1D1OA

Cooperativity in ef-hand ca2+-binding proteins: evidence of site-site communication from binding-induced changes in structure and dynamics of n56a calbindin d9k
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKAGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Site-site communication in the EF-hand Ca2+-binding protein calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1d1oA00
3NSLA 2L5XB 1DVIA 1GGWA 1KCYA 5CSNA 1G4YR 4GNKB 2JT8A 1RWYA 2OS8C 4OV2A 2AUCA 2WCEA 1SMGA 3IQQA 1JFKA 2H61C 2LANA 3FWBA 1CFFA 1NCYA 4M2QA 1OOJA 2LMVA 2BECA 2PRUA 3EKHA 3CR2A 4PDZA 5D69A 1SRAA 3IF7A 3NXAA 1DJXA 1OMVA 3TS5B 1NSHA 2G2BA 2ZRTA 2K2AA 1YTZC 1IQ3A 4USLA 1EXRA 1J7PA 2LV7A 1SY9A 1X02A 1ZOTB 2DOQA 2PSRA 2R2IA 4GGFC 3BQ3A 4L9MA 1B7TZ 3VGOA 2FOTA 2COLB 1MHOA 3PN7C 1SW8A 2EC6B 1SCMC 3D0YB 3SG4A 1E8AA 4MVFA 3EVVA 2PMYA 5HKYA 1W7JB 1J1DA 1PVAA 3OB1B 2KQYA 1EG3A 2JXCA 3E3RA 1PALA 1KWOB 1Y1UA 4NQGA 3TZ1A 1A4PA 1NX0A 1UURA 2H2KA 4N1GA 1BMOA 1TRFA 4D1EA 1RTP1 4I5LB 4NDDA 1QASA 2JWWA 4GFTA 4ORCB 4PCWA 1F4OA 4XYNA 4XJKA 2LMTA 5DKNA 1QIWA 1B1GA 3DF0A 4ORBB 3EVRA 2LHIA 3FS7A 1ZUZA 1WLZA 1QVIZ 2M9GA 2B1UA 4XJKB 2JOJA 2WNDA 1YVHA 3TDZA 5CSJA 1BJFA 1CFDA 1LINA 2ZFDA 2OPOA 2JPTA 1L2OB 4MZKA 1FBVA 1G8IA 3H4SE 1A03A 1ZFSA 1BR1B 4MLWA 2WCFA 5I2OA 3I5IC 1YUTA 1YX8A 1EH2A 1KQMC 1M46A 1QS7A 4P2YB 2BKHB 1BOCA 1CDPA 3CS1A 1JUOA 3EK8A 2K7BA 1YR5A 4C0LA 1N65A 2NCPA 3KPXA 3OX6A 4YBHB 1S6IA 3WNXB 4ETOA 1CLBA 3RM1A 3EKJA 1A75A 2JT0A 3AAJA 1WRLA 1Q80A 1QIVA 2I18A 1MXEA 1ZMZA 1IJ5A 2LVKA 5I8NA 1H4BA 3NSOA 1TN4A 1A75B 2CT9A 3A8RA 3MSEB 1DF0B 5DKQA 2WORA 3OHMB 2KI4B 2EHBA 1NUBA 2Y1NA 3DVJA 4N5XA 1Y1AA 2ZNDA 1CDNA 3OX5A 1J1EA 1CLLA 1K9KA 1DJYA 2L4HA 2PVBA 2L4IA 2LVVA 2HPSA 1KK8C 2KAVA 3QRXA 4E68A 3KHEA 1XA5A 3EVUA 2IS9A 1HQVA 1V1GA 2LUCA 1S6JA 2GGMA 4UPGA 1OZSA 1DMOA 3BUWB 2JT3A 1NWDA 1KK7Y 5FYXA 4WQ2A 1TIZA 5KTYA 1TCFA 2M3WA 3HX4A 1AJ4A 3WHUB 4QJ3B 4YRUA 1U5IB 2L2EA 1LVCD 1BU3A 3JVTC 1IRJA 2OS8B 1IQ5A 2KI6D 1UWOA 4PHKA 1SL8A 1UHIA 3F45A 1F70A 1CNPA 2F2OA 5I2LA 2LLTA 1R2UA 2O5GA 1OMRA 5ER5A 1AVSA 4OVNF 2D8NA 2KGRA 1K96A 1UHJA 2F3YA 1LA0A 1SNLA 4N1FA 5AERA 2BL0C 1KSOA 1QJTA 2LM5A 2LLUA 4MZLA 2FCEA 2OTGC 2MJWB 4CFRA 2MBXA 3EK4A 1XFWO 2BKIB 2L51A 3I5FB 4HREE 3D0YA 1NX2A 2K7OA 3O6BA 4M2OA 4WRIA 1MF8B 3PN7B 3SG3A 1K8UA 1PULA 1SCMB 2ZKMX 2JC2A 4A4BA 1JC2A 4YGEB 1ALVA 3CGAA 2CXJA 1DJIA 1Y1XA 4AQJA 5DKRA 1NPQA 1ZACA 4DRWA 3VRQA 2Q91A 1K95A 1WLMA 1B4CA 2I2RE 2LVJA 2Y4QA 2F3ZA 2JU0A 1KFUL 3M0WA 4PALA 1W7IB 3VROA 3FIAA 3LCPC 3OP0A 1FI5A 1MQ1A 1WY9A 5HLVA 1CFPA 5I2QA 1F54A 1KK7Z 1LXFC 2KI6C 2JTTA 1VRKA 3BXKA 5HKWA 3PLFB 2M1KB 2BBMA 3TDUA 1HT9A 1CM1A 1F4QA 2BBNA 2FCDA 2E6WA 1QV0A 4JWQA 1C7WA 2JZIA 3AKBA 1L7ZA 1QXPA 2BE4A 2EC6C 1ALWA 3DVMA 4PE0A 2F2PA 2M8UA 1R6PA 4YI8A 4CLNA 2KAYA 1KWOC 2GV5A 3CTNA 2M7NA 2ZN9A 3O78A 4IL1A 2ZNEA 1OE9B 1XO5A 1KQMB 2KOTA 1G33A 1SKTA 1FPWA 1EJ3A 3BUOB 2K7DA 2NLNA 3CR4X 1DGVA 5ER4X 5HLOA 3GK1A 1SR6C 3TDIA 1F55A 1UHKA 1PVBA 1M31A 1AK8A 3LL8B 3CR5X 1MUXA 2L98A 2JULA 1DT7B 2EGDA 2K2FA 4TNCA 1KFXL 1IKUA 2LAPA 3GK2A 4P5OE 4ZCVA 1DF0A 1K2HA 3SJSA 2HQWA 1L2OC 1DJWA 2BCBA 2LHLA 1D1OA 1Y6WA 2LP3A 5KU1A 1XK4A 2WC8A 2Q4UA 3DVKA 3CWGA 4DS7A 3I5HB 2JTZA 2L0PA 1C07A 1A2XA 4MBEA 2MRDA 3LK0A 4NDCA 4OCIA 3KO0A 3OB2B 1WRKA 4HSZA 1NP8A 1SK6D 1FF1A 2LC5A 4PE4A 1KK8B 1XFXO 1K94A 4MN0A 1WDCC 1XFVO 1PRWA 1TNXA 1CLMA 3SIBA 4C0KA 3D10A 1LA3A 1YUUA 1F71A 1J55A 3I5GB 4BY4A 3SG5A 4YGAA 1SL9A 1XFZO 2PASA 4QJ5B 4ICBA 2I94A 1QATA 1QV1A 2KI4C 3SG7A 1RROA 1U5IA 2BCAA 2KSPA 1CM4A 3ZWHA 4DIRA 2CNPA 2K61A 1PK0D 5G08A 3K21A 1Y0VH 1CDLA 3JVTB 4HRGA 1S26D 1JSAA 1QX7A 5PALA 1BF5A 2M1UA 2LP2A 5HKZA 2H61A 5BPJA 1IH0A 1ODBA 1FW4A 3LLEA 2KQ6A 4R1EA 5GQQC 2JXLA 2LUXA 1N0YA 3SIAA 4DUQA 1SPYA 3ZNIA 2V53A 2E30A 5AANA 2QACA 4CPVA 3JTDC 2KHNA 2WOSA 1SCVA 5AFPA 1CFCA 1XVJA 1AJ5A 5CSFA 1K93D 2BL0B 4OR9B 2CCMA 2KFHA 4GGFA 1K90D 4A4CA 3TUYC 1UUSA 2K0JA 2OTGB 4AQIA 3BUMB 4CIDA 4PE7A 4QJ4B 2TN4A 1S5GY 3ICBA 4NDBA 1GGZA 1M63B 2M49B 2KYFA 1JF0A 3BOWB 1BR4B 1BT6A 1GQMA 3WHTB 2NZ0A 4GPLB 4MEWA 1OMDA 2HETA 1CB1A 2LVIA 2KFGA 5CSIA 2MLFC 1MWNA 1CTRA 3AAKA 3CZTX 2F33A 1QLSA 5TNCA 1YVLA 2WCBA 2MHHA 3O4YA 4PE1A 2KNEA 1J7QA 1SL7A 1YRTB 1CDMA 1OSAA 1EL4A 1MXLC 2CTNA 1RFJA 2KBIA 1K9UA 3RLZA 3TS5C 1XFUO 2I7AA 4PHMA 1B8RA 4GAOA 4MSPA 1J7RA 2LCPA 3AKAA 1UHHA 5D7FA 1KFUS 4YI9A 4F0ZB 3I5FC 4CFQA 1NYAA 3C1VA 4PHJA 4Q04A 1K9PA 2VRGA 3NSIA 1CMGA 1KQVA 1B9AA 1DJHA 3O2PA 1F8HA 1B8CA 1QX5B 2AMIA 3KF9A 3BUXB 1RJVA 3SG2A 1M45A 1WRZA 2K8MB 2CBLA 1BLQA 4HRHA 2K7CA 4PHNA 3VRPA 4YGBB 1TNQA 1OZOA 2NXQA 1TOPA 3I5IB 1J7OA 1QTXA 1QLKA 2QPTA 2M29A 1AHRA 2HQ8A 1SR6B 1YURA 1S6CA 2JRFA 3HCMA 4FTGA 1CKKA 1JFJA 4BY5A 1XFYO 3PATA 4MZJA 3BYAA 2A4JA 4JQ0D 2KBMA 5AXIA 3DF0B 3CLNA 1S1EA 2O60A 1CMFA 1RK9A 3GOFA 1SBJA 2M7LA 5HYDA 2MLEC 2LNKA 1S5GZ 3DVEA 4GUKA 2HF5A 1S3PA 2KDHA 5F6TA 4ZCUA 2P6BB 1A29A 1PSBA 4C0JA 1KFXS 4ORAB 1OQPA 1N2DA 3EK7A 1FI6A 3KEVA 2MAZA 1SYMA 2Y5IA 1PSRA 2JNXA 1IJ6A 4OKHA 4FQOA 2LE9B 1JBAA 5KSZA 1JF2A 4GBAA 5IBWA 2GGZA 1YX7A 4I5JA 5J3XA 2AAOA 3BUNB 1WDCB 3PALA 3FWCA 1YRUB 2ZN8A 5B8IB 2ZRSA 4I5KA 2KAXA 1EG4A 1TTXA 2NCOA 1TNPA 1TCOB 1H8BA 1NX3A 3IQOA 2Y1MA 2JNFA 1S36A 3SG6A 1UHNA 2PALA 3A4UB 5JJGA 2BCXA 2KGBC 4DCKA 3I5HC 2M97A 1B47A 1XYDA 4MRYA 1TNWA 2ISDA 1KSMA 4JPZB 1NX1A 1B7TY 1XK4C 3LK1A 5JOLA 1JWDA 5K89A 2SCPA 1AUIB 4AOMA 1IWQA 4I5NB 1B8LA 1QX2A 2FJUB 3NSKA 3PM8A 4YGDB 3DD4A 3WXAA 1C7VA 1NCXA 4MRXA 4GGNA 1DGUA 3PSRA 1DTLA 2BE6A 2SASA 2KYCA 5CPVA 5AEQA 1IGVA 4YGCB 1NCZA 1UP5A 1DJZA 4M2PA 3JTDB 3I5GC 4U8DA 1BG1A 2M0RA 2KFFA 2F8PA 1AP4A 3VRNA 2JQ6A 1DJGA 3PFVA 3TUYB 1LKJA 4WQ3A 2L50A 3GK4X 1GJYA 1MR8A 1QVIY 3VRRA 2LLSA 1BODA 1YUSA 2RGIA 2MA2A 1RECA 1NIWA 1V1FA 3BOWA 2LMUA 1M39A 2G9BA 1IG5A
