2KI4C

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
97
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Heparin-binding growth factor 1
total genus 26
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4C00
2KSPA 1IH0A 1NCZA 1UUSA 1CNPA 4P5OE 3CZTX 2WOSA 2KFHA 1CDMA 1A29A 1QX7A 2H61A 1MXLC 3O4YA 1TCFA 1N2DA 1UWOA 5F6TA 2CBLA 2M1KB 1CDPA 2F8PA 3BOWB 1WDCB 3CGAA 1XFZO 2BL0C 4WQ3A 3IF7A 2Q4UA 5FYXA 4MBEA 1C7WA 4F0ZB 4C0LA 1DVIA 3OB1B 1DJGA 5DKNA 2KQYA 1J55A 2CCMA 4MN0A 4XJKA 2Y4QA 2K2AA 1CMFA 3AAKA 1SMGA 1TN4A 1YRTB 3I5FC 1BT6A 3O6BA 1KQMB 2JC2A 5CSIA 4A4BA 3CR2A 5K89A 1SKTA 3CTNA 3BUOB 3KEVA 1S6JA 1PSBA 5HKYA 5KU1A 4DCKA 1NUBA 2K8MB 1B8RA 1OMVA 1MHOA 3TS5B 1FW4A 3VROA 2KBIA 3BXKA 2EGDA 5D7FA 5AFPA 2LLSA 2WCBA 3FWCA 1Y1XA 1BR1B 2KAXA 2GGMA 4MVFA 2OPOA 3E3RA 1K95A 1C07A 1S26D 1SR6C 1PALA 3BQ3A 1BODA 2KOTA 1QJTA 3JTDC 5B8IB 1YUSA 2CTNA 2Q91A 1DF0A 1A75A 1C7VA 1QLKA 1EH2A 3CR4X 1CDNA 1CKKA 2QACA 2ZNDA 3H4SE 2F2OA 4OR9B 2M97A 1SYMA 1GJYA 3MSEB 1DJXA 3NSLA 4YI9A 1K9UA 1IWQA 4PE4A 4YRUA 3WHUB 1SL9A 3WXAA 1TRFA 1TNPA 4ICBA 4M2PA 1IQ5A 3EK4A 1L2OB 2R2IA 1B8CA 4GNKB 1QX5B 1F55A 1WDCC 1MXEA 1XO5A 3BUWB 1NPQA 1WRLA 2K61A 2PSRA 2BBMA 3K21A 2Y1NA 2NCPA 3KHEA 1KK8C 1AJ5A 4AOMA 1CDLA 1GQMA 1KK7Z 2LHIA 2HETA 4MRXA 3WHTB 5JOLA 2H61C 4CIDA 1YTZC 1SCMC 1KCYA 4I5NB 2SCPA 2JT8A 4CFQA 5I2QA 1CM4A 3DD4A 1LKJA 1KK8B 2KGBC 4PCWA 2L4HA 1YRUB 1KQVA 4CLNA 5D69A 1CMGA 1XFUO 3CS1A 3ZNIA 1CLLA 1DGUA 3DF0A 3SG3A 1CFFA 2DOQA 2KAVA 1DGVA 2FCEA 4OV2A 3I5FB 2JXLA 2BCAA 1ODBA 2EHBA 4BY4A 3I5GC 1XA5A 1KSOA 4GAOA 4OCIA 1PRWA 2NLNA 4QJ3B 4YGAA 1FPWA 2AAOA 4A4CA 5TNCA 2M49B 1DTLA 4HREE 3A8RA 4D1EA 2PMYA 3KPXA 1YX7A 1FI5A 5PALA 2KHNA 1DJZA 2F2PA 2L50A 3I5IC 4IL1A 2FJUB 2FCDA 1OE9B 2JTZA 1W7IB 2WCEA 1J7RA 1QVIY 3JVTB 3LLEA 3SG2A 2I7AA 1TTXA 2KI4B 1B1GA 1D1OA 4GGFC 2M7LA 3SIAA 1XFVO 2BKIB 2E30A 1FF1A 1B7TZ 4PE1A 1ZUZA 3HX4A 1VRKA 4I5KA 3NXAA 1K96A 3JVTC 2K7BA 3OB2B 2VRGA 4PHJA 5AERA 1S5GY 5G08A 2NZ0A 1KWOB 1IQ3A 1BR4B 3PALA 1TNXA 3SG5A 4DRWA 1J1DA 1SL7A 1F54A 2MA2A 4FTGA 2PASA 2CXJA 1ZFSA 4PALA 1XFWO 1EG3A 3I5HC 3A4UB 1WRZA 2LHLA 2MRDA 2BCXA 1S6IA 2KNEA 1DJYA 3D0YA 1TNQA 2LVVA 3EKJA 2LCPA 2RGIA 2M3WA 1BG1A 2JPTA 1TOPA 4N5XA 1NX1A 1Q80A 2F3YA 1YVHA 3IQQA 1SK6D 1KFUS 4C0KA 1DMOA 1NIWA 1MUXA 1RJVA 1SBJA 4GBAA 1F70A 3PSRA 1JBAA 1OQPA 2LP3A 1KFXS 4E68A 1NX2A 2P6BB 1NSHA 1K90D 2JXCA 3RLZA 4AQIA 2JOJA 1LINA 1PSRA 3VRQA 1UHKA 2WNDA 1YUTA 2L98A 1IJ5A 3WNXB 1KWOC 4USLA 2F3ZA 1TNWA 2ZN9A 1WRKA 3QRXA 2KFGA 2JWWA 5IBWA 5GQQC 1PK0D 2JTTA 3CR5X 4PDZA 1GGWA 3KF9A 3SG4A 2MJWB 1LVCD 4GGNA 2ZN8A 4TNCA 1S6CA 5CSFA 3C1VA 1TCOB 2PVBA 1G8IA 5I8NA 1S36A 1SCMB 3OX6A 3M0WA 3VRRA 2FOTA 1DT7B 2ZNEA 1QIWA 1V1FA 2LMUA 4YBHB 3TS5C 4BY5A 1J7OA 2ZRSA 3TDUA 1QV1A 1M39A 1A03A 4CFRA 4MZKA 4MRYA 1J7QA 4PHMA 2Y1MA 2HQWA 1L2OC 3AAJA 1EJ3A 3NSKA 3DVEA 3ZWHA 1EXRA 1TIZA 1E8AA 1XYDA 2F33A 1EL4A 1G33A 1WLZA 4NQGA 3TUYB 1R2UA 2LMTA 2M29A 4WQ2A 3DF0B 3I5HB 1QIVA 4NDCA 2BBNA 4MEWA 1J7PA 2MAZA 2K7DA 4XJKB 1EG4A 3CWGA 4NDBA 1QVIZ 1BJFA 1AP4A 2BE4A 5I2LA 1OOJA 2O5GA 2JU0A 2Y5IA 2BCBA 2M8UA 1XK4C 1F71A 4OKHA 2L0PA 1QATA 1LXFC 1BMOA 1WY9A 5HKZA 4JPZB 2NXQA 3BOWA 3GK1A 1HT9A 2NCOA 2HQ8A 2HF5A 3PATA 1ALVA 3GK4X 1IG5A 1MR8A 2AUCA 2PALA 3NSIA 2LUXA 1CFDA 1KFXL 2OTGC 3VRPA 4C0JA 1A4PA 2LVKA 1UHIA 1CTRA 3DVJA 2HPSA 4ORCB 4YGBB 2MLFC 1AVSA 2BECA 4NDDA 1A75B 4ORAB 4GUKA 3BYAA 1CM1A 2KI6D 3D0YB 3VRNA 4PE0A 4MSPA 1KSMA 1OMRA 5DKQA 2MBXA 1MQ1A 1F8HA 1B47A 1CFCA 1YUUA 1XFXO 1DJWA 1OMDA 2L5XB 2CT9A 3I5GB 1Y1UA 1RROA 2MLEC 4GGFA 2AMIA 2I2RE 5AXIA 2JNXA 4PHKA 1JUOA 2LVJA 1ZMZA 1QS7A 1M63B 1K9PA 1K8UA 1UHHA 1JSAA 2TN4A 1HQVA 1PULA 2KGRA 1UHJA 2EC6B 2LMVA 2MHHA 1OZOA 2LNKA 3HCMA 4QJ5B 3PFVA 3KO0A 5HKWA 4M2QA 2E6WA 4FQOA 1UHNA 2M1UA 1IGVA 2O60A 3PM8A 1NYAA 4N1FA 1LA3A 1JF0A 1AHRA 3F45A 3GK2A 2LE9B 3GOFA 1QX2A 1SR6B 2KFFA 3EVUA 1Y6WA 2K7OA 3FS7A 3VGOA 1CFPA 1K9KA 1BF5A 1M45A 3LK1A 1B7TY 3SG6A 3TZ1A 1M46A 2GV5A 5HYDA 3EVRA 1QXPA 1B9AA 1K94A 4YGEB 3LCPC 1S1EA 1ALWA 1KK7Y 1SPYA 5JJGA 4HSZA 5BPJA 1RWYA 4HRGA 4DIRA 1A2XA 3FIAA 3ICBA 1OSAA 1RFJA 2BL0B 3BUNB 1V1GA 2G9BA 1ZOTB 1DJIA 1XFYO 1DJHA 4M2OA 1IJ6A 4I5LB 3IQOA 1BLQA 3JTDB 4MZJA 3AKAA 3O78A 1B8LA 2KYFA 3LL8B 3PLFB 3EK8A 3DVMA 1YR5A 3O2PA 1JFKA 1H8BA 2H2KA 1YVLA 1SY9A 1K93D 2ZRTA 5CPVA 1JWDA 4HRHA 4YGCB 3BUMB 2OTGB 2JULA 1QTXA 4Q04A 3I5IB 3SIBA 4N1GA 1NP8A 3RM1A 2LLTA 1M31A 5HLVA 1YX8A 1QV0A 2K2FA 2LUCA 1JFJA 1NCYA 2PRUA 1KQMC 2KDHA 1KFUL 2SASA 2LC5A 4PE7A 4UPGA 3EK7A 3AKBA 4DUQA 1OZSA 5I2OA 4ZCUA 1G4YR 3FWBA 1SL8A 1SRAA 5KSZA 4OVNF 1LA0A 4QJ4B 2LP2A 2LM5A 5CSNA 1SCVA 1CB1A 1QASA 4AQJA 1DF0B 1MWNA 2WORA 2V53A 2OS8C 2COLB 4CPVA 1F4QA 3PN7B 2BKHB 2WCFA 2B1UA 2JT3A 1QLSA 4GFTA 3LK0A 2LV7A 3SJSA 2CNPA 2BE6A 4R1EA 1S3PA 2IS9A 2M0RA 2KQ6A 2KI6C 3CLNA 1BOCA 1NX3A 2L4IA 2L2EA 5KTYA 1RECA 1NCXA 1FI6A 1W7JB 2K7CA 1N0YA 2LAPA 4JQ0D 1ZACA 4JWQA 2LLUA 4YI8A 2GGZA 4MLWA 1SW8A 3TDIA 2JQ6A 2I18A 2OS8B 3OP0A 4XYNA 1UP5A 2KBMA 1J1EA 1FBVA 1JC2A 1BU3A 2I94A 1R6PA 4I5JA 3TDZA 2JZIA 1B4CA 1MF8B 1CLMA 4U8DA 4ZCVA 1YURA 1H4BA 1JF2A 4MZLA 1IKUA 1AJ4A 1U5IB 2EC6C 2KI4C 3PN7C 2JRFA 1XK4A 1Y1AA 2LANA 5ER5A 2D8NA 3NSOA 1NWDA 1PVAA 5AEQA 2LVIA 1RTP1 1IRJA 4ETOA 4WRIA 1GGZA 2JNFA 1S5GZ 3OHMB 5J3XA 1PVBA 2G2BA 1AK8A 5DKRA 2WC8A 1Y0VH 2K0JA 2ZKMX 3DVKA 2ISDA 1UURA 2JT0A 1U5IA 3OX5A 2KYCA 4GPLB 4L9MA 4PHNA 5AANA 3EVVA 2A4JA 2ZFDA 4YGDB 1K2HA 3BUXB 4P2YB 4ORBB 5CSJA 1CLBA 1N65A 1RK9A 3SG7A 4DS7A 2M9GA 1WLMA 3EKHA 5ER4X 2KAYA 1F4OA 1XVJA 1NX0A 5HLOA 1L7ZA 3D10A 2QPTA 1AUIB 2L51A 1SNLA 1X02A 3TUYC 2M7NA
