2KI4C

Fgf1-s100a13 complex structure: key component in non-classical path way of fgf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
97
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The heterohexameric complex structure, a component in the non-classical pathway for fibroblast growth factor 1 (FGF1) secretion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ki4C00
1MWNA 1FI6A 2CCMA 2L0PA 2M1KB 5HKYA 3EKHA 1B1GA 3IQQA 1CB1A 4R1EA 1R6PA 1X02A 2M1UA 4YI9A 1QLKA 1DTLA 2BE6A 3EVRA 3OP0A 4UPGA 1RFJA 4JWQA 3D10A 2KYCA 1DJWA 2LP3A 3A8RA 3BUNB 4PHJA 3VGOA 2KFFA 3IQOA 1C7WA 1S3PA 1CLMA 2M0RA 1IGVA 1F8HA 3IF7A 3PLFB 2KBMA 3EK4A 1PALA 4U8DA 2M97A 1J7PA 1G8IA 4N1GA 2BE4A 1J7QA 1OMDA 1SCVA 3FIAA 1J1EA 1D1OA 1CLBA 1BT6A 1UUSA 1LA0A 4HRHA 4E68A 3DF0B 3JTDB 5HYDA 5IBWA 1QXPA 3O2PA 1UHJA 1YUUA 2LAPA 1DMOA 1NX0A 1R2UA 1WDCC 3SG2A 1WLZA 3HCMA 3TS5C 3TUYC 1KK8B 4PALA 2V53A 4ORCB 3BUOB 1MXEA 1CMFA 2CTNA 1XVJA 1YUTA 2JOJA 2LE9B 1LXFC 1RJVA 2OPOA 3SJSA 3I5IC 4WQ2A 4JPZB 1TNPA 2LM5A 1WRKA 1MR8A 4PHNA 1GGWA 2LMUA 2JULA 1XFWO 2BL0B 5JJGA 2LMTA 1GQMA 1YRUB 2H61C 3SG7A 3SG3A 4PE4A 3BOWB 1CDMA 4TNCA 1RTP1 1QATA 1BODA 2LLUA 2QACA 3PN7C 1KWOC 3VRNA 4FQOA 3VRQA 2F33A 1XO5A 1AJ5A 3WHTB 1YRTB 1SL9A 4DCKA 1B8CA 1OZSA 4P5OE 4BY4A 2DOQA 2KAVA 1B7TZ 2JTTA 4F0ZB 4I5JA 3MSEB 2KGRA 4PCWA 4P2YB 4GUKA 2OTGC 2F3ZA 1XFXO 2G9BA 1C7VA 4I5KA 4A4BA 1SL7A 1CNPA 3SG6A 4QJ4B 3TDIA 2KFHA 2OS8B 1JF0A 3EVVA 3DF0A 5HKZA 1MHOA 4XJKB 1U5IB 2LMVA 4MLWA 1BLQA 3E3RA 3I5FB 1SRAA 1RECA 1NX3A 1BG1A 3D0YB 2Q4UA 1QVIZ 4DRWA 1CFCA 1M39A 2JPTA 3FWCA 4DS7A 1QX2A 5AXIA 2GGZA 1UHHA 2KAYA 1A75B 2HQ8A 4OVNF 1DF0B 1CM4A 3ZNIA 1A29A 1SCMC 1BU3A 1EL4A 2JT8A 4GGFC 4DIRA 3SIBA 1SNLA 1Y0VH 1JFKA 5FYXA 3CGAA 1KQMB 5D7FA 1B8RA 1OMVA 1FF1A 2I7AA 1S5GY 3BOWA 4GAOA 5BPJA 3CR5X 2L2EA 1WY9A 5HKWA 2LVVA 4MZLA 4ZCVA 2K8MB 2LLTA 2K7BA 3JVTC 2K61A 1Y1UA 2LC5A 3EK8A 3NSKA 2KI6D 4I5LB 4PHMA 4QJ5B 2NCPA 2JTZA 4M2PA 4MSPA 5AERA 2I18A 4GPLB 1NPQA 2EC6B 2L4HA 1N2DA 1KK7Y 1LKJA 1RK9A 1Y1XA 2NXQA 4NDBA 1DGVA 4MRYA 4CFRA 1L2OB 4YBHB 3M0WA 1PULA 2FOTA 1KK8C 2K2FA 1EJ3A 2WNDA 1H4BA 1NIWA 2F2PA 1SL8A 1CMGA 4MBEA 3BYAA 3PM8A 5KTYA 1LVCD 2JRFA 3DVJA 3O6BA 4HREE 1S6CA 1NCXA 1SBJA 3KO0A 1MXLC 2MLEC 2K0JA 4XJKA 1U5IA 4GNKB 3PALA 1JWDA 3CWGA 1DGUA 3D0YA 1NUBA 1MUXA 3AAKA 1YVHA 3NSLA 1N0YA 2AMIA 3BUXB 4YRUA 3SG4A 2KDHA 1M63B 1PK0D 1A75A 2ZN9A 1ALVA 3I5HC 1AJ4A 1DF0A 2MBXA 1K9UA 1UURA 2BBMA 1SY9A 1ZOTB 1XK4C 2PSRA 2E6WA 1L7ZA 1NSHA 2ZFDA 4MVFA 3FWBA 1K90D 1CKKA 4YGEB 4OCIA 2M49B 1S6JA 1N65A 3O78A 1JFJA 2PRUA 4XYNA 1AK8A 2LVJA 3DVKA 1UWOA 2KI4C 4YI8A 3WXAA 1BR4B 2LANA 1OZOA 1CFDA 4OR9B 4YGDB 5AFPA 1SMGA 4USLA 4CIDA 3AKBA 3NSIA 2M9GA 2AAOA 4NDCA 1G33A 1S6IA 2OS8C 4A4CA 1DVIA 2EHBA 1UHNA 1YTZC 4D1EA 1QASA 2KAXA 2L4IA 1NWDA 3I5GC 1TCOB 2PMYA 2FCDA 1DJHA 1IJ5A 1NCYA 1TOPA 1G4YR 1SR6B 1B4CA 1J55A 1IWQA 1TNWA 3NXAA 1M45A 5I2LA 4CFQA 1YURA 3KPXA 1TTXA 4HRGA 1LINA 4OKHA 4I5NB 3BXKA 2P6BB 5CSFA 2L50A 1S36A 1ZFSA 2HF5A 3LK1A 2JXCA 3LL8B 1AVSA 4QJ3B 1UHKA 1UP5A 2LV7A 4DUQA 1EXRA 2WC8A 2GV5A 3C1VA 5CSNA 3CZTX 1KSOA 1H8BA 3NSOA 2F2OA 1KCYA 3WHUB 1B9AA 4Q04A 1KSMA 4MEWA 1SPYA 2BCBA 2CBLA 4C0JA 1A4PA 1DJZA 2ZNDA 1K2HA 2NLNA 1KFUS 4OV2A 1ZUZA 3VRPA 1Y6WA 1J7OA 1Y1AA 1QLSA 5G08A 1KFUL 1JF2A 1OMRA 2LP2A 2QPTA 3TUYB 1WDCB 1WRLA 2M29A 2NZ0A 3TS5B 3ICBA 3VRRA 4IL1A 3PSRA 1K9PA 4PHKA 5PALA 1B7TY 3GOFA 2KHNA 3QRXA 5DKQA 1K95A 2MRDA 3FS7A 3I5IB 2M7LA 1PSBA 4PE7A 1B47A 3GK4X 1OQPA 2WOSA 4BY5A 1VRKA 2BECA 3H4SE 2ISDA 2CT9A 4GBAA 2Y1MA 2RGIA 1CFPA 5ER5A 2H2KA 2KGBC 2L51A 3OX5A 2SASA 1A2XA 2FJUB 1XFYO 3AAJA 2I94A 3GK1A 3WNXB 2D8NA 1YX8A 2KSPA 1KWOB 5ER4X 4ETOA 2SCPA 3DVEA 1F54A 1OSAA 1K93D 3KHEA 1QVIY 4GGNA 2PVBA 4C0KA 3JTDC 3OX6A 1QIVA 1DJIA 