chains in the Genus database with same CATH superfamily
3NSLA 2L5XB 3SS4A 1DVIA 1GGWA 1KCYA 5CSNA 1G4YR 4GNKB 2JT8A 1RWYA 2OS8C 3D74A 4OV2A 2AUCA 2WCEA 1SMGA 3IQQA 1JFKA 3NHIA 2H61C 2LANA 3FWBA 1CFFA 1NCYA 4M2QA 1OOJA 2LMVA 2BECA 2PRUA 3EKHA 3CR2A 4PDZA 5D69A 1DC1A 5D3OA 1SRAA 3IF7A 3NXAA 1DJXA 1OMVA 3TS5B 1NSHA 2G2BA 3CZ1A 2ZRTA 4F7FA 2K2AA 1YTZC 1IQ3A 4USLA 1EXRA 1J7PA 2H8VA 2LV7A 1SY9A 1X02A 1ZOTB 2DOQA 2PSRA 2R2IA 4GGFC 3BQ3A 4L9MA 1B7TZ 3VGOA 2FOTA 2COLB 1MHOA 3PN7C 3V2LA 1SW8A 2EC6B 1SCMC 3D0YB 3SG4A 3PJIA 1E8AA 4MVFA 3EVVA 2PMYA 5HKYA 1W7JB 1J1DA 1PVAA 3OB1B 2KQYA 1EG3A 2JXCA 3E3RA 4INXA 3S0AA 1PALA 1KWOB 1Y1UA 4NQGA 3TZ1A 1A4PA 1NX0A 1UURA 2H2KA 4N1GA 1BMOA 1TRFA 4D1EA 1RTP1 4I5LB 2KPHA 4NDDA 1QASA 2JWWA 4GFTA 4ORCB 4PCWA 5DICA 1F4OA 4XYNA 4XJKA 2LMTA 5DKNA 1QIWA 1B1GA 3DF0A 4ORBB 3EVRA 2LHIA 3FS7A 1ZUZA 1WLZA 3R1PA 1QVIZ 2M9GA 2B1UA 4XJKB 1OOIX 2JOJA 2WNDA 1YVHA 3TDZA 5CSJA 1BJFA 1C3ZA 1CFDA 1LINA 3BJHA 3DZTA 2ZFDA 1T14A 2OPOA 2JPTA 1L2OB 4MZKA 3L47A 1FBVA 1G8IA 1QWVA 3H4SE 1ZFSA 1A03A 1BR1B 4MLWA 2WCFA 5I2OA 3I5IC 1YUTA 1YX8A 1EH2A 1KQMC 1M46A 1QS7A 4P2YB 2BKHB 1BOCA 1CDPA 3CS1A 1JUOA 3EK8A 2K7BA 1YR5A 4C0LA 1N65A 2NCPA 3KPXA 3OX6A 4YBHB 2WCHA 1S6IA 3WNXB 3UO9A 4ETOA 1CLBA 3RM1A 3EKJA 1A75A 2JT0A 2WC6A 3S0GA 3AAJA 1WRLA 3CZ2A 1OOGA 1Z4HA 1Q80A 1QIVA 2I18A 1MXEA 1ZMZA 1IJ5A 2LVKA 5I8NA 1H4BA 3NSOA 1TN4A 1A75B 2CT9A 3A8RA 3MSEB 1DF0B 5DKQA 2WORA 3OHMB 2KI4B 1LS8A 1TUJA 2EHBA 1NUBA 3SS3A 2Y1NA 3DVJA 4N5XA 1Y1AA 2ZNDA 1CDNA 3RZSA 2WCJA 3OX5A 1J1EA 1CLLA 1K9KA 1DJYA 2L4HA 2PVBA 2L4IA 2LVVA 2HPSA 1KK8C 2KAVA 3QRXA 1SSEB 3B6XA 4KYNA 4E68A 3KHEA 1XA5A 3EVUA 2IS9A 1HQVA 3K1EA 3S0FA 1V1GA 2LUCA 1S6JA 2GGMA 4UPGA 1OZSA 1DMOA 3BUWB 2JT3A 1NWDA 3CZ0A 1KK7Y 5FYXA 4WQ2A 1TIZA 5KTYA 1TCFA 2M3WA 3HX4A 3PM2A 1AJ4A 3WHUB 4QJ3B 3D75A 4YRUA 1U5IB 2L2EA 1LVCD 1BU3A 3JVTC 1IRJA 2OS8B 1IQ5A 2KI6D 1UWOA 2WCLA 4PHKA 3IVTA 1SL8A 1UHIA 3F45A 1F70A 1CNPA 2F2OA 5I2LA 2LLTA 1R2UA 2O5GA 1OMRA 5ER5A 1AVSA 4OVNF 2D8NA 2KGRA 1K96A 1UHJA 2F3YA 1LA0A 1SNLA 4N1FA 5AERA 2BL0C 1KSOA 1QJTA 2LM5A 2LLUA 4MZLA 2FCEA 2OTGC 2MJWB 4CFRA 2MBXA 3EK4A 1XFWO 2BKIB 2L51A 2QDIA 3B88A 3I5FB 3D0YA 3R1OA 4HREE 1NX2A 2K7OA 3O6BA 4M2OA 4WRIA 1MF8B 3PN7B 3SG3A 1K8UA 1PULA 1SCMB 2ZKMX 2JC2A 4A4BA 1JC2A 4YGEB 1ALVA 3CGAA 2CXJA 1DJIA 2FJYA 1Y1XA 4AQJA 5DKRA 1NPQA 1ZACA 4DRWA 3VRQA 3VB1A 2Q91A 1K95A 1WLMA 2ERBA 1B4CA 2I2RE 2LVJA 2Y4QA 2F3ZA 2JU0A 1KFUL 3M0WA 4PALA 1W7IB 3VROA 3FIAA 1TWOA 3LCPC 3OP0A 1FI5A 1MQ1A 1WY9A 5HLVA 1CFPA 5I2QA 1F54A 1KK7Z 1LXFC 2KI6C 2JTTA 1VRKA 3BXKA 3S0BA 5HKWA 3PLFB 5EL2A 2M1KB 5HL1A 2BBMA 3TDUA 1HT9A 1CM1A 1F4QA 1DELA 2BBNA 2FCDA 2E6WA 1QV0A 3R1VA 1C7WA 4JWQA 2JZIA 1ORGA 3AKBA 1L7ZA 1QXPA 2BE4A 2EC6C 1ALWA 3DVMA 4PE0A 2F2PA 3B7AA 2M8UA 1R6PA 4YI8A 4CLNA 2KAYA 1KWOC 2GV5A 3CTNA 2M7NA 2ZN9A 3O78A 4IL1A 2ZNEA 1OE9B 3D78A 3L4LA 1XO5A 1KQMB 2KOTA 1G33A 1SKTA 1FPWA 5FI6A 1EJ3A 3BUOB 2K7DA 2NLNA 3CR4X 1DGVA 3FE6A 5ER4X 5HLOA 1DQEA 3GK1A 1SR6C 1Z2CB 3TDIA 1OOFA 1UHKA 1PVBA 1F55A 1M31A 1AK8A 4PT1A 3LL8B 3CR5X 1MUXA 2L98A 2JULA 3BFHA 4IJ7A 2EGDA 2PYQA 1DT7B 2L2CA 2K2FA 4TNCA 5I94A 3NGVA 1KFXL 1XFRA 1IKUA 2LAPA 3GK2A 4P5OE 1TUZA 4ZCVA 1DF0A 3UNWA 1K2HA 3SJSA 2HQWA 1L2OC 1DJWA 2YGUA 2BCBA 2LHLA 1D1OA 1DEKA 1Y6WA 2LP3A 2WCKA 5KU1A 1XK4A 2WC8A 2Q4UA 3DVKA 3CWGA 4DS7A 3I5HB 3OBVA 2JTZA 2L0PA 1C07A 1A2XA 4MBEA 3Q8IA 2MRDA 2GTEA 3LK0A 4NDCA 4OCIA 3KO0A 3OB2B 1WRKA 3CABA 1NP8A 1SK6D 4HSZA 1FF1A 2LC5A 4PE4A 1KK8B 1XFXO 2PQLA 1K94A 2WC5A 1WDCC 3OGNA 4MN0A 1XFVO 1PRWA 1TNXA 1CLMA 3SIBA 4C0KA 3D10A 1LA3A 4JD9A 1YUUA 1F71A 1J55A 3I5GB 2QEBA 4BY4A 3SG5A 4YGAA 1SL9A 2P71A 1XFZO 2PASA 4QJ5B 4ICBA 1C3YA 2I94A 1QATA 1QV1A 2KI4C 3SG7A 1RROA 1U5IA 2BCAA 2KSPA 1CM4A 3ZWHA 4DIRA 2CNPA 2K61A 3BFAA 1PK0D 5G08A 3K21A 1Y0VH 3O4XA 1CDLA 3JVTB 4HRGA 1S26D 1JSAA 3L4AA 1QX7A 5PALA 1BF5A 2M1UA 2LP2A 5HKZA 2H61A 5BPJA 1IH0A 1ODBA 3S0EA 1OOHA 1FW4A 3LLEA 2KQ6A 4R1EA 5GQQC 2JXLA 2LUXA 4OZDA 3WXAA 1N0YA 3SIAA 4DUQA 1SPYA 3ZNIA 2V53A 2E30A 5AANA 2QACA 4CPVA 3JTDC 2KHNA 2WOSA 1SCVA 5AFPA 1CFCA 1XVJA 1AJ5A 5CSFA 1K93D 1OW4A 2BL0B 2K60A 2CCMA 4FQTA 4OR9B 3SS5A 2KFHA 3D73A 4GGFA 1K90D 4A4CA 3TUYC 1UUSA 2K0JA 2OTGB 4AQIA 3CDNA 3BUMB 4CIDA 4PE7A 3EG5B 4QJ4B 2TN4A 1S5GY 3ICBA 4NDBA 1GGZA 1M63B 2M49B 3DY9A 2KYFA 1JF0A 3BOWB 1BR4B 1BT6A 1GQMA 3WHTB 2NZ0A 3BFBA 4GPLB 4MEWA 1OMDA 2HETA 2BNXA 2LVIA 2KFGA 1CB1A 5CSIA 2MLFC 1MWNA 1CTRA 3AAKA 3CZTX 2F33A 1QLSA 2JPOA 5FI7A 5TNCA 1YVLA 2WCBA 2MHHA 3O4YA 4PE1A 2KNEA 1J7QA 1SL7A 1YRTB 1CDMA 1OSAA 1EL4A 1MXLC 2CTNA 1RFJA 2KBIA 1K9UA 3RLZA 3TS5C 1XFUO 2I7AA 4PHMA 1B8RA 4GAOA 4MSPA 1J7RA 2LCPA 3AKAA 1UHHA 5D7FA 1KFUS 4YI9A 4F0ZB 3I5FC 4CFQA 1NYAA 3C1VA 3QMEA 4PHJA 4Q04A 3S0DA 1K9PA 2VRGA 3NSIA 3R72A 1CMGA 1KQVA 1B9AA 1DJHA 3O2PA 3B86A 1F8HA 1B8CA 1QX5B 2AMIA 3KF9A 3BUXB 1RJVA 3SG2A 1M45A 1WRZA 2K8MB 2CBLA 1BLQA 4HRHA 2K7CA 4PHNA 3VRPA 4YGBB 1TNQA 1OZOA 2NXQA 1TOPA 3I5IB 1J7OA 1QTXA 1QLKA 2QPTA 2M29A 