA 2L5XB 3AAKA 3NSOA 2JTZA 5HKWA 3VRQA 1B8LA 1L2OB 2A4JA 4P5OE 1IQ3A 3AKAA 1RWYA 1TTXA 3WXAA 1XFVO 3GK2A 1QIWA 1CMGA 4MRYA 1DJWA 1U5IA 1KFUS 1YVLA 4QJ3B 2P6BB 2OS8C 2F8PA 4GPLB 2F2PA 1TCFA 2L50A 3EKJA 5CSFA 2AMIA 1QIVA 2BE6A 4FTGA 5B8IB 1ALWA 1UUSA 1NX3A 1CDMA 1YRTB 3I5GC 1DJHA 2K0JA 1BG1A 2CT9A 1IKUA 1IGVA 1U5IB 2KDHA 2NCPA 1CFPA 3FWBA 2ZKMX 4GAOA 5ER4X 1JFJA 1UHHA 4A4BA 3EK4A 2LLTA 1IJ6A 1YTZC 1KK8C 3DVJA 3FS7A 2LP3A 1SW8A 4PE7A 2ZNDA 1C07A 4C0LA 2JC2A 1TCOB 2K2FA 1K90D 1FW4A 2ZRTA 2EHBA 3OHMB 1E8AA 3O4YA 1EG3A 1ZFSA 3OX6A 1RJVA 1XK4C 4GNKB 3PN7B 1N65A 1D1OA 2K7BA 3AKBA 2KQYA 2M1KB 2BKHB 2PALA 2LANA 2G2BA 2COLB 1X02A 1DT7B 3RM1A 1RECA 2I7AA 4P2YB 1S5GZ 4HREE 1WLMA 1CNPA 1A29A 1WRLA 1S6IA 2K7OA 4PE4A 1A2XA 3CR4X 1ZMZA 4JQ0D 5I2QA 4PALA 1WRKA 1BODA 2KOTA 1B8CA 1V1GA 2WOSA 1DJIA 1BF5A 1B9AA 2IS9A 1NSHA 2SASA 3BQ3A 4QJ5B 1F54A 1KK7Z 1OZSA 2RGIA 1OOJA 1KSOA 1J1EA 4GFTA 5PALA 4N1FA 4NDCA 4ZCUA 3LCPC 1OZOA 2FCEA 1MQ1A 2NZ0A 3SG5A 2K8MB 2LAPA 3F45A 1SR6C 5IBWA 1PK0D 4YRUA 1XK4A 3WNXB 3M0WA 1ODBA 4MLWA 3TUYC 3VRNA 1KK8B 2KAYA 2KI6D 1SL9A 1CKKA 1S36A 5TNCA 1UP5A 4YGCB 1YRUB 3TS5C 2FOTA 3DVKA 1CFCA 2LLSA 1FF1A 1M45A 3D10A 1PSBA 1GJYA 2CXJA 1JC2A 1NWDA 2H2KA 1SNLA 5DKNA 3CS1A 1CDLA 1OQPA 1SRAA 5I2LA 1QXPA 2OPOA 5AFPA 2B1UA 1IRJA 1DJZA 2GGZA 3SG4A 5DKRA 2E30A 2MA2A 2HQ8A 1C7VA 1EG4A 1ZOTB 3PATA 2F2OA 2JNXA 1QX2A 3NXAA 4PDZA 4YI9A 3SG6A 1KFXL 3CWGA 1FBVA 1K8UA 1XFYO 3GK4X 5DKQA 3DF0B 4GGFC 2O5GA 2CTNA 3JVTB 5F6TA 1S6CA 2KFFA 4XYNA 1BJFA 2G9BA 4CLNA 3OB2B 1B1GA 1QASA 1JF0A 3OB1B 4N5XA 3GK1A 4OV2A 1QV1A 4PE1A 2L4HA 2K7DA 4WQ3A 2M49B 4XJKA 3FWCA 1AUIB 4MRXA 2I2RE 1OMRA 4D1EA 2EGDA 1B8RA 2R2IA 1UURA 3EVRA 2ZN9A 2BCXA 2LVKA 1K9KA 1HQVA 2M8UA 2KYCA 4HRGA 1B7TZ 1M31A 1SL8A 1V1FA 4Q04A 4XJKB 2L4IA 1NUBA 2KI4B 1QATA 5J3XA 2K61A 1GGZA 2PMYA 5JOLA 3TS5B 3LK1A 1RFJA 1Y1XA 3PM8A 2HETA 1FI6A 2M29A 1G33A 4CFQA 4I5KA 1SCMC 1BMOA 2KFHA 3WHTB 2FCDA 4MEWA 2DOQA 3VGOA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7Z A;  1LVC D;  2Y4Q A;  1SCV A;  3JTD C;  4U8D A;  1EL4 A;  4ORA B;  1TNX A;  2ZNE A;  4ETO A;  1NX1 A;  1GQM A;  4M2O A;  4OR9 B;  2LMU A;  1CLL A;  4UPG A;  1F8H A;  1QVI Z;  1AJ5 A;  4JPZ B;  2M7N A;  2KBI A;  2Q4U A;  1JWD A;  1IG5 A;  1QVI Y;  1KQM B;  1UWO A;  1RTP 1;  2BE4 A;  1XYD A;  2JT0 A;  2JUL A;  3AAJ A;  1A4P A;  1N0Y A;  1TNW A;  1XA5 A;  5KSZ A;  1EXR A;  5K89 A;  2NCO A;  1FPW A;  1NX2 A;  1BLQ A;  1QS7 A;  2WND A;  4MVF A;  1IQ5 A;  4F0Z B;  2MJW B;  2Y5I A;  2KFG A;  2MAZ A;  2KNE A;  1M63 B;  1S5G Y;  4PHN A;  1IWQ A;  1QV0 A;  2LP2 A;  4MZK A;  1DVI A;  2F33 A;  2KSP A;  2NXQ A;  2OS8 B;  3CTN A;  2CNP A;  4PHM A;  2L51 A;  1NPQ A;  2K2A A;  1J55 A;  3BUM B;  1KWO C;  1AP4 A;  1SY9 A;  1PVB A;  4DUQ A;  3HCM A;  1KK7 Y;  2JT3 A;  2LC5 A;  3I5G B;  5CSJ A;  5HKY A;  3IQO A;  1TIZ A;  1SCM B;  4I5J A;  3HX4 A;  3BUW B;  4MN0 A;  1S26 D;  1PSR A;  1Y1U A;  5AXI A;  2HF5 A;  4YGE B;  1WRZ A;  2LE9 B;  2JT8 A;  2L2E A;  2JOJ A;  1QTX A;  1K94 A;  5CSI A;  2E6W A;  2WC8 A;  4ICB A;  1KFX S;  1OSA A;  1SYM A;  4ORC B;  2BL0 C;  1DJX A;  1HT9 A;  2KHN A;  3MSE B;  2KQ6 A;  1A03 A;  2OTG C;  4IL1 A;  2ISD A;  1F4O A;  1CLM A;  1OE9 B;  1S1E A;  2KGR A;  1K9P A;  1MHO A;  1WDC C;  1G4Y R;  2O60 A;  2LM5 A;  1AK8 A;  1SMG A;  2KYF A;  4PCW A;  2LCP A;  3KHE A;  3KPX A;  3PSR A;  3I5H C;  1SBJ A;  1QX7 A;  1TN4 A;  3DD4 A;  