1QS7A 5CSIA 1BMOA 3EVUA 3RM1A 1BOCA 1BJFA 2JWWA 3VROA 2AUCA 2JC2A 2PASA 2FCEA 2JNFA 2LUXA 1RWYA 4ICBA 1EG4A 2BBNA 2WCBA 2BCXA 2MHHA 5D69A 5JOLA 4JQ0D 1TNQA 4L9MA 3LK0A 2BL0C 2LHIA 3EK7A 2ZN8A 2Q91A 5I2OA 1JBAA 1SR6C 2CXJA 2HETA 1JSAA 1BF5A 2M8UA 3LLEA 1YVLA 1IH0A 3DVMA 1CDPA 3SG5A 1DJGA 5CSJA 5K89A 5DKRA 4AQJA 2HPSA 5GQQC 2WCEA 2BKIB 3ZWHA 2GGMA 4ZCUA 4AOMA 1F70A 1V1FA 1OE9B 1IRJA 1SCMB 4CPVA 1MF8B 2BKHB 1CTRA 1NP8A 3SIAA 2F3YA 2WCFA 3BQ3A 1IQ3A 1SKTA 1QX5B 1TNXA 4C0LA 2H61A 1WLMA 1ALWA 1IKUA 2K7OA 1UHIA 1A03A 1NX2A 3PATA 1C07A 1WRZA 2Y5IA 2KI6C 3BUMB 3JVTB 4AQIA 2BCAA 1F4OA 3OHMB 4PDZA 4MRXA 2O5GA 1SW8A 2JNXA 2KBIA 4NQGA 1AP4A 2MA2A 3AKAA 3I5FC 4M2QA 1AHRA 2F8PA 1S26D 1V1GA 3LCPC 5AANA 1XA5A 5KU1A 2R2IA 4NDDA 1XYDA 1YR5A 4ORBB 1F4QA 1CFFA 1ODBA 3CLNA 1J7RA 2Y1NA 3HX4A 1K96A 4YGAA 1OOJA 1XFVO 1TIZA 5I2QA 1KQMC 2A4JA 2ZRSA 1NCZA 3KEVA 2MAZA 1GJYA 1K9KA 4MZKA 2KNEA 1W7IB 2JT0A 1HT9A 2JXLA 1DJYA 4N5XA 3CTNA 4M2OA 2ZRTA 1LA3A 1QV0A 4WQ3A 3GK2A 4HSZA 5B8IB 3I5HB 3TDZA 2KOTA 2B1UA 2IS9A 2EGDA 5TNCA 2EC6C 2I2RE 5HLVA 3K21A 3CR4X 1SK6D 2HQWA 2O60A 4GGFA 2KQ6A 2MLFC 2L98A 1SYMA 1YUSA 4FTGA 1XFZO 4MZJA 1L2OC 2MJWB 2Y4QA 1PVBA 2LCPA 2ZNEA 2KI4B 3A4UB 1K8UA 1CDLA 1M31A 4ORAB 3TZ1A 1F71A 3F45A 2K7DA 4GFTA 4CLNA 1S5GZ 2LUCA 3OB2B 1FW4A 1JUOA 1QX7A 4N1FA 1B8LA 2E30A 2LHLA 1K94A 3OB1B 4WRIA 1XFUO 2PALA 1EG3A 1IJ6A 2NCOA 2WORA 1W7JB 1QV1A 3I5GB 4YGBB 1RROA 2JZIA 3CS1A 5CPVA 1KK7Z 1CM1A 1CLLA 2ZKMX 4PE1A 3PN7B 2KFGA 2VRGA 2JQ6A 2M7NA 1TRFA 2CNPA 1DJXA 1PRWA 1QJTA 3CR2A 1JC2A 2M3WA 1AUIB 2KYFA 3PFVA 1YX7A 5I8NA 1TN4A 2KQYA 3BUWB 3EKJA 2JU0A 3RLZA 2K7CA 1NYAA 1E8AA 1QTXA 1GGZA 2COLB 1IG5A 1DT7B 2L5XB 1KFXS 2OTGB 2K2AA 5J3XA 1IQ5A 1J1DA 1MQ1A 1ZMZA 2JT3A 1CDNA 4YGCB 1ZACA 1XK4A 2LLSA 2LVIA 1FPWA 2TN4A 3TDUA 1KFXL 4PE0A 1PVAA 3O4YA 2LNKA 2G2BA 1FBVA 5HLOA 1F55A 1FI5A 1EH2A 1PSRA 1Q80A 1M46A 3DD4A 5F6TA 5AEQA 5KSZA 2LVKA 1NX1A 1HQVA 1KQVA 1BR1B 1S1EA 1TCFA 4MN0A 5DKNA 3KF9A 1QIWA
chains in the Genus database with same CATH superfamily
1MWNA 1FI6A 2CCMA 2L0PA 2M1KB 5HKYA 3EKHA 1B1GA 3IQQA 3B88A 1CB1A 4R1EA 1R6PA 1X02A 2M1UA 4YI9A 1QLKA 5FI2A 1DTLA 2BE6A 3EVRA 3OP0A 4UPGA 1RFJA 2WCJA 3D10A 4JWQA 2KYCA 1DJWA 2LP3A 3A8RA 3BUNB 3CABA 4PHJA 3VGOA 2KFFA 3IQOA 1C7WA 1S3PA 1CLMA 2M0RA 1IGVA 1F8HA 3IF7A 3PLFB 2KBMA 3EK4A 2WC5A 1PALA 4U8DA 2M97A 1J7PA 1G8IA 2QEVA 4F7FA 4N1GA 2BE4A 1J7QA 1OMDA 1SCVA 3FIAA 1J1EA 1D1OA 1CLBA 1BT6A 1UUSA 1LA0A 4HRHA 4E68A 3DF0B 3JTDB 5HYDA 3NHIA 5IBWA 1QXPA 3O2PA 1UHJA 1YUUA 2LAPA 3B87A 3PM2A 1DMOA 3O4XA 1NX0A 1R2UA 1WDCC 3SG2A 1WLZA 3HCMA 3CZ0A 3TS5C 3TUYC 1KK8B 4PALA 2V53A 3Q8IA 3BUOB 1MXEA 4ORCB 2CTNA 1XVJA 1YUTA 2JOJA 1CMFA 2LE9B 1LXFC 1RJVA 2OPOA 3SJSA 3I5IC 4WQ2A 4JPZB 1TNPA 2LM5A 1WRKA 1MR8A 2K60A 3K1EA 4PHNA 3S0EA 1GGWA 2LMUA 2JULA 1XFWO 2BL0B 5JJGA 2LMTA 1GQMA 1YRUB 2H61C 3SG7A 3SG3A 4PE4A 3BOWB 1CDMA 4TNCA 1RTP1 1QATA 1BODA 2LLUA 2QACA 3CYZA 3PN7C 1KWOC 1OOIX 1SSEB 4FQOA 3VRNA 3VRQA 2F33A 1XO5A 3R1VA 1AJ5A 3WHTB 1YRTB 1SL9A 4DCKA 1B8CA 1OZSA 4P5OE 4BY4A 2DOQA 2KAVA 4KYNA 1B7TZ 2JTTA 4F0ZB 2BAPA 4I5JA 3MSEB 2KGRA 4PCWA 4P2YB 4GUKA 2OTGC 2F3ZA 1XFXO 2G9BA 1C7VA 2KLDA 4I5KA 3UNWA 4A4BA 1SL7A 1CNPA 3SG6A 4QJ4B 3TDIA 2KFHA 3FE6A 2OS8B 1JF0A 3EVVA 3DF0A 5HKZA 5EL2A 1MHOA 4XJKB 1U5IB 2LMVA 2QEOA 4MLWA 3BJHA 1BLQA 3E3RA 3I5FB 1SRAA 1RECA 1NX3A 1BG1A 5FI7A 2WC6A 3PJIA 3D0YB 2Q4UA 1QVIZ 4DRWA 1CFCA 1M39A 2JPTA 3FWCA 4DS7A 1QX2A 1TUJA 5AXIA 2GGZA 1UHHA 2KAYA 2WCKA 1A75B 2HQ8A 4OVNF 1DF0B 1CM4A 3ZNIA 1A29A 1SCMC 1BU3A 1EL4A 2JT8A 4GGFC 4DIRA 3CDNA 3SIBA 1SNLA 1Y0VH 1JFKA 3FE8A 5FYXA 3CGAA 1OW4A 1KQMB 5D7FA 1B8RA 1OMVA 1FF1A 2I7AA 1S5GY 3BOWA 4GAOA 5BPJA 3CR5X 2L2EA 1WY9A 5HKWA 3S0BA 2LVVA 4MZLA 4ZCVA 1W9ZA 2K8MB 2LLTA 2K7BA 