1AHRA 2HQ8A 1SR6B 1YURA 1S6CA 4INWA 2JRFA 3HCMA 4FTGA 1CKKA 1JFJA 4BY5A 2BAPA 1XFYO 3FE8A 3PATA 4MZJA 3BYAA 2A4JA 4JQ0D 2KBMA 5AXIA 3DF0B 3CLNA 1S1EA 2O60A 1CMFA 1RK9A 3GOFA 1SBJA 2P70A 2M7LA 5HYDA 2MLEC 2LNKA 1S5GZ 3DVEA 2QEOA 4GUKA 2HF5A 1S3PA 3DYEA 2KDHA 5F6TA 4ZCUA 2P6BB 1A29A 2WCMA 1PSBA 4C0JA 1KFXS 4ORAB 1OQPA 1N2DA 3EK7A 3D76A 1FI6A 3KEVA 2MAZA 1SYMA 2Y5IA 1PSRA 2JNXA 1IJ6A 4OKHA 5FI2A 1GM0A 4FQOA 2LE9B 1JBAA 5KSZA 2KLEA 1JF2A 4GBAA 5IBWA 2GGZA 1YX7A 4I5JA 5J3XA 2AAOA 1IIOA 3BUNB 1WDCB 3PALA 3FWCA 1YRUB 2ZN8A 5B8IB 2ZRSA 4JKTA 4I5KA 2KAXA 1EG4A 2QEVA 1TTXA 3FE9A 2NCOA 1TNPA 1TCOB 1H8BA 1NX3A 3IQOA 2Y1MA 2JNFA 1S36A 3SG6A 1UHNA 2PALA 2KLDA 1P28A 3A4UB 5JJGA 2BCXA 2KGBC 4DCKA 3N7HA 3I5HC 2M97A 1B47A 1XYDA 4MRYA 1TNWA 2ISDA 3CYZA 2L5YA 1KSMA 3D77A 4JPZB 1NX1A 1B7TY 1XK4C 3LK1A 5JOLA 1JWDA 5K89A 2SCPA 1AUIB 4AOMA 1IWQA 2QEHA 1B8LA 1QX2A 2FJUB 3DXLA 3NSKA 3PM8A 3DD4A 4I5NB 4YGDB 1C7VA 1W9ZA 3B87A 1NCXA 4MRXA 4GGNA 1DGUA 3PSRA 1DTLA 2BE6A 2SASA 2KYCA 5CPVA 5AEQA 1IGVA 4YGCB 1NCZA 1UP5A 1DJZA 4M2PA 3JTDB 3I5GC 4U8DA 1BG1A 2M0RA 2KFFA 2F8PA 1AP4A 3VRNA 3NHTA 2JQ6A 1DJGA 3PFVA 3TUYB 1LKJA 4WQ3A 2L50A 3GK4X 1GJYA 1MR8A 1QVIY 3VRRA 2LLSA 1BODA 1YUSA 2RGIA 2MA2A 1RECA 1NIWA 1V1FA 3BOWA 2LMUA 1M39A 2G9BA 1IG5A
chains in the Genus database with same CATH topology
3NSLA 2L5XB 1DVIA 1GGWA 1KCYA 5CSNA 1G4YR 4GNKB 2JT8A 1RWYA 2OS8C 4OV2A 2AUCA 2WCEA 1SMGA 3IQQA 1JFKA 2H61C 2LANA 3FWBA 1CFFA 1NCYA 4M2QA 1OOJA 2LMVA 2BECA 2PRUA 3EKHA 3CR2A 4PDZA 5D69A 1SRAA 3IF7A 3NXAA 1DJXA 1OMVA 3TS5B 1NSHA 2G2BA 2ZRTA 2K2AA 1YTZC 1IQ3A 4USLA 1EXRA 1J7PA 2LV7A 1SY9A 1X02A 1ZOTB 2DOQA 2PSRA 2R2IA 4GGFC 3BQ3A 4L9MA 1B7TZ 3VGOA 2FOTA 2COLB 1MHOA 3PN7C 1SW8A 2EC6B 1SCMC 3D0YB 3SG4A 1E8AA 4MVFA 3EVVA 2PMYA 5HKYA 1W7JB 1J1DA 1PVAA 3OB1B 2KQYA 1EG3A 2JXCA 3E3RA 1PALA 1KWOB 1Y1UA 4NQGA 3TZ1A 1A4PA 1NX0A 1UURA 2H2KA 4N1GA 1BMOA 1TRFA 4D1EA 1RTP1 4I5LB 4NDDA 1QASA 2JWWA 4GFTA 4ORCB 4PCWA 1F4OA 4XYNA 4XJKA 2LMTA 5DKNA 1QIWA 1B1GA 3DF0A 4ORBB 3EVRA 2LHIA 3FS7A 1ZUZA 1WLZA 1QVIZ 2M9GA 2B1UA 4XJKB 2JOJA 2WNDA 1YVHA 3TDZA 5CSJA 1BJFA 1CFDA 1LINA 2ZFDA 2OPOA 2JPTA 1L2OB 4MZKA 1FBVA 1G8IA 3H4SE 1A03A 1ZFSA 1BR1B 4MLWA 2WCFA 5I2OA 3I5IC 1YUTA 1YX8A 1EH2A 1KQMC 1M46A 1QS7A 4P2YB 2BKHB 1BOCA 1CDPA 3CS1A 1JUOA 3EK8A 2K7BA 1YR5A 4C0LA 1N65A 2NCPA 3KPXA 3OX6A 4YBHB 1S6IA 3WNXB 4ETOA 1CLBA 3RM1A 3EKJA 1A75A 2JT0A 3AAJA 1WRLA 1Q80A 1QIVA 2I18A 1MXEA 1ZMZA 1IJ5A 2LVKA 5I8NA 1H4BA 3NSOA 1TN4A 1A75B 2CT9A 3A8RA 3MSEB 1DF0B 5DKQA 2WORA 3OHMB 2KI4B 2EHBA 1NUBA 2Y1NA 3DVJA 4N5XA 1Y1AA 2ZNDA 1CDNA 3OX5A 1J1EA 1CLLA 1K9KA 1DJYA 2L4HA 2PVBA 2L4IA 2LVVA 2HPSA 1KK8C 2KAVA 3QRXA 4E68A 3KHEA 1XA5A 3EVUA 2IS9A 1HQVA 1V1GA 2LUCA 1S6JA 2GGMA 4UPGA 1OZSA 1DMOA 3BUWB 2JT3A 1NWDA 1KK7Y 5FYXA 4WQ2A 1TIZA 5KTYA 1TCFA 2M3WA 3HX4A 1AJ4A 3WHUB 4QJ3B 4YRUA 1U5IB 2L2EA 1LVCD 1BU3A 3JVTC 1IRJA 2OS8B 1IQ5A 2KI6D 1UWOA 4PHKA 1SL8A 1UHIA 3F45A 1F70A 1CNPA 2F2OA 5I2LA 2LLTA 1R2UA 2O5GA 1OMRA 5ER5A 1AVSA 4OVNF 2D8NA 2KGRA 1K96A 1UHJA 2F3YA 1LA0A 1SNLA 4N1FA 5AERA 2BL0C 1KSOA 1QJTA 2LM5A 2LLUA 4MZLA 2FCEA 2OTGC 2MJWB 4CFRA 2MBXA 3EK4A 1XFWO 2BKIB 2L51A 3I5FB 4HREE 3D0YA 1NX2A 2K7OA 3O6BA 4M2OA 4WRIA 1MF8B 3PN7B 3SG3A 1K8UA 1PULA 1SCMB 2ZKMX 2JC2A 4A4BA 1JC2A 4YGEB 1ALVA 3CGAA 2CXJA 1DJIA 1Y1XA 4AQJA 5DKRA 1NPQA 1ZACA 4DRWA 3VRQA 2Q91A 1K95A 1WLMA 1B4CA 2I2RE 2LVJA 2Y4QA 2F3ZA 2JU0A 1KFUL 3M0WA 4PALA 1W7IB 3VROA 3FIAA 3LCPC 3OP0A 1FI5A 1MQ1A 1WY9A 5HLVA 1CFPA 5I2QA 1F54A 1KK7Z 1LXFC 2KI6C 2JTTA 1VRKA 3BXKA 5HKWA 3PLFB 2M1KB 2BBMA 3TDUA 1HT9A 1CM1A 1F4QA 2BBNA 2FCDA 2E6WA 1QV0A 4JWQA 1C7WA 2JZIA 3AKBA 1L7ZA 1QXPA 2BE4A 2EC6C 1ALWA 3DVMA 4PE0A 2F2PA 2M8UA 1R6PA 4YI8A 4CLNA 2KAYA 1KWOC 2GV5A 3CTNA 2M7NA 2ZN9A 3O78A 4IL1A 2ZNEA 1OE9B 1XO5A 1KQMB 2KOTA 1G33A 1SKTA 1FPWA 1EJ3A 3BUOB 2K7DA 2NLNA 3CR4X 1DGVA 5ER4X 5HLOA 3GK1A 1SR6C 3TDIA 1F55A 1UHKA 1PVBA 1M31A 1AK8A 3LL8B 3CR5X 1MUXA 2L98A 2JULA 1DT7B 2EGDA 2K2FA 4TNCA 1KFXL 1IKUA 2LAPA 3GK2A 4P5OE 4ZCVA 1DF0A 1K2HA 3SJSA 2HQWA 1L2OC 1DJWA 2BCBA 2LHLA 1D1OA 1Y6WA 2LP3A 5KU1A 1XK4A 2WC8A 2Q4UA 3DVKA 3CWGA 4DS7A 3I5HB 2JTZA 2L0PA 1C07A 1A2XA 4MBEA 2MRDA 3LK0A 4NDCA 4OCIA 3KO0A 3OB2B 1WRKA 4HSZA 1NP8A 1SK6D 1FF1A 2LC5A 4PE4A 1KK8B 1XFXO 1K94A 4MN0A 1WDCC 1XFVO 1PRWA 1TNXA 1CLMA 3SIBA 4C0KA 3D10A 1LA3A 1YUUA 1F71A 1J55A 3I5GB 4BY4A 3SG5A 4YGAA 1SL9A 1XFZO 2PASA 4QJ5B 4ICBA 2I94A 1QATA 1QV1A 2KI4C 3SG7A 1RROA 1U5IA 2BCAA 2KSPA 1CM4A 3ZWHA 4DIRA 2CNPA 2K61A 1PK0D 5G08A 3K21A 1Y0VH 1CDLA 3JVTB 4HRGA 1S26D 1JSAA 1QX7A 5PALA 1BF5A 2M1UA 2LP2A 5HKZA 2H61A 5BPJA 1IH0A 1ODBA 1FW4A 3LLEA 2KQ6A 4R1EA 5GQQC 2JXLA 2LUXA 1N0YA 3SIAA 4DUQA 1SPYA 3ZNIA 2V53A 2E30A 5AANA 2QACA 4CPVA 3JTDC 2KHNA 2WOSA 1SCVA 5AFPA 1CFCA 1XVJA 1AJ5A 5CSFA 1K93D 2BL0B 4OR9B 2CCMA 2KFHA 4GGFA 1K90D 4A4CA 3TUYC 1UUSA 2K0JA 2OTGB 4AQIA 3BUMB 4CIDA 4PE7A 4QJ4B 2TN4A 1S5GY 3ICBA 4NDBA 1GGZA 1M63B 2M49B 2KYFA 1JF0A 3BOWB 1BR4B 1BT6A 1GQMA 3WHTB 2NZ0A 4GPLB 4MEWA 1OMDA 2HETA 1CB1A 2LVIA 2KFGA 5CSIA 2MLFC 1MWNA 1CTRA 3AAKA 3CZTX 2F33A 1QLSA 5TNCA 1YVLA 2WCBA 2MHHA 3O4YA 4PE1A 2KNEA 1J7QA 1SL7A 1YRTB 1CDMA 1OSAA 1EL4A 1MXLC 2CTNA 1RFJA 2KBIA 1K9UA 3RLZA 3TS5C 1XFUO 2I7AA 4PHMA 1B8RA 4GAOA 4MSPA 1J7RA 2LCPA 3AKAA 1UHHA 5D7FA 1KFUS 4YI9A 4F0ZB 3I5FC 4CFQA 1NYAA 3C1VA 4PHJA 4Q04A 1K9PA 2VRGA 3NSIA 1CMGA 1KQVA 1B9AA 1DJHA 