1M46 A;  1NCX A;  4NDD A;  5I8N A;  1L2O C;  1R6P A;  3BOW A;  1F70 A;  2LHL A;  2PRU A;  1K93 D;  1XFW O;  2LVV A;  3FIA A;  1ZUZ A;  1AHR A;  1JBA A;  3EKH A;  2KAX A;  2AUC A;  1NX0 A;  2JXC A;  2MLE C;  3VRP A;  2BBN A;  2L98 A;  5CPV A;  4NQG A;  4YBH B;  2WOR A;  5AEQ A;  1AJ4 A;  1Q80 A;  3LL8 B;  1H4B A;  2PVB A;  3BUX B;  4GUK A;  4I5L B;  1OMD A;  1TOP A;  1UHK A;  3NSK A;  1H8B A;  3BOW B;  3CR5 X;  4OKH A;  5KU1 A;  1NYA A;  4YI8 A;  5AER A;  2LMV A;  5JJG A;  1W7I B;  2EC6 C;  4ZCV A;  3OX5 A;  1CTR A;  2L0P A;  3BUN B;  1OMV A;  3EVV A;  3K21 A;  1YVH A;  3TZ1 A;  2V53 A;  3GOF A;  3IQQ A;  1SR6 B;  1TRF A;  1K96 A;  1B4C A;  1UHN A;  5BPJ A;  2M0R A;  1BR1 B;  4HSZ A;  2Q91 A;  2BCB A;  2FJU B;  2K7C A;  3TUY B;  4NDB A;  1UHJ A;  1YR5 A;  3ZWH A;  4USL A;  1DJY A;  1B7T Y;  4M2Q A;  3ZNI A;  2VRG A;  1CB1 A;  1KCY A;  3DVE A;  4CID A;  5GQQ C;  1G8I A;  2JU0 A;  3PN7 C;  1J7O A;  1BR4 B;  1QX5 B;  1XFU O;  3H4S E;  1PAL A;  2I94 A;  1JSA A;  1YUS A;  1XVJ A;  4GGF A;  1C7W A;  1BT6 A;  2BEC A;  1M39 A;  1QJT A;  3EK7 A;  1EJ3 A;  2QAC A;  3BYA A;  3LK0 A;  2JTT A;  1ALV A;  1J1D A;  1LKJ A;  1NP8 A;  1RRO A;  2Y1N A;  3RLZ A;  1J7R A;  2KGB C;  2M9G A;  4R1E A;  4OVN F;  3ICB A;  5CSN A;  1JUO A;  3LLE A;  1K2H A;  3CZT X;  1CMF A;  1K9U A;  4YGD B;  5HLO A;  1PRW A;  1CFF A;  1CM1 A;  1MUX A;  1JF2 A;  4MBE A;  2PSR A;  3OP0 A;  1BOC A;  1XO5 A;  2LVI A;  2BCA A;  3I5I C;  4PE0 A;  4FQO A;  4C0J A;  1NCY A;  4DS7 A;  2MBX A;  1GGW A;  1NIW A;  5AAN A;  3PAL A;  3CGA A;  1J7P A;  1SL7 A;  2EC6 B;  2LV7 A;  2LUX A;  4GGN A;  1PVA A;  4BY4 A;  1A75 A;  4AOM A;  3VRO A;  1EH2 A;  1YUR A;  2PAS A;  1RK9 A;  5D7F A;  1YX8 A;  1DGV A;  4E68 A;  3BXK A;  1Y0V H;  4M2P A;  4PHJ A;  2M1U A;  3KEV A;  2KI6 C;  2NLN A;  1MXL C;  2M97 A;  4TNC A;  1YUU A;  1KSM A;  1KFU L;  4ORB B;  3SJS A;  1A75 B;  4DIR A;  2MHH A;  3NSL A;  1JFK A;  1CDN A;  2TN4 A;  3EVU A;  2M3W A;  3TDZ A;  1DGU A;  5FYX A;  5HKZ A;  4HRH A;  2ZFD A;  2CCM A;  3SIA A;  1WY9 A;  4WQ2 A;  3A8R A;  3VRR A;  4YGA A;  2LMT A;  4BY5 A;  4WRI A;  1KQV A;  4CPV A;  3QRX A;  3NSI A;  1CFD A;  1B47 A;  1S3P A;  1TNP A;  1VRK A;  1MR8 A;  2WCE A;  3EK8 A;  3D0Y A;  2JZI A;  4MZJ A;  3E3R A;  3JTD B;  3SIB A;  1CDP A;  3JVT C;  2KAV A;  3PFV A;  1TNQ A;  4DCK A;  4A4C A;  1Y1A A;  4N1G A;  1N2D A;  3I5I B;  1QLK A;  3C1V A;  3SG3 A;  2D8N A;  3O78 A;  5G08 A;  1WLZ A;  1F4Q A;  1AVS A;  1F71 A;  3IF7 A;  1IH0 A;  2GGM A;  2JXL A;  3D0Y B;  3O2P A;  1DF0 A;  3I5F C;  5HYD A;  1SK6 D;  2WCB A;  1SKT A;  4GBA A;  2H61 C;  3SG7 A;  2MRD A;  1BU3 A;  4C0K A;  4YGB B;  1UHI A;  2KBM A;  3O6B A;  1YUT A;  2LLU A;  2ZN8 A;  2I18 A;  1NCZ A;  4JWQ A;  1W7J B;  4QJ4 B;  2KI4 C;  3DVM A;  1FI5 A;  1DF0 B;  2F3Y A;  1XFX O;  3KF9 A;  3TDI A;  1MXE A;  1MWN A;  4CFR A;  1KWO B;  1IJ5 A;  2JNF A;  1QLS A;  3A4U B;  3DF0 A;  1DMO A;  2JQ6 A;  1DTL A;  2BBM A;  2WCF A;  1SPY A;  2GV5 A;  4L9M A;  5HLV A;  1F55 A;  2AAO A;  1XFZ O;  2JPT A;  1PUL A;  2QPT A;  3CLN A;  1CLB A;  4DRW A;  1LA3 A;  2SCP A;  2JWW A;  2BKI B;  5KTY A;  3KO0 A;  1LA0 A;  2CBL A;  2BL0 B;  2LHI A;  1LIN A;  2HQW A;  1MF8 B;  3BUO B;  4OCI A;  2H61 A;  2JRF A;  2OTG B;  4I5N B;  5ER5 A;  4MZL A;  3CR2 A;  1Y6W A;  1K95 A;  3PLF B;  1KQM C;  2LUC A;  5D69 A;  2ZRS A;  3SG2 A;  3WHU B;  4AQJ A;  2HPS