3JVTC 2K61A 1Y1UA 2LC5A 3EK8A 3NSKA 2KI6D 4I5LB 4PHMA 4QJ5B 2NCPA 2JTZA 4M2PA 4MSPA 5AERA 2I18A 4GPLB 1NPQA 2EC6B 2L4HA 3OGNA 1N2DA 1KK7Y 1XFRA 1LKJA 1RK9A 1Y1XA 2NXQA 4NDBA 1DGVA 4MRYA 4CFRA 1L2OB 4YBHB 3M0WA 1PULA 2FOTA 1KK8C 2K2FA 1EJ3A 2WNDA 1H4BA 1NIWA 2F2PA 1SL8A 1CMGA 4MBEA 3BFHA 3BYAA 3PM8A 5I94A 5KTYA 1LVCD 2JRFA 3DVJA 3O6BA 4HREE 1S6CA 2GTEA 2L2CA 3DY9A 1NCXA 1SBJA 3KO0A 1MXLC 2MLEC 2K0JA 4XJKA 1U5IA 4GNKB 3PALA 1JWDA 3CWGA 1DGUA 3D0YA 1NUBA 1MUXA 3AAKA 1YVHA 3NSLA 1N0YA 2AMIA 3BUXB 4YRUA 3SG4A 2KDHA 1M63B 1PK0D 3FE9A 3UO9A 1A75A 2ZN9A 1ALVA 3I5HC 1AJ4A 3R1OA 1DF0A 4JKTA 2MBXA 1K9UA 1UURA 2BBMA 1SY9A 1ZOTB 1XK4C 2PSRA 2E6WA 1L7ZA 1NSHA 2ZFDA 4MVFA 3FWBA 1K90D 1CKKA 4YGEB 4OCIA 2M49B 1S6JA 1N65A 3O78A 1JFJA 2PRUA 4XYNA 1AK8A 2LVJA 4IJ7A 3DVKA 1UWOA 2KI4C 4YI8A 3S0DA 3WXAA 1BR4B 2LANA 1OZOA 1CFDA 3B86A 4INWA 4OR9B 4YGDB 5AFPA 1SMGA 4JD9A 4USLA 3AKBA 3NSIA 4CIDA 1DQEA 2AAOA 2M9GA 2WCHA 4NDCA 1G33A 1S6IA 2OS8C 3L4AA 1DVIA 2EHBA 1UHNA 1YTZC 4A4CA 4D1EA 1QASA 2KAXA 2L4IA 1NWDA 3I5GC 1TCOB 2PMYA 2FCDA 1DJHA 5D3OA 1IJ5A 1NCYA 1TOPA 1G4YR 1SR6B 1B4CA 1J55A 1IWQA 1TNWA 3NXAA 1M45A 3NHTA 5I2LA 4CFQA 1YURA 3KPXA 1TTXA 3L47A 4HRGA 3L4LA 1LINA 4OKHA 1OOFA 4I5NB 3BXKA 2P6BB 5CSFA 2L50A 1S36A 1ZFSA 2HF5A 3LK1A 2JXCA 3LL8B 1AVSA 4QJ3B 1OOHA 1UHKA 1UP5A 2LV7A 4DUQA 1EXRA 2WC8A 2GV5A 3C1VA 5CSNA 3CZTX 1KSOA 1H8BA 3NSOA 3DXLA 2F2OA 1C3YA 2JPOA 3WHUB 1KCYA 3DZTA 1B9AA 1DEKA 1KSMA 4MEWA 1SPYA 2BCBA 2CBLA 4Q04A 4C0JA 1A4PA 1DJZA 2P70A 2ZNDA 1K2HA 2NLNA 3S0GA 5DICA 1KFUS 1TWOA 3QMEA 4OV2A 2ERBA 2KLEA 5FI6A 1ZUZA 3VRPA 1Y6WA 1J7OA 1Y1AA 1QLSA 1DC1A 3D75A 1KFUL 2QDIA 5G08A 1JF2A 1OMRA 2LP2A 2QPTA 3TUYB 1WDCB 1WRLA 2M29A 2NZ0A 3TS5B 3ICBA 3VRRA 4IL1A 3PSRA 1K9PA 3N7HA 4PHKA 5PALA 1B7TY 3GOFA 2KHNA 3QRXA 3S0FA 5DKQA 1K95A 2MRDA 3RZSA 3FS7A 3I5IB 2FJYA 1PSBA 4PE7A 1B47A 2M7LA 3GK4X 1OQPA 2WOSA 4BY5A 1VRKA 2BECA 3H4SE 2ISDA 2PYQA 2CT9A 4GBAA 2Y1MA 2RGIA 3BFBA 1CFPA 5ER5A 2H2KA 2KGBC 2L51A 3OX5A 2SASA 1A2XA 2FJUB 3D77A 1XFYO 3AAJA 2I94A 3GK1A 3WNXB 3SS5A 1OOGA 2D8NA 1YX8A 2KSPA 1KWOB 5ER4X 4ETOA 2SCPA 3DVEA 1F54A 1OSAA 1K93D 3KHEA 1QVIY 4GGNA 2PVBA 4C0KA 3JTDC 3OX6A 1QIVA 1DJIA 1QS7A 5CSIA 3VB1A 1BMOA 1IIOA 3EVUA 3RM1A 1BOCA 1BJFA 2JWWA 3VROA 2AUCA 2JC2A 2PASA 3D73A 2FCEA 4PT1A 2JNFA 2LUXA 1RWYA 1LS8A 2BNXA 4ICBA 1EG4A 2BBNA 2WCBA 2BCXA 2MHHA 5D69A 5JOLA 4JQ0D 1TNQA 4L9MA 4INXA 3LK0A 2BL0C 2LHIA 3EK7A 2ZN8A 2Q91A 3NGVA 5I2OA 3R72A 3V2LA 1JBAA 1SR6C 2CXJA 2HETA 1JSAA 1BF5A 2M8UA 3S0AA 3LLEA 1YVLA 1IH0A 3DVMA 1CDPA 3SG5A 1DJGA 1ORGA 5CSJA 5K89A 5DKRA 4AQJA 2HPSA 5GQQC 2WCEA 2BKIB 3ZWHA 2GGMA 4ZCUA 4AOMA 1F70A 1Z4HA 1V1FA 1OE9B 1IRJA 1SCMB 4CPVA 1MF8B 2BKHB 1CTRA 1NP8A 2QEHA 3SIAA 2F3YA 2WCFA 3BQ3A 1IQ3A 1SKTA 1QX5B 1TNXA 4C0LA 2H61A 3IVTA 2QEBA 1WLMA 1ALWA 1IKUA 2K7OA 1UHIA 5HL1A 1A03A 1NX2A 3BFAA 1C3ZA 3PATA 1C07A 1WRZA 2P71A 2Y5IA 2KI6C 3BUMB 3JVTB 3CZ2A 3EG5B 3R1PA 1GM0A 2WCLA 4AQIA 2BCAA 1F4OA 3OHMB 4PDZA 4MRXA 2O5GA 1SW8A 2JNXA 4FQTA 2KBIA 4NQGA 2PQLA 1AP4A 2MA2A 3AKAA 3I5FC 4M2QA 1AHRA 2F8PA 1S26D 1V1GA 3LCPC 2WCMA 5AANA 1XA5A 5KU1A 3B7AA 2R2IA 4NDDA 1XYDA 1YR5A 3CZ1A 4ORBB 1F4QA 1CFFA 1ODBA 3CLNA 1J7RA 2Y1NA 2KPHA 3HX4A 1K96A 4YGAA 1OOJA 1XFVO 1TIZA 5I2QA 1KQMC 2A4JA 2ZRSA 1NCZA 3KEVA 2MAZA 1GJYA 1K9KA 4MZKA 2KNEA 1W7IB 2JT0A 1HT9A 2JXLA 1DJYA 4N5XA 3CTNA 4M2OA 2ZRTA 1LA3A 1QV0A 4WQ3A 3GK2A 4HSZA 5B8IB 3I5HB 3TDZA 2KOTA 2B1UA 2IS9A 2EGDA 5TNCA 2EC6C 2I2RE 5HLVA 3K21A 3CR4X 1SK6D 2HQWA 2O60A 4GGFA 2KQ6A 2MLFC 2L98A 3D76A 1SYMA 1YUSA 4FTGA 1XFZO 1QWVA 4MZJA 1L2OC 2MJWB 2Y4QA 1PVBA 2LCPA 2ZNEA 2KI4B 3A4UB 1K8UA 1CDLA 1M31A 4ORAB 3TZ1A 1F71A 3F45A 3DYEA 2K7DA 4GFTA 4CLNA 1S5GZ 2LUCA 3OB2B 1FW4A 1JUOA 1T14A 2H8VA 1P28A 3SS3A 1QX7A 4N1FA 