3O2PA 1F8HA 1B8CA 1QX5B 2AMIA 3KF9A 3BUXB 1RJVA 3SG2A 1M45A 1WRZA 2K8MB 2CBLA 1BLQA 4HRHA 2K7CA 4PHNA 3VRPA 4YGBB 1TNQA 1OZOA 2NXQA 1TOPA 3I5IB 1J7OA 1QTXA 1QLKA 2QPTA 2M29A 1AHRA 2HQ8A 1SR6B 1YURA 1S6CA 2JRFA 3HCMA 4FTGA 1CKKA 1JFJA 4BY5A 1XFYO 3PATA 4MZJA 3BYAA 2A4JA 4JQ0D 2KBMA 5AXIA 3DF0B 3CLNA 1S1EA 2O60A 1CMFA 1RK9A 3GOFA 1SBJA 2M7LA 5HYDA 2MLEC 2LNKA 1S5GZ 3DVEA 4GUKA 2HF5A 1S3PA 2KDHA 5F6TA 4ZCUA 2P6BB 1A29A 1PSBA 4C0JA 1KFXS 4ORAB 1OQPA 1N2DA 3EK7A 1FI6A 3KEVA 2MAZA 1SYMA 2Y5IA 1PSRA 2JNXA 1IJ6A 4OKHA 4FQOA 2LE9B 1JBAA 5KSZA 1JF2A 4GBAA 5IBWA 2GGZA 1YX7A 4I5JA 5J3XA 2AAOA 3BUNB 1WDCB 3PALA 3FWCA 1YRUB 2ZN8A 5B8IB 2ZRSA 4I5KA 2KAXA 1EG4A 1TTXA 2NCOA 1TNPA 1TCOB 1H8BA 1NX3A 3IQOA 2Y1MA 2JNFA 1S36A 3SG6A 1UHNA 2PALA 3A4UB 5JJGA 2BCXA 2KGBC 4DCKA 3I5HC 2M97A 1B47A 1XYDA 4MRYA 1TNWA 2ISDA 1KSMA 4JPZB 1NX1A 1B7TY 1XK4C 3LK1A 5JOLA 1JWDA 5K89A 2SCPA 1AUIB 4AOMA 1IWQA 4I5NB 1B8LA 1QX2A 2FJUB 3NSKA 3PM8A 4YGDB 3DD4A 3WXAA 1C7VA 1NCXA 4MRXA 4GGNA 1DGUA 3PSRA 1DTLA 2BE6A 2SASA 2KYCA 5CPVA 5AEQA 1IGVA 4YGCB 1NCZA 1UP5A 1DJZA 4M2PA 3JTDB 3I5GC 4U8DA 1BG1A 2M0RA 2KFFA 2F8PA 1AP4A 3VRNA 2JQ6A 1DJGA 3PFVA 3TUYB 1LKJA 4WQ3A 2L50A 3GK4X 1GJYA 1MR8A 1QVIY 3VRRA 2LLSA 1BODA 1YUSA 2RGIA 2MA2A 1RECA 1NIWA 1V1FA 3BOWA 2LMUA 1M39A 2G9BA 1IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSL A;  2L5X B;  1DVI A;  1GGW A;  1KCY A;  5CSN A;  1G4Y R;  4GNK B;  2JT8 A;  1RWY A;  2OS8 C;  4OV2 A;  2AUC A;  2WCE A;  1SMG A;  3IQQ A;  1JFK A;  2H61 C;  2LAN A;  3FWB A;  1CFF A;  1NCY A;  4M2Q A;  1OOJ A;  2LMV A;  2BEC A;  2PRU A;  3EKH A;  3CR2 A;  4PDZ A;  5D69 A;  1SRA A;  3IF7 A;  3NXA A;  1DJX A;  1OMV A;  3TS5 B;  1NSH A;  2G2B A;  2ZRT A;  2K2A A;  1YTZ C;  1IQ3 A;  4USL A;  1EXR A;  1J7P A;  2LV7 A;  1SY9 A;  1X02 A;  1ZOT B;  2DOQ A;  2PSR A;  2R2I A;  4GGF C;  3BQ3 A;  4L9M A;  1B7T Z;  3VGO A;  2FOT A;  2COL B;  1MHO A;  3PN7 C;  1SW8 A;  2EC6 B;  1SCM C;  3D0Y B;  3SG4 A;  1E8A A;  4MVF A;  3EVV A;  2PMY A;  5HKY A;  1W7J B;  1J1D A;  1PVA A;  3OB1 B;  2KQY A;  1EG3 A;  2JXC A;  3E3R A;  1PAL A;  1KWO B;  1Y1U A;  4NQG A;  3TZ1 A;  1A4P A;  1NX0 A;  1UUR A;  2H2K A;  4N1G A;  1BMO A;  1TRF A;  4D1E A;  1RTP 1;  4I5L B;  4NDD A;  1QAS A;  2JWW A;  4GFT A;  4ORC B;  4PCW A;  1F4O A;  4XYN A;  4XJK A;  2LMT A;  5DKN A;  1QIW A;  1B1G A;  3DF0 A;  4ORB B;  3EVR A;  2LHI A;  3FS7 A;  1ZUZ A;  1WLZ A;  1QVI Z;  2M9G A;  2B1U A;  4XJK B;  2JOJ A;  2WND A;  1YVH A;  3TDZ A;  5CSJ A;  1BJF A;  1CFD A;  1LIN A;  2ZFD A;  2OPO A;  2JPT A;  1L2O B;  4MZK A;  1FBV A;  1G8I A;  3H4S E;  1A03 A;  1ZFS A;  1BR1 B;  4MLW A;  2WCF A;  5I2O A;  3I5I C;  1YUT A;  1YX8 A;  1EH2 A;  1KQM C;  1M46 A;  1QS7 A;  4P2Y B;  2BKH B;  1BOC A;  1CDP A;  3CS1 A;  1JUO A;  3EK8 A;  2K7B A;  1YR5 A;  4C0L A;  1N65 A;  2NCP A;  3KPX A;  3OX6 A;  4YBH B;  1S6I A;  3WNX B;  4ETO A;  1CLB A;  3RM1 A;  3EKJ A;  1A75 A;  2JT0 A;  3AAJ A;  1WRL A;  1Q80 A;  1QIV A;  2I18 A;  1MXE A;  1ZMZ A;  1IJ5 A;  2LVK A;  5I8N A;  1H4B A;  3NSO A;  1TN4 A;  1A75 B;  2CT9 A;  3A8R A;  3MSE B;  1DF0 B;  5DKQ A;  2WOR A;  3OHM B;  2KI4 B;  2EHB A;  1NUB A;  2Y1N A;  3DVJ A;  4N5X A;  1Y1A A;  2ZND A;  1CDN A;  3OX5 A;  1J1E A;  1CLL A;  1K9K A;  1DJY A;  2L4H A;  2PVB A;  2L4I A;  2LVV A;  2HPS A;  1KK8 C;  2KAV A;  3QRX A;  4E68 A;  3KHE A;  1XA5 A;  3EVU A;  2IS9 A;  1HQV A;  1V1G A;  2LUC A;  1S6J A;  2GGM A;  4UPG A;  1OZS A;  1DMO A;  3BUW B;  2JT3 A;  1NWD A;  1KK7 Y;  5FYX A;  4WQ2 A;  1TIZ A;  5KTY A;  1TCF A;  2M3W A;  3HX4 A;  1AJ4 A;  3WHU B;  4QJ3 B;  4YRU A;  1U5I B;  2L2E A;  1LVC D;  1BU3 A;  3JVT C;  1IRJ A;  2OS8 B;  1IQ5 A;  2KI6 D;  1UWO A;  4PHK A;  1SL8 A;  1UHI A;  3F45 A;  1F70 A;  1CNP A;  2F2O A;  5I2L A;  2LLT A;  1R2U A;  2O5G A;  1OMR A;  5ER5 A;  1AVS A;  4OVN F;  2D8N A;  2KGR A;  1K96 A;  1UHJ A;  2F3Y A;  1LA0 A;  1SNL A;  4N1F A;  5AER A;  2BL0 C;  1KSO A;  1QJT A;  2LM5 A;  2LLU A;  4MZL A;  2FCE A;  2OTG C;  2MJW B;  4CFR A;  2MBX A;  3EK4 A;  1XFW O;  2BKI B;  2L51 A;  3I5F B;  4HRE E;  3D0Y A;  1NX2 A;  2K7O A;  3O6B A;  4M2O A;  4WRI A;  1MF8 B;  3PN7 B;  3SG3 A;  1K8U A;  1PUL A;  1SCM B;  2ZKM X;  2JC2 A;  4A4B A;  1JC2 A;  4YGE B;  1ALV A;  3CGA A;  2CXJ A;  1DJI A;  1Y1X A;  4AQJ A;  5DKR A;  1NPQ A;  1ZAC A;  4DRW A;  3VRQ A;  2Q91 A;  1K95 A;  1WLM A;  1B4C A;  2I2R E;  2LVJ A;  2Y4Q A;  2F3Z A;  2JU0 A;  1KFU L;  3M0W A;  4PAL A;  1W7I B;  3VRO A;  3FIA A;  3LCP C;  3OP0 A;  1FI5 A;  1MQ1 A;  1WY9 A;  5HLV A;  1CFP A;  5I2Q A;  1F54 A;  1KK7 Z;  1LXF C;  2KI6 C;  2JTT A;  1VRK A;  3BXK A;  5HKW A;  3PLF B;  2M1K B;  2BBM A;  3TDU A;  1HT9 A;  1CM1 A;  1F4Q A;  2BBN A;  2FCD A;  2E6W A;  1QV0 A;  4JWQ A;  1C7W A;  2JZI A;  3AKB A;  1L7Z A;  1QXP A;  2BE4 A;  2EC6 C;  1ALW A;  3DVM A;  4PE0 A;  2F2P A;  2M8U A;  1R6P A;  4YI8 A;  4CLN A;  2KAY A;  1KWO C;  2GV5 A;  3CTN A;  2M7N A;  2ZN9 A;  3O78 A;  4IL1 A;  2ZNE A;  1OE9 B;  1XO5 A;  1KQM B;  2KOT A;  1G33 A;  1SKT A;  1FPW A;  1EJ3 A;  3BUO B;  2K7D A;  2NLN A;  3CR4 X;  1DGV A;  5ER4 X;  5HLO A;  3GK1 A;  1SR6 C;  3TDI A;  1F55 A;  1UHK A;  1PVB A;  1M31 A;  1AK8 A;  3LL8 B;  3CR5 X;  1MUX A;  2L98 A;  2JUL A;  1DT7 B;  2EGD A;  2K2F A;  4TNC A;  1KFX L;  1IKU A;  2LAP A;  3GK2 A;  4P5O E;  