A;  3TDU A;  1WDC B;  1R2U A;  2F3Z A;  1YX7 A;  1CM4 A;  1LXF C;  5I2O A;  4PHK A;  2MLF C;  1J7Q A;  2Y1M A;  2LVJ A;  3I5F B;  4AQI A;  2M7L A;  3I5H B;  1S6J A;  2LNK A;  1DJG A;  1ZAC A;  2L5X B;  3AAK A;  3NSO A;  2JTZ A;  5HKW A;  3VRQ A;  1B8L A;  1L2O B;  2A4J A;  4P5O E;  1IQ3 A;  3AKA A;  1RWY A;  1TTX A;  3WXA A;  1XFV O;  3GK2 A;  1QIW A;  1CMG A;  4MRY A;  1DJW A;  1U5I A;  1KFU S;  1YVL A;  4QJ3 B;  2P6B B;  2OS8 C;  2F8P A;  4GPL B;  2F2P A;  1TCF A;  2L50 A;  3EKJ A;  5CSF A;  2AMI A;  1QIV A;  2BE6 A;  4FTG A;  5B8I B;  1ALW A;  1UUS A;  1NX3 A;  1CDM A;  1YRT B;  3I5G C;  1DJH A;  2K0J A;  1BG1 A;  2CT9 A;  1IKU A;  1IGV A;  1U5I B;  2KDH A;  2NCP A;  1CFP A;  3FWB A;  2ZKM X;  4GAO A;  5ER4 X;  1JFJ A;  1UHH A;  4A4B A;  3EK4 A;  2LLT A;  1IJ6 A;  1YTZ C;  1KK8 C;  3DVJ A;  3FS7 A;  2LP3 A;  1SW8 A;  4PE7 A;  2ZND A;  1C07 A;  4C0L A;  2JC2 A;  1TCO B;  2K2F A;  1K90 D;  1FW4 A;  2ZRT A;  2EHB A;  3OHM B;  1E8A A;  3O4Y A;  1EG3 A;  1ZFS A;  3OX6 A;  1RJV A;  1XK4 C;  4GNK B;  3PN7 B;  1N65 A;  1D1O A;  2K7B A;  3AKB A;  2KQY A;  2M1K B;  2BKH B;  2PAL A;  2LAN A;  2G2B A;  2COL B;  1X02 A;  1DT7 B;  3RM1 A;  1REC A;  2I7A A;  4P2Y B;  1S5G Z;  4HRE E;  1WLM A;  1CNP A;  1A29 A;  1WRL A;  1S6I A;  2K7O A;  4PE4 A;  1A2X A;  3CR4 X;  1ZMZ A;  4JQ0 D;  5I2Q A;  4PAL A;  1WRK A;  1BOD A;  2KOT A;  1B8C A;  1V1G A;  2WOS A;  1DJI A;  1BF5 A;  1B9A A;  2IS9 A;  1NSH A;  2SAS A;  3BQ3 A;  4QJ5 B;  1F54 A;  1KK7 Z;  1OZS A;  2RGI A;  1OOJ A;  1KSO A;  1J1E A;  4GFT A;  5PAL A;  4N1F A;  4NDC A;  4ZCU A;  3LCP C;  1OZO A;  2FCE A;  1MQ1 A;  2NZ0 A;  3SG5 A;  2K8M B;  2LAP A;  3F45 A;  1SR6 C;  5IBW A;  1PK0 D;  4YRU A;  1XK4 A;  3WNX B;  3M0W A;  1ODB A;  4MLW A;  3TUY C;  3VRN A;  1KK8 B;  2KAY A;  2KI6 D;  1SL9 A;  1CKK A;  1S36 A;  5TNC A;  1UP5 A;  4YGC B;  1YRU B;  3TS5 C;  2FOT A;  3DVK A;  1CFC A;  2LLS A;  1FF1 A;  1M45 A;  3D10 A;  1PSB A;  1GJY A;  2CXJ A;  1JC2 A;  1NWD A;  2H2K A;  1SNL A;  5DKN A;  3CS1 A;  1CDL A;  1OQP A;  1SRA A;  5I2L A;  1QXP A;  2OPO A;  5AFP A;  2B1U A;  1IRJ A;  1DJZ A;  2GGZ A;  3SG4 A;  5DKR A;  2E30 A;  2MA2 A;  2HQ8 A;  1C7V A;  1EG4 A;  1ZOT B;  3PAT A;  2F2O A;  2JNX A;  1QX2 A;  3NXA A;  4PDZ A;  4YI9 A;  3SG6 A;  1KFX L;  3CWG A;  1FBV A;  1K8U A;  1XFY O;  3GK4 X;  5DKQ A;  3DF0 B;  4GGF C;  2O5G A;  2CTN A;  3JVT B;  5F6T A;  1S6C A;  2KFF A;  4XYN A;  1BJF A;  2G9B A;  4CLN A;  3OB2 B;  1B1G A;  1QAS A;  1JF0 A;  3OB1 B;  4N5X A;  3GK1 A;  4OV2 A;  1QV1 A;  4PE1 A;  2L4H A;  2K7D A;  4WQ3 A;  2M49 B;  4XJK A;  3FWC A;  1AUI B;  4MRX A;  2I2R E;  1OMR A;  4D1E A;  2EGD A;  1B8R A;  2R2I A;  1UUR A;  3EVR A;  2ZN9 A;  2BCX A;  2LVK A;  1K9K A;  1HQV A;  2M8U A;  2KYC A;  4HRG A;  1B7T Z;  1M31 A;  1SL8 A;  1V1F A;  4Q04 A;  4XJK B;  2L4I A;  1NUB A;  2KI4 B;  1QAT A;  5J3X A;  2K61 A;  1GGZ A;  2PMY A;  5JOL A;  3TS5 B;  3LK1 A;  1RFJ A;  1Y1X A;  3PM8 A;  2HET A;  1FI6 A;  2M29 A;  1G33 A;  4CFQ A;  4I5K A;  1SCM C;  1BMO A;  2KFH A;  3WHT B;  2FCD A;  4MEW A;  2DOQ A;  3VGO A;  4MSP A; 
#chains in the Genus database with same CATH topology
