1D1OA

Cooperativity in ef-hand ca2+-binding proteins: evidence of site-site communication from binding-induced changes in structure and dynamics of n56a calbindin d9k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKAGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CALBINDIN D9K
publication title Site-site communication in the EF-hand Ca2+-binding protein calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1d1oA00
4ZCVA 4I5LB 2KNEA 3TDZA 5TNCA 1B7TZ 1RTP1 3BQ3A 1J1EA 1DJHA 1PRWA 2L4HA 3FS7A 2OTGB 3FWBA 1TNXA 5IBWA 2BL0C 2K2AA 2M1UA 5CSFA 5HKZA 1K90D 2WCEA 4YGCB 3VGOA 2LUXA 5HKYA 1RECA 3EVVA 1DJWA 1MF8B 4C0LA 1B8LA 1M45A 1W7JB 2F33A 4OVNF 1KFXL 1LA3A 2HF5A 2H61A 3SG7A 1EXRA 5JOLA 3SIAA 2KI6C 4BY4A 2KQ6A 3EVRA 4WQ2A 3PALA 1SCMC 4DS7A 1HQVA 1YVLA 1U5IB 2OTGC 5I8NA 3TDIA 3BOWB 4GGFC 2JT3A 2WCBA 1AJ4A 1PVBA 2K2FA 3I5IC 1SMGA 4PE0A 1TIZA 3WHTB 3I5HC 3D0YB 1F55A 2KI4C 3OX5A 1DMOA 1XO5A 1BU3A 1CLLA 2NLNA 1K93D 1SL7A 2PRUA 2Y5IA 2KFHA 3DF0B 3WNXB 3FIAA 2MLEC 2L50A 2WOSA 4DIRA 4QJ5B 4N1FA 1SR6B 1QIWA 2M7NA 3IQQA 1NP8A 1K9UA 2LHLA 4PCWA 1B47A 2M29A 2JU0A 3JTDC 5DKQA 1QVIZ 2KBIA 4R1EA 2L0PA 2D8NA 1J7PA 3VRNA 3SG3A 2TN4A 1CLMA 2KFFA 1YX7A 2WC8A 1YR5A 3JVTB 4N1GA 4A4BA 2K8MB 1CFFA 2L4IA 3KO0A 3MSEB 3H4SE 1PVAA 2LANA 1CKKA 3LK1A 1IKUA 2KBMA 2OS8B 1N2DA 5I2LA 4UPGA 4M2OA 1WRKA 1K8UA 2SASA 2R2IA 1QXPA 1GGWA 3D10A 2ZN9A 1KWOC 1QS7A 2K7OA 2WNDA 1GQMA 1TTXA 2JT8A 2KGRA 2COLB 2EHBA 2LVKA 2MA2A 3C1VA 3NSKA 4I5KA 5HLOA 1AK8A 3BUWB 5HLVA 1BR4B 3BYAA 1R6PA 2M49B 1NX3A 1NCYA 4E68A 1UHJA 1QX5B 2ZRSA 3BXKA 2CXJA 3GOFA 1Q80A 1H4BA 3GK4X 2JRFA 4I5NB 2LE9B 3CTNA 1NYAA 4DCKA 1KQMB 1IJ5A 3EVUA 1UHKA 5B8IB 2JT0A 1KFUS 1B7TY 2L98A 1KK8C 1PALA 4PHMA 1B9AA 4CFRA 5KU1A 1DJIA 1JFKA 1IWQA 4I5JA 1RWYA 1CDMA 1JSAA 3D0YA 4PDZA 1UP5A 1Y1XA 3AKAA 1XK4C 2KAXA 3TUYC 1ZOTB 1CTRA 1MHOA 3VRRA 2FOTA 5AEQA 1QLSA 2H2KA 4P2YB 5D69A 1IGVA 1OQPA 1BF5A 2KDHA 1DJZA 2BL0B 2KAYA 1J55A 2L51A 3TZ1A 2HPSA 3IF7A 3HCMA 4MVFA 3CS1A 1G8IA 4YI9A 2M1KB 1RJVA 2I2RE 2LLSA 3CZTX 3PM8A 1YTZC 1ODBA 2I18A 3DVEA 1MUXA 1YRTB 5AXIA 1MXEA 4OKHA 1KFXS 2K7DA 1PULA 4MEWA 1J7RA 2MAZA 1SCMB 5HYDA 1BODA 1OE9B 1CMGA 2M8UA 2LUCA 1EJ3A 1CDLA 1OMDA 3O4YA 2M97A 2FCEA 2KYFA 3I5IB 2F2OA 3SG5A 1LVCD 1YUTA 1F4QA 2M3WA 3NXAA 3VRPA 1KQVA 3I5HB 3AAJA 3RM1A 1YVHA 2E30A 2KI4B 1IQ5A 2LLTA 1WRZA 1V1FA 1XYDA 1CDPA 2NZ0A 2ZNEA 4WRIA 1C7VA 1QIVA 1JFJA 3ICBA 2ISDA 1B8RA 3TS5B 3BUMB 2LVJA 1M39A 4DRWA 4MLWA 3CWGA 2K7CA 2KGBC 1DGVA 2NXQA 1QVIY 1KSOA 1QJTA 1XK4A 1DJXA 1J1DA 2LVIA 1NUBA 3JTDB 1A2XA 4Q04A 1A29A 1FW4A 1IG5A 1UHHA 3A4UB 1CFPA 5DKRA 1SYMA 1QX7A 2BKHB 3TS5C 3ZWHA 2L5XB 1YUUA 1HT9A 1S5GZ 1N65A 1B1GA 2LHIA 2SCPA 3EK8A 1AVSA 4GAOA 1A4PA 1QV1A 4M2PA 1SW8A 1X02A 1C07A 1UWOA 1S3PA 2ZFDA 2CTNA 4HRGA 3CR5X 1KWOB 5CSJA 1SY9A 1DVIA 1UURA 2V53A 3KF9A 1A03A 1DGUA 2KI6D 1FI6A 2KSPA 3DVJA 1BR1B 1SL9A 1ZUZA 2LMUA 1PK0D 1UHIA 4MN0A 4QJ4B 4YGAA 3WXAA 2IS9A 3AKBA 4PHNA 1OMVA 4AQIA 1NX2A 2DOQA 2PVBA 1BT6A 3K21A 1JUOA 1KK7Z 1K94A 1XFZO 2LP3A 1H8BA 4WQ3A 1JF0A 1KK8B 2JOJA 2MLFC 3OHMB 1CDNA 1Y1AA 4MZLA 4JQ0D 1QASA 4PHKA 4USLA 4OR9B 1OZSA 1UHNA 4XJKA 3BUOB 3VRQA 5KSZA 1DF0B 3TUYB 2MRDA 2O60A 1S1EA 4MBEA 3RLZA 1WRLA 2AMIA 3I5GB 1Y0VH 2PSRA 3PSRA 4GBAA 3IQOA 3EK4A 5PALA 2KFGA 4P5OE 2E6WA 1SKTA 1F71A 1CLBA 1A75B 2GGZA 2KQYA 2ZKMX 3E3RA 2NCOA 2K61A 3LCPC 2GV5A 4GNKB 2F3ZA 5G08A 1DJGA 3HX4A 2VRGA 4GPLB 2PMYA 4ICBA 1CNPA 1L7ZA 2BE6A 4DUQA 4TNCA 3OP0A 1K9PA 3I5GC 1TOPA 2BCXA 4A4CA 1RROA 1OMRA 4YGEB 5K89A 2ZNDA 3GK2A 4HREE 5BPJA 1JF2A 1YX8A 3DD4A 4FQOA 1MWNA 1K96A 2A4JA 2G9BA 1CMFA 1BLQA 4PHJA 5CSIA 1NCXA 1N0YA 1DTLA 1NIWA 4PALA 1S6CA 1EG3A 3SJSA 1IH0A 1SCVA 1IJ6A 1SL8A 2QACA 5CPVA 1AHRA 3I5FC 4L9MA 1E8AA 4MSPA 1XFUO 2L2EA 1TNWA 2RGIA 4GFTA 4CIDA 1BG1A 3DVMA 1G4YR 1L2OC 2I94A 1QATA 3PN7C 3PATA 2O5GA 4NDCA 1ZMZA 1WDCC 1ZACA 5AFPA 3NSLA 1S6JA 4MZJA 1RFJA 3NSIA 4AQJA 1S5GY 2K7BA 1CM1A 2BECA 3FWCA 1YRUB 1NSHA 2I7AA 3CR4X 1MR8A 2JQ6A 3BUNB 3LK0A 1RK9A 2Y1NA 4XJKB 4CPVA 3EKHA 1R2UA 1NX1A 1D1OA 1XFVO 4OV2A 1TN4A 4C0KA 3BUXB 1AUIB 1LXFC 3SIBA 2JXLA 1FI5A 5J3XA 2Y1MA 1DF0A 1S6IA 1QLKA 1SNLA 1GGZA 2AAOA 1WY9A 4NQGA 3O6BA 4N5XA 1EG4A 2NCPA 3O78A 2LCPA 1LINA 1UUSA 3M0WA 1A75A 3WHUB 4U8DA 2LP2A 5FYXA 1XA5A 4YRUA 1AP4A 2BCAA 1OOJA 2PASA 1XVJA 1K95A 4GGFA 1GJYA 4ORAB 4XYNA 1G33A 2F3YA 1WLZA 4PE1A 1KK7Y 4MRXA 4FTGA 1C7WA 1TCFA 5AANA 1B4CA 1LA0A 5JJGA 2LV7A 1CM4A 2GGMA 2M0RA 3SG6A 2FCDA 2M9GA 5ER4X 3EKJA 1CFDA 1XFYO 1EH2A 4BY5A 2KOTA 5F6TA 1NWDA 4GGNA 4D1EA 3DVKA 1CB1A 1F8HA 5D7FA 2JWWA 3LL8B 1DT7B 2Q91A 2P6BB 2Q4UA 2KHNA 1M31A 3F45A 4YGDB 5I2OA 1MXLC 1PSRA 1Y6WA 5ER5A 1VRKA 1SBJA 1KSMA 1J7QA 2EC6B 1TRFA 1OSAA 2HQ8A 1SPYA 5DKNA 3QRXA 1BOCA 1DJYA 2BBMA 2LMTA 3PFVA 1NX0A 3KHEA 4AOMA 4F0ZB 2QPTA 1JC2A 3CLNA 4PE4A 1FPWA 2FJUB 4GUKA 1IQ3A 2JTZA 4JWQA 2F2PA 1Y1UA 3OB2B 1KCYA 2MHHA 3EK7A 2M7LA 1SR6C 4JPZB 2EGDA 3VROA 1NPQA 4ZCUA 1ALVA 3OX6A 1F54A 2BBNA 2HETA 3CGAA 1AJ5A 2EC6C 1PSBA 1ZFSA 2F8PA 4ORBB 2LMVA 2G2BA 1J7OA 1FF1A 3AAKA 1V1GA 2BE4A 4NDBA 3KEVA 4CFQA 2LM5A 2LVVA 1OZOA 2WCFA 1SRAA 1BMOA 3A8RA 3JVTC 2CT9A 1YUSA 2LC5A 2ZN8A 3PLFB 2B1UA 1B8CA 5HKWA 2LAPA 1K2HA 1BJFA 1CFCA 3GK1A 2PALA 2MBXA 1QX2A 2MJWB 1QV0A 4YBHB 1S26D 2OS8C 3I5FB 3O2PA 4CLNA 2K0JA 2CNPA 3NSOA 4YGBB 2JNXA 4M2QA 2CCMA 4QJ3B 2WORA 1F4OA 3OB1B 4YI8A 2BCBA 5KTYA 1L2OB 2OPOA 4OCIA 1U5IA 3PN7B 1S36A 1JBAA 1WDCB 1NCZA 2H61C 1TNQA 3BOWA 4HRHA 1LKJA 2JXCA 2KYCA 2ZRTA 2LNKA 4IL1A 3CR2A 1K9KA 1EL4A 2BKIB 3LLEA 1F70A 3SG4A 1YURA 1WLMA 1QTXA 5GQQC 2AUCA 4MRYA 1FBVA 2JC2A 1SK6D 5AERA 1M46A 3KPXA 3ZNIA 5CSNA 3TDUA 1IRJA 2JZIA 4MZKA 2JULA 4ORCB 1TNPA 4PE7A 2LLUA 3DF0A 2KAVA 4C0JA 1JWDA 4HSZA 1KFUL 1KQMC 2JPTA 1ALWA 2JTTA 4ETOA 1TCOB 3SG2A 5I2QA 2JNFA 2CBLA 1MQ1A 1W7IB 2Y4QA 1XFXO 2HQWA 1XFWO 4NDDA 1M63B