4ZCV A;  1DF0 A;  1K2H A;  3SJS A;  2HQW A;  1L2O C;  1DJW A;  2BCB A;  2LHL A;  1D1O A;  1Y6W A;  2LP3 A;  5KU1 A;  1XK4 A;  2WC8 A;  2Q4U A;  3DVK A;  3CWG A;  4DS7 A;  3I5H B;  2JTZ A;  2L0P A;  1C07 A;  1A2X A;  4MBE A;  2MRD A;  3LK0 A;  4NDC A;  4OCI A;  3KO0 A;  3OB2 B;  1WRK A;  4HSZ A;  1NP8 A;  1SK6 D;  1FF1 A;  2LC5 A;  4PE4 A;  1KK8 B;  1XFX O;  1K94 A;  4MN0 A;  1WDC C;  1XFV O;  1PRW A;  1TNX A;  1CLM A;  3SIB A;  4C0K A;  3D10 A;  1LA3 A;  1YUU A;  1F71 A;  1J55 A;  3I5G B;  4BY4 A;  3SG5 A;  4YGA A;  1SL9 A;  1XFZ O;  2PAS A;  4QJ5 B;  4ICB A;  2I94 A;  1QAT A;  1QV1 A;  2KI4 C;  3SG7 A;  1RRO A;  1U5I A;  2BCA A;  2KSP A;  1CM4 A;  3ZWH A;  4DIR A;  2CNP A;  2K61 A;  1PK0 D;  5G08 A;  3K21 A;  1Y0V H;  1CDL A;  3JVT B;  4HRG A;  1S26 D;  1JSA A;  1QX7 A;  5PAL A;  1BF5 A;  2M1U A;  2LP2 A;  5HKZ A;  2H61 A;  5BPJ A;  1IH0 A;  1ODB A;  1FW4 A;  3LLE A;  2KQ6 A;  4R1E A;  5GQQ C;  2JXL A;  2LUX A;  1N0Y A;  3SIA A;  4DUQ A;  1SPY A;  3ZNI A;  2V53 A;  2E30 A;  5AAN A;  2QAC A;  4CPV A;  3JTD C;  2KHN A;  2WOS A;  1SCV A;  5AFP A;  1CFC A;  1XVJ A;  1AJ5 A;  5CSF A;  1K93 D;  2BL0 B;  4OR9 B;  2CCM A;  2KFH A;  4GGF A;  1K90 D;  4A4C A;  3TUY C;  1UUS A;  2K0J A;  2OTG B;  4AQI A;  3BUM B;  4CID A;  4PE7 A;  4QJ4 B;  2TN4 A;  1S5G Y;  3ICB A;  4NDB A;  1GGZ A;  1M63 B;  2M49 B;  2KYF A;  1JF0 A;  3BOW B;  1BR4 B;  1BT6 A;  1GQM A;  3WHT B;  2NZ0 A;  4GPL B;  4MEW A;  1OMD A;  2HET A;  1CB1 A;  2LVI A;  2KFG A;  5CSI A;  2MLF C;  1MWN A;  1CTR A;  3AAK A;  3CZT X;  2F33 A;  1QLS A;  5TNC A;  1YVL A;  2WCB A;  2MHH A;  3O4Y A;  4PE1 A;  2KNE A;  1J7Q A;  1SL7 A;  1YRT B;  1CDM A;  1OSA A;  1EL4 A;  1MXL C;  2CTN A;  1RFJ A;  2KBI A;  1K9U A;  3RLZ A;  3TS5 C;  1XFU O;  2I7A A;  4PHM A;  1B8R A;  4GAO A;  4MSP A;  1J7R A;  2LCP A;  3AKA A;  1UHH A;  5D7F A;  1KFU S;  4YI9 A;  4F0Z B;  3I5F C;  4CFQ A;  1NYA A;  3C1V A;  4PHJ A;  4Q04 A;  1K9P A;  2VRG A;  3NSI A;  1CMG A;  1KQV A;  1B9A A;  1DJH A;  3O2P A;  1F8H A;  1B8C A;  1QX5 B;  2AMI A;  3KF9 A;  3BUX B;  1RJV A;  3SG2 A;  1M45 A;  1WRZ A;  2K8M B;  2CBL A;  1BLQ A;  4HRH A;  2K7C A;  4PHN A;  3VRP A;  4YGB B;  1TNQ A;  1OZO A;  2NXQ A;  1TOP A;  3I5I B;  1J7O A;  1QTX A;  1QLK A;  2QPT A;  2M29 A;  1AHR A;  2HQ8 A;  1SR6 B;  1YUR A;  1S6C A;  2JRF A;  3HCM A;  4FTG A;  1CKK A;  1JFJ A;  4BY5 A;  1XFY O;  3PAT A;  4MZJ A;  3BYA A;  2A4J A;  4JQ0 D;  2KBM A;  5AXI A;  3DF0 B;  3CLN A;  1S1E A;  2O60 A;  1CMF A;  1RK9 A;  3GOF A;  1SBJ A;  2M7L A;  5HYD A;  2MLE C;  2LNK A;  1S5G Z;  3DVE A;  4GUK A;  2HF5 A;  1S3P A;  2KDH A;  5F6T A;  4ZCU A;  2P6B B;  1A29 A;  1PSB A;  4C0J A;  1KFX S;  4ORA B;  1OQP A;  1N2D A;  3EK7 A;  1FI6 A;  3KEV A;  2MAZ A;  1SYM A;  2Y5I A;  1PSR A;  2JNX A;  1IJ6 A;  4OKH A;  4FQO A;  2LE9 B;  1JBA A;  5KSZ A;  1JF2 A;  4GBA A;  5IBW A;  2GGZ A;  1YX7 A;  4I5J A;  5J3X A;  2AAO A;  3BUN B;  1WDC B;  3PAL A;  3FWC A;  1YRU B;  2ZN8 A;  5B8I B;  2ZRS A;  4I5K A;  2KAX A;  1EG4 A;  1TTX A;  2NCO A;  1TNP A;  1TCO B;  1H8B A;  1NX3 A;  3IQO A;  2Y1M A;  2JNF A;  1S36 A;  3SG6 A;  1UHN A;  2PAL A;  3A4U B;  5JJG A;  2BCX A;  2KGB C;  4DCK A;  3I5H C;  2M97 A;  1B47 A;  1XYD A;  4MRY A;  1TNW A;  2ISD A;  1KSM A;  4JPZ B;  1NX1 A;  1B7T Y;  1XK4 C;  3LK1 A;  5JOL A;  1JWD A;  5K89 A;  2SCP A;  1AUI B;  4AOM A;  1IWQ A;  4I5N B;  1B8L A;  1QX2 A;  2FJU B;  3NSK A;  3PM8 A;  4YGD B;  3DD4 A;  3WXA A;  1C7V A;  1NCX A;  4MRX A;  4GGN A;  1DGU A;  3PSR A;  1DTL A;  2BE6 A;  2SAS A;  2KYC A;  5CPV A;  5AEQ A;  1IGV A;  4YGC B;  1NCZ A;  1UP5 A;  1DJZ A;  4M2P A;  3JTD B;  3I5G C;  4U8D A;  1BG1 A;  2M0R A;  2KFF A;  2F8P A;  1AP4 A;  3VRN A;  2JQ6 A;  1DJG A;  3PFV A;  3TUY B;  1LKJ A;  4WQ3 A;  2L50 A;  3GK4 X;  1GJY A;  1MR8 A;  1QVI Y;  3VRR A;  2LLS A;  1BOD A;  1YUS A;  2RGI A;  2MA2 A;  1REC A;  1NIW A;  1V1F A;  3BOW A;  2LMU A;  1M39 A;  2G9B A;  1IG5 A; 
#chains in the Genus database with same CATH topology
 3NSL A;  2L5X B;  3SS4 A;  1DVI A;  1GGW A;  1KCY A;  5CSN A;  1G4Y R;  4GNK B;  2JT8 A;  1RWY A;  2OS8 C;  3D74 A;  4OV2 A;  2AUC A;  2WCE A;  1SMG A;  3IQQ A;  1JFK A;  3NHI A;  2H61 C;  2LAN A;  3FWB A;  1CFF A;  1NCY A;  4M2Q A;  1OOJ A;  2LMV A;  2BEC A;  2PRU A;  3EKH A;  3CR2 A;  4PDZ A;  5D69 A;  1DC1 A;  5D3O A;  1SRA A;  3IF7 A;  3NXA A;  1DJX A;  1OMV A;  3TS5 B;  1NSH A;  2G2B A;  3CZ1 A;  2ZRT A;  4F7F A;  2K2A A;  1YTZ C;  1IQ3 A;  4USL A;  1EXR A;  1J7P A;  2H8V A;  2LV7 A;  1SY9 A;  1X02 A;  1ZOT B;  2DOQ A;  2PSR A;  2R2I A;  4GGF C;  3BQ3 A;  4L9M A;  1B7T Z;  3VGO A;  2FOT A;  2COL B;  1MHO A;  3PN7 C;  3V2L A;  1SW8 A;  2EC6 B;  1SCM C;  3D0Y B;  3SG4 A;  3PJI A;  1E8A A;  4MVF A;  3EVV A;  2PMY A;  5HKY A;  1W7J B;  1J1D A;  1PVA A;  3OB1 B;  2KQY A;  1EG3 A;  2JXC A;  3E3R A;  4INX A;  3S0A A;  1PAL A;  1KWO B;  1Y1U A;  4NQG A;  3TZ1 A;  1A4P A;  1NX0 A;  1UUR A;  2H2K A;  4N1G A;  1BMO A;  1TRF A;  4D1E A;  1RTP 1;  4I5L B;  2KPH A;  4NDD A;  1QAS A;  2JWW A;  4GFT A;  4ORC B;  4PCW A;  5DIC A;  1F4O A;  4XYN A;  4XJK A;  2LMT A;  5DKN A;  1QIW A;  1B1G A;  3DF0 A;  4ORB B;  3EVR A;  2LHI A;  3FS7 A;  1ZUZ A;  1WLZ A;  3R1P A;  1QVI Z;  2M9G A;  2B1U A;  4XJK B;  1OOI X;  2JOJ A;  2WND A;  1YVH A;  3TDZ A;  