1B8LA 2E30A 2LHLA 1K94A 3OB1B 3OBVA 4WRIA 1XFUO 2PALA 1EG3A 1IJ6A 2NCOA 2WORA 1W7JB 1QV1A 3I5GB 4YGBB 1RROA 2JZIA 3CS1A 1TUZA 5CPVA 1KK7Z 1CM1A 1CLLA 2ZKMX 4PE1A 3PN7B 2KFGA 2VRGA 2JQ6A 2M7NA 1TRFA 2CNPA 1DJXA 1PRWA 1QJTA 3CR2A 1JC2A 2M3WA 1AUIB 2KYFA 3PFVA 1YX7A 5I8NA 3SS4A 1TN4A 2KQYA 3BUWB 3EKJA 2JU0A 2YGUA 3RLZA 2K7CA 3D74A 1NYAA 1E8AA 1QTXA 1GGZA 2COLB 1IG5A 3D78A 1DT7B 2L5XB 1KFXS 2OTGB 2K2AA 5J3XA 1IQ5A 1J1DA 1MQ1A 1ZMZA 4OZDA 2JT3A 1CDNA 4YGCB 1ZACA 1XK4A 2LLSA 2LVIA 1FPWA 2TN4A 3TDUA 1KFXL 4PE0A 1PVAA 3O4YA 2LNKA 2G2BA 1FBVA 5HLOA 1F55A 1FI5A 1EH2A 1PSRA 1Z2CB 1Q80A 1M46A 3DD4A 5F6TA 1DELA 5AEQA 5KSZA 3B6XA 2LVKA 2L5YA 1NX1A 1HQVA 1KQVA 1BR1B 1S1EA 1TCFA 4MN0A 5DKNA 3KF9A 1QIWA
chains in the Genus database with same CATH topology
1MWNA 1FI6A 2CCMA 2L0PA 2M1KB 5HKYA 3EKHA 1B1GA 3IQQA 1CB1A 4R1EA 1R6PA 1X02A 2M1UA 4YI9A 1QLKA 1DTLA 2BE6A 3EVRA 3OP0A 4UPGA 1RFJA 4JWQA 3D10A 2KYCA 1DJWA 2LP3A 3A8RA 3BUNB 4PHJA 3VGOA 2KFFA 3IQOA 1C7WA 1S3PA 1CLMA 2M0RA 1IGVA 1F8HA 3IF7A 3PLFB 2KBMA 3EK4A 1PALA 4U8DA 2M97A 1J7PA 1G8IA 4N1GA 2BE4A 1J7QA 1OMDA 1SCVA 3FIAA 1J1EA 1D1OA 1CLBA 1BT6A 1UUSA 1LA0A 4HRHA 4E68A 3DF0B 3JTDB 5HYDA 5IBWA 1QXPA 3O2PA 1UHJA 1YUUA 2LAPA 1DMOA 1NX0A 1R2UA 1WDCC 3SG2A 1WLZA 3HCMA 3TS5C 3TUYC 1KK8B 4PALA 2V53A 4ORCB 3BUOB 1MXEA 1CMFA 2CTNA 1XVJA 1YUTA 2JOJA 2LE9B 1LXFC 1RJVA 2OPOA 3SJSA 3I5IC 4WQ2A 4JPZB 1TNPA 2LM5A 1WRKA 1MR8A 4PHNA 1GGWA 2LMUA 2JULA 1XFWO 2BL0B 5JJGA 2LMTA 1GQMA 1YRUB 2H61C 3SG7A 3SG3A 4PE4A 3BOWB 1CDMA 4TNCA 1RTP1 1QATA 1BODA 2LLUA 2QACA 3PN7C 1KWOC 3VRNA 4FQOA 3VRQA 2F33A 1XO5A 1AJ5A 3WHTB 1YRTB 1SL9A 4DCKA 1B8CA 1OZSA 4P5OE 4BY4A 2DOQA 2KAVA 1B7TZ 2JTTA 4F0ZB 4I5JA 3MSEB 2KGRA 4PCWA 4P2YB 4GUKA 2OTGC 2F3ZA 1XFXO 2G9BA 1C7VA 4I5KA 4A4BA 1SL7A 1CNPA 3SG6A 4QJ4B 3TDIA 2KFHA 2OS8B 1JF0A 3EVVA 3DF0A 5HKZA 1MHOA 4XJKB 1U5IB 2LMVA 4MLWA 1BLQA 3E3RA 3I5FB 1SRAA 1RECA 1NX3A 1BG1A 3D0YB 2Q4UA 1QVIZ 4DRWA 1CFCA 1M39A 2JPTA 3FWCA 4DS7A 1QX2A 5AXIA 2GGZA 1UHHA 2KAYA 1A75B 2HQ8A 4OVNF 1DF0B 1CM4A 3ZNIA 1A29A 1SCMC 1BU3A 1EL4A 2JT8A 4GGFC 4DIRA 3SIBA 1SNLA 1Y0VH 1JFKA 5FYXA 3CGAA 1KQMB 5D7FA 1B8RA 1OMVA 1FF1A 2I7AA 1S5GY 3BOWA 4GAOA 5BPJA 3CR5X 2L2EA 1WY9A 5HKWA 2LVVA 4MZLA 4ZCVA 2K8MB 2LLTA 2K7BA 3JVTC 2K61A 1Y1UA 2LC5A 3EK8A 3NSKA 2KI6D 4I5LB 4PHMA 4QJ5B 2NCPA 2JTZA 4M2PA 4MSPA 5AERA 2I18A 4GPLB 1NPQA 2EC6B 2L4HA 1N2DA 1KK7Y 1LKJA 1RK9A 1Y1XA 2NXQA 4NDBA 1DGVA 4MRYA 4CFRA 1L2OB 4YBHB 3M0WA 1PULA 2FOTA 1KK8C 2K2FA 1EJ3A 2WNDA 1H4BA 1NIWA 2F2PA 1SL8A 1CMGA 4MBEA 3BYAA 3PM8A 5KTYA 1LVCD 2JRFA 3DVJA 3O6BA 4HREE 1S6CA 1NCXA 1SBJA 3KO0A 1MXLC 2MLEC 2K0JA 4XJKA 1U5IA 4GNKB 3PALA 1JWDA 3CWGA 1DGUA 3D0YA 1NUBA 1MUXA 3AAKA 1YVHA 3NSLA 1N0YA 2AMIA 3BUXB 4YRUA 3SG4A 2KDHA 1M63B 1PK0D 1A75A 2ZN9A 1ALVA 3I5HC 1AJ4A 1DF0A 2MBXA 1K9UA 1UURA 2BBMA 1SY9A 1ZOTB 1XK4C 2PSRA 2E6WA 1L7ZA 1NSHA 2ZFDA 4MVFA 3FWBA 1K90D 1CKKA 4YGEB 4OCIA 2M49B 1S6JA 1N65A 3O78A 1JFJA 2PRUA 4XYNA 1AK8A 2LVJA 3DVKA 1UWOA 2KI4C 4YI8A 3WXAA 1BR4B 2LANA 1OZOA 1CFDA 4OR9B 4YGDB 5AFPA 1SMGA 4USLA 4CIDA 3AKBA 3NSIA 2M9GA 2AAOA 4NDCA 1G33A 1S6IA 2OS8C 4A4CA 1DVIA 2EHBA 1UHNA 1YTZC 4D1EA 1QASA 2KAXA 2L4IA 1NWDA 3I5GC 1TCOB 2PMYA 2FCDA 1DJHA 1IJ5A 1NCYA 1TOPA 1G4YR 1SR6B 1B4CA 1J55A 1IWQA 1TNWA 3NXAA 1M45A 5I2LA 4CFQA 1YURA 3KPXA 1TTXA 4HRGA 1LINA 4OKHA 4I5NB 3BXKA 2P6BB 5CSFA 2L50A 1S36A 1ZFSA 2HF5A 3LK1A 2JXCA 3LL8B 1AVSA 4QJ3B 1UHKA 1UP5A 2LV7A 4DUQA 1EXRA 2WC8A 2GV5A 3C1VA 5CSNA 3CZTX 1KSOA 1H8BA 3NSOA 2F2OA 1KCYA 3WHUB 1B9AA 4Q04A 1KSMA 4MEWA 1SPYA 2BCBA 2CBLA 4C0JA 1A4PA 1DJZA 2ZNDA 1K2HA 2NLNA 1KFUS 4OV2A 1ZUZA 3VRPA 1Y6WA 1J7OA 1Y1AA 1QLSA 5G08A 1KFUL 1JF2A 1OMRA 2LP2A 2QPTA 3TUYB 1WDCB 1WRLA 2M29A 2NZ0A 3TS5B 3ICBA 3VRRA 4IL1A 3PSRA 1K9PA 