chains in the Genus database with same CATH superfamily
4ZCVA 4I5LB 2KNEA 3TDZA 5TNCA 1B7TZ 1RTP1 3BQ3A 2WCJA 3S0EA 3DY9A 5FI6A 1J1EA 1DJHA 1PRWA 2L4HA 3FS7A 2OTGB 3FWBA 1TNXA 5IBWA 2BL0C 2K2AA 3B86A 2M1UA 5CSFA 5HKZA 1K90D 2WCEA 4YGCB 3VGOA 2LUXA 5HKYA 3S0GA 1RECA 3EVVA 1DJWA 1MF8B 4C0LA 1B8LA 1M45A 1W7JB 2F33A 1OOHA 4OVNF 1KFXL 1LA3A 2HF5A 2H61A 3SG7A 1EXRA 5JOLA 3SIAA 2KI6C 4BY4A 2KQ6A 3EVRA 4WQ2A 3PALA 1SCMC 4DS7A 1HQVA 1YVLA 1U5IB 2OTGC 5I8NA 3TDIA 3BOWB 4GGFC 2JT3A 2WCBA 1AJ4A 1PVBA 2K2FA 3I5IC 1SMGA 4PE0A 3PM2A 1TIZA 3WHTB 1OOGA 3I5HC 3NGVA 3D0YB 1F55A 2KI4C 3OX5A 1DMOA 1XO5A 1BU3A 1CLLA 2NLNA 1K93D 1SL7A 2PRUA 2Y5IA 3CZ2A 3O4XA 2KFHA 3DF0B 3WNXB 3FIAA 3CDNA 2MLEC 2L50A 2WOSA 4DIRA 4QJ5B 4N1FA 1SR6B 1QIWA 2M7NA 3IQQA 1NP8A 1K9UA 2LHLA 4PCWA 3CYZA 1B47A 2PYQA 2M29A 2JU0A 3JTDC 5DKQA 1QVIZ 2KBIA 4R1EA 2L0PA 2D8NA 1J7PA 3VRNA 3SG3A 2TN4A 1CLMA 2KFFA 1YX7A 2WC8A 1YR5A 3JVTB 4IL1A 4N1GA 4A4BA 2K8MB 1CFFA 2L4IA 3KO0A 3MSEB 3FE9A 3H4SE 1PVAA 2LANA 1CKKA 3LK1A 1IKUA 2KBMA 1Z4HA 1N2DA 2OS8B 5I2LA 3D75A 4M2OA 1WRKA 4UPGA 1K8UA 2SASA 4JD9A 2R2IA 1QXPA 2P70A 1GGWA 3D10A 2ZN9A 1KWOC 1QS7A 2K7OA 2WNDA 1GQMA 1TTXA 2JT8A 2KGRA 2COLB 2EHBA 2LVKA 2MA2A 3C1VA 3NSKA 4I5KA 5HLOA 1AK8A 3S0DA 3BUWB 3OGNA 5HLVA 1BR4B 1DC1A 3BYAA 1R6PA 2M49B 1NX3A 1NCYA 4E68A 1UHJA 1QX5B 2P71A 3K1EA 2ZRSA 3BXKA 4FQTA 2CXJA 3GOFA 1Q80A 1H4BA 3GK4X 2JRFA 4I5NB 2LE9B 3CTNA 1NYAA 4DCKA 1KQMB 1IJ5A 3EVUA 1UHKA 5B8IB 2JT0A 5FI2A 1KFUS 1B7TY 2L98A 1KK8C 1PALA 4OZDA 1B9AA 4PHMA 4CFRA 5KU1A 1DJIA 3DYEA 1JFKA 1IWQA 4I5JA 1RWYA 1CDMA 1JSAA 3D0YA 4PDZA 1UP5A 1Y1XA 3AKAA 1XK4C 2KAXA 3TUYC 1ZOTB 1CTRA 1MHOA 3VRRA 2FOTA 5AEQA 1QLSA 3NHIA 3D74A 2H2KA 4P2YB 5D69A 1IGVA 1OQPA 1BF5A 2KDHA 3V2LA 5I94A 1DJZA 2BL0B 2KAYA 1J55A 2L51A 3TZ1A 2HPSA 3IF7A 3HCMA 2KPHA 1DQEA 4MVFA 3CS1A 1G8IA 4YI9A 2M1KB 1P28A 1RJVA 2I2RE 2LLSA 3CZTX 3RZSA 3PM8A 1YTZC 1ODBA 2I18A 3DVEA 1TWOA 1MUXA 1YRTB 5AXIA 1MXEA 4OKHA 1KFXS 1Z2CB 1PULA 2K7DA 1J7RA 2MAZA 4MEWA 1SCMB 5HYDA 1BODA 1OE9B 3L4AA 1CMGA 2M8UA 2LUCA 1EJ3A 1CDLA 1OMDA 3O4YA 2M97A 2FCEA 2KYFA 3I5IB 2F2OA 3SG5A 1LVCD 1YUTA 1F4QA 2M3WA 3NXAA 3VRPA 1KQVA 3I5HB 3AAJA 3RM1A 1YVHA 2E30A 2KI4B 1IQ5A 2LLTA 1WRZA 1V1FA 1XYDA 1CDPA 2NZ0A 2ZNEA 3B87A 3NHTA 4WRIA 1QIVA 1T14A 5HL1A 1JFJA 3N7HA 1IIOA 3ICBA 2ISDA 1B8RA 3TS5B 3BUMB 2LVJA 1M39A 1ORGA 4DRWA 4MLWA 3CWGA 2BNXA 2K7CA 2KGBC 1DGVA 2NXQA 1QVIY 1KSOA 1QJTA 1XK4A 1DJXA 2K60A 1J1DA 2LVIA 1NUBA 3JTDB 1A2XA 4Q04A 1A29A 1FW4A 1IG5A 1UHHA 3A4UB 1CFPA 5DKRA 1SYMA 1QX7A 2BKHB 3TS5C 3ZWHA 2L5XB 1YUUA 1HT9A 1S5GZ 1N65A 1B1GA 2LHIA 2SCPA 2KLEA 3B7AA 3EK8A 1AVSA 4GAOA 1A4PA 1QV1A 4M2PA 1SW8A 1X02A 1C07A 1UWOA 1S3PA 1OOIX 2ZFDA 2CTNA 4HRGA 3CR5X 1DELA 1KWOB 3FE8A 5CSJA 1SY9A 1DVIA 1UURA 2V53A 3KF9A 1A03A 1DGUA 1LS8A 2KI6D 4JKTA 3SS5A 1FI6A 2KSPA 3DVJA 1BR1B 1SL9A 1ZUZA 1TUJA 2L5YA 1PK0D 2LMUA 1UHIA 4PT1A 4MN0A 4QJ4B 4YGAA 3WXAA 2IS9A 3AKBA 4PHNA 1OMVA 4AQIA 1NX2A 2DOQA 2PVBA 1BT6A 3K21A 1JUOA 1OOFA 1KK7Z 4INWA 1K94A 1XFZO 2LP3A 2WCHA 1H8BA 4WQ3A 1JF0A 1KK8B 2JOJA 2MLFC 3OHMB 1CDNA 5FI7A 1Y1AA 4MZLA 2QEVA 4JQ0D 1QASA 4PHKA 3L47A 4USLA 4OR9B 1OZSA 1UHNA 4XJKA 3BUOB 3UO9A 3VRQA 5KSZA 1DF0B 3TUYB 2MRDA 2O60A 1S1EA 4MBEA 3RLZA 1WRLA 2AMIA 3I5GB 1Y0VH 2PSRA 3PSRA 2PQLA 4GBAA 3IQOA 3EK4A 5PALA 2KFGA 4P5OE 2E6WA 1SKTA 3B6XA 1F71A 3D76A 1CLBA 1A75B 2GGZA 2KQYA 2ZKMX 3E3RA 2NCOA 2K61A 3QMEA 3LCPC 2GV5A 4GNKB 3D77A 3PJIA 2F3ZA 5G08A 1DJGA 3HX4A 2VRGA 3BFBA 2WCKA 2PMYA 4GPLB 4ICBA 5D3OA 1L7ZA 3VB1A 1CNPA 2BE6A 3BJHA 4DUQA 4TNCA 2WCMA 3OP0A 1K9PA 3I5GC 1TOPA 2BCXA 4A4CA 1RROA 1OMRA 4YGEB 5K89A 2ZNDA 3GK2A 4HREE 5BPJA 4IJ7A 1JF2A 1YX8A 3B88A 3DD4A 4FQOA 1MWNA 1K96A 2A4JA 2G9BA 1CMFA 1BLQA 3CZ0A 4PHJA 1SSEB 5EL2A 5CSIA 1NCXA 1N0YA 1DTLA 1NIWA 2QDIA 1S6CA 1EG3A 4PALA 3SJSA 1SCVA 4F7FA 1IJ6A 1IH0A 1SL8A 2QACA 5CPVA 1AHRA 3I5FC 1XFRA 4L9MA 1E8AA 3DZTA 4MSPA 1XFUO 2L2EA 1TNWA 2L2CA 2RGIA 4GFTA 4CIDA 3SS3A 1BG1A 1DEKA 3DVMA 3IVTA 1G4YR 1L2OC 2I94A 1QATA 3PN7C 3PATA 2O5GA 2GTEA 3Q8IA 1ZMZA 1WDCC 1ZACA 2KLDA 4NDCA 5AFPA 3NSLA 3D78A 1S6JA 1GM0A 4MZJA 1RFJA 3NSIA 4AQJA 1S5GY 2K7BA 1CM1A 2BECA 3FWCA 1YRUB 1NSHA 2I7AA 3CR4X 1MR8A 2JQ6A 3BUNB 2QEBA 1RK9A 2Y1NA 3LK0A 3CZ1A 4XJKB 3EKHA 4CPVA 1R2UA 1NX1A 1D1OA 1XFVO 4OV2A 1TN4A 4C0KA 3BUXB 1AUIB 1LXFC 3SIBA 3SS4A 2JXLA 1FI5A 5J3XA 1QWVA 1DF0A 1S6IA 2Y1MA 1QLKA 1SNLA 1GGZA 2AAOA 1WY9A 3BFHA 4NQGA 3O6BA 4N5XA 1EG4A 2NCPA 2QEHA 3O78A 2LCPA 1OW4A 1LINA 1UUSA 3M0WA 1A75A 3WHUB 4U8DA 2LP2A 5FYXA 1XA5A 4YRUA 1AP4A 2BCAA 1OOJA 2JPOA 1XVJA 1K95A 2PASA 1GJYA 4GGFA 4ORAB 1G33A 2WC5A 4XYNA 3S0FA 2F3YA 1WLZA 4PE1A 1KK7Y 4MRXA 4FTGA 1C7WA 1TCFA 5AANA 3OBVA 1B4CA 1LA0A 5JJGA 2LV7A 1CM4A 2GGMA 2M0RA 3SG6A 2FCDA 2M9GA 2H8VA 3EKJA 1CFDA 5ER4X 1C3YA 1XFYO 1EH2A 4BY5A 2KOTA 1C3ZA 5F6TA 1NWDA 4GGNA 4D1EA 3BFAA 3DVKA 1CB1A 1F8HA 5D7FA 2JWWA 3LL8B 1DT7B 2Q91A 2P6BB 2Q4UA 3FE6A 2KHNA 1M31A 3F45A 4YGDB 5I2OA 1MXLC 1PSRA 1Y6WA 5ER5A 