5CSJ A;  1BJF A;  1C3Z A;  1CFD A;  1LIN A;  3BJH A;  3DZT A;  2ZFD A;  1T14 A;  2OPO A;  2JPT A;  1L2O B;  4MZK A;  3L47 A;  1FBV A;  1G8I A;  1QWV A;  3H4S E;  1ZFS A;  1A03 A;  1BR1 B;  4MLW A;  2WCF A;  5I2O A;  3I5I C;  1YUT A;  1YX8 A;  1EH2 A;  1KQM C;  1M46 A;  1QS7 A;  4P2Y B;  2BKH B;  1BOC A;  1CDP A;  3CS1 A;  1JUO A;  3EK8 A;  2K7B A;  1YR5 A;  4C0L A;  1N65 A;  2NCP A;  3KPX A;  3OX6 A;  4YBH B;  2WCH A;  1S6I A;  3WNX B;  3UO9 A;  4ETO A;  1CLB A;  3RM1 A;  3EKJ A;  1A75 A;  2JT0 A;  2WC6 A;  3S0G A;  3AAJ A;  1WRL A;  3CZ2 A;  1OOG A;  1Z4H A;  1Q80 A;  1QIV A;  2I18 A;  1MXE A;  1ZMZ A;  1IJ5 A;  2LVK A;  5I8N A;  1H4B A;  3NSO A;  1TN4 A;  1A75 B;  2CT9 A;  3A8R A;  3MSE B;  1DF0 B;  5DKQ A;  2WOR A;  3OHM B;  2KI4 B;  1LS8 A;  1TUJ A;  2EHB A;  1NUB A;  3SS3 A;  2Y1N A;  3DVJ A;  4N5X A;  1Y1A A;  2ZND A;  1CDN A;  3RZS A;  2WCJ A;  3OX5 A;  1J1E A;  1CLL A;  1K9K A;  1DJY A;  2L4H A;  2PVB A;  2L4I A;  2LVV A;  2HPS A;  1KK8 C;  2KAV A;  3QRX A;  1SSE B;  3B6X A;  4KYN A;  4E68 A;  3KHE A;  1XA5 A;  3EVU A;  2IS9 A;  1HQV A;  3K1E A;  3S0F A;  1V1G A;  2LUC A;  1S6J A;  2GGM A;  4UPG A;  1OZS A;  1DMO A;  3BUW B;  2JT3 A;  1NWD A;  3CZ0 A;  1KK7 Y;  5FYX A;  4WQ2 A;  1TIZ A;  5KTY A;  1TCF A;  2M3W A;  3HX4 A;  3PM2 A;  1AJ4 A;  3WHU B;  4QJ3 B;  3D75 A;  4YRU A;  1U5I B;  2L2E A;  1LVC D;  1BU3 A;  3JVT C;  1IRJ A;  2OS8 B;  1IQ5 A;  2KI6 D;  1UWO A;  2WCL A;  4PHK A;  3IVT A;  1SL8 A;  1UHI A;  3F45 A;  1F70 A;  1CNP A;  2F2O A;  5I2L A;  2LLT A;  1R2U A;  2O5G A;  1OMR A;  5ER5 A;  1AVS A;  4OVN F;  2D8N A;  2KGR A;  1K96 A;  1UHJ A;  2F3Y A;  1LA0 A;  1SNL A;  4N1F A;  5AER A;  2BL0 C;  1KSO A;  1QJT A;  2LM5 A;  2LLU A;  4MZL A;  2FCE A;  2OTG C;  2MJW B;  4CFR A;  2MBX A;  3EK4 A;  1XFW O;  2BKI B;  2L51 A;  2QDI A;  3B88 A;  3I5F B;  3D0Y A;  3R1O A;  4HRE E;  1NX2 A;  2K7O A;  3O6B A;  4M2O A;  4WRI A;  1MF8 B;  3PN7 B;  3SG3 A;  1K8U A;  1PUL A;  1SCM B;  2ZKM X;  2JC2 A;  4A4B A;  1JC2 A;  4YGE B;  1ALV A;  3CGA A;  2CXJ A;  1DJI A;  2FJY A;  1Y1X A;  4AQJ A;  5DKR A;  1NPQ A;  1ZAC A;  4DRW A;  3VRQ A;  3VB1 A;  2Q91 A;  1K95 A;  1WLM A;  2ERB A;  1B4C A;  2I2R E;  2LVJ A;  2Y4Q A;  2F3Z A;  2JU0 A;  1KFU L;  3M0W A;  4PAL A;  1W7I B;  3VRO A;  3FIA A;  1TWO A;  3LCP C;  3OP0 A;  1FI5 A;  1MQ1 A;  1WY9 A;  5HLV A;  1CFP A;  5I2Q A;  1F54 A;  1KK7 Z;  1LXF C;  2KI6 C;  2JTT A;  1VRK A;  3BXK A;  3S0B A;  5HKW A;  3PLF B;  5EL2 A;  2M1K B;  5HL1 A;  2BBM A;  3TDU A;  1HT9 A;  1CM1 A;  1F4Q A;  1DEL A;  2BBN A;  2FCD A;  2E6W A;  1QV0 A;  3R1V A;  1C7W A;  4JWQ A;  2JZI A;  1ORG A;  3AKB A;  1L7Z A;  1QXP A;  2BE4 A;  2EC6 C;  1ALW A;  3DVM A;  4PE0 A;  2F2P A;  3B7A A;  2M8U A;  1R6P A;  4YI8 A;  4CLN A;  2KAY A;  1KWO C;  2GV5 A;  3CTN A;  2M7N A;  2ZN9 A;  3O78 A;  4IL1 A;  2ZNE A;  1OE9 B;  3D78 A;  3L4L A;  1XO5 A;  1KQM B;  2KOT A;  1G33 A;  1SKT A;  1FPW A;  5FI6 A;  1EJ3 A;  3BUO B;  2K7D A;  2NLN A;  3CR4 X;  1DGV A;  3FE6 A;  5ER4 X;  5HLO A;  1DQE A;  3GK1 A;  1SR6 C;  1Z2C B;  3TDI A;  1OOF A;  1UHK A;  1PVB A;  1F55 A;  1M31 A;  1AK8 A;  4PT1 A;  3LL8 B;  3CR5 X;  1MUX A;  2L98 A;  2JUL A;  3BFH A;  4IJ7 A;  2EGD A;  2PYQ A;  1DT7 B;  2L2C A;  2K2F A;  4TNC A;  5I94 A;  3NGV A;  1KFX L;  1XFR A;  1IKU A;  2LAP A;  3GK2 A;  4P5O E;  1TUZ A;  4ZCV A;  1DF0 A;  3UNW A;  1K2H A;  3SJS A;  2HQW A;  1L2O C;  1DJW A;  2YGU A;  2BCB A;  2LHL A;  1D1O A;  1DEK A;  1Y6W A;  2LP3 A;  2WCK A;  5KU1 A;  1XK4 A;  2WC8 A;  2Q4U A;  3DVK A;  3CWG A;  4DS7 A;  3I5H B;  3OBV A;  2JTZ A;  2L0P A;  1C07 A;  1A2X A;  4MBE A;  3Q8I A;  2MRD A;  2GTE A;  3LK0 A;  4NDC A;  4OCI A;  3KO0 A;  3OB2 B;  1WRK A;  3CAB A;  1NP8 A;  1SK6 D;  4HSZ A;  1FF1 A;  2LC5 A;  4PE4 A;  1KK8 B;  1XFX O;  2PQL A;  1K94 A;  2WC5 A;  1WDC C;  3OGN A;  4MN0 A;  1XFV O;  1PRW A;  1TNX A;  1CLM A;  3SIB A;  4C0K A;  3D10 A;  1LA3 A;  4JD9 A;  1YUU A;  1F71 A;  1J55 A;  3I5G B;  2QEB A;  4BY4 A;  3SG5 A;  4YGA A;  1SL9 A;  2P71 A;  1XFZ O;  2PAS A;  4QJ5 B;  4ICB A;  1C3Y A;  2I94 A;  1QAT A;  1QV1 A;  2KI4 C;  3SG7 A;  1RRO A;  1U5I A;  2BCA A;  2KSP A;  1CM4 A;  3ZWH A;  4DIR A;  2CNP A;  2K61 A;  3BFA A;  1PK0 D;  5G08 A;  3K21 A;  1Y0V H;  3O4X A;  1CDL A;  3JVT B;  4HRG A;  1S26 D;  1JSA A;  3L4A A;  1QX7 A;  5PAL A;  1BF5 A;  2M1U A;  2LP2 A;  5HKZ A;  2H61 A;  5BPJ A;  1IH0 A;  1ODB A;  3S0E A;  1OOH A;  1FW4 A;  3LLE A;  2KQ6 A;  4R1E A;  5GQQ C;  2JXL A;  2LUX A;  4OZD A;  3WXA A;  1N0Y A;  3SIA A;  4DUQ A;  1SPY A;  3ZNI A;  2V53 A;  2E30 A;  5AAN A;  2QAC A;  4CPV A;  3JTD C;  2KHN A;  2WOS A;  1SCV A;  5AFP A;  1CFC A;  1XVJ A;  1AJ5 A;  5CSF A;  1K93 D;  1OW4 A;  2BL0 B;  2K60 A;  2CCM A;  4FQT A;  4OR9 B;  3SS5 A;  2KFH A;  3D73 A;  4GGF A;  1K90 D;  4A4C A;  3TUY C;  1UUS A;  2K0J A;  2OTG B;  4AQI A;  3CDN A;  3BUM B;  4CID A;  4PE7 A;  3EG5 B;  4QJ4 B;  2TN4 A;  1S5G Y;  3ICB A;  4NDB A;  1GGZ A;  1M63 B;  2M49 B;  3DY9 A;  2KYF A;  1JF0 A;  3BOW B;  1BR4 B;  1BT6 A;  1GQM A;  3WHT B;  2NZ0 A;  3BFB A;  4GPL B;  4MEW A;  1OMD A;  2HET A;  2BNX A;  2LVI A;  2KFG A;  1CB1 A;  5CSI A;  2MLF C;  1MWN A;  1CTR A;  3AAK A;  3CZT X;  2F33 A;  1QLS A;  2JPO A;  5FI7 A;  5TNC A;  1YVL A;  2WCB A;  2MHH A;  3O4Y A;  4PE1 A;  2KNE