4PHKA 5PALA 1B7TY 3GOFA 2KHNA 3QRXA 5DKQA 1K95A 2MRDA 3FS7A 3I5IB 2M7LA 1PSBA 4PE7A 1B47A 3GK4X 1OQPA 2WOSA 4BY5A 1VRKA 2BECA 3H4SE 2ISDA 2CT9A 4GBAA 2Y1MA 2RGIA 1CFPA 5ER5A 2H2KA 2KGBC 2L51A 3OX5A 2SASA 1A2XA 2FJUB 1XFYO 3AAJA 2I94A 3GK1A 3WNXB 2D8NA 1YX8A 2KSPA 1KWOB 5ER4X 4ETOA 2SCPA 3DVEA 1F54A 1OSAA 1K93D 3KHEA 1QVIY 4GGNA 2PVBA 4C0KA 3JTDC 3OX6A 1QIVA 1DJIA 1QS7A 5CSIA 1BMOA 3EVUA 3RM1A 1BOCA 1BJFA 2JWWA 3VROA 2AUCA 2JC2A 2PASA 2FCEA 2JNFA 2LUXA 1RWYA 4ICBA 1EG4A 2BBNA 2WCBA 2BCXA 2MHHA 5D69A 5JOLA 4JQ0D 1TNQA 4L9MA 3LK0A 2BL0C 2LHIA 3EK7A 2ZN8A 2Q91A 5I2OA 1JBAA 1SR6C 2CXJA 2HETA 1JSAA 1BF5A 2M8UA 3LLEA 1YVLA 1IH0A 3DVMA 1CDPA 3SG5A 1DJGA 5CSJA 5K89A 5DKRA 4AQJA 2HPSA 5GQQC 2WCEA 2BKIB 3ZWHA 2GGMA 4ZCUA 4AOMA 1F70A 1V1FA 1OE9B 1IRJA 1SCMB 4CPVA 1MF8B 2BKHB 1CTRA 1NP8A 3SIAA 2F3YA 2WCFA 3BQ3A 1IQ3A 1SKTA 1QX5B 1TNXA 4C0LA 2H61A 1WLMA 1ALWA 1IKUA 2K7OA 1UHIA 1A03A 1NX2A 3PATA 1C07A 1WRZA 2Y5IA 2KI6C 3BUMB 3JVTB 4AQIA 2BCAA 1F4OA 3OHMB 4PDZA 4MRXA 2O5GA 1SW8A 2JNXA 2KBIA 4NQGA 1AP4A 2MA2A 3AKAA 3I5FC 4M2QA 1AHRA 2F8PA 1S26D 1V1GA 3LCPC 5AANA 1XA5A 5KU1A 2R2IA 4NDDA 1XYDA 1YR5A 4ORBB 1F4QA 1CFFA 1ODBA 3CLNA 1J7RA 2Y1NA 3HX4A 1K96A 4YGAA 1OOJA 1XFVO 1TIZA 5I2QA 1KQMC 2A4JA 2ZRSA 1NCZA 3KEVA 2MAZA 1GJYA 1K9KA 4MZKA 2KNEA 1W7IB 2JT0A 1HT9A 2JXLA 1DJYA 4N5XA 3CTNA 4M2OA 2ZRTA 1LA3A 1QV0A 4WQ3A 3GK2A 4HSZA 5B8IB 3I5HB 3TDZA 2KOTA 2B1UA 2IS9A 2EGDA 5TNCA 2EC6C 2I2RE 5HLVA 3K21A 3CR4X 1SK6D 2HQWA 2O60A 4GGFA 2KQ6A 2MLFC 2L98A 1SYMA 1YUSA 4FTGA 1XFZO 4MZJA 1L2OC 2MJWB 2Y4QA 1PVBA 2LCPA 2ZNEA 2KI4B 3A4UB 1K8UA 1CDLA 1M31A 4ORAB 3TZ1A 1F71A 3F45A 2K7DA 4GFTA 4CLNA 1S5GZ 2LUCA 3OB2B 1FW4A 1JUOA 1QX7A 4N1FA 1B8LA 2E30A 2LHLA 1K94A 3OB1B 4WRIA 1XFUO 2PALA 1EG3A 1IJ6A 2NCOA 2WORA 1W7JB 1QV1A 3I5GB 4YGBB 1RROA 2JZIA 3CS1A 5CPVA 1KK7Z 1CM1A 1CLLA 2ZKMX 4PE1A 3PN7B 2KFGA 2VRGA 2JQ6A 2M7NA 1TRFA 2CNPA 1DJXA 1PRWA 1QJTA 3CR2A 1JC2A 2M3WA 1AUIB 2KYFA 3PFVA 1YX7A 5I8NA 1TN4A 2KQYA 3BUWB 3EKJA 2JU0A 3RLZA 2K7CA 1NYAA 1E8AA 1QTXA 1GGZA 2COLB 1IG5A 1DT7B 2L5XB 1KFXS 2OTGB 2K2AA 5J3XA 1IQ5A 1J1DA 1MQ1A 1ZMZA 2JT3A 1CDNA 4YGCB 1ZACA 1XK4A 2LLSA 2LVIA 1FPWA 2TN4A 3TDUA 1KFXL 4PE0A 1PVAA 3O4YA 2LNKA 2G2BA 1FBVA 5HLOA 1F55A 1FI5A 1EH2A 1PSRA 1Q80A 1M46A 3DD4A 5F6TA 5AEQA 5KSZA 2LVKA 1NX1A 1HQVA 1KQVA 1BR1B 1S1EA 1TCFA 4MN0A 5DKNA 3KF9A 1QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWN A;  1FI6 A;  2CCM A;  2L0P A;  2M1K B;  5HKY A;  3EKH A;  1B1G A;  3IQQ A;  1CB1 A;  4R1E A;  1R6P A;  1X02 A;  2M1U A;  4YI9 A;  1QLK A;  1DTL A;  2BE6 A;  3EVR A;  3OP0 A;  4UPG A;  1RFJ A;  4JWQ A;  3D10 A;  2KYC A;  1DJW A;  2LP3 A;  3A8R A;  3BUN B;  4PHJ A;  3VGO A;  2KFF A;  3IQO A;  1C7W A;  1S3P A;  1CLM A;  2M0R A;  1IGV A;  1F8H A;  3IF7 A;  3PLF B;  2KBM A;  3EK4 A;  1PAL A;  4U8D A;  2M97 A;  1J7P A;  1G8I A;  4N1G A;  2BE4 A;  1J7Q A;  1OMD A;  1SCV A;  3FIA A;  1J1E A;  1D1O A;  1CLB A;  1BT6 A;  1UUS A;  1LA0 A;  4HRH A;  4E68 A;  3DF0 B;  3JTD B;  5HYD A;  5IBW A;  1QXP A;  3O2P A;  1UHJ A;  1YUU A;  2LAP A;  1DMO A;  1NX0 A;  1R2U A;  1WDC C;  3SG2 A;  1WLZ A;  3HCM A;  3TS5 C;  3TUY C;  1KK8 B;  4PAL A;  2V53 A;  4ORC B;  3BUO B;  1MXE A;  1CMF A;  2CTN A;  1XVJ A;  1YUT A;  2JOJ A;  2LE9 B;  1LXF C;  1RJV A;  2OPO A;  3SJS A;  3I5I C;  4WQ2 A;  4JPZ B;  1TNP A;  2LM5 A;  1WRK A;  1MR8 A;  4PHN A;  1GGW A;  2LMU A;  2JUL A;  1XFW O;  2BL0 B;  5JJG A;  2LMT A;  1GQM A;  1YRU B;  2H61 C;  3SG7 A;  3SG3 A;  4PE4 A;  3BOW B;  1CDM A;  4TNC A;  1RTP 1;  1QAT A;  1BOD A;  2LLU A;  2QAC A;  3PN7 C;  1KWO C;  3VRN A;  4FQO A;  3VRQ A;  2F33 A;  1XO5 A;  1AJ5 A;  3WHT B;  1YRT B;  1SL9 A;  4DCK A;  1B8C A;  1OZS A;  4P5O E;  4BY4 A;  2DOQ A;  