chains in the Genus database with same CATH superfamily
2KSPA 1IH0A 1NCZA 1UUSA 1CNPA 4P5OE 3CZTX 2WOSA 2KFHA 1CDMA 1A29A 1QX7A 2H61A 1MXLC 3O4YA 1TCFA 1N2DA 1UWOA 5F6TA 2CBLA 2M1KB 4INXA 1CDPA 2F8PA 3BOWB 1WDCB 3CGAA 1XFZO 2BL0C 4WQ3A 3IF7A 2Q4UA 5FYXA 4MBEA 1C7WA 4F0ZB 2PQLA 4C0LA 1DVIA 3D78A 1DJGA 3OB1B 5DKNA 2KQYA 1J55A 2CCMA 4MN0A 4XJKA 2Y4QA 2K2AA 1CMFA 1TUJA 3AAKA 1SMGA 1TN4A 1YRTB 3CZ1A 3I5FC 3R1VA 1BT6A 3O6BA 1KQMB 2JC2A 5CSIA 4A4BA 3CR2A 5K89A 1SKTA 3B87A 3CTNA 3O4XA 3BUOB 3KEVA 1S6JA 1PSBA 4IJ7A 5HKYA 5KU1A 4DCKA 1NUBA 2K8MB 1B8RA 1OMVA 1MHOA 3TS5B 1FW4A 3VROA 2KBIA 3BXKA 2EGDA 2P70A 5D7FA 5AFPA 2LLSA 2WCBA 2FJYA 3FWCA 1W9ZA 1Y1XA 1BR1B 2KAXA 2GGMA 4MVFA 2KLDA 2OPOA 3E3RA 1K95A 3RZSA 1C07A 1S26D 1SR6C 1PALA 3BQ3A 1BODA 2KOTA 1QJTA 3JTDC 5B8IB 1YUSA 2CTNA 2Q91A 1DF0A 1A75A 1C7VA 1QLKA 1EH2A 3CR4X 1CDNA 1CKKA 2QACA 2ZNDA 3H4SE 2F2OA 4OR9B 2M97A 3BFAA 1SYMA 1GJYA 3MSEB 1DJXA 3NSLA 4YI9A 1K9UA 1IWQA 4PE4A 3SS5A 5FI7A 5FI6A 3WHUB 1SL9A 3WXAA 4YRUA 1TRFA 1TNPA 4ICBA 4M2PA 2QEHA 1IQ5A 3EK4A 1L2OB 2R2IA 1B8CA 4GNKB 1QX5B 1F55A 1WDCC 1MXEA 1XO5A 3BUWB 1NPQA 1WRLA 2K61A 2PSRA 2BBMA 3K21A 1GM0A 1DELA 2Y1NA 2NCPA 3FE8A 3KHEA 1KK8C 1AJ5A 4AOMA 1CDLA 1GQMA 1KK7Z 2LHIA 2HETA 4MRXA 3WHTB 5JOLA 2H61C 4CIDA 1OOGA 1SCMC 1YTZC 1KCYA 4I5NB 2SCPA 2JT8A 4CFQA 5I2QA 1CM4A 3DD4A 1LKJA 1KK8B 2KGBC 4PCWA 2L4HA 1YRUB 1KQVA 4CLNA 1DEKA 5D69A 1CMGA 1XFUO 3CS1A 4KYNA 1CLLA 3ZNIA 1DGUA 3DF0A 3SG3A 1CFFA 2DOQA 2KAVA 1DGVA 2FCEA 4OV2A 3I5FB 2JXLA 2BCAA 1ODBA 2EHBA 4BY4A 3I5GC 1XA5A 1KSOA 3BFHA 3PJIA 4GAOA 4OCIA 3V2LA 1PRWA 2NLNA 4QJ3B 4YGAA 2BNXA 1FPWA 3S0GA 2AAOA 4A4CA 5TNCA 2M49B 1DTLA 4HREE 3A8RA 4D1EA 2PMYA 3KPXA 1YX7A 1FI5A 5PALA 2KHNA 1DJZA 2F2PA 2L50A 3I5IC 3R1OA 4IL1A 1DC1A 2FJUB 2FCDA 1OE9B 2JTZA 1W7IB 2WCEA 1J7RA 1QVIY 3JVTB 3LLEA 3SG2A 2I7AA 1TTXA 2KI4B 1B1GA 1D1OA 3OGNA 4GGFC 2M7LA 3SIAA 3D77A 1XFVO 2BKIB 2E30A 2QEVA 1FF1A 1B7TZ 4PE1A 1ZUZA 3HX4A 1VRKA 4I5KA 3NXAA 1K96A 3JVTC 2K7BA 3OB2B 2VRGA 3Q8IA 4PHJA 3SS3A 5AERA 1S5GY 5G08A 2NZ0A 1KWOB 1IQ3A 1BR4B 3PALA 1TNXA 3SG5A 4DRWA 1J1DA 1SL7A 1F54A 2MA2A 4FTGA 2L5YA 2PASA 1QWVA 2CXJA 1ZFSA 3IVTA 2WCKA 1TWOA 4PALA 1XFWO 5EL2A 1EG3A 3I5HC 3PM2A 1TUZA 3A4UB 1WRZA 2LHLA 2MRDA 2BCXA 1S6IA 2KNEA 1DJYA 3D0YA 1SSEB 1TNQA 2K60A 2LVVA 3EKJA 2LCPA 2RGIA 2M3WA 1BG1A 2JPTA 1TOPA 4N5XA 1NX1A 1Q80A 1YVHA 2F3YA 3IQQA 1SK6D 1KFUS 4C0KA 1DMOA 1NIWA 5HL1A 1MUXA 1RJVA 3NHIA 1SBJA 4GBAA 1F70A 3PSRA 5I94A 1JBAA 1OQPA 2LP3A 1KFXS 3NGVA 4E68A 1NX2A 2P6BB 1NSHA 1K90D 2JXCA 3RLZA 2GTEA 4AQIA 2JOJA 1LINA 1PSRA 3VRQA 1UHKA 2WNDA 1YUTA 3N7HA 2L98A 2ERBA 1IJ5A 3WNXB 1KWOC 4USLA 2F3ZA 1TNWA 2ZN9A 1WRKA 3L47A 2KFGA 3QRXA 2QDIA 2JWWA 5IBWA 5GQQC 1PK0D 2JTTA 3CR5X 4PDZA 4PT1A 1GGWA 3KF9A 3SG4A 2MJWB 1LVCD 4GGNA 2ZN8A 4TNCA 1S6CA 3S0FA 5CSFA 3C1VA 1TCOB 3R1PA 3SS4A 2PVBA 1G8IA 5I8NA 1S36A 1SCMB 3OX6A 3M0WA 3VRRA 3UNWA 2FOTA 1DT7B 2ZNEA 3FE9A 1QIWA 1V1FA 2LMUA 4YBHB 3TS5C 4BY5A 1J7OA 2ZRSA 3TDUA 1QV1A 1M39A 1A03A 4CFRA 3BJHA 4MZKA 4MRYA 5D3OA 1J7QA 4PHMA 2Y1MA 2HQWA 1L2OC 3AAJA 2WCJA 1EJ3A 3OBVA 3NSKA 3DVEA 2JPOA 1EXRA 3DY9A 1TIZA 3QMEA 1E8AA 1XYDA 2F33A 1EL4A 3ZWHA 1G33A 1WLZA 3D73A 4NQGA 3TUYB 1R2UA 2LMTA 2M29A 4WQ2A 2WC5A 3DF0B 1QIVA 3I5HB 2BBNA 4NDCA 4MEWA 3EG5B 1J7PA 2MAZA 2K7DA 4XJKB 1EG4A 3CWGA 4NDBA 1QVIZ 1BJFA 1AP4A 2BE4A 5I2LA 1OOJA 2O5GA 2JU0A 2WCHA 2BCBA 2Y5IA 2M8UA 1XK4C 3CZ2A 1F71A 4OKHA 2L0PA 1QATA 1LXFC 1BMOA 1WY9A 5HKZA 4JPZB 2NXQA 3BOWA 3GK1A 1HT9A 2NCOA 2HQ8A 2HF5A 3PATA 1ALVA 3GK4X 1IG5A 1MR8A 2AUCA 2PALA 1DQEA 3NSIA 3D76A 2LUXA 1CFDA 1KFXL 2OTGC 3VRPA 4C0JA 1A4PA 2LVKA 1UHIA 3NHTA 1CTRA 3DVJA 2HPSA 3D74A 4ORCB 4YGBB 1OOHA 2MLFC 1C3ZA 1AVSA 2BECA 4NDDA 1A75B 4ORAB 4GUKA 3BYAA 1CM1A 2KI6D 3D0YB 3VRNA 4PE0A 4MSPA 1KSMA 1OMRA 5DKQA 2MBXA 1MQ1A 1F8HA 1B47A 1CFCA 1YUUA 1XFXO 1DJWA 1OMDA 2L5XB 3BFBA 2CT9A 3B7AA 3I5GB 1Y1UA 1RROA 2MLEC 4GGFA 2AMIA 2L2CA 2I2RE 5AXIA 2JNXA 4PHKA 4FQTA 1JUOA 2LVJA 1ZMZA 1QS7A 1M63B 1K9PA 1K8UA 1UHHA 1JSAA 2TN4A 1HQVA 1PULA 2KGRA 1UHJA 2EC6B 2LMVA 2MHHA 1OZOA 3B6XA 2WC6A 2LNKA 3HCMA 4QJ5B 3PFVA 3KO0A 5HKWA 4M2QA 2E6WA 4FQOA 1UHNA 2H8VA 2M1UA 1IGVA 2O60A 3PM8A 1NYAA 4N1FA 1LA3A 1JF0A 1AHRA 3F45A 3GK2A 2LE9B 3GOFA 1QX2A 1SR6B 2KFFA 3EVUA 1Y6WA 2K7OA 3FS7A 3VGOA 4F7FA 1CFPA 1K9KA 3S0DA 1BF5A 1M45A 3LK1A 1B7TY 3SG6A 5FI2A 1M46A 3TZ1A 2GV5A 5HYDA 3EVRA 1QXPA 1B9AA 1K94A 4YGEB 3LCPC 1S1EA 1ALWA 1KK7Y 1SPYA 5JJGA 4HSZA 5BPJA 1RWYA 4HRGA 4DIRA 1A2XA 3FIAA 3ICBA 1OSAA 1C3YA 1RFJA 2BL0B 3BUNB 3DYEA 1V1GA 2G9BA 3S0EA 1ZOTB 1DJIA 3CDNA 1XFYO 1DJHA 4M2OA 1IJ6A 1Z2CB 4I5LB 3IQOA 1BLQA 3JTDB 4MZJA 3AKAA 3O78A 1B8LA 2KYFA 3LL8B 3PLFB 3EK8A 3DVMA 1YR5A 3O2PA 3CZ0A 1JFKA 1H8BA 2H2KA 2KLEA 3UO9A 1YVLA 1SY9A 1K93D 2ZRTA 5CPVA 1JWDA 4HRHA 3S0AA 4YGCB 3BUMB 2OTGB 2JULA 1QTXA 4Q04A 3I5IB 3SIBA 4N1GA 1NP8A 3RM1A 2LLTA 1M31A 5HLVA 1YX8A 1QV0A 2K2FA 2LUCA 1JFJA 1NCYA 2PRUA 1KQMC 2KDHA 3VB1A 1KFUL 2SASA 2LC5A 4PE7A 4UPGA 3EK7A 3AKBA 4DUQA 1OZSA 5I2OA 4ZCUA 1G4YR 3FWBA 1SL8A 1SRAA 5KSZA 4OVNF 1LA0A 1Z4HA 5DICA 4QJ4B 2LP2A 3DXLA 2LM5A 5CSNA 1SCVA 2WCLA 1ORGA 1CB1A 1QASA 4AQJA 1DF0B 