1VRKA 1W9ZA 1SBJA 2ERBA 2WC6A 1KSMA 1J7QA 2EC6B 1TRFA 4KYNA 1OSAA 2HQ8A 1SPYA 5DICA 3QRXA 5DKNA 1BOCA 1DJYA 2BBMA 2LMTA 3PFVA 1NX0A 3KHEA 4AOMA 4F0ZB 2QPTA 3DXLA 1JC2A 3CLNA 3S0BA 4PE4A 1FPWA 2FJUB 3S0AA 4GUKA 1IQ3A 2JTZA 4JWQA 2F2PA 1Y1UA 3OB2B 1KCYA 2MHHA 3EK7A 2M7LA 1SR6C 4JPZB 2BAPA 2EGDA 3VROA 1NPQA 4ZCUA 1ALVA 3OX6A 3R72A 1F54A 2BBNA 2FJYA 2HETA 1AJ5A 2EC6C 3CGAA 1PSBA 1ZFSA 2F8PA 4ORBB 2LMVA 2G2BA 1J7OA 1FF1A 3AAKA 1V1GA 2BE4A 4NDBA 3KEVA 3R1VA 4CFQA 2LM5A 2LVVA 1OZOA 2WCFA 1SRAA 3UNWA 1BMOA 3A8RA 3JVTC 2CT9A 1YUSA 2LC5A 2ZN8A 3D73A 2B1UA 1B8CA 3PLFB 2LAPA 5HKWA 1K2HA 1BJFA 1CFCA 3GK1A 2PALA 2MBXA 1QX2A 2MJWB 1QV0A 4YBHB 1S26D 2OS8C 3I5FB 3O2PA 3L4LA 4CLNA 2K0JA 2CNPA 3NSOA 4YGBB 2JNXA 4M2QA 2CCMA 4QJ3B 2WORA 1F4OA 3OB1B 4YI8A 2BCBA 5KTYA 1L2OB 2OPOA 4OCIA 1U5IA 3PN7B 1S36A 1JBAA 1WDCB 1NCZA 2H61C 1TNQA 3BOWA 4HRHA 1LKJA 2JXCA 2KYCA 2ZRTA 2LNKA 2YGUA 3CR2A 1K9KA 1EL4A 2BKIB 3LLEA 3R1OA 1F70A 3SG4A 1YURA 1WLMA 1QTXA 3CABA 2AUCA 5GQQC 4MRYA 1FBVA 2JC2A 1SK6D 5AERA 1M46A 3KPXA 3ZNIA 3R1PA 5CSNA 3TDUA 1IRJA 3EG5B 2JZIA 4MZKA 2JULA 4ORCB 1TNPA 4PE7A 2LLUA 3DF0A 1C7VA 2KAVA 4C0JA 1JWDA 4HSZA 1KFUL 1KQMC 1TUZA 4INXA 2JPTA 1ALWA 2JTTA 4ETOA 1TCOB 3SG2A 5I2QA 2JNFA 2CBLA 1MQ1A 1W7IB 2QEOA 2WCLA 1XFXO 2HQWA 2Y4QA 1XFWO 4NDDA 1M63B
chains in the Genus database with same CATH topology
4ZCVA 4I5LB 2KNEA 3TDZA 5TNCA 1B7TZ 1RTP1 3BQ3A 1J1EA 1DJHA 1PRWA 2L4HA 3FS7A 2OTGB 3FWBA 1TNXA 5IBWA 2BL0C 2K2AA 2M1UA 5CSFA 5HKZA 1K90D 2WCEA 4YGCB 3VGOA 2LUXA 5HKYA 1RECA 3EVVA 1DJWA 1MF8B 4C0LA 1B8LA 1M45A 1W7JB 2F33A 4OVNF 1KFXL 1LA3A 2HF5A 2H61A 3SG7A 1EXRA 5JOLA 3SIAA 2KI6C 4BY4A 2KQ6A 3EVRA 4WQ2A 3PALA 1SCMC 4DS7A 1HQVA 1YVLA 1U5IB 2OTGC 5I8NA 3TDIA 3BOWB 4GGFC 2JT3A 2WCBA 1AJ4A 1PVBA 2K2FA 3I5IC 1SMGA 4PE0A 1TIZA 3WHTB 3I5HC 3D0YB 1F55A 2KI4C 3OX5A 1DMOA 1XO5A 1BU3A 1CLLA 2NLNA 1K93D 1SL7A 2PRUA 2Y5IA 2KFHA 3DF0B 3WNXB 3FIAA 2MLEC 2L50A 2WOSA 4DIRA 4QJ5B 4N1FA 1SR6B 1QIWA 2M7NA 3IQQA 1NP8A 1K9UA 2LHLA 4PCWA 1B47A 2M29A 2JU0A 3JTDC 5DKQA 1QVIZ 2KBIA 4R1EA 2L0PA 2D8NA 1J7PA 3VRNA 3SG3A 2TN4A 1CLMA 2KFFA 1YX7A 2WC8A 1YR5A 3JVTB 4N1GA 4A4BA 2K8MB 1CFFA 2L4IA 3KO0A 3MSEB 3H4SE 1PVAA 2LANA 1CKKA 3LK1A 1IKUA 2KBMA 2OS8B 1N2DA 5I2LA 4UPGA 4M2OA 1WRKA 1K8UA 2SASA 2R2IA 1QXPA 1GGWA 3D10A 2ZN9A 1KWOC 1QS7A 2K7OA 2WNDA 1GQMA 1TTXA 2JT8A 2KGRA 2COLB 2EHBA 2LVKA 2MA2A 3C1VA 3NSKA 4I5KA 5HLOA 1AK8A 3BUWB 5HLVA 1BR4B 3BYAA 1R6PA 2M49B 1NX3A 1NCYA 4E68A 1UHJA 1QX5B 2ZRSA 3BXKA 2CXJA 3GOFA 1Q80A 1H4BA 3GK4X 2JRFA 4I5NB 2LE9B 3CTNA 1NYAA 4DCKA 1KQMB 1IJ5A 3EVUA 1UHKA 5B8IB 2JT0A 1KFUS 1B7TY 2L98A 1KK8C 1PALA 4PHMA 1B9AA 4CFRA 5KU1A 1DJIA 1JFKA 1IWQA 4I5JA 1RWYA 1CDMA 1JSAA 3D0YA 4PDZA 1UP5A 1Y1XA 3AKAA 1XK4C 2KAXA 3TUYC 1ZOTB 1CTRA 1MHOA 3VRRA 2FOTA 5AEQA 1QLSA 2H2KA 4P2YB 5D69A 1IGVA 1OQPA 1BF5A 2KDHA 1DJZA 2BL0B 2KAYA 1J55A 2L51A 3TZ1A 2HPSA 3IF7A 3HCMA 4MVFA 3CS1A 1G8IA 4YI9A 2M1KB 1RJVA 2I2RE 2LLSA 3CZTX 3PM8A 1YTZC 1ODBA 2I18A 3DVEA 1MUXA 1YRTB 5AXIA 1MXEA 4OKHA 1KFXS 2K7DA 1PULA 4MEWA 1J7RA 2MAZA 1SCMB 5HYDA 1BODA 1OE9B 1CMGA 2M8UA 2LUCA 1EJ3A 1CDLA 1OMDA 3O4YA 2M97A 2FCEA 2KYFA 3I5IB 2F2OA 3SG5A 1LVCD 1YUTA 1F4QA 2M3WA 3NXAA 3VRPA 1KQVA 3I5HB 3AAJA 3RM1A 1YVHA 2E30A 2KI4B 1IQ5A 2LLTA 1WRZA 1V1FA 1XYDA 1CDPA 2NZ0A 2ZNEA 4WRIA 1C7VA 1QIVA 1JFJA 3ICBA 2ISDA 1B8RA 3TS5B 3BUMB 2LVJA 1M39A 4DRWA 4MLWA 3CWGA 2K7CA 2KGBC 1DGVA 2NXQA 1QVIY 1KSOA 1QJTA 1XK4A 1DJXA 1J1DA 2LVIA 1NUBA 3JTDB 1A2XA 4Q04A 1A29A 1FW4A 1IG5A 1UHHA 3A4UB 1CFPA 5DKRA 1SYMA 1QX7A 2BKHB 3TS5C 3ZWHA 2L5XB 1YUUA 1HT9A 1S5GZ 1N65A 1B1GA 2LHIA 2SCPA 3EK8A 1AVSA 4GAOA 1A4PA 1QV1A 4M2PA 1SW8A 1X02A 1C07A 1UWOA 1S3PA 2ZFDA 2CTNA 4HRGA 3CR5X 1KWOB 5CSJA 1SY9A 1DVIA 1UURA 2V53A 3KF9A 1A03A 1DGUA 2KI6D 1FI6A 2KSPA 3DVJA 1BR1B 1SL9A 1ZUZA 2LMUA 1PK0D 1UHIA 4MN0A 4QJ4B 4YGAA 3WXAA 2IS9A 3AKBA 4PHNA 1OMVA 4AQIA 1NX2A 2DOQA 2PVBA 1BT6A 3K21A 1JUOA 1KK7Z 1K94A 1XFZO 2LP3A 1H8BA 4WQ3A 1JF0A 1KK8B 2JOJA 2MLFC 3OHMB 1CDNA 1Y1AA 4MZLA 4JQ0D 1QASA 4PHKA 4USLA 4OR9B 1OZSA 1UHNA 4XJKA 3BUOB 3VRQA 5KSZA 1DF0B 3TUYB 2MRDA 2O60A 1S1EA 4MBEA 3RLZA 1WRLA 2AMIA 3I5GB 1Y0VH 2PSRA 3PSRA 4GBAA 3IQOA 3EK4A 5PALA 2KFGA 4P5OE 2E6WA 1SKTA 1F71A 1CLBA 1A75B 2GGZA 2KQYA 2ZKMX 3E3RA 2NCOA 2K61A 3LCPC 2GV5A 4GNKB 2F3ZA 5G08A 1DJGA 3HX4A 2VRGA 4GPLB 2PMYA 4ICBA 1CNPA 1L7ZA 2BE6A 4DUQA 4TNCA 3OP0A 1K9PA 3I5GC 1TOPA 2BCXA 4A4CA 1RROA 1OMRA 4YGEB 5K89A 2ZNDA 3GK2A 4HREE 5BPJA 1JF2A 1YX8A 3DD4A 4FQOA 1MWNA 1K96A 2A4JA 2G9BA 1CMFA 1BLQA 4PHJA 5CSIA 1NCXA 1N0YA 1DTLA 1NIWA 4PALA 1S6CA 1EG3A 3SJSA 1IH0A 1SCVA 1IJ6A 1SL8A 2QACA 5CPVA 1AHRA 3I5FC 4L9MA 1E8AA 4MSPA 1XFUO 2L2EA 1TNWA 2RGIA 4GFTA 4CIDA 1BG1A 3DVMA 1G4YR 1L2OC 2I94A 1QATA 3PN7C 3PATA 2O5GA 4NDCA 1ZMZA 1WDCC 1ZACA 5AFPA 3NSLA 1S6JA 4MZJA 1RFJA 3NSIA 4AQJA 1S5GY 2K7BA 1CM1A 2BECA 3FWCA 1YRUB 1NSHA 2I7AA 3CR4X 1MR8A 2JQ6A 3BUNB 3LK0A 1RK9A 2Y1NA 4XJKB 4CPVA 3EKHA 1R2UA 1NX1A 1D1OA 1XFVO 4OV2A 1TN4A 4C0KA 3BUXB 1AUIB 1LXFC 3SIBA 2JXLA 1FI5A 5J3XA 2Y1MA 1DF0A 1S6IA 1QLKA 1SNLA 1GGZA 2AAOA 1WY9A 4NQGA 3O6BA 4N5XA 1EG4A 2NCPA 3O78A 2LCPA 1LINA 1UUSA 3M0WA 1A75A 3WHUB 4U8DA 2LP2A 5FYXA 1XA5A 4YRUA 1AP4A 2BCAA 1OOJA 2PASA 1XVJA 1K95A 4GGFA 1GJYA 4ORAB 4XYNA 1G33A 2F3YA 1WLZA 4PE1A 1KK7Y 4MRXA 4FTGA 1C7WA 1TCFA 5AANA 1B4CA 1LA0A 5JJGA 2LV7A 1CM4A 2GGMA 2M0RA 3SG6A 2FCDA 2M9GA 5ER4X 3EKJA 1CFDA 