2KAV A;  1B7T Z;  2JTT A;  4F0Z B;  4I5J A;  3MSE B;  2KGR A;  4PCW A;  4P2Y B;  4GUK A;  2OTG C;  2F3Z A;  1XFX O;  2G9B A;  1C7V A;  4I5K A;  4A4B A;  1SL7 A;  1CNP A;  3SG6 A;  4QJ4 B;  3TDI A;  2KFH A;  2OS8 B;  1JF0 A;  3EVV A;  3DF0 A;  5HKZ A;  1MHO A;  4XJK B;  1U5I B;  2LMV A;  4MLW A;  1BLQ A;  3E3R A;  3I5F B;  1SRA A;  1REC A;  1NX3 A;  1BG1 A;  3D0Y B;  2Q4U A;  1QVI Z;  4DRW A;  1CFC A;  1M39 A;  2JPT A;  3FWC A;  4DS7 A;  1QX2 A;  5AXI A;  2GGZ A;  1UHH A;  2KAY A;  1A75 B;  2HQ8 A;  4OVN F;  1DF0 B;  1CM4 A;  3ZNI A;  1A29 A;  1SCM C;  1BU3 A;  1EL4 A;  2JT8 A;  4GGF C;  4DIR A;  3SIB A;  1SNL A;  1Y0V H;  1JFK A;  5FYX A;  3CGA A;  1KQM B;  5D7F A;  1B8R A;  1OMV A;  1FF1 A;  2I7A A;  1S5G Y;  3BOW A;  4GAO A;  5BPJ A;  3CR5 X;  2L2E A;  1WY9 A;  5HKW A;  2LVV A;  4MZL A;  4ZCV A;  2K8M B;  2LLT A;  2K7B A;  3JVT C;  2K61 A;  1Y1U A;  2LC5 A;  3EK8 A;  3NSK A;  2KI6 D;  4I5L B;  4PHM A;  4QJ5 B;  2NCP A;  2JTZ A;  4M2P A;  4MSP A;  5AER A;  2I18 A;  4GPL B;  1NPQ A;  2EC6 B;  2L4H A;  1N2D A;  1KK7 Y;  1LKJ A;  1RK9 A;  1Y1X A;  2NXQ A;  4NDB A;  1DGV A;  4MRY A;  4CFR A;  1L2O B;  4YBH B;  3M0W A;  1PUL A;  2FOT A;  1KK8 C;  2K2F A;  1EJ3 A;  2WND A;  1H4B A;  1NIW A;  2F2P A;  1SL8 A;  1CMG A;  4MBE A;  3BYA A;  3PM8 A;  5KTY A;  1LVC D;  2JRF A;  3DVJ A;  3O6B A;  4HRE E;  1S6C A;  1NCX A;  1SBJ A;  3KO0 A;  1MXL C;  2MLE C;  2K0J A;  4XJK A;  1U5I A;  4GNK B;  3PAL A;  1JWD A;  3CWG A;  1DGU A;  3D0Y A;  1NUB A;  1MUX A;  3AAK A;  1YVH A;  3NSL A;  1N0Y A;  2AMI A;  3BUX B;  4YRU A;  3SG4 A;  2KDH A;  1M63 B;  1PK0 D;  1A75 A;  2ZN9 A;  1ALV A;  3I5H C;  1AJ4 A;  1DF0 A;  2MBX A;  1K9U A;  1UUR A;  2BBM A;  1SY9 A;  1ZOT B;  1XK4 C;  2PSR A;  2E6W A;  1L7Z A;  1NSH A;  2ZFD A;  4MVF A;  3FWB A;  1K90 D;  1CKK A;  4YGE B;  4OCI A;  2M49 B;  1S6J A;  1N65 A;  3O78 A;  1JFJ A;  2PRU A;  4XYN A;  1AK8 A;  2LVJ A;  3DVK A;  1UWO A;  2KI4 C;  4YI8 A;  3WXA A;  1BR4 B;  2LAN A;  1OZO A;  1CFD A;  4OR9 B;  4YGD B;  5AFP A;  1SMG A;  4USL A;  4CID A;  3AKB A;  3NSI A;  2M9G A;  2AAO A;  4NDC A;  1G33 A;  1S6I A;  2OS8 C;  4A4C A;  1DVI A;  2EHB A;  1UHN A;  1YTZ C;  4D1E A;  1QAS A;  2KAX A;  2L4I A;  1NWD A;  3I5G C;  1TCO B;  2PMY A;  2FCD A;  1DJH A;  1IJ5 A;  1NCY A;  1TOP A;  1G4Y R;  1SR6 B;  1B4C A;  1J55 A;  1IWQ A;  1TNW A;  3NXA A;  1M45 A;  5I2L A;  4CFQ A;  1YUR A;  3KPX A;  1TTX A;  4HRG A;  1LIN A;  4OKH A;  4I5N B;  3BXK A;  2P6B B;  5CSF A;  2L50 A;  1S36 A;  1ZFS A;  2HF5 A;  3LK1 A;  2JXC A;  3LL8 B;  1AVS A;  4QJ3 B;  1UHK A;  1UP5 A;  2LV7 A;  4DUQ A;  1EXR A;  2WC8 A;  2GV5 A;  3C1V A;  5CSN A;  3CZT X;  1KSO A;  1H8B A;  3NSO A;  2F2O A;  1KCY A;  3WHU B;  1B9A A;  4Q04 A;  1KSM A;  4MEW A;  1SPY A;  2BCB A;  2CBL A;  4C0J A;  1A4P A;  1DJZ A;  2ZND A;  1K2H A;  2NLN A;  1KFU S;  4OV2 A;  1ZUZ A;  3VRP A;  1Y6W A;  1J7O A;  1Y1A A;  1QLS A;  5G08 A;  1KFU L;  1JF2 A;  1OMR A;  2LP2 A;  2QPT A;  3TUY B;  1WDC B;  1WRL A;  2M29 A;  2NZ0 A;  3TS5 B;  3ICB A;  3VRR A;  4IL1 A;  3PSR A;  1K9P A;  4PHK A;  5PAL A;  1B7T Y;  3GOF A;  2KHN A;  3QRX A;  5DKQ A;  1K95 A;  2MRD A;  3FS7 A;  3I5I B;  2M7L A;  1PSB A;  4PE7 A;  1B47 A;  3GK4 X;  1OQP A;  2WOS A;  4BY5 A;  1VRK A;  2BEC A;  3H4S E;  2ISD A;  2CT9 A;  4GBA A;  2Y1M A;  2RGI A;  1CFP A;  5ER5 A;  2H2K A;  2KGB C;  2L51 A;  3OX5 A;  2SAS A;  1A2X A;  2FJU B;  1XFY O;  3AAJ A;  2I94 A;  3GK1 A;  3WNX B;  2D8N A;  1YX8 A;  2KSP A;  1KWO B;  5ER4 X;  4ETO A;  2SCP A;  3DVE A;  1F54 A;  1OSA A;  1K93 D;  3KHE A;  1QVI Y;  4GGN A;  2PVB A;  4C0K A;  3JTD C;  3OX6 A;  1QIV A;  1DJI A;  1QS7 A;  5CSI A;  1BMO A;  3EVU A;  3RM1 A;  1BOC A;  1BJF