A;  1J7Q A;  1SL7 A;  1YRT B;  1CDM A;  1OSA A;  1EL4 A;  1MXL C;  2CTN A;  1RFJ A;  2KBI A;  1K9U A;  3RLZ A;  3TS5 C;  1XFU O;  2I7A A;  4PHM A;  1B8R A;  4GAO A;  4MSP A;  1J7R A;  2LCP A;  3AKA A;  1UHH A;  5D7F A;  1KFU S;  4YI9 A;  4F0Z B;  3I5F C;  4CFQ A;  1NYA A;  3C1V A;  3QME A;  4PHJ A;  4Q04 A;  3S0D A;  1K9P A;  2VRG A;  3NSI A;  3R72 A;  1CMG A;  1KQV A;  1B9A A;  1DJH A;  3O2P A;  3B86 A;  1F8H A;  1B8C A;  1QX5 B;  2AMI A;  3KF9 A;  3BUX B;  1RJV A;  3SG2 A;  1M45 A;  1WRZ A;  2K8M B;  2CBL A;  1BLQ A;  4HRH A;  2K7C A;  4PHN A;  3VRP A;  4YGB B;  1TNQ A;  1OZO A;  2NXQ A;  1TOP A;  3I5I B;  1J7O A;  1QTX A;  1QLK A;  2QPT A;  2M29 A;  1AHR A;  2HQ8 A;  1SR6 B;  1YUR A;  1S6C A;  4INW A;  2JRF A;  3HCM A;  4FTG A;  1CKK A;  1JFJ A;  4BY5 A;  2BAP A;  1XFY O;  3FE8 A;  3PAT A;  4MZJ A;  3BYA A;  2A4J A;  4JQ0 D;  2KBM A;  5AXI A;  3DF0 B;  3CLN A;  1S1E A;  2O60 A;  1CMF A;  1RK9 A;  3GOF A;  1SBJ A;  2P70 A;  2M7L A;  5HYD A;  2MLE C;  2LNK A;  1S5G Z;  3DVE A;  2QEO A;  4GUK A;  2HF5 A;  1S3P A;  3DYE A;  2KDH A;  5F6T A;  4ZCU A;  2P6B B;  1A29 A;  2WCM A;  1PSB A;  4C0J A;  1KFX S;  4ORA B;  1OQP A;  1N2D A;  3EK7 A;  3D76 A;  1FI6 A;  3KEV A;  2MAZ A;  1SYM A;  2Y5I A;  1PSR A;  2JNX A;  1IJ6 A;  4OKH A;  5FI2 A;  1GM0 A;  4FQO A;  2LE9 B;  1JBA A;  5KSZ A;  2KLE A;  1JF2 A;  4GBA A;  5IBW A;  2GGZ A;  1YX7 A;  4I5J A;  5J3X A;  2AAO A;  1IIO A;  3BUN B;  1WDC B;  3PAL A;  3FWC A;  1YRU B;  2ZN8 A;  5B8I B;  2ZRS A;  4JKT A;  4I5K A;  2KAX A;  1EG4 A;  2QEV A;  1TTX A;  3FE9 A;  2NCO A;  1TNP A;  1TCO B;  1H8B A;  1NX3 A;  3IQO A;  2Y1M A;  2JNF A;  1S36 A;  3SG6 A;  1UHN A;  2PAL A;  2KLD A;  1P28 A;  3A4U B;  5JJG A;  2BCX A;  2KGB C;  4DCK A;  3N7H A;  3I5H C;  2M97 A;  1B47 A;  1XYD A;  4MRY A;  1TNW A;  2ISD A;  3CYZ A;  2L5Y A;  1KSM A;  3D77 A;  4JPZ B;  1NX1 A;  1B7T Y;  1XK4 C;  3LK1 A;  5JOL A;  1JWD A;  5K89 A;  2SCP A;  1AUI B;  4AOM A;  1IWQ A;  2QEH A;  1B8L A;  1QX2 A;  2FJU B;  3DXL A;  3NSK A;  3PM8 A;  3DD4 A;  4I5N B;  4YGD B;  1C7V A;  1W9Z A;  3B87 A;  1NCX A;  4MRX A;  4GGN A;  1DGU A;  3PSR A;  1DTL A;  2BE6 A;  2SAS A;  2KYC A;  5CPV A;  5AEQ A;  1IGV A;  4YGC B;  1NCZ A;  1UP5 A;  1DJZ A;  4M2P A;  3JTD B;  3I5G C;  4U8D A;  1BG1 A;  2M0R A;  2KFF A;  2F8P A;  1AP4 A;  3VRN A;  3NHT A;  2JQ6 A;  1DJG A;  3PFV A;  3TUY B;  1LKJ A;  4WQ3 A;  2L50 A;  3GK4 X;  1GJY A;  1MR8 A;  1QVI Y;  3VRR A;  2LLS A;  1BOD A;  1YUS A;  2RGI A;  2MA2 A;  1REC A;  1NIW A;  1V1F A;  3BOW A;  2LMU A;  1M39 A;  2G9B A;  1IG5 A; 
#chains in the Genus database with same CATH homology
 3NSL A;  2L5X B;  1DVI A;  1GGW A;  1KCY A;  5CSN A;  1G4Y R;  4GNK B;  2JT8 A;  1RWY A;  2OS8 C;  4OV2 A;  2AUC A;  2WCE A;  1SMG A;  3IQQ A;  1JFK A;  2H61 C;  2LAN A;  3FWB A;  1CFF A;  1NCY A;  4M2Q A;  1OOJ A;  2LMV A;  2BEC A;  2PRU A;  3EKH A;  3CR2 A;  4PDZ A;  5D69 A;  1SRA A;  3IF7 A;  3NXA A;  1DJX A;  1OMV A;  3TS5 B;  1NSH A;  2G2B A;  2ZRT A;  2K2A A;  1YTZ C;  1IQ3 A;  4USL A;  1EXR A;  1J7P A;  2LV7 A;  1SY9 A;  1X02 A;  1ZOT B;  2DOQ A;  2PSR A;  2R2I A;  4GGF C;  3BQ3 A;  4L9M A;  1B7T Z;  3VGO A;  2FOT A;  2COL B;  1MHO A;  3PN7 C;  1SW8 A;  2EC6 B;  1SCM C;  3D0Y B;  3SG4 A;  1E8A A;  4MVF A;  3EVV A;  2PMY A;  5HKY A;  1W7J B;  1J1D A;  1PVA A;  3OB1 B;  2KQY A;  1EG3 A;  2JXC A;  3E3R A;  1PAL A;  1KWO B;  1Y1U A;  4NQG A;  3TZ1 A;  1A4P A;  1NX0 A;  1UUR A;  2H2K A;  4N1G A;  1BMO A;  1TRF A;  4D1E A;  1RTP 1;  4I5L B;  4NDD A;  1QAS A;  2JWW A;  4GFT A;  4ORC B;  4PCW A;  1F4O A;  4XYN A;  4XJK A;  2LMT A;  5DKN A;  1QIW A;  1B1G A;  3DF0 A;  4ORB B;  3EVR A;  2LHI A;  3FS7 A;  1ZUZ A;  1WLZ A;  1QVI Z;  2M9G A;  2B1U A;  4XJK B;  2JOJ A;  2WND A;  1YVH A;  3TDZ A;  5CSJ A;  1BJF A;  1CFD A;  1LIN A;  2ZFD A;  2OPO A;  2JPT A;  1L2O B;  4MZK A;  1FBV A;  1G8I A;  3H4S E;  1A03 A;  1ZFS A;  1BR1 B;  4MLW A;  2WCF A;  5I2O A;  3I5I C;  1YUT A;  1YX8 A;  1EH2 A;  1KQM C;  1M46 A;  1QS7 A;  4P2Y B;  2BKH B;  1BOC A;  1CDP A;  3CS1 A;  1JUO A;  3EK8 A;  2K7B A;  1YR5 A;  4C0L A;  1N65 A;  2NCP A;  3KPX A;  3OX6 A;  4YBH B;  1S6I A;  3WNX B;  4ETO A;  1CLB A;  3RM1 A;  3EKJ A;  1A75 A;  2JT0 A;  3AAJ A;  1WRL A;  1Q80 A;  1QIV A;  2I18 A;  1MXE A;  1ZMZ A;  1IJ5 A;  2LVK A;  5I8N A;  1H4B A;  3NSO A;  1TN4 A;  1A75 B;  2CT9 A;  3A8R A;  3MSE B;  1DF0 B;  5DKQ A;  2WOR A;  3OHM B;  2KI4 B;  2EHB A;  1NUB A;  2Y1N A;  3DVJ A;  4N5X A;  1Y1A A;  2ZND A;  1CDN A;  3OX5 A;  1J1E A;  1CLL A;  1K9K A;  1DJY A;  2L4H A;  2PVB A;  2L4I A;  2LVV A;  2HPS A;  1KK8 C;  2KAV A;  3QRX A;  4E68 A;  3KHE A;  1XA5 A;  3EVU A;  2IS9 A;  1HQV A;  1V1G A;  2LUC A;  1S6J A;  2GGM A;  4UPG A;  1OZS A;  1DMO A;  3BUW B;  2JT3 A;  1NWD A;  1KK7 Y;  5FYX A;  4WQ2 A;  1TIZ A;  5KTY A;  1TCF A;  2M3W A;  3HX4 A;  1AJ4 A;  3WHU B;  4QJ3 B;  4YRU A;  1U5I B;  2L2E A;  1LVC D;  1BU3 A;  3JVT C;  1IRJ A;  2OS8 B;  1IQ5 A;  2KI6 D;  1UWO A;  4PHK A;  1SL8 A;  1UHI A;  3F45 A;  1F70 A;  1CNP A;  2F2O A;  5I2L A;  2LLT A;  1R2U A;  2O5G A;  1OMR A;  5ER5 A;  1AVS A;  4OVN F;  2D8N A;  2KGR A;  1K96 A;  1UHJ A;  2F3Y A;  1LA0 A;  1SNL A;  4N1F A;  5AER A;  2BL0 C;  1KSO A;  1QJT A;  2LM5 A;  2LLU A;  4MZL A;  2FCE A;  2OTG C;  2MJW B;  4CFR