1MWNA 2WORA 3D75A 2V53A 2OS8C 2COLB 4CPVA 1F4QA 4INWA 3PN7B 2BKHB 2WCFA 2B1UA 2JT3A 1QLSA 4GFTA 3LK0A 2LV7A 3SJSA 2CNPA 2BE6A 4R1EA 1OOFA 1T14A 3S0BA 1S3PA 2IS9A 2M0RA 2KPHA 3CYZA 2KQ6A 2KI6C 3R72A 3CLNA 1BOCA 1NX3A 2L4IA 2L2EA 5KTYA 2P71A 1RECA 3L4LA 1NCXA 1FI6A 1W7JB 2K7CA 1N0YA 2LAPA 4JQ0D 1ZACA 4JWQA 2LLUA 4YI8A 2GGZA 4MLWA 1LS8A 1SW8A 2YGUA 3TDIA 2JQ6A 2I18A 2OS8B 2WCMA 3OP0A 3DZTA 4XYNA 1UP5A 2KBMA 1IIOA 1J1EA 1FBVA 1JC2A 1BU3A 2I94A 1R6PA 2QEBA 4I5JA 3TDZA 1OW4A 2JZIA 1B4CA 1MF8B 1CLMA 4JD9A 4U8DA 3K1EA 4ZCVA 1YURA 1H4BA 1JF2A 4JKTA 4MZLA 1IKUA 1AJ4A 1U5IB 2EC6C 2KI4C 3PN7C 2JRFA 1XK4A 1Y1AA 2LANA 5ER5A 2D8NA 3NSOA 1NWDA 1PVAA 5AEQA 2LVIA 1RTP1 1IRJA 4ETOA 4WRIA 1GGZA 1XFRA 1S5GZ 2JNFA 3OHMB 3B86A 1PVBA 4OZDA 5J3XA 3L4AA 2G2BA 1AK8A 5DKRA 2WC8A 1Y0VH 2K0JA 2QEOA 2ZKMX 3DVKA 2ISDA 2PYQA 1UURA 2JT0A 1U5IA 3OX5A 1P28A 2KYCA 4GPLB 4L9MA 4PHNA 5AANA 3CABA 3EVVA 2A4JA 3FE6A 2ZFDA 4YGDB 1K2HA 3BUXB 4P2YB 4ORBB 5CSJA 1OOIX 1CLBA 1N65A 1RK9A 3SG7A 4DS7A 2M9GA 1WLMA 3EKHA 5ER4X 2BAPA 2KAYA 1F4OA 1XVJA 1NX0A 3B88A 1L7ZA 5HLOA 3D10A 2QPTA 1AUIB 2L51A 1SNLA 1X02A 3TUYC 2M7NA
chains in the Genus database with same CATH topology
2KSPA 1IH0A 1NCZA 1UUSA 1CNPA 4P5OE 3CZTX 2WOSA 2KFHA 1CDMA 1A29A 1QX7A 2H61A 1MXLC 3O4YA 1TCFA 1N2DA 1UWOA 5F6TA 2CBLA 2M1KB 1CDPA 2F8PA 3BOWB 1WDCB 3CGAA 1XFZO 2BL0C 4WQ3A 3IF7A 2Q4UA 5FYXA 4MBEA 1C7WA 4F0ZB 4C0LA 1DVIA 3OB1B 1DJGA 5DKNA 2KQYA 1J55A 2CCMA 4MN0A 4XJKA 2Y4QA 2K2AA 1CMFA 3AAKA 1SMGA 1TN4A 1YRTB 3I5FC 1BT6A 3O6BA 1KQMB 2JC2A 5CSIA 4A4BA 3CR2A 5K89A 1SKTA 3CTNA 3BUOB 3KEVA 1S6JA 1PSBA 5HKYA 5KU1A 4DCKA 1NUBA 2K8MB 1B8RA 1OMVA 1MHOA 3TS5B 1FW4A 3VROA 2KBIA 3BXKA 2EGDA 5D7FA 5AFPA 2LLSA 2WCBA 3FWCA 1Y1XA 1BR1B 2KAXA 2GGMA 4MVFA 2OPOA 3E3RA 1K95A 1C07A 1S26D 1SR6C 1PALA 3BQ3A 1BODA 2KOTA 1QJTA 3JTDC 5B8IB 1YUSA 2CTNA 2Q91A 1DF0A 1A75A 1C7VA 1QLKA 1EH2A 3CR4X 1CDNA 1CKKA 2QACA 2ZNDA 3H4SE 2F2OA 4OR9B 2M97A 1SYMA 1GJYA 3MSEB 1DJXA 3NSLA 4YI9A 1K9UA 1IWQA 4PE4A 4YRUA 3WHUB 1SL9A 3WXAA 1TRFA 1TNPA 4ICBA 4M2PA 1IQ5A 3EK4A 1L2OB 2R2IA 1B8CA 4GNKB 1QX5B 1F55A 1WDCC 1MXEA 1XO5A 3BUWB 1NPQA 1WRLA 2K61A 2PSRA 2BBMA 3K21A 2Y1NA 2NCPA 3KHEA 1KK8C 1AJ5A 4AOMA 1CDLA 1GQMA 1KK7Z 2LHIA 2HETA 4MRXA 3WHTB 5JOLA 2H61C 4CIDA 1YTZC 1SCMC 1KCYA 4I5NB 2SCPA 2JT8A 4CFQA 5I2QA 1CM4A 3DD4A 1LKJA 1KK8B 2KGBC 4PCWA 2L4HA 1YRUB 1KQVA 4CLNA 5D69A 1CMGA 1XFUO 3CS1A 3ZNIA 1CLLA 1DGUA 3DF0A 3SG3A 1CFFA 2DOQA 2KAVA 1DGVA 2FCEA 4OV2A 3I5FB 2JXLA 2BCAA 1ODBA 2EHBA 4BY4A 3I5GC 1XA5A 1KSOA 4GAOA 4OCIA 1PRWA 2NLNA 4QJ3B 4YGAA 1FPWA 2AAOA 4A4CA 5TNCA 2M49B 1DTLA 4HREE 3A8RA 4D1EA 2PMYA 3KPXA 1YX7A 1FI5A 5PALA 2KHNA 1DJZA 2F2PA 2L50A 3I5IC 4IL1A 2FJUB 2FCDA 1OE9B 2JTZA 1W7IB 2WCEA 1J7RA 1QVIY 3JVTB 3LLEA 3SG2A 2I7AA 1TTXA 2KI4B 1B1GA 1D1OA 4GGFC 2M7LA 3SIAA 1XFVO 2BKIB 2E30A 1FF1A 1B7TZ 4PE1A 1ZUZA 3HX4A 1VRKA 4I5KA 3NXAA 1K96A 3JVTC 2K7BA 3OB2B 2VRGA 4PHJA 5AERA 1S5GY 5G08A 2NZ0A 1KWOB 1IQ3A 1BR4B 3PALA 1TNXA 3SG5A 4DRWA 1J1DA 1SL7A 1F54A 2MA2A 4FTGA 2PASA 2CXJA 1ZFSA 4PALA 1XFWO 1EG3A 3I5HC 3A4UB 1WRZA 2LHLA 2MRDA 2BCXA 1S6IA 2KNEA 1DJYA 3D0YA 1TNQA 2LVVA 3EKJA 2LCPA 2RGIA 2M3WA 1BG1A 2JPTA 1TOPA 4N5XA 1NX1A 1Q80A 2F3YA 1YVHA 3IQQA 1SK6D 1KFUS 4C0KA 1DMOA 1NIWA 1MUXA 1RJVA 1SBJA 4GBAA 1F70A 3PSRA 1JBAA 1OQPA 2LP3A 1KFXS 4E68A 1NX2A 2P6BB 1NSHA 1K90D 2JXCA 3RLZA 4AQIA 2JOJA 1LINA 1PSRA 3VRQA 1UHKA 2WNDA 1YUTA 2L98A 1IJ5A 3WNXB 1KWOC 4USLA 2F3ZA 1TNWA 2ZN9A 1WRKA 3QRXA 2KFGA 2JWWA 5IBWA 5GQQC 1PK0D 2JTTA 3CR5X 4PDZA 1GGWA 3KF9A 3SG4A 2MJWB 1LVCD 4GGNA 2ZN8A 4TNCA 1S6CA 5CSFA 3C1VA 1TCOB 2PVBA 1G8IA 5I8NA 1S36A 1SCMB 3OX6A 3M0WA 3VRRA 2FOTA 1DT7B 2ZNEA 1QIWA 1V1FA 2LMUA 4YBHB 3TS5C 4BY5A 1J7OA 2ZRSA 3TDUA 1QV1A 1M39A 1A03A 4CFRA 4MZKA 4MRYA 1J7QA 4PHMA 2Y1MA 2HQWA 1L2OC 3AAJA 1EJ3A 3NSKA 3DVEA 3ZWHA 1EXRA 1TIZA 1E8AA 1XYDA 2F33A 1EL4A 1G33A 1WLZA 4NQGA 3TUYB 1R2UA 2LMTA 2M29A 4WQ2A 3DF0B 3I5HB 1QIVA 4NDCA 2BBNA 4MEWA 1J7PA 2MAZA 2K7DA 4XJKB 1EG4A 3CWGA 4NDBA 1QVIZ 1BJFA 1AP4A 2BE4A 5I2LA 1OOJA 2O5GA 2JU0A 2Y5IA 2BCBA 2M8UA 1XK4C 1F71A 4OKHA 2L0PA 1QATA 1LXFC 1BMOA 1WY9A 5HKZA 4JPZB 2NXQA 3BOWA 3GK1A 1HT9A 2NCOA 2HQ8A 2HF5A 3PATA 1ALVA 3GK4X 1IG5A 1MR8A 2AUCA 2PALA 3NSIA 2LUXA 1CFDA 1KFXL 2OTGC 3VRPA 4C0JA 1A4PA 2LVKA 1UHIA 1CTRA 3DVJA 2HPSA 4ORCB 4YGBB 2MLFC 1AVSA 2BECA 4NDDA 1A75B 4ORAB 4GUKA 3BYAA 1CM1A 2KI6D 3D0YB 3VRNA 4PE0A 4MSPA 1KSMA 1OMRA 5DKQA 2MBXA 1MQ1A 1F8HA 1B47A 1CFCA 1YUUA 1XFXO 1DJWA 1OMDA 2L5XB 2CT9A 3I5GB 1Y1UA 1RROA 2MLEC 4GGFA 2AMIA 2I2RE 5AXIA 2JNXA 4PHKA 1JUOA 2LVJA 1ZMZA 1QS7A 1M63B 1K9PA 1K8UA 1UHHA 1JSAA 2TN4A 1HQVA 1PULA 2KGRA 1UHJA 2EC6B 2LMVA 2MHHA 1OZOA 2LNKA 3HCMA 4QJ5B 3PFVA 3KO0A 5HKWA 4M2QA 2E6WA 4FQOA 1UHNA 2M1UA 1IGVA 2O60A 3PM8A 1NYAA 4N1FA 1LA3A 1JF0A 1AHRA 3F45A 3GK2A 2LE9B 3GOFA 1QX2A 1SR6B 2KFFA 3EVUA 1Y6WA 2K7OA 3FS7A 3VGOA 1CFPA 1K9KA 1BF5A 1M45A 3LK1A 1B7TY 3SG6A 3TZ1A 1M46A 2GV5A 5HYDA 3EVRA 1QXPA 1B9AA 1K94A 4YGEB 3LCPC 1S1EA 1ALWA 1KK7Y 1SPYA 5JJGA 4HSZA 5BPJA 1RWYA 4HRGA 4DIRA 1A2XA 3FIAA 3ICBA 1OSAA 1RFJA 2BL0B 3BUNB 1V1GA 2G9BA 1ZOTB 1DJIA 1XFYO 1DJHA 4M2OA 1IJ6A 4I5LB 3IQOA 1BLQA 3JTDB 4MZJA 3AKAA 3O78A 1B8LA 2KYFA 3LL8B 3PLFB 3EK8A 3DVMA 1YR5A 3O2PA 1JFKA 1H8BA 2H2KA 1YVLA 1SY9A 1K93D 2ZRTA 5CPVA 1JWDA 4HRHA 4YGCB 3BUMB 2OTGB 2JULA 1QTXA 4Q04A 3I5IB 3SIBA 4N1GA 1NP8A 