1XFYO 1EH2A 4BY5A 2KOTA 5F6TA 1NWDA 4GGNA 4D1EA 3DVKA 1CB1A 1F8HA 5D7FA 2JWWA 3LL8B 1DT7B 2Q91A 2P6BB 2Q4UA 2KHNA 1M31A 3F45A 4YGDB 5I2OA 1MXLC 1PSRA 1Y6WA 5ER5A 1VRKA 1SBJA 1KSMA 1J7QA 2EC6B 1TRFA 1OSAA 2HQ8A 1SPYA 5DKNA 3QRXA 1BOCA 1DJYA 2BBMA 2LMTA 3PFVA 1NX0A 3KHEA 4AOMA 4F0ZB 2QPTA 1JC2A 3CLNA 4PE4A 1FPWA 2FJUB 4GUKA 1IQ3A 2JTZA 4JWQA 2F2PA 1Y1UA 3OB2B 1KCYA 2MHHA 3EK7A 2M7LA 1SR6C 4JPZB 2EGDA 3VROA 1NPQA 4ZCUA 1ALVA 3OX6A 1F54A 2BBNA 2HETA 3CGAA 1AJ5A 2EC6C 1PSBA 1ZFSA 2F8PA 4ORBB 2LMVA 2G2BA 1J7OA 1FF1A 3AAKA 1V1GA 2BE4A 4NDBA 3KEVA 4CFQA 2LM5A 2LVVA 1OZOA 2WCFA 1SRAA 1BMOA 3A8RA 3JVTC 2CT9A 1YUSA 2LC5A 2ZN8A 3PLFB 2B1UA 1B8CA 5HKWA 2LAPA 1K2HA 1BJFA 1CFCA 3GK1A 2PALA 2MBXA 1QX2A 2MJWB 1QV0A 4YBHB 1S26D 2OS8C 3I5FB 3O2PA 4CLNA 2K0JA 2CNPA 3NSOA 4YGBB 2JNXA 4M2QA 2CCMA 4QJ3B 2WORA 1F4OA 3OB1B 4YI8A 2BCBA 5KTYA 1L2OB 2OPOA 4OCIA 1U5IA 3PN7B 1S36A 1JBAA 1WDCB 1NCZA 2H61C 1TNQA 3BOWA 4HRHA 1LKJA 2JXCA 2KYCA 2ZRTA 2LNKA 4IL1A 3CR2A 1K9KA 1EL4A 2BKIB 3LLEA 1F70A 3SG4A 1YURA 1WLMA 1QTXA 5GQQC 2AUCA 4MRYA 1FBVA 2JC2A 1SK6D 5AERA 1M46A 3KPXA 3ZNIA 5CSNA 3TDUA 1IRJA 2JZIA 4MZKA 2JULA 4ORCB 1TNPA 4PE7A 2LLUA 3DF0A 2KAVA 4C0JA 1JWDA 4HSZA 1KFUL 1KQMC 2JPTA 1ALWA 2JTTA 4ETOA 1TCOB 3SG2A 5I2QA 2JNFA 2CBLA 1MQ1A 1W7IB 2Y4QA 1XFXO 2HQWA 1XFWO 4NDDA 1M63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCV A;  4I5L B;  2KNE A;  3TDZ A;  5TNC A;  1B7T Z;  1RTP 1;  3BQ3 A;  1J1E A;  1DJH A;  1PRW A;  2L4H A;  3FS7 A;  2OTG B;  3FWB A;  1TNX A;  5IBW A;  2BL0 C;  2K2A A;  2M1U A;  5CSF A;  5HKZ A;  1K90 D;  2WCE A;  4YGC B;  3VGO A;  2LUX A;  5HKY A;  1REC A;  3EVV A;  1DJW A;  1MF8 B;  4C0L A;  1B8L A;  1M45 A;  1W7J B;  2F33 A;  4OVN F;  1KFX L;  1LA3 A;  2HF5 A;  2H61 A;  3SG7 A;  1EXR A;  5JOL A;  3SIA A;  2KI6 C;  4BY4 A;  2KQ6 A;  3EVR A;  4WQ2 A;  3PAL A;  1SCM C;  4DS7 A;  1HQV A;  1YVL A;  1U5I B;  2OTG C;  5I8N A;  3TDI A;  3BOW B;  4GGF C;  2JT3 A;  2WCB A;  1AJ4 A;  1PVB A;  2K2F A;  3I5I C;  1SMG A;  4PE0 A;  1TIZ A;  3WHT B;  3I5H C;  3D0Y B;  1F55 A;  2KI4 C;  3OX5 A;  1DMO A;  1XO5 A;  1BU3 A;  1CLL A;  2NLN A;  1K93 D;  1SL7 A;  2PRU A;  2Y5I A;  2KFH A;  3DF0 B;  3WNX B;  3FIA A;  2MLE C;  2L50 A;  2WOS A;  4DIR A;  4QJ5 B;  4N1F A;  1SR6 B;  1QIW A;  2M7N A;  3IQQ A;  1NP8 A;  1K9U A;  2LHL A;  4PCW A;  1B47 A;  2M29 A;  2JU0 A;  3JTD C;  5DKQ A;  1QVI Z;  2KBI A;  4R1E A;  2L0P A;  2D8N A;  1J7P A;  3VRN A;  3SG3 A;  2TN4 A;  1CLM A;  2KFF A;  1YX7 A;  2WC8 A;  1YR5 A;  3JVT B;  4N1G A;  4A4B A;  2K8M B;  1CFF A;  2L4I A;  3KO0 A;  3MSE B;  3H4S E;  1PVA A;  2LAN A;  1CKK A;  3LK1 A;  1IKU A;  2KBM A;  2OS8 B;  1N2D A;  5I2L A;  4UPG A;  4M2O A;  1WRK A;  1K8U A;  2SAS A;  2R2I A;  1QXP A;  1GGW A;  3D10 A;  2ZN9 A;  1KWO C;  1QS7 A;  2K7O A;  2WND A;  1GQM A;  1TTX A;  2JT8 A;  2KGR A;  2COL B;  2EHB A;  2LVK A;  2MA2 A;  3C1V A;  3NSK A;  4I5K A;  5HLO A;  1AK8 A;  3BUW B;  5HLV A;  1BR4 B;  3BYA A;  1R6P A;  2M49 B;  1NX3 A;  1NCY A;  4E68 A;  1UHJ A;  1QX5 B;  2ZRS A;  3BXK A;  2CXJ A;  3GOF A;  1Q80 A;  1H4B A;  3GK4 X;  2JRF A;  4I5N B;  2LE9 B;  3CTN A;  1NYA A;  4DCK A;  1KQM B;  1IJ5 A;  3EVU A;  1UHK A;  5B8I B;  2JT0 A;  1KFU S;  1B7T Y;  2L98 A;  1KK8 C;  1PAL A;  4PHM A;  1B9A A;  4CFR A;  5KU1 A;  1DJI A;  1JFK A;  1IWQ A;  4I5J A;  1RWY A;  1CDM A;  1JSA A;  3D0Y A;  4PDZ A;  1UP5 A;  1Y1X A;  3AKA A;  1XK4 C;  2KAX A;  3TUY C;  1ZOT B;  1CTR A;  1MHO A;  3VRR A;  2FOT A;  5AEQ A;  1QLS A;  2H2K A;  4P2Y B;  5D69 A;  1IGV A;  1OQP A;  1BF5 A;  2KDH A;  1DJZ A;  2BL0 B;  2KAY A;  1J55 A;  2L51 A;  3TZ1 A;  2HPS A;  3IF7 A;  3HCM A;  4MVF A;  3CS1 A;  1G8I A;  4YI9 A;  2M1K B;  1RJV A;  2I2R E;  2LLS A;  3CZT X;  3PM8 A;  1YTZ C;  1ODB A;  2I18 A;  3DVE A;  1MUX A;  1YRT B;  5AXI A;  1MXE A;  4OKH A;  1KFX S;  2K7D A;  1PUL A;  4MEW A;  1J7R A;  2MAZ A;  1SCM B;  5HYD A;  1BOD A;  1OE9 B;  1CMG A;  2M8U A;  2LUC A;  1EJ3 A;  1CDL A;  1OMD A;  3O4Y A;  2M97 A;  2FCE A;  2KYF A;  3I5I B;  2F2O A;  3SG5 A;  1LVC D;  1YUT A;  1F4Q A;  2M3W A;  3NXA A;  3VRP A;  1KQV A;  3I5H B;  3AAJ A;  3RM1 A;  1YVH A;  2E30 A;  2KI4 B;  1IQ5 A;  2LLT A;  1WRZ A;  1V1F A;  1XYD A;  1CDP A;  2NZ0 A;  2ZNE A;  4WRI A;  1C7V A;  1QIV A;  1JFJ A;  3ICB A;  2ISD A;  1B8R A;  3TS5 B;  3BUM B;  2LVJ A;  1M39 A;  4DRW A;  4MLW A;  3CWG A;  2K7C A;  2KGB C;  1DGV A;  2NXQ A;  1QVI Y;  1KSO A;  1QJT A;  1XK4 A;  1DJX A;  1J1D A;  2LVI A;  1NUB A;  3JTD B;  1A2X A;  4Q04 A;  1A29 A;  1FW4 A;  1IG5 A;  1UHH A;  3A4U B;  1CFP A;  5DKR A;  1SYM A;  1QX7 A;  2BKH B;  3TS5 C;  3ZWH A;  2L5X B;  1YUU A;  1HT9 A;  1S5G Z;  1N65 A;  1B1G A;  2LHI A;  2SCP A;  3EK8 A;  1AVS A;  4GAO A;  1A4P A;  1QV1 A;  4M2P A;  1SW8 A;  1X02 A;  1C07 A;  1UWO A;  1S3P A;  2ZFD A;  2CTN A;  4HRG A;  3CR5 X;  1KWO B;  5CSJ A;  1SY9 A;  1DVI A;  1UUR A;  2V53 A;  3KF9 A;  1A03 A;  1DGU A;  2KI6 D;  1FI6 A;  2KSP A;  3DVJ A;  1BR1 B;  1SL9 A;  1ZUZ A;  2LMU A;  1PK0 D;  1UHI A;  4MN0 A;  4QJ4 B;  4YGA A;  3WXA A;  2IS9 A;  3AKB A;  4PHN A;  1OMV A;  4AQI A;  1NX2 A;  2DOQ A;  2PVB A;  1BT6 A;  3K21 A;  1JUO A;  1KK7 Z;  1K94 A;  1XFZ O;  2LP3 A;  1H8B A;  4WQ3 A;  1JF0 A;  1KK8 B;  2JOJ A;  2MLF C;  3OHM B;  1CDN A;  1Y1A A;  4MZL A;  4JQ0 D;  1QAS A;  4PHK A;  4USL