 1L7Z A;  1LVC D;  2Y4Q A;  1SCV A;  3JTD C;  4U8D A;  1EL4 A;  4ORA B;  1TNX A;  2ZNE A;  4ETO A;  1NX1 A;  1GQM A;  4M2O A;  4OR9 B;  2WCK A;  2LMU A;  1CLL A;  4UPG A;  1F8H A;  1QVI Z;  1AJ5 A;  4JPZ B;  2M7N A;  2KBI A;  2Q4U A;  3K1E A;  1JWD A;  1IG5 A;  1QVI Y;  1KQM B;  1UWO A;  1RTP 1;  2BE4 A;  1XYD A;  3B6X A;  2JT0 A;  2JUL A;  3OBV A;  3AAJ A;  1A4P A;  1N0Y A;  1TNW A;  1XA5 A;  1Z2C B;  5KSZ A;  1EXR A;  5K89 A;  2NCO A;  1FPW A;  1NX2 A;  1BLQ A;  1QS7 A;  2WND A;  4MVF A;  1IQ5 A;  3D78 A;  4F0Z B;  2MJW B;  2Y5I A;  2KFG A;  2MAZ A;  2KNE A;  1M63 B;  1S5G Y;  4PHN A;  3RZS A;  1IWQ A;  1OOH A;  1QV0 A;  1TWO A;  2LP2 A;  4MZK A;  1DVI A;  2F33 A;  2KSP A;  2NXQ A;  2OS8 B;  3CTN A;  2CNP A;  4PHM A;  2L51 A;  3CAB A;  1NPQ A;  2K2A A;  1J55 A;  3BUM B;  1KWO C;  1AP4 A;  1SY9 A;  1PVB A;  1OOF A;  4DUQ A;  3HCM A;  1KK7 Y;  2JT3 A;  2L2C A;  2LC5 A;  3I5G B;  5CSJ A;  5HKY A;  3IQO A;  1TIZ A;  1SCM B;  2BNX A;  4I5J A;  3HX4 A;  3BUW B;  4MN0 A;  1S26 D;  1PSR A;  1Y1U A;  5AXI A;  2HF5 A;  4YGE B;  1WRZ A;  2LE9 B;  2JT8 A;  2L2E A;  2JOJ A;  1QTX A;  1K94 A;  1OOG A;  3BJH A;  5CSI A;  2E6W A;  2WC8 A;  4ICB A;  1KFX S;  1OSA A;  1SYM A;  4ORC B;  2BL0 C;  1DJX A;  1HT9 A;  2KHN A;  3MSE B;  2KQ6 A;  1A03 A;  5D3O A;  2OTG C;  4IL1 A;  2ISD A;  1F4O A;  1CLM A;  1OE9 B;  1S1E A;  2KGR A;  1K9P A;  1MHO A;  1WDC C;  2QEV A;  1G4Y R;  2O60 A;  3B86 A;  2LM5 A;  1AK8 A;  1DEK A;  1SMG A;  2KYF A;  4PCW A;  2KLD A;  2LCP A;  3KHE A;  3KPX A;  3PSR A;  3I5H C;  3FE8 A;  1SBJ A;  1QX7 A;  1TN4 A;  3DD4 A;  1M46 A;  1NCX A;  4NDD A;  5I8N A;  1L2O C;  1R6P A;  3BOW A;  1F70 A;  2LHL A;  2PRU A;  1OOI X;  1K93 D;  1XFW O;  2ERB A;  2LVV A;  1ZUZ A;  1AHR A;  3FIA A;  1JBA A;  3EKH A;  2KAX A;  2AUC A;  1NX0 A;  2JXC A;  2MLE C;  3VRP A;  2BBN A;  2L98 A;  5CPV A;  4NQG A;  4YBH B;  2WOR A;  5AEQ A;  3D74 A;  1AJ4 A;  1Q80 A;  3LL8 B;  3Q8I A;  1H4B A;  2PVB A;  3BUX B;  4GUK A;  4I5L B;  1OMD A;  1TOP A;  1UHK A;  3NSK A;  1H8B A;  3BOW B;  3CR5 X;  3CZ0 A;  4OKH A;  1NYA A;  4YI8 A;  5AER A;  2LMV A;  5JJG A;  1W7I B;  2EC6 C;  4ZCV A;  3OX5 A;  1CTR A;  2L0P A;  3BUN B;  1OMV A;  3EVV A;  3K21 A;  1YVH A;  3TZ1 A;  2V53 A;  3GOF A;  3IQQ A;  3V2L A;  1SR6 B;  1TRF A;  1K96 A;  1B4C A;  1UHN A;  5BPJ A;  2M0R A;  1BR1 B;  4HSZ A;  2Q91 A;  2BCB A;  2FJU B;  2K7C A;  3TUY B;  5I94 A;  4NDB A;  1UHJ A;  3R1P A;  1YR5 A;  3O4X A;  1DC1 A;  5FI6 A;  3ZWH A;  2QEH A;  4USL A;  1DJY A;  1B7T Y;  4M2Q A;  3ZNI A;  2VRG A;  1CB1 A;  1KCY A;  3DVE A;  4CID A;  5GQQ C;  1G8I A;  2JU0 A;  3PN7 C;  4FQT A;  1J7O A;  1BR4 B;  3B87 A;  1QX5 B;  1XFU O;  3H4S E;  1PAL A;  2I94 A;  4OZD A;  1YUS A;  1JSA A;  1XVJ A;  4GGF A;  1C7W A;  2PYQ A;  1BT6 A;  2BEC A;  1M39 A;  1QJT A;  3EK7 A;  1EJ3 A;  2QAC A;  3BYA A;  3LK0 A;  2JTT A;  1ALV A;  5FI7 A;  1J1D A;  1LKJ A;  1NP8 A;  1RRO A;  2Y1N A;  3RLZ A;  1J7R A;  2KGB C;  2M9G A;  4R1E A;  4OVN F;  3ICB A;  5CSN A;  1JUO A;  3LLE A;  1K2H A;  3CZT X;  1CMF A;  1K9U A;  4YGD B;  5HLO A;  1PRW A;  1CFF A;  3B7A A;  1CM1 A;  1MUX A;  1JF2 A;  3OGN A;  4MBE A;  2JPO A;  2PSR A;  3OP0 A;  1BOC A;  1XO5 A;  2LVI A;  2BCA A;  3I5I C;  4PE0 A;  4FQO A;  4C0J A;  1NCY A;  4DS7 A;  2MBX A;  1GGW A;  1NIW A;  5AAN A;  3PAL A;  3CGA A;  1J7P A;  1SL7 A;  2EC6 B;  2LV7 A;  1IIO A;  1TUJ A;  2LUX A;  3R72 A;  4GGN A;  1PVA A;  2KLE A;  1A75 A;  4AOM A;  4BY4 A;  3D76 A;  3VRO A;  1YUR A;  2PAS A;  1RK9 A;  1EH2 A;  5D7F A;  1YX8 A;  1DGV A;  4E68 A;  3BXK A;  1C3Z A;  1Y0V H;  2GTE A;  4M2P A;  4PHJ A;  