3RM1A 2LLTA 1M31A 5HLVA 1YX8A 1QV0A 2K2FA 2LUCA 1JFJA 1NCYA 2PRUA 1KQMC 2KDHA 1KFUL 2SASA 2LC5A 4PE7A 4UPGA 3EK7A 3AKBA 4DUQA 1OZSA 5I2OA 4ZCUA 1G4YR 3FWBA 1SL8A 1SRAA 5KSZA 4OVNF 1LA0A 4QJ4B 2LP2A 2LM5A 5CSNA 1SCVA 1CB1A 1QASA 4AQJA 1DF0B 1MWNA 2WORA 2V53A 2OS8C 2COLB 4CPVA 1F4QA 3PN7B 2BKHB 2WCFA 2B1UA 2JT3A 1QLSA 4GFTA 3LK0A 2LV7A 3SJSA 2CNPA 2BE6A 4R1EA 1S3PA 2IS9A 2M0RA 2KQ6A 2KI6C 3CLNA 1BOCA 1NX3A 2L4IA 2L2EA 5KTYA 1RECA 1NCXA 1FI6A 1W7JB 2K7CA 1N0YA 2LAPA 4JQ0D 1ZACA 4JWQA 2LLUA 4YI8A 2GGZA 4MLWA 1SW8A 3TDIA 2JQ6A 2I18A 2OS8B 3OP0A 4XYNA 1UP5A 2KBMA 1J1EA 1FBVA 1JC2A 1BU3A 2I94A 1R6PA 4I5JA 3TDZA 2JZIA 1B4CA 1MF8B 1CLMA 4U8DA 4ZCVA 1YURA 1H4BA 1JF2A 4MZLA 1IKUA 1AJ4A 1U5IB 2EC6C 2KI4C 3PN7C 2JRFA 1XK4A 1Y1AA 2LANA 5ER5A 2D8NA 3NSOA 1NWDA 1PVAA 5AEQA 2LVIA 1RTP1 1IRJA 4ETOA 4WRIA 1GGZA 2JNFA 1S5GZ 3OHMB 5J3XA 1PVBA 2G2BA 1AK8A 5DKRA 2WC8A 1Y0VH 2K0JA 2ZKMX 3DVKA 2ISDA 1UURA 2JT0A 1U5IA 3OX5A 2KYCA 4GPLB 4L9MA 4PHNA 5AANA 3EVVA 2A4JA 2ZFDA 4YGDB 1K2HA 3BUXB 4P2YB 4ORBB 5CSJA 1CLBA 1N65A 1RK9A 3SG7A 4DS7A 2M9GA 1WLMA 3EKHA 5ER4X 2KAYA 1F4OA 1XVJA 1NX0A 5HLOA 1L7ZA 3D10A 2QPTA 1AUIB 2L51A 1SNLA 1X02A 3TUYC 2M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSP A;  1IH0 A;  1NCZ A;  1UUS A;  1CNP A;  4P5O E;  3CZT X;  2WOS A;  2KFH A;  1CDM A;  1A29 A;  1QX7 A;  2H61 A;  1MXL C;  3O4Y A;  1TCF A;  1N2D A;  1UWO A;  5F6T A;  2CBL A;  2M1K B;  1CDP A;  2F8P A;  3BOW B;  1WDC B;  3CGA A;  1XFZ O;  2BL0 C;  4WQ3 A;  3IF7 A;  2Q4U A;  5FYX A;  4MBE A;  1C7W A;  4F0Z B;  4C0L A;  1DVI A;  3OB1 B;  1DJG A;  5DKN A;  2KQY A;  1J55 A;  2CCM A;  4MN0 A;  4XJK A;  2Y4Q A;  2K2A A;  1CMF A;  3AAK A;  1SMG A;  1TN4 A;  1YRT B;  3I5F C;  1BT6 A;  3O6B A;  1KQM B;  2JC2 A;  5CSI A;  4A4B A;  3CR2 A;  5K89 A;  1SKT A;  3CTN A;  3BUO B;  3KEV A;  1S6J A;  1PSB A;  5HKY A;  5KU1 A;  4DCK A;  1NUB A;  2K8M B;  1B8R A;  1OMV A;  1MHO A;  3TS5 B;  1FW4 A;  3VRO A;  2KBI A;  3BXK A;  2EGD A;  5D7F A;  5AFP A;  2LLS A;  2WCB A;  3FWC A;  1Y1X A;  1BR1 B;  2KAX A;  2GGM A;  4MVF A;  2OPO A;  3E3R A;  1K95 A;  1C07 A;  1S26 D;  1SR6 C;  1PAL A;  3BQ3 A;  1BOD A;  2KOT A;  1QJT A;  3JTD C;  5B8I B;  1YUS A;  2CTN A;  2Q91 A;  1DF0 A;  1A75 A;  1C7V A;  1QLK A;  1EH2 A;  3CR4 X;  1CDN A;  1CKK A;  2QAC A;  2ZND A;  3H4S E;  2F2O A;  4OR9 B;  2M97 A;  1SYM A;  1GJY A;  3MSE B;  1DJX A;  3NSL A;  4YI9 A;  1K9U A;  1IWQ A;  4PE4 A;  4YRU A;  3WHU B;  1SL9 A;  3WXA A;  1TRF A;  1TNP A;  4ICB A;  4M2P A;  1IQ5 A;  3EK4 A;  1L2O B;  2R2I A;  1B8C A;  4GNK B;  1QX5 B;  1F55 A;  1WDC C;  1MXE A;  1XO5 A;  3BUW B;  1NPQ A;  1WRL A;  2K61 A;  2PSR A;  2BBM A;  3K21 A;  2Y1N A;  2NCP A;  3KHE A;  1KK8 C;  1AJ5 A;  4AOM A;  1CDL A;  1GQM A;  1KK7 Z;  2LHI A;  2HET A;  4MRX A;  3WHT B;  5JOL A;  2H61 C;  4CID A;  1YTZ C;  1SCM C;  1KCY A;  4I5N B;  2SCP A;  2JT8 A;  4CFQ A;  5I2Q A;  1CM4 A;  3DD4 A;  1LKJ A;  1KK8 B;  2KGB C;  4PCW A;  2L4H A;  1YRU B;  1KQV A;  4CLN A;  5D69 A;  1CMG A;  1XFU O;  3CS1 A;  3ZNI A;  1CLL A;  1DGU A;  3DF0 A;  3SG3 A;  1CFF A;  2DOQ A;  2KAV A;  1DGV A;  2FCE A;  4OV2 A;  3I5F B;  2JXL A;  2BCA A;  1ODB A;  2EHB A;  4BY4 A;  3I5G C;  1XA5 A;  1KSO A;  4GAO A;  4OCI A;  1PRW A;  2NLN A;  4QJ3 B;  4YGA A;  1FPW A;  2AAO A;  4A4C A;  5TNC A;  2M49 B;  1DTL A;  4HRE E;  3A8R A;  4D1E A;  2PMY A;  3KPX A;  1YX7 A;  1FI5 A;  5PAL A;  2KHN A;  1DJZ A;  2F2P A;  2L50 A;  3I5I C;  4IL1 A;  2FJU B;  2FCD A;  1OE9 B;  2JTZ A;  1W7I B;  2WCE A;  1J7R A;  1QVI Y;  3JVT B;  3LLE A;  3SG2 A;  2I7A A;  1TTX A;  2KI4 B;  1B1G A;  1D1O A;  4GGF C;  2M7L A;  3SIA A;  1XFV O;  2BKI B;  2E30 A;  1FF1 A;  1B7T Z;  4PE1 A;  1ZUZ A;  3HX4 A;  1VRK A;  4I5K A;  3NXA A;  1K96 A;  3JVT C;  2K7B A;  3OB2 B;  2VRG A;  4PHJ A;  5AER A;  1S5G Y;  5G08 A;  2NZ0 A;  1KWO B;  1IQ3 A;  1BR4 B;  3PAL A;  1TNX A;  3SG5 A;  4DRW A;  1J1D A;  1SL7 A;  1F54 A;  2MA2 A;  4FTG A;  2PAS A;  2CXJ A;  1ZFS A;  4PAL A;  1XFW O;  1EG3 A;  3I5H C;  3A4U B;  1WRZ A;  2LHL A;  2MRD A;  2BCX A;  1S6I A;  2KNE A;  1DJY A;  3D0Y A;  1TNQ A;  2LVV A;  3EKJ A;  2LCP A;  2RGI A;  2M3W A;  1BG1 A;  2JPT A;  1TOP A;  4N5X A;  1NX1 A;  1Q80 A;  2F3Y A;  1YVH A;  3IQQ A;  1SK6 D;  1KFU S;  4C0K A;  1DMO A;  1NIW A;  1MUX A;  1RJV A;  1SBJ A;  4GBA A;  1F70 A;  3PSR A;  1JBA A;  1OQP A;  2LP3 A;  1KFX S;  4E68 A;  1NX2 A;  2P6B B;  1NSH A;  1K90 D;  2JXC A;  3RLZ A;  4AQI A;  2JOJ A;  1LIN A;  1PSR A;  3VRQ A;  1UHK A;  2WND A;  1YUT A;  2L98 A;  1IJ5 A;  3WNX B;  1KWO C;  4USL A;  2F3Z A;  1TNW A;  2ZN9 A;  1WRK A;  3QRX A;  2KFG A;  2JWW A;  5IBW A;  5GQQ C;  1PK0 D;  2JTT A;  3CR5 X;  4PDZ A;  1GGW A;  3KF9 A;  3SG4 A;  2MJW B;  1LVC D;  4GGN A;  2ZN8 A;  4TNC A;  1S6C A;  5CSF A;  3C1V A;  1TCO B;  2PVB A;  1G8I A;  5I8N A;  1S36 A;  1SCM B;  3OX6 A;  3M0W A;  3VRR A;  2FOT A;  1DT7 B;  2ZNE A;  1QIW A;  1V1F A;  2LMU A;  4YBH B;  3TS5 C;  4BY5 A;  1J7O A;  2ZRS A;  3TDU A;  1QV1 A;  1M39 A;  1A03 A;  4CFR A;  4MZK A;  4MRY A;  1J7Q A;  4PHM A;  2Y1M A;  2HQW A;  1L2O C;  3AAJ A;  1EJ3 A;  3NSK A;  3DVE A;  3ZWH A;  1EXR A;  1TIZ A;  1E8A A;  1XYD A;  2F33 A;  1EL4 A;  1G33 A;  1WLZ A;  4NQG A;  3TUY B;  1R2U A;  2LMT A;  2M29 A;  4WQ2 A;  3DF0 B;  3I5H B;  