A;  4OR9 B;  1OZS A;  1UHN A;  4XJK A;  3BUO B;  3VRQ A;  5KSZ A;  1DF0 B;  3TUY B;  2MRD A;  2O60 A;  1S1E A;  4MBE A;  3RLZ A;  1WRL A;  2AMI A;  3I5G B;  1Y0V H;  2PSR A;  3PSR A;  4GBA A;  3IQO A;  3EK4 A;  5PAL A;  2KFG A;  4P5O E;  2E6W A;  1SKT A;  1F71 A;  1CLB A;  1A75 B;  2GGZ A;  2KQY A;  2ZKM X;  3E3R A;  2NCO A;  2K61 A;  3LCP C;  2GV5 A;  4GNK B;  2F3Z A;  5G08 A;  1DJG A;  3HX4 A;  2VRG A;  4GPL B;  2PMY A;  4ICB A;  1CNP A;  1L7Z A;  2BE6 A;  4DUQ A;  4TNC A;  3OP0 A;  1K9P A;  3I5G C;  1TOP A;  2BCX A;  4A4C A;  1RRO A;  1OMR A;  4YGE B;  5K89 A;  2ZND A;  3GK2 A;  4HRE E;  5BPJ A;  1JF2 A;  1YX8 A;  3DD4 A;  4FQO A;  1MWN A;  1K96 A;  2A4J A;  2G9B A;  1CMF A;  1BLQ A;  4PHJ A;  5CSI A;  1NCX A;  1N0Y A;  1DTL A;  1NIW A;  4PAL A;  1S6C A;  1EG3 A;  3SJS A;  1IH0 A;  1SCV A;  1IJ6 A;  1SL8 A;  2QAC A;  5CPV A;  1AHR A;  3I5F C;  4L9M A;  1E8A A;  4MSP A;  1XFU O;  2L2E A;  1TNW A;  2RGI A;  4GFT A;  4CID A;  1BG1 A;  3DVM A;  1G4Y R;  1L2O C;  2I94 A;  1QAT A;  3PN7 C;  3PAT A;  2O5G A;  4NDC A;  1ZMZ A;  1WDC C;  1ZAC A;  5AFP A;  3NSL A;  1S6J A;  4MZJ A;  1RFJ A;  3NSI A;  4AQJ A;  1S5G Y;  2K7B A;  1CM1 A;  2BEC A;  3FWC A;  1YRU B;  1NSH A;  2I7A A;  3CR4 X;  1MR8 A;  2JQ6 A;  3BUN B;  3LK0 A;  1RK9 A;  2Y1N A;  4XJK B;  4CPV A;  3EKH A;  1R2U A;  1NX1 A;  1D1O A;  1XFV O;  4OV2 A;  1TN4 A;  4C0K A;  3BUX B;  1AUI B;  1LXF C;  3SIB A;  2JXL A;  1FI5 A;  5J3X A;  2Y1M A;  1DF0 A;  1S6I A;  1QLK A;  1SNL A;  1GGZ A;  2AAO A;  1WY9 A;  4NQG A;  3O6B A;  4N5X A;  1EG4 A;  2NCP A;  3O78 A;  2LCP A;  1LIN A;  1UUS A;  3M0W A;  1A75 A;  3WHU B;  4U8D A;  2LP2 A;  5FYX A;  1XA5 A;  4YRU A;  1AP4 A;  2BCA A;  1OOJ A;  2PAS A;  1XVJ A;  1K95 A;  4GGF A;  1GJY A;  4ORA B;  4XYN A;  1G33 A;  2F3Y A;  1WLZ A;  4PE1 A;  1KK7 Y;  4MRX A;  4FTG A;  1C7W A;  1TCF A;  5AAN A;  1B4C A;  1LA0 A;  5JJG A;  2LV7 A;  1CM4 A;  2GGM A;  2M0R A;  3SG6 A;  2FCD A;  2M9G A;  5ER4 X;  3EKJ A;  1CFD A;  1XFY O;  1EH2 A;  4BY5 A;  2KOT A;  5F6T A;  1NWD A;  4GGN A;  4D1E A;  3DVK A;  1CB1 A;  1F8H A;  5D7F A;  2JWW A;  3LL8 B;  1DT7 B;  2Q91 A;  2P6B B;  2Q4U A;  2KHN A;  1M31 A;  3F45 A;  4YGD B;  5I2O A;  1MXL C;  1PSR A;  1Y6W A;  5ER5 A;  1VRK A;  1SBJ A;  1KSM A;  1J7Q A;  2EC6 B;  1TRF A;  1OSA A;  2HQ8 A;  1SPY A;  5DKN A;  3QRX A;  1BOC A;  1DJY A;  2BBM A;  2LMT A;  3PFV A;  1NX0 A;  3KHE A;  4AOM A;  4F0Z B;  2QPT A;  1JC2 A;  3CLN A;  4PE4 A;  1FPW A;  2FJU B;  4GUK A;  1IQ3 A;  2JTZ A;  4JWQ A;  2F2P A;  1Y1U A;  3OB2 B;  1KCY A;  2MHH A;  3EK7 A;  2M7L A;  1SR6 C;  4JPZ B;  2EGD A;  3VRO A;  1NPQ A;  4ZCU A;  1ALV A;  3OX6 A;  1F54 A;  2BBN A;  2HET A;  3CGA A;  1AJ5 A;  2EC6 C;  1PSB A;  1ZFS A;  2F8P A;  4ORB B;  2LMV A;  2G2B A;  1J7O A;  1FF1 A;  3AAK A;  1V1G A;  2BE4 A;  4NDB A;  3KEV A;  4CFQ A;  2LM5 A;  2LVV A;  1OZO A;  2WCF A;  1SRA A;  1BMO A;  3A8R A;  3JVT C;  2CT9 A;  1YUS A;  2LC5 A;  2ZN8 A;  3PLF B;  2B1U A;  1B8C A;  5HKW A;  2LAP A;  1K2H A;  1BJF A;  1CFC A;  3GK1 A;  2PAL A;  2MBX A;  1QX2 A;  2MJW B;  1QV0 A;  4YBH B;  1S26 D;  2OS8 C;  3I5F B;  3O2P A;  4CLN A;  2K0J A;  2CNP A;  3NSO A;  4YGB B;  2JNX A;  4M2Q A;  2CCM A;  4QJ3 B;  2WOR A;  1F4O A;  3OB1 B;  4YI8 A;  2BCB A;  5KTY A;  1L2O B;  2OPO A;  4OCI A;  1U5I A;  3PN7 B;  1S36 A;  1JBA A;  1WDC B;  1NCZ A;  2H61 C;  1TNQ A;  3BOW A;  4HRH A;  1LKJ A;  2JXC A;  2KYC A;  2ZRT A;  2LNK A;  4IL1 A;  3CR2 A;  1K9K A;  1EL4 A;  2BKI B;  3LLE A;  1F70 A;  3SG4 A;  1YUR A;  1WLM A;  1QTX A;  5GQQ C;  2AUC A;  4MRY A;  1FBV A;  2JC2 A;  1SK6 D;  5AER A;  1M46 A;  3KPX A;  3ZNI A;  5CSN A;  3TDU A;  1IRJ A;  2JZI A;  4MZK A;  2JUL A;  4ORC B;  1TNP A;  4PE7 A;  2LLU A;  3DF0 A;  2KAV A;  4C0J A;  1JWD A;  4HSZ A;  1KFU L;  1KQM C;  2JPT A;  1ALW A;  2JTT A;  4ETO A;  1TCO B;  3SG2 A;  5I2Q A;  2JNF A;  2CBL A;  1MQ1 A;  1W7I B;  2Y4Q A;  1XFX O;  2HQW A;  1XFW O;  4NDD A;  1M63 B; 
#chains in the Genus database with same CATH topology
 4ZCV A;  4I5L B;  2KNE A;  3TDZ A;  5TNC A;  1B7T Z;  1RTP 1;  3BQ3 A;  2WCJ A;  3S0E A;  3DY9 A;  5FI6 A;  1J1E A;  1DJH A;  1PRW A;  2L4H A;  3FS7 A;  2OTG B;  3FWB A;  1TNX A;  5IBW A;  2BL0 C;  2K2A A;  3B86 A;  2M1U A;  5CSF A;  5HKZ A;  1K90 D;  2WCE A;  4YGC B;  3VGO A;  2LUX A;  5HKY A;  3S0G A;  1REC A;  3EVV A;  1DJW A;  1MF8 B;  4C0L A;  1B8L A;  1M45 A;  1W7J B;  2F33 A;  1OOH A;  4OVN F;  1KFX L;  1LA3 A;  2HF5 A;  2H61 A;  3SG7 A;  1EXR A;  5JOL A;  3SIA A;  2KI6 C;  4BY4 A;  2KQ6 A;  3EVR A;  4WQ2 A;  3PAL A;  1SCM C;  4DS7 A;  1HQV A;  1YVL A;  1U5I B;  2OTG C;  5I8N A;  3TDI A;  3BOW B;  4GGF C;  2JT3 A;  2WCB A;  1AJ4 A;  1PVB A;  2K2F A;  3I5I C;  1SMG A;  4PE0 A;  3PM2 A;  1TIZ A;  3WHT B;  1OOG A;  3I5H C;  3NGV A;  3D0Y B;  1F55 A;  2KI4 C;  3OX5 A;  1DMO A;  1XO5 A;  1BU3 A;  1CLL A;  2NLN A;  1K93 D;  1SL7 A;  2PRU A;  2Y5I A;  3CZ2 A;  3O4X A;  2KFH A;  3DF0 B;  3WNX B;  3FIA A;  3CDN A;  2MLE C;  2L50 A;  2WOS A;  4DIR A;  4QJ5 B;  4N1F A;  1SR6 B;  1QIW A;  2M7N A;  3IQQ A;  1NP8 A;  1K9U A;  2LHL A;  4PCW A;  3CYZ A;  1B47 A;  2PYQ A;  2M29 A;  2JU0 A;  3JTD C;  5DKQ A;  1QVI Z;  2KBI A;  4R1E A;  2L0P A;  2D8N A;  1J7P A;  3VRN A;  3SG3 A;  2TN4 A;  1CLM A;  2KFF A;  1YX7 A;  2WC8 A;  1YR5 A;  