4JKT A;  2M1U A;  3KEV A;  2KI6 C;  2NLN A;  1MXL C;  2H8V A;  2M97 A;  2WC6 A;  2WCL A;  4TNC A;  1YUU A;  1KSM A;  1KFU L;  4ORB B;  3SJS A;  1A75 B;  4DIR A;  2MHH A;  3NHI A;  3NSL A;  1JFK A;  1CDN A;  2TN4 A;  3EVU A;  2M3W A;  3TDZ A;  1DGU A;  5FYX A;  5HKZ A;  4HRH A;  2ZFD A;  2CCM A;  3SIA A;  1WY9 A;  4WQ2 A;  3A8R A;  3VRR A;  3S0G A;  4YGA A;  2LMT A;  3VB1 A;  4BY5 A;  4WRI A;  1KQV A;  4CPV A;  3QRX A;  3NSI A;  1CFD A;  1B47 A;  1S3P A;  1TNP A;  1VRK A;  1MR8 A;  2WCE A;  3EK8 A;  3D0Y A;  2JZI A;  4MZJ A;  3E3R A;  3JTD B;  3SIB A;  1CDP A;  2WCM A;  3JVT C;  2KAV A;  3PFV A;  1TNQ A;  4DCK A;  3PM2 A;  4A4C A;  1Y1A A;  4N1G A;  1N2D A;  3I5I B;  1QLK A;  3C1V A;  3SG3 A;  2D8N A;  3O78 A;  5G08 A;  1WLZ A;  2YGU A;  1F4Q A;  1AVS A;  1F71 A;  3IF7 A;  1IH0 A;  2GGM A;  2JXL A;  3D0Y B;  3O2P A;  3S0E A;  3CYZ A;  1DF0 A;  3I5F C;  5HYD A;  1SK6 D;  2WCB A;  1SKT A;  4GBA A;  2H61 C;  2KPH A;  3SG7 A;  2MRD A;  1BU3 A;  4C0K A;  4YGB B;  1GM0 A;  1UHI A;  2KBM A;  3O6B A;  1YUT A;  2LLU A;  2ZN8 A;  2I18 A;  1NCZ A;  4JWQ A;  1W7J B;  4QJ4 B;  2KI4 C;  3SS5 A;  3DVM A;  1FI5 A;  1DF0 B;  3BFH A;  2F3Y A;  1XFX O;  3KF9 A;  3TDI A;  2P70 A;  1MXE A;  1MWN A;  4CFR A;  3NGV A;  1KWO B;  1IJ5 A;  2JNF A;  1QLS A;  3A4U B;  2WCH A;  3DF0 A;  5ER5 A;  1DMO A;  3SS4 A;  2JQ6 A;  1DTL A;  2BBM A;  2WCF A;  1SPY A;  2GV5 A;  4L9M A;  5HLV A;  1F55 A;  2AAO A;  4F7F A;  1XFZ O;  2JPT A;  1PUL A;  2QPT A;  3CLN A;  1CLB A;  4DRW A;  1LA3 A;  2SCP A;  2JWW A;  3QME A;  1W9Z A;  3FE9 A;  2BKI B;  3UO9 A;  5KTY A;  3KO0 A;  1LA0 A;  2CBL A;  2QEB A;  2BL0 B;  2LHI A;  1LIN A;  2HQW A;  1MF8 B;  3BUO B;  3BFB A;  2H61 A;  1P28 A;  2JRF A;  2OTG B;  4I5N B;  4OCI A;  4MZL A;  3CR2 A;  1Y6W A;  4PT1 A;  1K95 A;  3PLF B;  1KQM C;  2LUC A;  5D69 A;  2ZRS A;  3SG2 A;  3WHU B;  4AQJ A;  2HPS A;  5EL2 A;  3TDU A;  1WDC B;  1R2U A;  2F3Z A;  1YX7 A;  1CM4 A;  1LXF C;  5I2O A;  4PHK A;  2MLF C;  1J7Q A;  2Y1M A;  2LVJ A;  3I5F B;  3S0B A;  1XFR A;  2M7L A;  2L5Y A;  3I5H B;  4INX A;  1S6J A;  4AQI A;  2LNK A;  1DJG A;  3IVT A;  1ZAC A;  2L5X B;  3AAK A;  3NSO A;  2JTZ A;  5HKW A;  3VRQ A;  1B8L A;  1L2O B;  2A4J A;  4P5O E;  1IQ3 A;  3AKA A;  1RWY A;  1TTX A;  3WXA A;  1XFV O;  3GK2 A;  1QIW A;  5KU1 A;  1CMG A;  4MRY A;  1DJW A;  1U5I A;  1KFU S;  1YVL A;  4QJ3 B;  2P6B B;  2OS8 C;  2F8P A;  5HL1 A;  4GPL B;  2F2P A;  1TCF A;  2L50 A;  3EKJ A;  5CSF A;  2P71 A;  2AMI A;  1QIV A;  2BE6 A;  4FTG A;  5B8I B;  3UNW A;  1ALW A;  1UUS A;  1NX3 A;  1CDM A;  1YRT B;  3D77 A;  3I5G C;  1DJH A;  2K0J A;  1BG1 A;  2CT9 A;  1IKU A;  1IGV A;  1U5I B;  2KDH A;  2NCP A;  1CFP A;  3DZT A;  3FWB A;  3S0F A;  2ZKM X;  3R1V A;  4GAO A;  5ER4 X;  4KYN A;  1JFJ A;  1UHH A;  4A4B A;  3L4L A;  3EK4 A;  1C3Y A;  2LLT A;  1DQE A;  1LS8 A;  1IJ6 A;  1YTZ C;  1KK8 C;  3DVJ A;  3FS7 A;  2LP3 A;  1SW8 A;  3B88 A;  4PE7 A;  2ZND A;  1C07 A;  4C0L A;  2JC2 A;  1TCO B;  2K2F A;  1K90 D;  1FW4 A;  2ZRT A;  2EHB A;  3OHM B;  1E8A A;  3O4Y A;  1EG3 A;  1OW4 A;  1ZFS A;  3OX6 A;  1RJV A;  1XK4 C;  4GNK B;  3PN7 B;  1N65 A;  2QEO A;  2K7B A;  3AKB A;  2KQY A;  2M1K B;  2BAP A;  3EG5 B;  1D1O A;  2BKH B;  2PAL A;  2LAN A;  2G2B A;  2COL B;  1X02 A;  2WC5 A;  1DT7 B;  1ORG A;  3RM1 A;  3S0A A;  1REC A;  2I7A A;  4P2Y B;  1S5G Z;  4HRE E;  1WLM A;  1CNP A;  