1QIV A;  4NDC A;  2BBN A;  4MEW A;  1J7P A;  2MAZ A;  2K7D A;  4XJK B;  1EG4 A;  3CWG A;  4NDB A;  1QVI Z;  1BJF A;  1AP4 A;  2BE4 A;  5I2L A;  1OOJ A;  2O5G A;  2JU0 A;  2Y5I A;  2BCB A;  2M8U A;  1XK4 C;  1F71 A;  4OKH A;  2L0P A;  1QAT A;  1LXF C;  1BMO A;  1WY9 A;  5HKZ A;  4JPZ B;  2NXQ A;  3BOW A;  3GK1 A;  1HT9 A;  2NCO A;  2HQ8 A;  2HF5 A;  3PAT A;  1ALV A;  3GK4 X;  1IG5 A;  1MR8 A;  2AUC A;  2PAL A;  3NSI A;  2LUX A;  1CFD A;  1KFX L;  2OTG C;  3VRP A;  4C0J A;  1A4P A;  2LVK A;  1UHI A;  1CTR A;  3DVJ A;  2HPS A;  4ORC B;  4YGB B;  2MLF C;  1AVS A;  2BEC A;  4NDD A;  1A75 B;  4ORA B;  4GUK A;  3BYA A;  1CM1 A;  2KI6 D;  3D0Y B;  3VRN A;  4PE0 A;  4MSP A;  1KSM A;  1OMR A;  5DKQ A;  2MBX A;  1MQ1 A;  1F8H A;  1B47 A;  1CFC A;  1YUU A;  1XFX O;  1DJW A;  1OMD A;  2L5X B;  2CT9 A;  3I5G B;  1Y1U A;  1RRO A;  2MLE C;  4GGF A;  2AMI A;  2I2R E;  5AXI A;  2JNX A;  4PHK A;  1JUO A;  2LVJ A;  1ZMZ A;  1QS7 A;  1M63 B;  1K9P A;  1K8U A;  1UHH A;  1JSA A;  2TN4 A;  1HQV A;  1PUL A;  2KGR A;  1UHJ A;  2EC6 B;  2LMV A;  2MHH A;  1OZO A;  2LNK A;  3HCM A;  4QJ5 B;  3PFV A;  3KO0 A;  5HKW A;  4M2Q A;  2E6W A;  4FQO A;  1UHN A;  2M1U A;  1IGV A;  2O60 A;  3PM8 A;  1NYA A;  4N1F A;  1LA3 A;  1JF0 A;  1AHR A;  3F45 A;  3GK2 A;  2LE9 B;  3GOF A;  1QX2 A;  1SR6 B;  2KFF A;  3EVU A;  1Y6W A;  2K7O A;  3FS7 A;  3VGO A;  1CFP A;  1K9K A;  1BF5 A;  1M45 A;  3LK1 A;  1B7T Y;  3SG6 A;  3TZ1 A;  1M46 A;  2GV5 A;  5HYD A;  3EVR A;  1QXP A;  1B9A A;  1K94 A;  4YGE B;  3LCP C;  1S1E A;  1ALW A;  1KK7 Y;  1SPY A;  5JJG A;  4HSZ A;  5BPJ A;  1RWY A;  4HRG A;  4DIR A;  1A2X A;  3FIA A;  3ICB A;  1OSA A;  1RFJ A;  2BL0 B;  3BUN B;  1V1G A;  2G9B A;  1ZOT B;  1DJI A;  1XFY O;  1DJH A;  4M2O A;  1IJ6 A;  4I5L B;  3IQO A;  1BLQ A;  3JTD B;  4MZJ A;  3AKA A;  3O78 A;  1B8L A;  2KYF A;  3LL8 B;  3PLF B;  3EK8 A;  3DVM A;  1YR5 A;  3O2P A;  1JFK A;  1H8B A;  2H2K A;  1YVL A;  1SY9 A;  1K93 D;  2ZRT A;  5CPV A;  1JWD A;  4HRH A;  4YGC B;  3BUM B;  2OTG B;  2JUL A;  1QTX A;  4Q04 A;  3I5I B;  3SIB A;  4N1G A;  1NP8 A;  3RM1 A;  2LLT A;  1M31 A;  5HLV A;  1YX8 A;  1QV0 A;  2K2F A;  2LUC A;  1JFJ A;  1NCY A;  2PRU A;  1KQM C;  2KDH A;  1KFU L;  2SAS A;  2LC5 A;  4PE7 A;  4UPG A;  3EK7 A;  3AKB A;  4DUQ A;  1OZS A;  5I2O A;  4ZCU A;  1G4Y R;  3FWB A;  1SL8 A;  1SRA A;  5KSZ A;  4OVN F;  1LA0 A;  4QJ4 B;  2LP2 A;  2LM5 A;  5CSN A;  1SCV A;  1CB1 A;  1QAS A;  4AQJ A;  1DF0 B;  1MWN A;  2WOR A;  2V53 A;  2OS8 C;  2COL B;  4CPV A;  1F4Q A;  3PN7 B;  2BKH B;  2WCF A;  2B1U A;  2JT3 A;  1QLS A;  4GFT A;  3LK0 A;  2LV7 A;  3SJS A;  2CNP A;  2BE6 A;  4R1E A;  1S3P A;  2IS9 A;  2M0R A;  2KQ6 A;  2KI6 C;  3CLN A;  1BOC A;  1NX3 A;  2L4I A;  2L2E A;  5KTY A;  1REC A;  1NCX A;  1FI6 A;  1W7J B;  2K7C A;  1N0Y A;  2LAP A;  4JQ0 D;  1ZAC A;  4JWQ A;  2LLU A;  4YI8 A;  2GGZ A;  4MLW A;  1SW8 A;  3TDI A;  2JQ6 A;  2I18 A;  2OS8 B;  3OP0 A;  4XYN A;  1UP5 A;  2KBM A;  1J1E A;  1FBV A;  1JC2 A;  1BU3 A;  2I94 A;  1R6P A;  4I5J A;  3TDZ A;  2JZI A;  1B4C A;  1MF8 B;  1CLM A;  4U8D A;  4ZCV A;  1YUR A;  1H4B A;  1JF2 A;  4MZL A;  1IKU A;  1AJ4 A;  1U5I B;  2EC6 C;  2KI4 C;  3PN7 C;  2JRF A;  1XK4 A;  1Y1A A;  2LAN A;  5ER5 A;  2D8N A;  3NSO A;  1NWD A;  1PVA A;  5AEQ A;  2LVI A;  1RTP 1;  1IRJ A;  4ETO A;  4WRI A;  1GGZ A;  2JNF A;  1S5G Z;  3OHM B;  5J3X A;  1PVB A;  2G2B A;  1AK8 A;  5DKR A;  2WC8 A;  1Y0V H;  2K0J A;  2ZKM X;  3DVK A;  2ISD A;  1UUR A;  2JT0 A;  1U5I A;  3OX5 A;  2KYC A;  4GPL B;  4L9M A;  4PHN A;  5AAN A;  3EVV A;  2A4J A;  2ZFD A;  4YGD B;  1K2H A;  3BUX B;  4P2Y B;  4ORB B;  5CSJ A;  1CLB A;  1N65 A;  1RK9 A;  3SG7 A;  4DS7 A;  2M9G A;  1WLM A;  3EKH A;  5ER4 X;  2KAY A;  1F4O A;  1XVJ A;  1NX0 A;  5HLO A;  1L7Z A;  3D10 A;  2QPT A;  1AUI B;  2L51 A;  1SNL A;  1X02 A;  3TUY C;  2M7N A; 
#chains in the Genus database with same CATH topology
 2KSP A;  1IH0 A;  1NCZ A;  1UUS A;  1CNP A;  4P5O E;  3CZT X;  2WOS A;  2KFH A;  1CDM A;  1A29 A;  1QX7 A;  2H61 A;  1MXL C;  3O4Y A;  1TCF A;  1N2D A;  1UWO A;  5F6T A;  2CBL A;  2M1K B;  4INX A;  1CDP A;  2F8P A;  3BOW B;  1WDC B;  3CGA A;  1XFZ O;  2BL0 C;  4WQ3 A;  3IF7 A;  2Q4U A;  5FYX A;  4MBE A;  1C7W A;  4F0Z B;  2PQL A;  4C0L A;  1DVI A;  3D78 A;  1DJG A;  3OB1 B;  5DKN A;  2KQY A;  1J55 A;  2CCM A;  4MN0 A;  4XJK A;  2Y4Q A;  2K2A A;  1CMF A;  1TUJ A;  3AAK A;  1SMG A;  1TN4 A;  1YRT B;  3CZ1 A;  3I5F C;  3R1V A;  1BT6 A;  3O6B A;  1KQM B;  2JC2 A;  5CSI A;  4A4B A;  3CR2 A;  5K89 A;  1SKT A;  3B87 A;  3CTN A;  3O4X A;  3BUO B;  3KEV A;  1S6J A;  1PSB A;  4IJ7 A;  5HKY A;  5KU1 A;  4DCK A;  1NUB A;  2K8M B;  1B8R A;  1OMV A;  1MHO A;  3TS5 B;  1FW4 A;  3VRO A;  2KBI A;  3BXK A;  2EGD A;  2P70 A;  5D7F A;  5AFP A;  2LLS A;  2WCB A;  2FJY A;  3FWC A;  1W9Z A;  1Y1X A;  1BR1 B;  2KAX A;  2GGM A;  4MVF A;  2KLD A;  2OPO A;  3E3R A;  1K95 A;  3RZS A;  1C07 A;  1S26 D;  1SR6 C;  1PAL A;  3BQ3 A;  1BOD A;  2KOT A;  1QJT A;  3JTD C;  5B8I B;  1YUS A;  2CTN A;  2Q91 A;  1DF0 A;  1A75 A;  1C7V A;  1QLK A;  1EH2 A;  3CR4 X;  1CDN A;  1CKK A;  2QAC A;  2ZND A;  3H4S E;  2F2O A;  4OR9 B;  2M97 A;  3BFA A;  1SYM A;  1GJY A;  3MSE B;  1DJX A;  3NSL A;  4YI9 A;  1K9U A;  1IWQ A;  4PE4 A;  3SS5 A;  5FI7 