3JVT B;  4IL1 A;  4N1G A;  4A4B A;  2K8M B;  1CFF A;  2L4I A;  3KO0 A;  3MSE B;  3FE9 A;  3H4S E;  1PVA A;  2LAN A;  1CKK A;  3LK1 A;  1IKU A;  2KBM A;  1Z4H A;  1N2D A;  2OS8 B;  5I2L A;  3D75 A;  4M2O A;  1WRK A;  4UPG A;  1K8U A;  2SAS A;  4JD9 A;  2R2I A;  1QXP A;  2P70 A;  1GGW A;  3D10 A;  2ZN9 A;  1KWO C;  1QS7 A;  2K7O A;  2WND A;  1GQM A;  1TTX A;  2JT8 A;  2KGR A;  2COL B;  2EHB A;  2LVK A;  2MA2 A;  3C1V A;  3NSK A;  4I5K A;  5HLO A;  1AK8 A;  3S0D A;  3BUW B;  3OGN A;  5HLV A;  1BR4 B;  1DC1 A;  3BYA A;  1R6P A;  2M49 B;  1NX3 A;  1NCY A;  4E68 A;  1UHJ A;  1QX5 B;  2P71 A;  3K1E A;  2ZRS A;  3BXK A;  4FQT A;  2CXJ A;  3GOF A;  1Q80 A;  1H4B A;  3GK4 X;  2JRF A;  4I5N B;  2LE9 B;  3CTN A;  1NYA A;  4DCK A;  1KQM B;  1IJ5 A;  3EVU A;  1UHK A;  5B8I B;  2JT0 A;  5FI2 A;  1KFU S;  1B7T Y;  2L98 A;  1KK8 C;  1PAL A;  4OZD A;  1B9A A;  4PHM A;  4CFR A;  5KU1 A;  1DJI A;  3DYE A;  1JFK A;  1IWQ A;  4I5J A;  1RWY A;  1CDM A;  1JSA A;  3D0Y A;  4PDZ A;  1UP5 A;  1Y1X A;  3AKA A;  1XK4 C;  2KAX A;  3TUY C;  1ZOT B;  1CTR A;  1MHO A;  3VRR A;  2FOT A;  5AEQ A;  1QLS A;  3NHI A;  3D74 A;  2H2K A;  4P2Y B;  5D69 A;  1IGV A;  1OQP A;  1BF5 A;  2KDH A;  3V2L A;  5I94 A;  1DJZ A;  2BL0 B;  2KAY A;  1J55 A;  2L51 A;  3TZ1 A;  2HPS A;  3IF7 A;  3HCM A;  2KPH A;  1DQE A;  4MVF A;  3CS1 A;  1G8I A;  4YI9 A;  2M1K B;  1P28 A;  1RJV A;  2I2R E;  2LLS A;  3CZT X;  3RZS A;  3PM8 A;  1YTZ C;  1ODB A;  2I18 A;  3DVE A;  1TWO A;  1MUX A;  1YRT B;  5AXI A;  1MXE A;  4OKH A;  1KFX S;  1Z2C B;  1PUL A;  2K7D A;  1J7R A;  2MAZ A;  4MEW A;  1SCM B;  5HYD A;  1BOD A;  1OE9 B;  3L4A A;  1CMG A;  2M8U A;  2LUC A;  1EJ3 A;  1CDL A;  1OMD A;  3O4Y A;  2M97 A;  2FCE A;  2KYF A;  3I5I B;  2F2O A;  3SG5 A;  1LVC D;  1YUT A;  1F4Q A;  2M3W A;  3NXA A;  3VRP A;  1KQV A;  3I5H B;  3AAJ A;  3RM1 A;  1YVH A;  2E30 A;  2KI4 B;  1IQ5 A;  2LLT A;  1WRZ A;  1V1F A;  1XYD A;  1CDP A;  2NZ0 A;  2ZNE A;  3B87 A;  3NHT A;  4WRI A;  1QIV A;  1T14 A;  5HL1 A;  1JFJ A;  3N7H A;  1IIO A;  3ICB A;  2ISD A;  1B8R A;  3TS5 B;  3BUM B;  2LVJ A;  1M39 A;  1ORG A;  4DRW A;  4MLW A;  3CWG A;  2BNX A;  2K7C A;  2KGB C;  1DGV A;  2NXQ A;  1QVI Y;  1KSO A;  1QJT A;  1XK4 A;  1DJX A;  2K60 A;  1J1D A;  2LVI A;  1NUB A;  3JTD B;  1A2X A;  4Q04 A;  1A29 A;  1FW4 A;  1IG5 A;  1UHH A;  3A4U B;  1CFP A;  5DKR A;  1SYM A;  1QX7 A;  2BKH B;  3TS5 C;  3ZWH A;  2L5X B;  1YUU A;  1HT9 A;  1S5G Z;  1N65 A;  1B1G A;  2LHI A;  2SCP A;  2KLE A;  3B7A A;  3EK8 A;  1AVS A;  4GAO A;  1A4P A;  1QV1 A;  4M2P A;  1SW8 A;  1X02 A;  1C07 A;  1UWO A;  1S3P A;  1OOI X;  2ZFD A;  2CTN A;  4HRG A;  3CR5 X;  1DEL A;  1KWO B;  3FE8 A;  5CSJ A;  1SY9 A;  1DVI A;  1UUR A;  2V53 A;  3KF9 A;  1A03 A;  1DGU A;  1LS8 A;  2KI6 D;  4JKT A;  3SS5 A;  1FI6 A;  2KSP A;  3DVJ A;  1BR1 B;  1SL9 A;  1ZUZ A;  1TUJ A;  2L5Y A;  1PK0 D;  2LMU A;  1UHI A;  4PT1 A;  4MN0 A;  4QJ4 B;  4YGA A;  3WXA A;  2IS9 A;  3AKB A;  4PHN A;  1OMV A;  4AQI A;  1NX2 A;  2DOQ A;  2PVB A;  1BT6 A;  3K21 A;  1JUO A;  1OOF A;  1KK7 Z;  4INW A;  1K94 A;  1XFZ O;  2LP3 A;  2WCH A;  1H8B A;  4WQ3 A;  1JF0 A;  1KK8 B;  2JOJ A;  2MLF C;  3OHM B;  1CDN A;  5FI7 A;  1Y1A A;  4MZL A;  2QEV A;  4JQ0 D;  1QAS A;  4PHK A;  3L47 A;  4USL A;  4OR9 B;  1OZS A;  1UHN A;  4XJK A;  3BUO B;  3UO9 A;  3VRQ A;  5KSZ A;  1DF0 B;  3TUY B;  2MRD A;  2O60 A;  1S1E A;  4MBE A;  3RLZ A;  1WRL A;  2AMI A;  3I5G B;  1Y0V H;  2PSR A;  3PSR A;  2PQL A;  4GBA A;  3IQO A;  3EK4 A;  5PAL A;  2KFG A;  4P5O E;  2E6W A;  1SKT A;  3B6X A;  1F71 A;  3D76 A;  1CLB A;  1A75 B;  2GGZ A;  2KQY A;  2ZKM X;  3E3R A;  2NCO A;  2K61 A;  3QME A;  3LCP C;  2GV5 A;  4GNK B;  3D77 A;  3PJI A;  2F3Z A;  5G08 A;  1DJG A;  3HX4 A;  2VRG A;  3BFB A;  2WCK A;  2PMY A;  4GPL B;  4ICB A;  5D3O A;  1L7Z A;  3VB1 A;  1CNP A;  2BE6 A;  3BJH A;  4DUQ A;  4TNC A;  2WCM A;  3OP0 A;  1K9P A;  3I5G C;  1TOP A;  2BCX A;  4A4C A;  1RRO A;  1OMR A;  4YGE B;  5K89 A;  2ZND A;  3GK2 A;  4HRE E;  5BPJ A;  4IJ7 A;  1JF2 A;  1YX8 A;  3B88 A;  3DD4 A;  4FQO A;  1MWN A;  1K96 A;  2A4J A;  2G9B A;  1CMF A;  1BLQ A;  3CZ0 A;  4PHJ A;  1SSE B;  5EL2 A;  5CSI A;  1NCX A;  1N0Y A;  1DTL A;  1NIW A;  2QDI A;  1S6C A;  1EG3 A;  4PAL A;  3SJS A;  1SCV A;  4F7F A;  1IJ6 A;  1IH0 A;  1SL8 A;  2QAC A;  5CPV A;  1AHR A;  3I5F C;  1XFR A;  4L9M A;  1E8A A;  3DZT A;  4MSP A;  1XFU O;  2L2E A;  1TNW A;  2L2C A;  2RGI A;  4GFT A;  4CID A;  3SS3 A;  1BG1 A;  1DEK A;  3DVM A;  3IVT A;  1G4Y R;  1L2O C;  2I94 A;  1QAT A;  3PN7 C;  3PAT A;  2O5G A;  2GTE A;  3Q8I A;  1ZMZ A;  1WDC C;  1ZAC A;  2KLD A;  4NDC A;  5AFP A;  3NSL A;  3D78 A;  1S6J A;  1GM0 A;  4MZJ A;  1RFJ A;  3NSI A;  4AQJ A;  1S5G Y;  2K7B A;  1CM1 A;  2BEC A;  3FWC A;  1YRU B;  1NSH A;  2I7A A;  3CR4 X;  1MR8 A;  2JQ6 A;  3BUN B;  2QEB A;  1RK9 A;  2Y1N A;  3LK0 A;  3CZ1 A;  4XJK B;  3EKH A;  4CPV A;  1R2U A;  1NX1 A;  1D1O A;  1XFV O;  4OV2 A;  1TN4 A;  4C0K A;  3BUX B;  1AUI B;  1LXF C;  3SIB A;  3SS4 A;  2JXL A;  1FI5 A;  5J3X A;  1QWV A;  1DF0 A;  1S6I A;  2Y1M A;  1QLK A;  1SNL A;  1GGZ A;  2AAO A;  1WY9 A;  3BFH A;  4NQG A;  3O6B A;  4N5X A;  1EG4 A;  2NCP A;  2QEH A;  3O78 A;  2LCP A;  1OW4 A;  1LIN A;  1UUS A;  3M0W A;  1A75 A;  3WHU B;  4U8D A;  2LP2 A;  5FYX A;  1XA5 