1A29 A;  1WRL A;  1S6I A;  2K7O A;  4PE4 A;  2WCJ A;  4IJ7 A;  1A2X A;  3CR4 X;  1ZMZ A;  4JQ0 D;  5I2Q A;  3CZ1 A;  4PAL A;  1WRK A;  1BOD A;  2KOT A;  1B8C A;  1V1G A;  2WOS A;  1DJI A;  1BF5 A;  1B9A A;  2IS9 A;  1NSH A;  2SAS A;  3BQ3 A;  4QJ5 B;  1F54 A;  1KK7 Z;  1OZS A;  2RGI A;  2FJY A;  1OOJ A;  1KSO A;  1J1E A;  4GFT A;  5PAL A;  4N1F A;  4NDC A;  4ZCU A;  3LCP C;  1OZO A;  2FCE A;  4JD9 A;  1MQ1 A;  2NZ0 A;  3SG5 A;  2K8M B;  2LAP A;  3F45 A;  1SR6 C;  3DY9 A;  1PK0 D;  5IBW A;  4YRU A;  1XK4 A;  3L4A A;  1QWV A;  2K60 A;  3WNX B;  4INW A;  3M0W A;  1ODB A;  4MLW A;  3TUY C;  3VRN A;  1KK8 B;  3CZ2 A;  2KAY A;  2KI6 D;  1SL9 A;  1CKK A;  1S36 A;  3CDN A;  5TNC A;  1UP5 A;  4YGC B;  1YRU B;  3TS5 C;  2FOT A;  3DVK A;  1CFC A;  2LLS A;  1FF1 A;  1M45 A;  3D10 A;  1PSB A;  1GJY A;  2CXJ A;  1JC2 A;  3D75 A;  1SSE B;  1NWD A;  2H2K A;  1SNL A;  3BFA A;  3CS1 A;  5DKN A;  1CDL A;  1OQP A;  1SRA A;  3D73 A;  5I2L A;  1QXP A;  2OPO A;  5AFP A;  2B1U A;  3DYE A;  1IRJ A;  5DIC A;  1DJZ A;  2GGZ A;  3SG4 A;  5DKR A;  2E30 A;  2MA2 A;  2HQ8 A;  1C7V A;  1EG4 A;  1ZOT B;  3PAT A;  2F2O A;  2JNX A;  3R1O A;  1QX2 A;  3NXA A;  4PDZ A;  4YI9 A;  3SG6 A;  1KFX L;  3CWG A;  1FBV A;  1K8U A;  2QDI A;  1XFY O;  3GK4 X;  3DXL A;  3PJI A;  3DF0 B;  4GGF C;  2O5G A;  5DKQ A;  2CTN A;  5FI2 A;  3JVT B;  5F6T A;  1S6C A;  2KFF A;  4XYN A;  1BJF A;  2G9B A;  4CLN A;  3L47 A;  3SS3 A;  3OB2 B;  1B1G A;  1QAS A;  1JF0 A;  3OB1 B;  4N5X A;  3S0D A;  3GK1 A;  3N7H A;  4OV2 A;  1QV1 A;  4PE1 A;  2L4H A;  2K7D A;  4WQ3 A;  2M49 B;  4XJK A;  3FWC A;  1AUI B;  4MRX A;  2I2R E;  1OMR A;  4D1E A;  1Z4H A;  1T14 A;  2EGD A;  1B8R A;  1DEL A;  2R2I A;  1UUR A;  3EVR A;  2ZN9 A;  2BCX A;  2LVK A;  2PQL A;  1K9K A;  1HQV A;  2M8U A;  2KYC A;  4HRG A;  1B7T Z;  1M31 A;  1SL8 A;  1V1F A;  4Q04 A;  4XJK B;  2L4I A;  1NUB A;  2KI4 B;  1QAT A;  5J3X A;  2K61 A;  1GGZ A;  2PMY A;  5JOL A;  3TS5 B;  3LK1 A;  1RFJ A;  1Y1X A;  3PM8 A;  2HET A;  1FI6 A;  3FE6 A;  3NHT A;  2M29 A;  1G33 A;  4CFQ A;  4I5K A;  1SCM C;  1BMO A;  1TUZ A;  2KFH A;  2FCD A;  3WHT B;  4MEW A;  2DOQ A;  3VGO A;  4MSP A; 
#chains in the Genus database with same CATH homology
 1L7Z A;  1LVC D;  2Y4Q A;  1SCV A;  3JTD C;  4U8D A;  1EL4 A;  4ORA B;  1TNX A;  2ZNE A;  4ETO A;  1NX1 A;  1GQM A;  4M2O A;  4OR9 B;  2LMU A;  1CLL A;  4UPG A;  1F8H A;  1QVI Z;  1AJ5 A;  4JPZ B;  2M7N A;  2KBI A;  2Q4U A;  1JWD A;  1IG5 A;  1QVI Y;  1KQM B;  1UWO A;  1RTP 1;  2BE4 A;  1XYD A;  2JT0 A;  2JUL A;  3AAJ A;  1A4P A;  1N0Y A;  1TNW A;  1XA5 A;  5KSZ A;  1EXR A;  5K89 A;  2NCO A;  1FPW A;  1NX2 A;  1BLQ A;  1QS7 A;  2WND A;  4MVF A;  1IQ5 A;  4F0Z B;  2MJW B;  2Y5I A;  2KFG A;  2MAZ A;  2KNE A;  1M63 B;  1S5G Y;  4PHN A;  1IWQ A;  1QV0 A;  2LP2 A;  4MZK A;  1DVI A;  2F33 A;  2KSP A;  2NXQ A;  2OS8 B;  3CTN A;  2CNP A;  4PHM A;  2L51 A;  1NPQ A;  2K2A A;  1J55 A;  3BUM B;  1KWO C;  1AP4 A;  1SY9 A;  1PVB A;  4DUQ A;  3HCM A;  1KK7 Y;  2JT3 A;  2LC5 A;  3I5G B;  5CSJ A;  5HKY A;  3IQO A;  1TIZ A;  1SCM B;  4I5J A;  3HX4 A;  3BUW B;  4MN0 A;  1S26 D;  1PSR A;  1Y1U A;  5AXI A;  2HF5 A;  4YGE B;  1WRZ A;  2LE9 B;  2JT8 A;  2L2E A;  2JOJ A;  1QTX A;  1K94 A;  5CSI A;  2E6W A;  2WC8 A;  4ICB A;  1KFX S;  1OSA A;  1SYM A;  4ORC B;  2BL0 C;  1DJX A;  1HT9 A;  2KHN A;  3MSE B;  2KQ6 A;  1A03 A;  2OTG C;  4IL1 