A;  2JWW A;  3VRO A;  2AUC A;  2JC2 A;  2PAS A;  2FCE A;  2JNF A;  2LUX A;  1RWY A;  4ICB A;  1EG4 A;  2BBN A;  2WCB A;  2BCX A;  2MHH A;  5D69 A;  5JOL A;  4JQ0 D;  1TNQ A;  4L9M A;  3LK0 A;  2BL0 C;  2LHI A;  3EK7 A;  2ZN8 A;  2Q91 A;  5I2O A;  1JBA A;  1SR6 C;  2CXJ A;  2HET A;  1JSA A;  1BF5 A;  2M8U A;  3LLE A;  1YVL A;  1IH0 A;  3DVM A;  1CDP A;  3SG5 A;  1DJG A;  5CSJ A;  5K89 A;  5DKR A;  4AQJ A;  2HPS A;  5GQQ C;  2WCE A;  2BKI B;  3ZWH A;  2GGM A;  4ZCU A;  4AOM A;  1F70 A;  1V1F A;  1OE9 B;  1IRJ A;  1SCM B;  4CPV A;  1MF8 B;  2BKH B;  1CTR A;  1NP8 A;  3SIA A;  2F3Y A;  2WCF A;  3BQ3 A;  1IQ3 A;  1SKT A;  1QX5 B;  1TNX A;  4C0L A;  2H61 A;  1WLM A;  1ALW A;  1IKU A;  2K7O A;  1UHI A;  1A03 A;  1NX2 A;  3PAT A;  1C07 A;  1WRZ A;  2Y5I A;  2KI6 C;  3BUM B;  3JVT B;  4AQI A;  2BCA A;  1F4O A;  3OHM B;  4PDZ A;  4MRX A;  2O5G A;  1SW8 A;  2JNX A;  2KBI A;  4NQG A;  1AP4 A;  2MA2 A;  3AKA A;  3I5F C;  4M2Q A;  1AHR A;  2F8P A;  1S26 D;  1V1G A;  3LCP C;  5AAN A;  1XA5 A;  5KU1 A;  2R2I A;  4NDD A;  1XYD A;  1YR5 A;  4ORB B;  1F4Q A;  1CFF A;  1ODB A;  3CLN A;  1J7R A;  2Y1N A;  3HX4 A;  1K96 A;  4YGA A;  1OOJ A;  1XFV O;  1TIZ A;  5I2Q A;  1KQM C;  2A4J A;  2ZRS A;  1NCZ A;  3KEV A;  2MAZ A;  1GJY A;  1K9K A;  4MZK A;  2KNE A;  1W7I B;  2JT0 A;  1HT9 A;  2JXL A;  1DJY A;  4N5X A;  3CTN A;  4M2O A;  2ZRT A;  1LA3 A;  1QV0 A;  4WQ3 A;  3GK2 A;  4HSZ A;  5B8I B;  3I5H B;  3TDZ A;  2KOT A;  2B1U A;  2IS9 A;  2EGD A;  5TNC A;  2EC6 C;  2I2R E;  5HLV A;  3K21 A;  3CR4 X;  1SK6 D;  2HQW A;  2O60 A;  4GGF A;  2KQ6 A;  2MLF C;  2L98 A;  1SYM A;  1YUS A;  4FTG A;  1XFZ O;  4MZJ A;  1L2O C;  2MJW B;  2Y4Q A;  1PVB A;  2LCP A;  2ZNE A;  2KI4 B;  3A4U B;  1K8U A;  1CDL A;  1M31 A;  4ORA B;  3TZ1 A;  1F71 A;  3F45 A;  2K7D A;  4GFT A;  4CLN A;  1S5G Z;  2LUC A;  3OB2 B;  1FW4 A;  1JUO A;  1QX7 A;  4N1F A;  1B8L A;  2E30 A;  2LHL A;  1K94 A;  3OB1 B;  4WRI A;  1XFU O;  2PAL A;  1EG3 A;  1IJ6 A;  2NCO A;  2WOR A;  1W7J B;  1QV1 A;  3I5G B;  4YGB B;  1RRO A;  2JZI A;  3CS1 A;  5CPV A;  1KK7 Z;  1CM1 A;  1CLL A;  2ZKM X;  4PE1 A;  3PN7 B;  2KFG A;  2VRG A;  2JQ6 A;  2M7N A;  1TRF A;  2CNP A;  1DJX A;  1PRW A;  1QJT A;  3CR2 A;  1JC2 A;  2M3W A;  1AUI B;  2KYF A;  3PFV A;  1YX7 A;  5I8N A;  1TN4 A;  2KQY A;  3BUW B;  3EKJ A;  2JU0 A;  3RLZ A;  2K7C A;  1NYA A;  1E8A A;  1QTX A;  1GGZ A;  2COL B;  1IG5 A;  1DT7 B;  2L5X B;  1KFX S;  2OTG B;  2K2A A;  5J3X A;  1IQ5 A;  1J1D A;  1MQ1 A;  1ZMZ A;  2JT3 A;  1CDN A;  4YGC B;  1ZAC A;  1XK4 A;  2LLS A;  2LVI A;  1FPW A;  2TN4 A;  3TDU A;  1KFX L;  4PE0 A;  1PVA A;  3O4Y A;  2LNK A;  2G2B A;  1FBV A;  5HLO A;  1F55 A;  1FI5 A;  1EH2 A;  1PSR A;  1Q80 A;  1M46 A;  3DD4 A;  5F6T A;  5AEQ A;  5KSZ A;  2LVK A;  1NX1 A;  1HQV A;  1KQV A;  1BR1 B;  1S1E A;  1TCF A;  4MN0 A;  5DKN A;  3KF9 A;  1QIW A; 
#chains in the Genus database with same CATH topology
 1MWN A;  1FI6 A;  2CCM A;  2L0P A;  2M1K B;  5HKY A;  3EKH A;  1B1G A;  3IQQ A;  3B88 A;  1CB1 A;  4R1E A;  1R6P A;  1X02 A;  2M1U A;  4YI9 A;  1QLK A;  5FI2 A;  1DTL A;  2BE6 A;  3EVR A;  3OP0 A;  4UPG A;  1RFJ A;  2WCJ A;  3D10 A;  4JWQ A;  2KYC A;  1DJW A;  2LP3 A;  3A8R A;  3BUN B;  3CAB A;  4PHJ A;  3VGO A;  2KFF A;  3IQO A;  1C7W A;  1S3P A;  1CLM A;  2M0R A;  1IGV A;  1F8H A;  3IF7 A;  3PLF B;  2KBM A;  3EK4 A;  2WC5 A;  1PAL A;  4U8D A;  2M97 A;  1J7P A;  1G8I A;  2QEV A;  4F7F A;  4N1G A;  2BE4 A;  1J7Q A;  1OMD A;  1SCV A;  3FIA A;  1J1E A;  1D1O A;  1CLB A;  1BT6 A;  1UUS A;  1LA0 A;  4HRH A;  4E68 A;  3DF0 B;  3JTD B;  5HYD A;  3NHI A;  5IBW A;  1QXP A;  3O2P A;  1UHJ A;  1YUU A;  2LAP A;  3B87 A;  3PM2 A;  1DMO A;  3O4X A;  1NX0 