A;  4YRU A;  1AP4 A;  2BCA A;  1OOJ A;  2JPO A;  1XVJ A;  1K95 A;  2PAS A;  1GJY A;  4GGF A;  4ORA B;  1G33 A;  2WC5 A;  4XYN A;  3S0F A;  2F3Y A;  1WLZ A;  4PE1 A;  1KK7 Y;  4MRX A;  4FTG A;  1C7W A;  1TCF A;  5AAN A;  3OBV A;  1B4C A;  1LA0 A;  5JJG A;  2LV7 A;  1CM4 A;  2GGM A;  2M0R A;  3SG6 A;  2FCD A;  2M9G A;  2H8V A;  3EKJ A;  1CFD A;  5ER4 X;  1C3Y A;  1XFY O;  1EH2 A;  4BY5 A;  2KOT A;  1C3Z A;  5F6T A;  1NWD A;  4GGN A;  4D1E A;  3BFA A;  3DVK A;  1CB1 A;  1F8H A;  5D7F A;  2JWW A;  3LL8 B;  1DT7 B;  2Q91 A;  2P6B B;  2Q4U A;  3FE6 A;  2KHN A;  1M31 A;  3F45 A;  4YGD B;  5I2O A;  1MXL C;  1PSR A;  1Y6W A;  5ER5 A;  1VRK A;  1W9Z A;  1SBJ A;  2ERB A;  2WC6 A;  1KSM A;  1J7Q A;  2EC6 B;  1TRF A;  4KYN A;  1OSA A;  2HQ8 A;  1SPY A;  5DIC A;  3QRX A;  5DKN A;  1BOC A;  1DJY A;  2BBM A;  2LMT A;  3PFV A;  1NX0 A;  3KHE A;  4AOM A;  4F0Z B;  2QPT A;  3DXL A;  1JC2 A;  3CLN A;  3S0B A;  4PE4 A;  1FPW A;  2FJU B;  3S0A A;  4GUK A;  1IQ3 A;  2JTZ A;  4JWQ A;  2F2P A;  1Y1U A;  3OB2 B;  1KCY A;  2MHH A;  3EK7 A;  2M7L A;  1SR6 C;  4JPZ B;  2BAP A;  2EGD A;  3VRO A;  1NPQ A;  4ZCU A;  1ALV A;  3OX6 A;  3R72 A;  1F54 A;  2BBN A;  2FJY A;  2HET A;  1AJ5 A;  2EC6 C;  3CGA A;  1PSB A;  1ZFS A;  2F8P A;  4ORB B;  2LMV A;  2G2B A;  1J7O A;  1FF1 A;  3AAK A;  1V1G A;  2BE4 A;  4NDB A;  3KEV A;  3R1V A;  4CFQ A;  2LM5 A;  2LVV A;  1OZO A;  2WCF A;  1SRA A;  3UNW A;  1BMO A;  3A8R A;  3JVT C;  2CT9 A;  1YUS A;  2LC5 A;  2ZN8 A;  3D73 A;  2B1U A;  1B8C A;  3PLF B;  2LAP A;  5HKW A;  1K2H A;  1BJF A;  1CFC A;  3GK1 A;  2PAL A;  2MBX A;  1QX2 A;  2MJW B;  1QV0 A;  4YBH B;  1S26 D;  2OS8 C;  3I5F B;  3O2P A;  3L4L A;  4CLN A;  2K0J A;  2CNP A;  3NSO A;  4YGB B;  2JNX A;  4M2Q A;  2CCM A;  4QJ3 B;  2WOR A;  1F4O A;  3OB1 B;  4YI8 A;  2BCB A;  5KTY A;  1L2O B;  2OPO A;  4OCI A;  1U5I A;  3PN7 B;  1S36 A;  1JBA A;  1WDC B;  1NCZ A;  2H61 C;  1TNQ A;  3BOW A;  4HRH A;  1LKJ A;  2JXC A;  2KYC A;  2ZRT A;  2LNK A;  2YGU A;  3CR2 A;  1K9K A;  1EL4 A;  2BKI B;  3LLE A;  3R1O A;  1F70 A;  3SG4 A;  1YUR A;  1WLM A;  1QTX A;  3CAB A;  2AUC A;  5GQQ C;  4MRY A;  1FBV A;  2JC2 A;  1SK6 D;  5AER A;  1M46 A;  3KPX A;  3ZNI A;  3R1P A;  5CSN A;  3TDU A;  1IRJ A;  3EG5 B;  2JZI A;  4MZK A;  2JUL A;  4ORC B;  1TNP A;  4PE7 A;  2LLU A;  3DF0 A;  1C7V A;  2KAV A;  4C0J A;  1JWD A;  4HSZ A;  1KFU L;  1KQM C;  1TUZ A;  4INX A;  2JPT A;  1ALW A;  2JTT A;  4ETO A;  1TCO B;  3SG2 A;  5I2Q A;  2JNF A;  2CBL A;  1MQ1 A;  1W7I B;  2QEO A;  2WCL A;  1XFX O;  2HQW A;  2Y4Q A;  1XFW O;  4NDD A;  1M63 B; 
#chains in the Genus database with same CATH homology
 4ZCV A;  4I5L B;  2KNE A;  3TDZ A;  5TNC A;  1B7T Z;  1RTP 1;  3BQ3 A;  1J1E A;  1DJH A;  1PRW A;  2L4H A;  3FS7 A;  2OTG B;  3FWB A;  1TNX A;  5IBW A;  2BL0 C;  2K2A A;  2M1U A;  5CSF A;  5HKZ A;  1K90 D;  2WCE A;  4YGC B;  3VGO A;  2LUX A;  5HKY A;  1REC A;  3EVV A;  1DJW A;  1MF8 B;  4C0L A;  1B8L A;  1M45 A;  1W7J B;  2F33 A;  4OVN F;  1KFX L;  1LA3 A;  2HF5 A;  2H61 A;  3SG7 A;  1EXR A;  5JOL A;  3SIA A;  2KI6 C;  4BY4 A;  2KQ6 A;  3EVR A;  4WQ2 A;  3PAL A;  1SCM C;  4DS7 A;  1HQV A;  1YVL A;  1U5I B;  2OTG C;  5I8N A;  3TDI A;  3BOW B;  4GGF C;  2JT3 A;  2WCB A;  1AJ4 A;  1PVB A;  2K2F A;  3I5I C;  1SMG A;  4PE0 A;  1TIZ A;  3WHT B;  3I5H C;  3D0Y B;  1F55 A;  2KI4 C;  3OX5 A;  1DMO A;  1XO5 A;  1BU3 A;  1CLL A;  2NLN A;  1K93 D;  1SL7 A;  2PRU A;  2Y5I A;  2KFH A;  3DF0 B;  3WNX B;  3FIA A;  2MLE C;  2L50 A;  2WOS A;  4DIR A;  4QJ5 B;  4N1F A;  1SR6 B;  1QIW A;  2M7N A;  3IQQ A;  1NP8 A;  1K9U A;  2LHL A;  4PCW A;  1B47 A;  2M29 A;  2JU0 A;  3JTD C;  5DKQ A;  1QVI Z;  2KBI A;  4R1E A;  2L0P A;  2D8N A;  1J7P A;  3VRN A;  3SG3 A;  2TN4 A;  1CLM A;  2KFF A;  1YX7 A;  2WC8 A;  1YR5 A;  3JVT B;  4N1G A;  4A4B A;  2K8M B;  1CFF A;  2L4I A;  3KO0 A;  3MSE B;  3H4S E;  1PVA A;  2LAN A;  1CKK A;  3LK1 A;  1IKU A;  2KBM A;  2OS8 B;  1N2D A;  5I2L A;  4UPG A;  4M2O A;  1WRK A;  1K8U A;  2SAS A;  2R2I A;  1QXP A;  1GGW A;  3D10 A;  2ZN9 A;  1KWO C;  1QS7 A;  2K7O A;  2WND A;  1GQM A;  1TTX A;  2JT8 A;  2KGR A;  2COL B;  2EHB A;  2LVK A;  2MA2 A;  3C1V A;  3NSK A;  4I5K A;  5HLO A;  1AK8 A;  3BUW B;  5HLV A;  1BR4 B;  3BYA A;  1R6P A;  2M49 B;  1NX3 A;  1NCY A;  4E68 A;  1UHJ A;  1QX5 B;  2ZRS A;  3BXK A;  2CXJ A;  3GOF A;  1Q80 A;  1H4B A;  3GK4 X;  2JRF A;  4I5N B;  2LE9 B;  3CTN A;  1NYA A;  4DCK A;  1KQM B;  1IJ5 A;  3EVU A;  1UHK A;  5B8I B;  2JT0 A;  1KFU S;  1B7T Y;  2L98 A;  1KK8 C;  1PAL A;  4PHM A;  1B9A A;  4CFR A;  5KU1 A;  1DJI A;  1JFK A;  1IWQ A;  4I5J A;  1RWY A;  1CDM A;  1JSA A;  3D0Y A;  4PDZ A;  1UP5 A;  1Y1X A;  3AKA A;  1XK4 C;  2KAX A;  3TUY C;  1ZOT B;  1CTR A;  1MHO A;  3VRR A;  2FOT A;  5AEQ A;  1QLS A;  2H2K A;  4P2Y B;  5D69 A;  1IGV A;  1OQP A;  1BF5 A;  2KDH A;  1DJZ A;  2BL0 B;  2KAY A;  1J55 A;  2L51 A;  3TZ1 A;  2HPS A;  3IF7 A;  3HCM A;  4MVF A;  3CS1 A;  1G8I A;  4YI9 A;  2M1K B;  1RJV A;  2I2R E;  2LLS A;  3CZT X;  3PM8 A;  1YTZ C;  1ODB A;  2I18 A;  3DVE A;  1MUX A;  1YRT B;  5AXI A;  1MXE A;  4OKH A;  1KFX S;  2K7D A;  1PUL A;  4MEW A;  1J7R A;  2MAZ A;  1SCM B;  5HYD A;  1BOD A;  1OE9 B;  1CMG A;  2M8U A;  2LUC A;  1EJ3 A;  1CDL A;  1OMD A;  3O4Y A;  2M97 A;  2FCE A;  2KYF A;  3I5I B;  