A;  5FI6 A;  3WHU B;  1SL9 A;  3WXA A;  4YRU A;  1TRF A;  1TNP A;  4ICB A;  4M2P A;  2QEH A;  1IQ5 A;  3EK4 A;  1L2O B;  2R2I A;  1B8C A;  4GNK B;  1QX5 B;  1F55 A;  1WDC C;  1MXE A;  1XO5 A;  3BUW B;  1NPQ A;  1WRL A;  2K61 A;  2PSR A;  2BBM A;  3K21 A;  1GM0 A;  1DEL A;  2Y1N A;  2NCP A;  3FE8 A;  3KHE A;  1KK8 C;  1AJ5 A;  4AOM A;  1CDL A;  1GQM A;  1KK7 Z;  2LHI A;  2HET A;  4MRX A;  3WHT B;  5JOL A;  2H61 C;  4CID A;  1OOG A;  1SCM C;  1YTZ C;  1KCY A;  4I5N B;  2SCP A;  2JT8 A;  4CFQ A;  5I2Q A;  1CM4 A;  3DD4 A;  1LKJ A;  1KK8 B;  2KGB C;  4PCW A;  2L4H A;  1YRU B;  1KQV A;  4CLN A;  1DEK A;  5D69 A;  1CMG A;  1XFU O;  3CS1 A;  4KYN A;  1CLL A;  3ZNI A;  1DGU A;  3DF0 A;  3SG3 A;  1CFF A;  2DOQ A;  2KAV A;  1DGV A;  2FCE A;  4OV2 A;  3I5F B;  2JXL A;  2BCA A;  1ODB A;  2EHB A;  4BY4 A;  3I5G C;  1XA5 A;  1KSO A;  3BFH A;  3PJI A;  4GAO A;  4OCI A;  3V2L A;  1PRW A;  2NLN A;  4QJ3 B;  4YGA A;  2BNX A;  1FPW A;  3S0G A;  2AAO A;  4A4C A;  5TNC A;  2M49 B;  1DTL A;  4HRE E;  3A8R A;  4D1E A;  2PMY A;  3KPX A;  1YX7 A;  1FI5 A;  5PAL A;  2KHN A;  1DJZ A;  2F2P A;  2L50 A;  3I5I C;  3R1O A;  4IL1 A;  1DC1 A;  2FJU B;  2FCD A;  1OE9 B;  2JTZ A;  1W7I B;  2WCE A;  1J7R A;  1QVI Y;  3JVT B;  3LLE A;  3SG2 A;  2I7A A;  1TTX A;  2KI4 B;  1B1G A;  1D1O A;  3OGN A;  4GGF C;  2M7L A;  3SIA A;  3D77 A;  1XFV O;  2BKI B;  2E30 A;  2QEV A;  1FF1 A;  1B7T Z;  4PE1 A;  1ZUZ A;  3HX4 A;  1VRK A;  4I5K A;  3NXA A;  1K96 A;  3JVT C;  2K7B A;  3OB2 B;  2VRG A;  3Q8I A;  4PHJ A;  3SS3 A;  5AER A;  1S5G Y;  5G08 A;  2NZ0 A;  1KWO B;  1IQ3 A;  1BR4 B;  3PAL A;  1TNX A;  3SG5 A;  4DRW A;  1J1D A;  1SL7 A;  1F54 A;  2MA2 A;  4FTG A;  2L5Y A;  2PAS A;  1QWV A;  2CXJ A;  1ZFS A;  3IVT A;  2WCK A;  1TWO A;  4PAL A;  1XFW O;  5EL2 A;  1EG3 A;  3I5H C;  3PM2 A;  1TUZ A;  3A4U B;  1WRZ A;  2LHL A;  2MRD A;  2BCX A;  1S6I A;  2KNE A;  1DJY A;  3D0Y A;  1SSE B;  1TNQ A;  2K60 A;  2LVV A;  3EKJ A;  2LCP A;  2RGI A;  2M3W A;  1BG1 A;  2JPT A;  1TOP A;  4N5X A;  1NX1 A;  1Q80 A;  1YVH A;  2F3Y A;  3IQQ A;  1SK6 D;  1KFU S;  4C0K A;  1DMO A;  1NIW A;  5HL1 A;  1MUX A;  1RJV A;  3NHI A;  1SBJ A;  4GBA A;  1F70 A;  3PSR A;  5I94 A;  1JBA A;  1OQP A;  2LP3 A;  1KFX S;  3NGV A;  4E68 A;  1NX2 A;  2P6B B;  1NSH A;  1K90 D;  2JXC A;  3RLZ A;  2GTE A;  4AQI A;  2JOJ A;  1LIN A;  1PSR A;  3VRQ A;  1UHK A;  2WND A;  1YUT A;  3N7H A;  2L98 A;  2ERB A;  1IJ5 A;  3WNX B;  1KWO C;  4USL A;  2F3Z A;  1TNW A;  2ZN9 A;  1WRK A;  3L47 A;  2KFG A;  3QRX A;  2QDI A;  2JWW A;  5IBW A;  5GQQ C;  1PK0 D;  2JTT A;  3CR5 X;  4PDZ A;  4PT1 A;  1GGW A;  3KF9 A;  3SG4 A;  2MJW B;  1LVC D;  4GGN A;  2ZN8 A;  4TNC A;  1S6C A;  3S0F A;  5CSF A;  3C1V A;  1TCO B;  3R1P A;  3SS4 A;  2PVB A;  1G8I A;  5I8N A;  1S36 A;  1SCM B;  3OX6 A;  3M0W A;  3VRR A;  3UNW A;  2FOT A;  1DT7 B;  2ZNE A;  3FE9 A;  1QIW A;  1V1F A;  2LMU A;  4YBH B;  3TS5 C;  4BY5 A;  1J7O A;  2ZRS A;  3TDU A;  1QV1 A;  1M39 A;  1A03 A;  4CFR A;  3BJH A;  4MZK A;  4MRY A;  5D3O A;  1J7Q A;  4PHM A;  2Y1M A;  2HQW A;  1L2O C;  3AAJ A;  2WCJ A;  1EJ3 A;  3OBV A;  3NSK A;  3DVE A;  2JPO A;  1EXR A;  3DY9 A;  1TIZ A;  3QME A;  1E8A A;  1XYD A;  2F33 A;  1EL4 A;  3ZWH A;  1G33 A;  1WLZ A;  3D73 A;  4NQG A;  3TUY B;  1R2U A;  2LMT A;  2M29 A;  4WQ2 A;  2WC5 A;  3DF0 B;  1QIV A;  3I5H B;  2BBN A;  4NDC A;  4MEW A;  3EG5 B;  1J7P A;  2MAZ A;  2K7D A;  4XJK B;  1EG4 A;  3CWG A;  4NDB A;  1QVI Z;  1BJF A;  1AP4 A;  2BE4 A;  5I2L A;  1OOJ A;  2O5G A;  2JU0 A;  2WCH A;  2BCB A;  2Y5I A;  2M8U A;  1XK4 C;  3CZ2 A;  1F71 A;  4OKH A;  2L0P A;  1QAT A;  1LXF C;  1BMO A;  1WY9 A;  5HKZ A;  4JPZ B;  2NXQ A;  3BOW A;  3GK1 A;  1HT9 A;  2NCO A;  2HQ8 A;  2HF5 A;  3PAT A;  1ALV A;  3GK4 X;  1IG5 A;  1MR8 A;  2AUC A;  2PAL A;  1DQE A;  3NSI A;  3D76 A;  2LUX A;  1CFD A;  1KFX L;  2OTG C;  3VRP A;  4C0J A;  1A4P A;  2LVK A;  1UHI A;  3NHT A;  1CTR A;  3DVJ A;  2HPS A;  3D74 A;  4ORC B;  4YGB B;  1OOH A;  2MLF C;  1C3Z A;  1AVS A;  2BEC A;  4NDD A;  1A75 B;  4ORA B;  4GUK A;  3BYA A;  1CM1 A;  2KI6 D;  3D0Y B;  3VRN A;  4PE0 A;  4MSP A;  1KSM A;  1OMR A;  5DKQ A;  2MBX A;  1MQ1 A;  1F8H A;  1B47 A;  1CFC A;  1YUU A;  1XFX O;  1DJW A;  1OMD A;  2L5X B;  3BFB A;  2CT9 A;  3B7A A;  3I5G B;  1Y1U A;  1RRO A;  2MLE C;  4GGF A;  2AMI A;  2L2C A;  2I2R E;  5AXI A;  2JNX A;  4PHK A;  4FQT A;  1JUO A;  2LVJ A;  1ZMZ A;  1QS7 A;  1M63 B;  1K9P A;  1K8U A;  1UHH A;  1JSA A;  2TN4 A;  1HQV A;  1PUL A;  2KGR A;  1UHJ A;  2EC6 B;  2LMV A;  2MHH A;  1OZO A;  3B6X A;  2WC6 A;  2LNK A;  3HCM A;  4QJ5 B;  3PFV A;  3KO0 A;  5HKW A;  4M2Q A;  2E6W A;  4FQO A;  1UHN A;  2H8V A;  2M1U A;  1IGV A;  2O60 A;  3PM8 A;  1NYA A;  4N1F A;  1LA3 A;  1JF0 A;  1AHR A;  3F45 A;  3GK2 A;  2LE9 B;  3GOF A;  1QX2 A;  1SR6 B;  2KFF A;  3EVU A;  1Y6W A;  2K7O A;  3FS7 A;  3VGO A;  4F7F A;  1CFP A;  1K9K A;  3S0D A;  1BF5 A;  1M45 A;  3LK1 A;  1B7T Y;  3SG6 A;  5FI2 A;  1M46 A;  3TZ1 A;  2GV5 A;  5HYD A;  3EVR A;  1QXP A;  1B9A A;  1K94 A;  4YGE B;  3LCP C;  1S1E A;  1ALW A;  1KK7 Y;  1SPY A;  5JJG A;  4HSZ A;  5BPJ A;  1RWY A;  4HRG A;  4DIR A;  1A2X A;  3FIA A;  3ICB A;  1OSA A;  1C3Y A;  1RFJ A;  2BL0 B;  3BUN B;  3DYE A;  1V1G A;  2G9B A;  3S0E A;  1ZOT B;  1DJI