A;  2ISD A;  1F4O A;  1CLM A;  1OE9 B;  1S1E A;  2KGR A;  1K9P A;  1MHO A;  1WDC C;  1G4Y R;  2O60 A;  2LM5 A;  1AK8 A;  1SMG A;  2KYF A;  4PCW A;  2LCP A;  3KHE A;  3KPX A;  3PSR A;  3I5H C;  1SBJ A;  1QX7 A;  1TN4 A;  3DD4 A;  1M46 A;  1NCX A;  4NDD A;  5I8N A;  1L2O C;  1R6P A;  3BOW A;  1F70 A;  2LHL A;  2PRU A;  1K93 D;  1XFW O;  2LVV A;  3FIA A;  1ZUZ A;  1AHR A;  1JBA A;  3EKH A;  2KAX A;  2AUC A;  1NX0 A;  2JXC A;  2MLE C;  3VRP A;  2BBN A;  2L98 A;  5CPV A;  4NQG A;  4YBH B;  2WOR A;  5AEQ A;  1AJ4 A;  1Q80 A;  3LL8 B;  1H4B A;  2PVB A;  3BUX B;  4GUK A;  4I5L B;  1OMD A;  1TOP A;  1UHK A;  3NSK A;  1H8B A;  3BOW B;  3CR5 X;  4OKH A;  5KU1 A;  1NYA A;  4YI8 A;  5AER A;  2LMV A;  5JJG A;  1W7I B;  2EC6 C;  4ZCV A;  3OX5 A;  1CTR A;  2L0P A;  3BUN B;  1OMV A;  3EVV A;  3K21 A;  1YVH A;  3TZ1 A;  2V53 A;  3GOF A;  3IQQ A;  1SR6 B;  1TRF A;  1K96 A;  1B4C A;  1UHN A;  5BPJ A;  2M0R A;  1BR1 B;  4HSZ A;  2Q91 A;  2BCB A;  2FJU B;  2K7C A;  3TUY B;  4NDB A;  1UHJ A;  1YR5 A;  3ZWH A;  4USL A;  1DJY A;  1B7T Y;  4M2Q A;  3ZNI A;  2VRG A;  1CB1 A;  1KCY A;  3DVE A;  4CID A;  5GQQ C;  1G8I A;  2JU0 A;  3PN7 C;  1J7O A;  1BR4 B;  1QX5 B;  1XFU O;  3H4S E;  1PAL A;  2I94 A;  1JSA A;  1YUS A;  1XVJ A;  4GGF A;  1C7W A;  1BT6 A;  2BEC A;  1M39 A;  1QJT A;  3EK7 A;  1EJ3 A;  2QAC A;  3BYA A;  3LK0 A;  2JTT A;  1ALV A;  1J1D A;  1LKJ A;  1NP8 A;  1RRO A;  2Y1N A;  3RLZ A;  1J7R A;  2KGB C;  2M9G A;  4R1E A;  4OVN F;  3ICB A;  5CSN A;  1JUO A;  3LLE A;  1K2H A;  3CZT X;  1CMF A;  1K9U A;  4YGD B;  5HLO A;  1PRW A;  1CFF A;  1CM1 A;  1MUX A;  1JF2 A;  4MBE A;  2PSR A;  3OP0 A;  1BOC A;  1XO5 A;  2LVI A;  2BCA A;  3I5I C;  4PE0 A;  4FQO A;  4C0J A;  1NCY A;  4DS7 A;  2MBX A;  1GGW A;  1NIW A;  5AAN A;  3PAL A;  3CGA A;  1J7P A;  1SL7 A;  2EC6 B;  2LV7 A;  2LUX A;  4GGN A;  1PVA A;  4BY4 A;  1A75 A;  4AOM A;  3VRO A;  1EH2 A;  1YUR A;  2PAS A;  1RK9 A;  5D7F A;  1YX8 A;  1DGV A;  4E68 A;  3BXK A;  1Y0V H;  4M2P A;  4PHJ A;  2M1U A;  3KEV A;  2KI6 C;  2NLN A;  1MXL C;  2M97 A;  4TNC A;  1YUU A;  1KSM A;  1KFU L;  4ORB B;  3SJS A;  1A75 B;  4DIR A;  2MHH A;  3NSL A;  1JFK A;  1CDN A;  2TN4 A;  3EVU A;  2M3W A;  3TDZ A;  1DGU A;  5FYX A;  5HKZ A;  4HRH A;  2ZFD A;  2CCM A;  3SIA A;  1WY9 A;  4WQ2 A;  3A8R A;  3VRR A;  4YGA A;  2LMT A;  4BY5 A;  4WRI A;  1KQV A;  4CPV A;  3QRX A;  3NSI A;  1CFD A;  1B47 A;  1S3P A;  1TNP A;  1VRK A;  1MR8 A;  2WCE A;  3EK8 A;  3D0Y A;  2JZI A;  4MZJ A;  3E3R A;  3JTD B;  3SIB A;  1CDP A;  3JVT C;  2KAV A;  3PFV A;  1TNQ A;  4DCK A;  4A4C A;  1Y1A A;  4N1G A;  1N2D A;  3I5I B;  1QLK A;  3C1V A;  3SG3 A;  2D8N A;  3O78 A;  5G08 A;  1WLZ A;  1F4Q A;  1AVS A;  1F71 A;  3IF7 A;  1IH0 A;  2GGM A;  2JXL A;  3D0Y B;  3O2P A;  1DF0 A;  3I5F C;  5HYD A;  1SK6 D;  2WCB A;  1SKT A;  4GBA A;  2H61 C;  3SG7 A;  2MRD A;  1BU3 A;  4C0K A;  4YGB B;  1UHI A;  2KBM A;  3O6B A;  1YUT A;  2LLU A;  2ZN8 A;  2I18 A;  1NCZ A;  4JWQ A;  1W7J B;  4QJ4 B;  2KI4 C;  3DVM A;  1FI5 A;  1DF0 B;  2F3Y A;  1XFX O;  3KF9 A;  3TDI A;  1MXE A;  1MWN A;  4CFR A;  1KWO B;  1IJ5 A;  2JNF A;  1QLS A;  3A4U B;  3DF0 A;  1DMO A;  2JQ6 A;  1DTL A;  2BBM A;  2WCF A;  1SPY A;  2GV5 A;  4L9M A;  5HLV A;  1F55 A;  2AAO A;  1XFZ O;  2JPT A;  1PUL A;  2QPT A;  3CLN A;  1CLB A;  4DRW A;  1LA3 A;  2SCP A;  2JWW A;  2BKI B;  5KTY A;  3KO0 A;  1LA0 