2F2O A;  3SG5 A;  1LVC D;  1YUT A;  1F4Q A;  2M3W A;  3NXA A;  3VRP A;  1KQV A;  3I5H B;  3AAJ A;  3RM1 A;  1YVH A;  2E30 A;  2KI4 B;  1IQ5 A;  2LLT A;  1WRZ A;  1V1F A;  1XYD A;  1CDP A;  2NZ0 A;  2ZNE A;  4WRI A;  1C7V A;  1QIV A;  1JFJ A;  3ICB A;  2ISD A;  1B8R A;  3TS5 B;  3BUM B;  2LVJ A;  1M39 A;  4DRW A;  4MLW A;  3CWG A;  2K7C A;  2KGB C;  1DGV A;  2NXQ A;  1QVI Y;  1KSO A;  1QJT A;  1XK4 A;  1DJX A;  1J1D A;  2LVI A;  1NUB A;  3JTD B;  1A2X A;  4Q04 A;  1A29 A;  1FW4 A;  1IG5 A;  1UHH A;  3A4U B;  1CFP A;  5DKR A;  1SYM A;  1QX7 A;  2BKH B;  3TS5 C;  3ZWH A;  2L5X B;  1YUU A;  1HT9 A;  1S5G Z;  1N65 A;  1B1G A;  2LHI A;  2SCP A;  3EK8 A;  1AVS A;  4GAO A;  1A4P A;  1QV1 A;  4M2P A;  1SW8 A;  1X02 A;  1C07 A;  1UWO A;  1S3P A;  2ZFD A;  2CTN A;  4HRG A;  3CR5 X;  1KWO B;  5CSJ A;  1SY9 A;  1DVI A;  1UUR A;  2V53 A;  3KF9 A;  1A03 A;  1DGU A;  2KI6 D;  1FI6 A;  2KSP A;  3DVJ A;  1BR1 B;  1SL9 A;  1ZUZ A;  2LMU A;  1PK0 D;  1UHI A;  4MN0 A;  4QJ4 B;  4YGA A;  3WXA A;  2IS9 A;  3AKB A;  4PHN A;  1OMV A;  4AQI A;  1NX2 A;  2DOQ A;  2PVB A;  1BT6 A;  3K21 A;  1JUO A;  1KK7 Z;  1K94 A;  1XFZ O;  2LP3 A;  1H8B A;  4WQ3 A;  1JF0 A;  1KK8 B;  2JOJ A;  2MLF C;  3OHM B;  1CDN A;  1Y1A A;  4MZL A;  4JQ0 D;  1QAS A;  4PHK A;  4USL A;  4OR9 B;  1OZS A;  1UHN A;  4XJK A;  3BUO B;  3VRQ A;  5KSZ A;  1DF0 B;  3TUY B;  2MRD A;  2O60 A;  1S1E A;  4MBE A;  3RLZ A;  1WRL A;  2AMI A;  3I5G B;  1Y0V H;  2PSR A;  3PSR A;  4GBA A;  3IQO A;  3EK4 A;  5PAL A;  2KFG A;  4P5O E;  2E6W A;  1SKT A;  1F71 A;  1CLB A;  1A75 B;  2GGZ A;  2KQY A;  2ZKM X;  3E3R A;  2NCO A;  2K61 A;  3LCP C;  2GV5 A;  4GNK B;  2F3Z A;  5G08 A;  1DJG A;  3HX4 A;  2VRG A;  4GPL B;  2PMY A;  4ICB A;  1CNP A;  1L7Z A;  2BE6 A;  4DUQ A;  4TNC A;  3OP0 A;  1K9P A;  3I5G C;  1TOP A;  2BCX A;  4A4C A;  1RRO A;  1OMR A;  4YGE B;  5K89 A;  2ZND A;  3GK2 A;  4HRE E;  5BPJ A;  1JF2 A;  1YX8 A;  3DD4 A;  4FQO A;  1MWN A;  1K96 A;  2A4J A;  2G9B A;  1CMF A;  1BLQ A;  4PHJ A;  5CSI A;  1NCX A;  1N0Y A;  1DTL A;  1NIW A;  4PAL A;  1S6C A;  1EG3 A;  3SJS A;  1IH0 A;  1SCV A;  1IJ6 A;  1SL8 A;  2QAC A;  5CPV A;  1AHR A;  3I5F C;  4L9M A;  1E8A A;  4MSP A;  1XFU O;  2L2E A;  1TNW A;  2RGI A;  4GFT A;  4CID A;  1BG1 A;  3DVM A;  1G4Y R;  1L2O C;  2I94 A;  1QAT A;  3PN7 C;  3PAT A;  2O5G A;  4NDC A;  1ZMZ A;  1WDC C;  1ZAC A;  5AFP A;  3NSL A;  1S6J A;  4MZJ A;  1RFJ A;  3NSI A;  4AQJ A;  1S5G Y;  2K7B A;  1CM1 A;  2BEC A;  3FWC A;  1YRU B;  1NSH A;  2I7A A;  3CR4 X;  1MR8 A;  2JQ6 A;  3BUN B;  3LK0 A;  1RK9 A;  2Y1N A;  4XJK B;  4CPV A;  3EKH A;  1R2U A;  1NX1 A;  1D1O A;  1XFV O;  4OV2 A;  1TN4 A;  4C0K A;  3BUX B;  1AUI B;  1LXF C;  3SIB A;  2JXL A;  1FI5 A;  5J3X A;  2Y1M A;  1DF0 A;  1S6I A;  1QLK A;  1SNL A;  1GGZ A;  2AAO A;  1WY9 A;  4NQG A;  3O6B A;  4N5X A;  1EG4 A;  2NCP A;  3O78 A;  2LCP A;  1LIN A;  1UUS A;  3M0W A;  1A75 A;  3WHU B;  4U8D A;  2LP2 A;  5FYX A;  1XA5 A;  4YRU A;  1AP4 A;  2BCA A;  1OOJ A;  2PAS A;  1XVJ A;  1K95 A;  4GGF A;  1GJY A;  4ORA B;  4XYN A;  1G33 A;  2F3Y A;  1WLZ A;  4PE1 A;  1KK7 Y;  4MRX A;  4FTG A;  1C7W A;  1TCF A;  5AAN A;  1B4C A;  1LA0 A;  5JJG A;  2LV7 A;  1CM4 A;  2GGM A;  2M0R A;  3SG6 A;  2FCD A;  2M9G A;  5ER4 X;  3EKJ A;  1CFD A;  1XFY O;  1EH2 A;  4BY5 A;  2KOT A;  5F6T A;  1NWD A;  4GGN A;  4D1E A;  3DVK A;  1CB1 A;  1F8H A;  5D7F A;  2JWW A;  3LL8 B;  1DT7 B;  2Q91 A;  2P6B B;  2Q4U A;  2KHN A;  1M31 A;  3F45 A;  4YGD B;  5I2O A;  1MXL C;  1PSR A;  1Y6W A;  5ER5 A;  1VRK A;  1SBJ A;  1KSM A;  1J7Q A;  2EC6 B;  1TRF A;  1OSA A;  2HQ8 A;  1SPY A;  5DKN A;  3QRX A;  1BOC A;  1DJY A;  2BBM A;  2LMT A;  3PFV A;  1NX0 A;  3KHE A;  4AOM A;  4F0Z B;  2QPT A;  1JC2 A;  3CLN A;  4PE4 A;  1FPW A;  2FJU B;  4GUK A;  1IQ3 A;  2JTZ A;  4JWQ A;  2F2P A;  1Y1U A;  3OB2 B;  1KCY A;  2MHH A;  3EK7 A;  2M7L A;  1SR6 C;  4JPZ B;  2EGD A;  3VRO A;  1NPQ A;  4ZCU A;  1ALV A;  3OX6 A;  1F54 A;  2BBN A;  2HET A;  3CGA A;  1AJ5 A;  2EC6 C;  1PSB A;  1ZFS A;  2F8P A;  4ORB B;  2LMV A;  2G2B A;  1J7O A;  1FF1 A;  3AAK A;  1V1G A;  2BE4 A;  4NDB A;  3KEV A;  4CFQ A;  2LM5 A;  2LVV A;  1OZO A;  2WCF A;  1SRA A;  1BMO A;  3A8R A;  3JVT C;  2CT9 A;  1YUS A;  2LC5 A;  2ZN8 A;  3PLF B;  2B1U A;  1B8C A;  5HKW A;  2LAP A;  1K2H A;  1BJF A;  1CFC A;  3GK1 A;  2PAL A;  2MBX A;  1QX2 A;  2MJW B;  1QV0 A;  4YBH B;  1S26 D;  2OS8 C;  3I5F B;  3O2P A;  4CLN A;  2K0J A;  2CNP A;  3NSO A;  4YGB B;  2JNX A;  4M2Q A;  2CCM A;  4QJ3 B;  2WOR A;  1F4O A;  3OB1 B;  4YI8 A;  2BCB A;  5KTY A;  1L2O B;  2OPO A;  4OCI A;  1U5I A;  3PN7 B;  1S36 A;  1JBA A;  1WDC B;  1NCZ A;  2H61 C;  1TNQ A;  3BOW A;  4HRH A;  1LKJ A;  2JXC A;  2KYC A;  2ZRT A;  2LNK A;  4IL1 A;  3CR2 A;  1K9K A;  1EL4 A;  2BKI B;  3LLE A;  1F70 A;  3SG4 A;  1YUR A;  1WLM A;  1QTX A;  5GQQ C;  2AUC A;  4MRY A;  1FBV A;  2JC2 A;  1SK6 D;  5AER A;  1M46 A;  3KPX A;  3ZNI A;  5CSN A;  3TDU A;  1IRJ A;  2JZI A;  4MZK A;  2JUL A;  4ORC B;  1TNP A;  4PE7 A;  2LLU A;  3DF0 A;  2KAV A;  4C0J A;  1JWD A;  4HSZ A;  1KFU L;  1KQM C;  2JPT A;  1ALW A;  2JTT A;  4ETO A;  1TCO B;  3SG2 A;  5I2Q A;  2JNF A;  2CBL A;  1MQ1 A;  1W7I B;  2Y4Q A;  1XFX O;  2HQW A;  1XFW O;  4NDD A;  1M63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...