A;  3CDN A;  1XFY O;  1DJH A;  4M2O A;  1IJ6 A;  1Z2C B;  4I5L B;  3IQO A;  1BLQ A;  3JTD B;  4MZJ A;  3AKA A;  3O78 A;  1B8L A;  2KYF A;  3LL8 B;  3PLF B;  3EK8 A;  3DVM A;  1YR5 A;  3O2P A;  3CZ0 A;  1JFK A;  1H8B A;  2H2K A;  2KLE A;  3UO9 A;  1YVL A;  1SY9 A;  1K93 D;  2ZRT A;  5CPV A;  1JWD A;  4HRH A;  3S0A A;  4YGC B;  3BUM B;  2OTG B;  2JUL A;  1QTX A;  4Q04 A;  3I5I B;  3SIB A;  4N1G A;  1NP8 A;  3RM1 A;  2LLT A;  1M31 A;  5HLV A;  1YX8 A;  1QV0 A;  2K2F A;  2LUC A;  1JFJ A;  1NCY A;  2PRU A;  1KQM C;  2KDH A;  3VB1 A;  1KFU L;  2SAS A;  2LC5 A;  4PE7 A;  4UPG A;  3EK7 A;  3AKB A;  4DUQ A;  1OZS A;  5I2O A;  4ZCU A;  1G4Y R;  3FWB A;  1SL8 A;  1SRA A;  5KSZ A;  4OVN F;  1LA0 A;  1Z4H A;  5DIC A;  4QJ4 B;  2LP2 A;  3DXL A;  2LM5 A;  5CSN A;  1SCV A;  2WCL A;  1ORG A;  1CB1 A;  1QAS A;  4AQJ A;  1DF0 B;  1MWN A;  2WOR A;  3D75 A;  2V53 A;  2OS8 C;  2COL B;  4CPV A;  1F4Q A;  4INW A;  3PN7 B;  2BKH B;  2WCF A;  2B1U A;  2JT3 A;  1QLS A;  4GFT A;  3LK0 A;  2LV7 A;  3SJS A;  2CNP A;  2BE6 A;  4R1E A;  1OOF A;  1T14 A;  3S0B A;  1S3P A;  2IS9 A;  2M0R A;  2KPH A;  3CYZ A;  2KQ6 A;  2KI6 C;  3R72 A;  3CLN A;  1BOC A;  1NX3 A;  2L4I A;  2L2E A;  5KTY A;  2P71 A;  1REC A;  3L4L A;  1NCX A;  1FI6 A;  1W7J B;  2K7C A;  1N0Y A;  2LAP A;  4JQ0 D;  1ZAC A;  4JWQ A;  2LLU A;  4YI8 A;  2GGZ A;  4MLW A;  1LS8 A;  1SW8 A;  2YGU A;  3TDI A;  2JQ6 A;  2I18 A;  2OS8 B;  2WCM A;  3OP0 A;  3DZT A;  4XYN A;  1UP5 A;  2KBM A;  1IIO A;  1J1E A;  1FBV A;  1JC2 A;  1BU3 A;  2I94 A;  1R6P A;  2QEB A;  4I5J A;  3TDZ A;  1OW4 A;  2JZI A;  1B4C A;  1MF8 B;  1CLM A;  4JD9 A;  4U8D A;  3K1E A;  4ZCV A;  1YUR A;  1H4B A;  1JF2 A;  4JKT A;  4MZL A;  1IKU A;  1AJ4 A;  1U5I B;  2EC6 C;  2KI4 C;  3PN7 C;  2JRF A;  1XK4 A;  1Y1A A;  2LAN A;  5ER5 A;  2D8N A;  3NSO A;  1NWD A;  1PVA A;  5AEQ A;  2LVI A;  1RTP 1;  1IRJ A;  4ETO A;  4WRI A;  1GGZ A;  1XFR A;  1S5G Z;  2JNF A;  3OHM B;  3B86 A;  1PVB A;  4OZD A;  5J3X A;  3L4A A;  2G2B A;  1AK8 A;  5DKR A;  2WC8 A;  1Y0V H;  2K0J A;  2QEO A;  2ZKM X;  3DVK A;  2ISD A;  2PYQ A;  1UUR A;  2JT0 A;  1U5I A;  3OX5 A;  1P28 A;  2KYC A;  4GPL B;  4L9M A;  4PHN A;  5AAN A;  3CAB A;  3EVV A;  2A4J A;  3FE6 A;  2ZFD A;  4YGD B;  1K2H A;  3BUX B;  4P2Y B;  4ORB B;  5CSJ A;  1OOI X;  1CLB A;  1N65 A;  1RK9 A;  3SG7 A;  4DS7 A;  2M9G A;  1WLM A;  3EKH A;  5ER4 X;  2BAP A;  2KAY A;  1F4O A;  1XVJ A;  1NX0 A;  3B88 A;  1L7Z A;  5HLO A;  3D10 A;  2QPT A;  1AUI B;  2L51 A;  1SNL A;  1X02 A;  3TUY C;  2M7N A; 
#chains in the Genus database with same CATH homology
 2KSP A;  1IH0 A;  1NCZ A;  1UUS A;  1CNP A;  4P5O E;  3CZT X;  2WOS A;  2KFH A;  1CDM A;  1A29 A;  1QX7 A;  2H61 A;  1MXL C;  3O4Y A;  1TCF A;  1N2D A;  1UWO A;  5F6T A;  2CBL A;  2M1K B;  1CDP A;  2F8P A;  3BOW B;  1WDC B;  3CGA A;  1XFZ O;  2BL0 C;  4WQ3 A;  3IF7 A;  2Q4U A;  5FYX A;  4MBE A;  1C7W A;  4F0Z B;  4C0L A;  1DVI A;  3OB1 B;  1DJG A;  5DKN A;  2KQY A;  1J55 A;  2CCM A;  4MN0 A;  4XJK A;  2Y4Q A;  2K2A A;  1CMF A;  3AAK A;  1SMG A;  1TN4 A;  1YRT B;  3I5F C;  1BT6 A;  3O6B A;  1KQM B;  2JC2 A;  5CSI A;  4A4B A;  3CR2 A;  5K89 A;  1SKT A;  3CTN A;  3BUO B;  3KEV A;  1S6J A;  1PSB A;  5HKY A;  5KU1 A;  4DCK A;  1NUB A;  2K8M B;  1B8R A;  1OMV A;  1MHO A;  3TS5 B;  1FW4 A;  3VRO A;  2KBI A;  3BXK A;  2EGD A;  5D7F A;  5AFP A;  2LLS A;  2WCB A;  3FWC A;  1Y1X A;  1BR1 B;  2KAX A;  2GGM A;  4MVF A;  2OPO A;  3E3R A;  1K95 A;  1C07 A;  1S26 D;  1SR6 C;  1PAL A;  3BQ3 A;  1BOD A;  2KOT A;  1QJT A;  3JTD C;  5B8I B;  1YUS A;  2CTN A;  2Q91 A;  1DF0 A;  1A75 A;  1C7V A;  1QLK A;  1EH2 A;  3CR4 X;  1CDN A;  1CKK A;  2QAC A;  2ZND A;  3H4S E;  2F2O A;  4OR9 B;  2M97 A;  1SYM A;  1GJY A;  3MSE B;  1DJX A;  3NSL A;  4YI9 A;  1K9U A;  1IWQ A;  4PE4 A;  4YRU A;  3WHU B;  1SL9 A;  3WXA A;  1TRF A;  1TNP A;  4ICB A;  4M2P A;  1IQ5 A;  3EK4 A;  1L2O B;  2R2I A;  1B8C A;  4GNK B;  1QX5 B;  1F55 A;  1WDC C;  1MXE A;  1XO5 A;  3BUW B;  1NPQ A;  1WRL A;  2K61 A;  2PSR A;  2BBM A;  3K21 A;  2Y1N A;  2NCP A;  3KHE A;  1KK8 C;  1AJ5 A;  4AOM A;  1CDL A;  1GQM A;  1KK7 Z;  2LHI A;  2HET A;  4MRX A;  3WHT B;  5JOL A;  2H61 C;  4CID A;  1YTZ C;  1SCM C;  1KCY A;  4I5N B;  2SCP A;  2JT8 A;  4CFQ A;  5I2Q A;  1CM4 A;  3DD4 A;  1LKJ A;  1KK8 B;  2KGB C;  4PCW A;  2L4H A;  1YRU B;  1KQV A;  4CLN A;  5D69 A;  1CMG A;  1XFU O;  3CS1 A;  3ZNI A;  1CLL A;  1DGU A;  3DF0 A;  3SG3 A;  1CFF A;  2DOQ A;  2KAV A;  1DGV A;  2FCE A;  4OV2 A;  3I5F B;  2JXL A;  2BCA A;  1ODB A;  2EHB A;  4BY4 A;  3I5G C;  1XA5 A;  1KSO A;  4GAO A;  4OCI A;  1PRW A;  2NLN A;  4QJ3 B;  4YGA A;  1FPW A;  2AAO A;  4A4C A;  5TNC A;  2M49 B;  1DTL A;  4HRE E;  3A8R A;  4D1E A;  2PMY A;  3KPX A;  1YX7 A;  1FI5 A;  5PAL A;  2KHN A;  1DJZ A;  2F2P A;  2L50 A;  3I5I C;  4IL1 A;  2FJU B;  2FCD A;  1OE9 B;  2JTZ A;  1W7I B;  2WCE A;  1J7R A;  1QVI Y;  3JVT B;  3LLE A;  3SG2 A;  2I7A A;  1TTX A;  2KI4 B;  1B1G A;  1D1O A;  4GGF C;  2M7L A;  3SIA A;  1XFV O;  2BKI B;  2E30 A;  1FF1 A;  1B7T Z;  4PE1 A;  1ZUZ A;  3HX4 A;  1VRK A;  4I5K A;  3NXA A;  1K96 A;  3JVT C;  2K7B A;  3OB2 B;  2VRG A;  4PHJ A;  5AER A;  1S5G Y;  5G08 A;  2NZ0 A;  1KWO B;  1IQ3 A;  1BR4 B;  3PAL A;  1TNX A;  3SG5 A;  4DRW A;  1J1D A;  