A;  2MBX A;  3EK4 A;  1XFW O;  2BKI B;  2L51 A;  3I5F B;  4HRE E;  3D0Y A;  1NX2 A;  2K7O A;  3O6B A;  4M2O A;  4WRI A;  1MF8 B;  3PN7 B;  3SG3 A;  1K8U A;  1PUL A;  1SCM B;  2ZKM X;  2JC2 A;  4A4B A;  1JC2 A;  4YGE B;  1ALV A;  3CGA A;  2CXJ A;  1DJI A;  1Y1X A;  4AQJ A;  5DKR A;  1NPQ A;  1ZAC A;  4DRW A;  3VRQ A;  2Q91 A;  1K95 A;  1WLM A;  1B4C A;  2I2R E;  2LVJ A;  2Y4Q A;  2F3Z A;  2JU0 A;  1KFU L;  3M0W A;  4PAL A;  1W7I B;  3VRO A;  3FIA A;  3LCP C;  3OP0 A;  1FI5 A;  1MQ1 A;  1WY9 A;  5HLV A;  1CFP A;  5I2Q A;  1F54 A;  1KK7 Z;  1LXF C;  2KI6 C;  2JTT A;  1VRK A;  3BXK A;  5HKW A;  3PLF B;  2M1K B;  2BBM A;  3TDU A;  1HT9 A;  1CM1 A;  1F4Q A;  2BBN A;  2FCD A;  2E6W A;  1QV0 A;  4JWQ A;  1C7W A;  2JZI A;  3AKB A;  1L7Z A;  1QXP A;  2BE4 A;  2EC6 C;  1ALW A;  3DVM A;  4PE0 A;  2F2P A;  2M8U A;  1R6P A;  4YI8 A;  4CLN A;  2KAY A;  1KWO C;  2GV5 A;  3CTN A;  2M7N A;  2ZN9 A;  3O78 A;  4IL1 A;  2ZNE A;  1OE9 B;  1XO5 A;  1KQM B;  2KOT A;  1G33 A;  1SKT A;  1FPW A;  1EJ3 A;  3BUO B;  2K7D A;  2NLN A;  3CR4 X;  1DGV A;  5ER4 X;  5HLO A;  3GK1 A;  1SR6 C;  3TDI A;  1F55 A;  1UHK A;  1PVB A;  1M31 A;  1AK8 A;  3LL8 B;  3CR5 X;  1MUX A;  2L98 A;  2JUL A;  1DT7 B;  2EGD A;  2K2F A;  4TNC A;  1KFX L;  1IKU A;  2LAP A;  3GK2 A;  4P5O E;  4ZCV A;  1DF0 A;  1K2H A;  3SJS A;  2HQW A;  1L2O C;  1DJW A;  2BCB A;  2LHL A;  1D1O A;  1Y6W A;  2LP3 A;  5KU1 A;  1XK4 A;  2WC8 A;  2Q4U A;  3DVK A;  3CWG A;  4DS7 A;  3I5H B;  2JTZ A;  2L0P A;  1C07 A;  1A2X A;  4MBE A;  2MRD A;  3LK0 A;  4NDC A;  4OCI A;  3KO0 A;  3OB2 B;  1WRK A;  4HSZ A;  1NP8 A;  1SK6 D;  1FF1 A;  2LC5 A;  4PE4 A;  1KK8 B;  1XFX O;  1K94 A;  4MN0 A;  1WDC C;  1XFV O;  1PRW A;  1TNX A;  1CLM A;  3SIB A;  4C0K A;  3D10 A;  1LA3 A;  1YUU A;  1F71 A;  1J55 A;  3I5G B;  4BY4 A;  3SG5 A;  4YGA A;  1SL9 A;  1XFZ O;  2PAS A;  4QJ5 B;  4ICB A;  2I94 A;  1QAT A;  1QV1 A;  2KI4 C;  3SG7 A;  1RRO A;  1U5I A;  2BCA A;  2KSP A;  1CM4 A;  3ZWH A;  4DIR A;  2CNP A;  2K61 A;  1PK0 D;  5G08 A;  3K21 A;  1Y0V H;  1CDL A;  3JVT B;  4HRG A;  1S26 D;  1JSA A;  1QX7 A;  5PAL A;  1BF5 A;  2M1U A;  2LP2 A;  5HKZ A;  2H61 A;  5BPJ A;  1IH0 A;  1ODB A;  1FW4 A;  3LLE A;  2KQ6 A;  4R1E A;  5GQQ C;  2JXL A;  2LUX A;  1N0Y A;  3SIA A;  4DUQ A;  1SPY A;  3ZNI A;  2V53 A;  2E30 A;  5AAN A;  2QAC A;  4CPV A;  3JTD C;  2KHN A;  2WOS A;  1SCV A;  5AFP A;  1CFC A;  1XVJ A;  1AJ5 A;  5CSF A;  1K93 D;  2BL0 B;  4OR9 B;  2CCM A;  2KFH A;  4GGF A;  1K90 D;  4A4C A;  3TUY C;  1UUS A;  2K0J A;  2OTG B;  4AQI A;  3BUM B;  4CID A;  4PE7 A;  4QJ4 B;  2TN4 A;  1S5G Y;  3ICB A;  4NDB A;  1GGZ A;  1M63 B;  2M49 B;  2KYF A;  1JF0 A;  3BOW B;  1BR4 B;  1BT6 A;  1GQM A;  3WHT B;  2NZ0 A;  4GPL B;  4MEW A;  1OMD A;  2HET A;  1CB1 A;  2LVI A;  2KFG A;  5CSI A;  2MLF C;  1MWN A;  1CTR A;  3AAK A;  3CZT X;  2F33 A;  1QLS A;  5TNC A;  1YVL A;  2WCB A;  2MHH A;  3O4Y A;  4PE1 A;  2KNE A;  1J7Q A;  1SL7 A;  1YRT B;  1CDM A;  1OSA A;  1EL4 A;  1MXL C;  2CTN A;  1RFJ A;  2KBI A;  1K9U A;  3RLZ A;  3TS5 C;  1XFU O;  2I7A A;  4PHM A;  1B8R A;  4GAO A;  4MSP A;  1J7R A;  2LCP A;  3AKA A;  1UHH A;  5D7F A;  1KFU S;  4YI9 A;  4F0Z B;  3I5F C;  4CFQ A;  1NYA A;  3C1V A;  4PHJ A;  4Q04 A;  1K9P A;  2VRG A;  3NSI A;  1CMG A;  1KQV A;  1B9A A;  1DJH A;  3O2P A;  1F8H A;  1B8C A;  1QX5 B;  2AMI A;  3KF9 A;  3BUX B;  1RJV A;  3SG2 A;  1M45 A;  1WRZ A;  2K8M B;  2CBL A;  1BLQ A;  4HRH A;  2K7C A;  4PHN A;  3VRP A;  4YGB B;  1TNQ A;  1OZO A;  2NXQ A;  1TOP A;  3I5I B;  1J7O A;  1QTX A;  1QLK A;  2QPT A;  2M29 A;  1AHR A;  2HQ8 A;  1SR6 B;  1YUR A;  1S6C A;  2JRF A;  3HCM A;  4FTG A;  1CKK A;  1JFJ A;  4BY5 A;  1XFY O;  3PAT A;  4MZJ A;  3BYA A;  2A4J A;  4JQ0 D;  2KBM A;  5AXI A;  3DF0 B;  3CLN A;  1S1E A;  2O60 A;  1CMF A;  1RK9 A;  3GOF A;  1SBJ A;  2M7L A;  5HYD A;  2MLE C;  2LNK A;  1S5G Z;  3DVE A;  4GUK A;  2HF5 A;  1S3P A;  2KDH A;  5F6T A;  4ZCU A;  2P6B B;  1A29 A;  1PSB A;  4C0J A;  1KFX S;  4ORA B;  1OQP A;  1N2D A;  3EK7 A;  1FI6 A;  3KEV A;  2MAZ A;  1SYM A;  2Y5I A;  1PSR A;  2JNX A;  1IJ6 A;  4OKH A;  4FQO A;  2LE9 B;  1JBA A;  5KSZ A;  1JF2 A;  4GBA A;  5IBW A;  2GGZ A;  1YX7 A;  4I5J A;  5J3X A;  2AAO A;  3BUN B;  1WDC B;  3PAL A;  3FWC A;  1YRU B;  2ZN8 A;  5B8I B;  2ZRS A;  4I5K A;  2KAX A;  1EG4 A;  1TTX A;  2NCO A;  1TNP A;  1TCO B;  1H8B A;  1NX3 A;  3IQO A;  2Y1M A;  2JNF A;  1S36 A;  3SG6 A;  1UHN A;  2PAL A;  3A4U B;  5JJG A;  2BCX A;  2KGB C;  4DCK A;  3I5H C;  2M97 A;  1B47 A;  1XYD A;  4MRY A;  1TNW A;  2ISD A;  1KSM A;  4JPZ B;  1NX1 A;  1B7T Y;  1XK4 C;  3LK1 A;  5JOL A;  1JWD A;  5K89 A;  2SCP A;  1AUI B;  4AOM A;  1IWQ A;  4I5N B;  1B8L A;  1QX2 A;  2FJU B;  3NSK A;  3PM8 A;  4YGD B;  3DD4 A;  3WXA A;  1C7V A;  1NCX A;  4MRX A;  4GGN A;  1DGU A;  3PSR A;  1DTL A;  2BE6 A;  2SAS A;  2KYC A;  5CPV A;  5AEQ A;  1IGV A;  4YGC B;  1NCZ A;  1UP5 A;  1DJZ A;  4M2P A;  3JTD B;  3I5G C;  4U8D A;  1BG1 A;  2M0R A;  2KFF A;  2F8P A;  1AP4 A;  3VRN A;  2JQ6 A;  1DJG A;  3PFV A;  3TUY B;  1LKJ A;  4WQ3 A;  2L50 A;  3GK4 X;  1GJY A;  1MR8 A;  1QVI Y;  3VRR A;  2LLS A;  1BOD A;  1YUS A;  2RGI A;  2MA2 A;  1REC A;  1NIW A;  1V1F A;  3BOW A;  2LMU A;  1M39 A;  2G9B A;  1IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...