A;  2CBL A;  2BL0 B;  2LHI A;  1LIN A;  2HQW A;  1MF8 B;  3BUO B;  4OCI A;  2H61 A;  2JRF A;  2OTG B;  4I5N B;  5ER5 A;  4MZL A;  3CR2 A;  1Y6W A;  1K95 A;  3PLF B;  1KQM C;  2LUC A;  5D69 A;  2ZRS A;  3SG2 A;  3WHU B;  4AQJ A;  2HPS A;  3TDU A;  1WDC B;  1R2U A;  2F3Z A;  1YX7 A;  1CM4 A;  1LXF C;  5I2O A;  4PHK A;  2MLF C;  1J7Q A;  2Y1M A;  2LVJ A;  3I5F B;  4AQI A;  2M7L A;  3I5H B;  1S6J A;  2LNK A;  1DJG A;  1ZAC A;  2L5X B;  3AAK A;  3NSO A;  2JTZ A;  5HKW A;  3VRQ A;  1B8L A;  1L2O B;  2A4J A;  4P5O E;  1IQ3 A;  3AKA A;  1RWY A;  1TTX A;  3WXA A;  1XFV O;  3GK2 A;  1QIW A;  1CMG A;  4MRY A;  1DJW A;  1U5I A;  1KFU S;  1YVL A;  4QJ3 B;  2P6B B;  2OS8 C;  2F8P A;  4GPL B;  2F2P A;  1TCF A;  2L50 A;  3EKJ A;  5CSF A;  2AMI A;  1QIV A;  2BE6 A;  4FTG A;  5B8I B;  1ALW A;  1UUS A;  1NX3 A;  1CDM A;  1YRT B;  3I5G C;  1DJH A;  2K0J A;  1BG1 A;  2CT9 A;  1IKU A;  1IGV A;  1U5I B;  2KDH A;  2NCP A;  1CFP A;  3FWB A;  2ZKM X;  4GAO A;  5ER4 X;  1JFJ A;  1UHH A;  4A4B A;  3EK4 A;  2LLT A;  1IJ6 A;  1YTZ C;  1KK8 C;  3DVJ A;  3FS7 A;  2LP3 A;  1SW8 A;  4PE7 A;  2ZND A;  1C07 A;  4C0L A;  2JC2 A;  1TCO B;  2K2F A;  1K90 D;  1FW4 A;  2ZRT A;  2EHB A;  3OHM B;  1E8A A;  3O4Y A;  1EG3 A;  1ZFS A;  3OX6 A;  1RJV A;  1XK4 C;  4GNK B;  3PN7 B;  1N65 A;  1D1O A;  2K7B A;  3AKB A;  2KQY A;  2M1K B;  2BKH B;  2PAL A;  2LAN A;  2G2B A;  2COL B;  1X02 A;  1DT7 B;  3RM1 A;  1REC A;  2I7A A;  4P2Y B;  1S5G Z;  4HRE E;  1WLM A;  1CNP A;  1A29 A;  1WRL A;  1S6I A;  2K7O A;  4PE4 A;  1A2X A;  3CR4 X;  1ZMZ A;  4JQ0 D;  5I2Q A;  4PAL A;  1WRK A;  1BOD A;  2KOT A;  1B8C A;  1V1G A;  2WOS A;  1DJI A;  1BF5 A;  1B9A A;  2IS9 A;  1NSH A;  2SAS A;  3BQ3 A;  4QJ5 B;  1F54 A;  1KK7 Z;  1OZS A;  2RGI A;  1OOJ A;  1KSO A;  1J1E A;  4GFT A;  5PAL A;  4N1F A;  4NDC A;  4ZCU A;  3LCP C;  1OZO A;  2FCE A;  1MQ1 A;  2NZ0 A;  3SG5 A;  2K8M B;  2LAP A;  3F45 A;  1SR6 C;  5IBW A;  1PK0 D;  4YRU A;  1XK4 A;  3WNX B;  3M0W A;  1ODB A;  4MLW A;  3TUY C;  3VRN A;  1KK8 B;  2KAY A;  2KI6 D;  1SL9 A;  1CKK A;  1S36 A;  5TNC A;  1UP5 A;  4YGC B;  1YRU B;  3TS5 C;  2FOT A;  3DVK A;  1CFC A;  2LLS A;  1FF1 A;  1M45 A;  3D10 A;  1PSB A;  1GJY A;  2CXJ A;  1JC2 A;  1NWD A;  2H2K A;  1SNL A;  5DKN A;  3CS1 A;  1CDL A;  1OQP A;  1SRA A;  5I2L A;  1QXP A;  2OPO A;  5AFP A;  2B1U A;  1IRJ A;  1DJZ A;  2GGZ A;  3SG4 A;  5DKR A;  2E30 A;  2MA2 A;  2HQ8 A;  1C7V A;  1EG4 A;  1ZOT B;  3PAT A;  2F2O A;  2JNX A;  1QX2 A;  3NXA A;  4PDZ A;  4YI9 A;  3SG6 A;  1KFX L;  3CWG A;  1FBV A;  1K8U A;  1XFY O;  3GK4 X;  5DKQ A;  3DF0 B;  4GGF C;  2O5G A;  2CTN A;  3JVT B;  5F6T A;  1S6C A;  2KFF A;  4XYN A;  1BJF A;  2G9B A;  4CLN A;  3OB2 B;  1B1G A;  1QAS A;  1JF0 A;  3OB1 B;  4N5X A;  3GK1 A;  4OV2 A;  1QV1 A;  4PE1 A;  2L4H A;  2K7D A;  4WQ3 A;  2M49 B;  4XJK A;  3FWC A;  1AUI B;  4MRX A;  2I2R E;  1OMR A;  4D1E A;  2EGD A;  1B8R A;  2R2I A;  1UUR A;  3EVR A;  2ZN9 A;  2BCX A;  2LVK A;  1K9K A;  1HQV A;  2M8U A;  2KYC A;  4HRG A;  1B7T Z;  1M31 A;  1SL8 A;  1V1F A;  4Q04 A;  4XJK B;  2L4I A;  1NUB A;  2KI4 B;  1QAT A;  5J3X A;  2K61 A;  1GGZ A;  2PMY A;  5JOL A;  3TS5 B;  3LK1 A;  1RFJ A;  1Y1X A;  3PM8 A;  2HET A;  1FI6 A;  2M29 A;  1G33 A;  4CFQ A;  4I5K A;  1SCM C;  1BMO A;  2KFH A;  3WHT B;  2FCD A;  4MEW A;  2DOQ A;  3VGO A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...