1SL7 A;  1F54 A;  2MA2 A;  4FTG A;  2PAS A;  2CXJ A;  1ZFS A;  4PAL A;  1XFW O;  1EG3 A;  3I5H C;  3A4U B;  1WRZ A;  2LHL A;  2MRD A;  2BCX A;  1S6I A;  2KNE A;  1DJY A;  3D0Y A;  1TNQ A;  2LVV A;  3EKJ A;  2LCP A;  2RGI A;  2M3W A;  1BG1 A;  2JPT A;  1TOP A;  4N5X A;  1NX1 A;  1Q80 A;  2F3Y A;  1YVH A;  3IQQ A;  1SK6 D;  1KFU S;  4C0K A;  1DMO A;  1NIW A;  1MUX A;  1RJV A;  1SBJ A;  4GBA A;  1F70 A;  3PSR A;  1JBA A;  1OQP A;  2LP3 A;  1KFX S;  4E68 A;  1NX2 A;  2P6B B;  1NSH A;  1K90 D;  2JXC A;  3RLZ A;  4AQI A;  2JOJ A;  1LIN A;  1PSR A;  3VRQ A;  1UHK A;  2WND A;  1YUT A;  2L98 A;  1IJ5 A;  3WNX B;  1KWO C;  4USL A;  2F3Z A;  1TNW A;  2ZN9 A;  1WRK A;  3QRX A;  2KFG A;  2JWW A;  5IBW A;  5GQQ C;  1PK0 D;  2JTT A;  3CR5 X;  4PDZ A;  1GGW A;  3KF9 A;  3SG4 A;  2MJW B;  1LVC D;  4GGN A;  2ZN8 A;  4TNC A;  1S6C A;  5CSF A;  3C1V A;  1TCO B;  2PVB A;  1G8I A;  5I8N A;  1S36 A;  1SCM B;  3OX6 A;  3M0W A;  3VRR A;  2FOT A;  1DT7 B;  2ZNE A;  1QIW A;  1V1F A;  2LMU A;  4YBH B;  3TS5 C;  4BY5 A;  1J7O A;  2ZRS A;  3TDU A;  1QV1 A;  1M39 A;  1A03 A;  4CFR A;  4MZK A;  4MRY A;  1J7Q A;  4PHM A;  2Y1M A;  2HQW A;  1L2O C;  3AAJ A;  1EJ3 A;  3NSK A;  3DVE A;  3ZWH A;  1EXR A;  1TIZ A;  1E8A A;  1XYD A;  2F33 A;  1EL4 A;  1G33 A;  1WLZ A;  4NQG A;  3TUY B;  1R2U A;  2LMT A;  2M29 A;  4WQ2 A;  3DF0 B;  3I5H B;  1QIV A;  4NDC A;  2BBN A;  4MEW A;  1J7P A;  2MAZ A;  2K7D A;  4XJK B;  1EG4 A;  3CWG A;  4NDB A;  1QVI Z;  1BJF A;  1AP4 A;  2BE4 A;  5I2L A;  1OOJ A;  2O5G A;  2JU0 A;  2Y5I A;  2BCB A;  2M8U A;  1XK4 C;  1F71 A;  4OKH A;  2L0P A;  1QAT A;  1LXF C;  1BMO A;  1WY9 A;  5HKZ A;  4JPZ B;  2NXQ A;  3BOW A;  3GK1 A;  1HT9 A;  2NCO A;  2HQ8 A;  2HF5 A;  3PAT A;  1ALV A;  3GK4 X;  1IG5 A;  1MR8 A;  2AUC A;  2PAL A;  3NSI A;  2LUX A;  1CFD A;  1KFX L;  2OTG C;  3VRP A;  4C0J A;  1A4P A;  2LVK A;  1UHI A;  1CTR A;  3DVJ A;  2HPS A;  4ORC B;  4YGB B;  2MLF C;  1AVS A;  2BEC A;  4NDD A;  1A75 B;  4ORA B;  4GUK A;  3BYA A;  1CM1 A;  2KI6 D;  3D0Y B;  3VRN A;  4PE0 A;  4MSP A;  1KSM A;  1OMR A;  5DKQ A;  2MBX A;  1MQ1 A;  1F8H A;  1B47 A;  1CFC A;  1YUU A;  1XFX O;  1DJW A;  1OMD A;  2L5X B;  2CT9 A;  3I5G B;  1Y1U A;  1RRO A;  2MLE C;  4GGF A;  2AMI A;  2I2R E;  5AXI A;  2JNX A;  4PHK A;  1JUO A;  2LVJ A;  1ZMZ A;  1QS7 A;  1M63 B;  1K9P A;  1K8U A;  1UHH A;  1JSA A;  2TN4 A;  1HQV A;  1PUL A;  2KGR A;  1UHJ A;  2EC6 B;  2LMV A;  2MHH A;  1OZO A;  2LNK A;  3HCM A;  4QJ5 B;  3PFV A;  3KO0 A;  5HKW A;  4M2Q A;  2E6W A;  4FQO A;  1UHN A;  2M1U A;  1IGV A;  2O60 A;  3PM8 A;  1NYA A;  4N1F A;  1LA3 A;  1JF0 A;  1AHR A;  3F45 A;  3GK2 A;  2LE9 B;  3GOF A;  1QX2 A;  1SR6 B;  2KFF A;  3EVU A;  1Y6W A;  2K7O A;  3FS7 A;  3VGO A;  1CFP A;  1K9K A;  1BF5 A;  1M45 A;  3LK1 A;  1B7T Y;  3SG6 A;  3TZ1 A;  1M46 A;  2GV5 A;  5HYD A;  3EVR A;  1QXP A;  1B9A A;  1K94 A;  4YGE B;  3LCP C;  1S1E A;  1ALW A;  1KK7 Y;  1SPY A;  5JJG A;  4HSZ A;  5BPJ A;  1RWY A;  4HRG A;  4DIR A;  1A2X A;  3FIA A;  3ICB A;  1OSA A;  1RFJ A;  2BL0 B;  3BUN B;  1V1G A;  2G9B A;  1ZOT B;  1DJI A;  1XFY O;  1DJH A;  4M2O A;  1IJ6 A;  4I5L B;  3IQO A;  1BLQ A;  3JTD B;  4MZJ A;  3AKA A;  3O78 A;  1B8L A;  2KYF A;  3LL8 B;  3PLF B;  3EK8 A;  3DVM A;  1YR5 A;  3O2P A;  1JFK A;  1H8B A;  2H2K A;  1YVL A;  1SY9 A;  1K93 D;  2ZRT A;  5CPV A;  1JWD A;  4HRH A;  4YGC B;  3BUM B;  2OTG B;  2JUL A;  1QTX A;  4Q04 A;  3I5I B;  3SIB A;  4N1G A;  1NP8 A;  3RM1 A;  2LLT A;  1M31 A;  5HLV A;  1YX8 A;  1QV0 A;  2K2F A;  2LUC A;  1JFJ A;  1NCY A;  2PRU A;  1KQM C;  2KDH A;  1KFU L;  2SAS A;  2LC5 A;  4PE7 A;  4UPG A;  3EK7 A;  3AKB A;  4DUQ A;  1OZS A;  5I2O A;  4ZCU A;  1G4Y R;  3FWB A;  1SL8 A;  1SRA A;  5KSZ A;  4OVN F;  1LA0 A;  4QJ4 B;  2LP2 A;  2LM5 A;  5CSN A;  1SCV A;  1CB1 A;  1QAS A;  4AQJ A;  1DF0 B;  1MWN A;  2WOR A;  2V53 A;  2OS8 C;  2COL B;  4CPV A;  1F4Q A;  3PN7 B;  2BKH B;  2WCF A;  2B1U A;  2JT3 A;  1QLS A;  4GFT A;  3LK0 A;  2LV7 A;  3SJS A;  2CNP A;  2BE6 A;  4R1E A;  1S3P A;  2IS9 A;  2M0R A;  2KQ6 A;  2KI6 C;  3CLN A;  1BOC A;  1NX3 A;  2L4I A;  2L2E A;  5KTY A;  1REC A;  1NCX A;  1FI6 A;  1W7J B;  2K7C A;  1N0Y A;  2LAP A;  4JQ0 D;  1ZAC A;  4JWQ A;  2LLU A;  4YI8 A;  2GGZ A;  4MLW A;  1SW8 A;  3TDI A;  2JQ6 A;  2I18 A;  2OS8 B;  3OP0 A;  4XYN A;  1UP5 A;  2KBM A;  1J1E A;  1FBV A;  1JC2 A;  1BU3 A;  2I94 A;  1R6P A;  4I5J A;  3TDZ A;  2JZI A;  1B4C A;  1MF8 B;  1CLM A;  4U8D A;  4ZCV A;  1YUR A;  1H4B A;  1JF2 A;  4MZL A;  1IKU A;  1AJ4 A;  1U5I B;  2EC6 C;  2KI4 C;  3PN7 C;  2JRF A;  1XK4 A;  1Y1A A;  2LAN A;  5ER5 A;  2D8N A;  3NSO A;  1NWD A;  1PVA A;  5AEQ A;  2LVI A;  1RTP 1;  1IRJ A;  4ETO A;  4WRI A;  1GGZ A;  2JNF A;  1S5G Z;  3OHM B;  5J3X A;  1PVB A;  2G2B A;  1AK8 A;  5DKR A;  2WC8 A;  1Y0V H;  2K0J A;  2ZKM X;  3DVK A;  2ISD A;  1UUR A;  2JT0 A;  1U5I A;  3OX5 A;  2KYC A;  4GPL B;  4L9M A;  4PHN A;  5AAN A;  3EVV A;  2A4J A;  2ZFD A;  4YGD B;  1K2H A;  3BUX B;  4P2Y B;  4ORB B;  5CSJ A;  1CLB A;  1N65 A;  1RK9 A;  3SG7 A;  4DS7 A;  2M9G A;  1WLM A;  3EKH A;  5ER4 X;  2KAY A;  1F4O A;  1XVJ A;  1NX0 A;  5HLO A;  1L7Z A;  3D10 A;  2QPT A;  1AUI B;  2L51 A;  1SNL A;  1X02 A;  3TUY C;  2M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...