A;  1R2U A;  1WDC C;  3SG2 A;  1WLZ A;  3HCM A;  3CZ0 A;  3TS5 C;  3TUY C;  1KK8 B;  4PAL A;  2V53 A;  3Q8I A;  3BUO B;  1MXE A;  4ORC B;  2CTN A;  1XVJ A;  1YUT A;  2JOJ A;  1CMF A;  2LE9 B;  1LXF C;  1RJV A;  2OPO A;  3SJS A;  3I5I C;  4WQ2 A;  4JPZ B;  1TNP A;  2LM5 A;  1WRK A;  1MR8 A;  2K60 A;  3K1E A;  4PHN A;  3S0E A;  1GGW A;  2LMU A;  2JUL A;  1XFW O;  2BL0 B;  5JJG A;  2LMT A;  1GQM A;  1YRU B;  2H61 C;  3SG7 A;  3SG3 A;  4PE4 A;  3BOW B;  1CDM A;  4TNC A;  1RTP 1;  1QAT A;  1BOD A;  2LLU A;  2QAC A;  3CYZ A;  3PN7 C;  1KWO C;  1OOI X;  1SSE B;  4FQO A;  3VRN A;  3VRQ A;  2F33 A;  1XO5 A;  3R1V A;  1AJ5 A;  3WHT B;  1YRT B;  1SL9 A;  4DCK A;  1B8C A;  1OZS A;  4P5O E;  4BY4 A;  2DOQ A;  2KAV A;  4KYN A;  1B7T Z;  2JTT A;  4F0Z B;  2BAP A;  4I5J A;  3MSE B;  2KGR A;  4PCW A;  4P2Y B;  4GUK A;  2OTG C;  2F3Z A;  1XFX O;  2G9B A;  1C7V A;  2KLD A;  4I5K A;  3UNW A;  4A4B A;  1SL7 A;  1CNP A;  3SG6 A;  4QJ4 B;  3TDI A;  2KFH A;  3FE6 A;  2OS8 B;  1JF0 A;  3EVV A;  3DF0 A;  5HKZ A;  5EL2 A;  1MHO A;  4XJK B;  1U5I B;  2LMV A;  2QEO A;  4MLW A;  3BJH A;  1BLQ A;  3E3R A;  3I5F B;  1SRA A;  1REC A;  1NX3 A;  1BG1 A;  5FI7 A;  2WC6 A;  3PJI A;  3D0Y B;  2Q4U A;  1QVI Z;  4DRW A;  1CFC A;  1M39 A;  2JPT A;  3FWC A;  4DS7 A;  1QX2 A;  1TUJ A;  5AXI A;  2GGZ A;  1UHH A;  2KAY A;  2WCK A;  1A75 B;  2HQ8 A;  4OVN F;  1DF0 B;  1CM4 A;  3ZNI A;  1A29 A;  1SCM C;  1BU3 A;  1EL4 A;  2JT8 A;  4GGF C;  4DIR A;  3CDN A;  3SIB A;  1SNL A;  1Y0V H;  1JFK A;  3FE8 A;  5FYX A;  3CGA A;  1OW4 A;  1KQM B;  5D7F A;  1B8R A;  1OMV A;  1FF1 A;  2I7A A;  1S5G Y;  3BOW A;  4GAO A;  5BPJ A;  3CR5 X;  2L2E A;  1WY9 A;  5HKW A;  3S0B A;  2LVV A;  4MZL A;  4ZCV A;  1W9Z A;  2K8M B;  2LLT A;  2K7B A;  3JVT C;  2K61 A;  1Y1U A;  2LC5 A;  3EK8 A;  3NSK A;  2KI6 D;  4I5L B;  4PHM A;  4QJ5 B;  2NCP A;  2JTZ A;  4M2P A;  4MSP A;  5AER A;  2I18 A;  4GPL B;  1NPQ A;  2EC6 B;  2L4H A;  3OGN A;  1N2D A;  1KK7 Y;  1XFR A;  1LKJ A;  1RK9 A;  1Y1X A;  2NXQ A;  4NDB A;  1DGV A;  4MRY A;  4CFR A;  1L2O B;  4YBH B;  3M0W A;  1PUL A;  2FOT A;  1KK8 C;  2K2F A;  1EJ3 A;  2WND A;  1H4B A;  1NIW A;  2F2P A;  1SL8 A;  1CMG A;  4MBE A;  3BFH A;  3BYA A;  3PM8 A;  5I94 A;  5KTY A;  1LVC D;  2JRF A;  3DVJ A;  3O6B A;  4HRE E;  1S6C A;  2GTE A;  2L2C A;  3DY9 A;  1NCX A;  1SBJ A;  3KO0 A;  1MXL C;  2MLE C;  2K0J A;  4XJK A;  1U5I A;  4GNK B;  3PAL A;  1JWD A;  3CWG A;  1DGU A;  3D0Y A;  1NUB A;  1MUX A;  3AAK A;  1YVH A;  3NSL A;  1N0Y A;  2AMI A;  3BUX B;  4YRU A;  3SG4 A;  2KDH A;  1M63 B;  1PK0 D;  3FE9 A;  3UO9 A;  1A75 A;  2ZN9 A;  1ALV A;  3I5H C;  1AJ4 A;  3R1O A;  1DF0 A;  4JKT A;  2MBX A;  1K9U A;  1UUR A;  2BBM A;  1SY9 A;  1ZOT B;  1XK4 C;  2PSR A;  2E6W A;  1L7Z A;  1NSH A;  2ZFD A;  4MVF A;  3FWB A;  1K90 D;  1CKK A;  4YGE B;  4OCI A;  2M49 B;  1S6J A;  1N65 A;  3O78 A;  1JFJ A;  2PRU A;  4XYN A;  1AK8 A;  2LVJ A;  4IJ7 A;  3DVK A;  1UWO A;  2KI4 C;  4YI8 A;  3S0D A;  3WXA A;  1BR4 B;  2LAN A;  1OZO A;  1CFD A;  3B86 A;  4INW A;  4OR9 B;  4YGD B;  5AFP A;  1SMG A;  4JD9 A;  4USL A;  3AKB A;  3NSI A;  4CID A;  1DQE A;  2AAO A;  2M9G A;  2WCH A;  4NDC A;  1G33 A;  1S6I A;  2OS8 C;  3L4A A;  1DVI A;  2EHB A;  1UHN A;  1YTZ C;  4A4C A;  4D1E A;  1QAS A;  2KAX A;  2L4I A;  1NWD A;  3I5G C;  1TCO B;  2PMY A;  2FCD A;  1DJH A;  5D3O A;  1IJ5 A;  1NCY A;  1TOP A;  1G4Y R;  1SR6 B;  1B4C A;  1J55 A;  1IWQ A;  1TNW A;  3NXA A;  1M45 A;  3NHT A;  5I2L A;  4CFQ A;  1YUR A;  3KPX A;  1TTX A;  3L47 A;  4HRG A;  3L4L A;  1LIN A;  4OKH A;  1OOF A;  4I5N B;  3BXK A;  2P6B B;  5CSF A;  2L50 A;  1S36 A;  1ZFS A;  2HF5 A;  3LK1 A;  2JXC A;  3LL8 B;  1AVS A;  4QJ3 B;  1OOH A;  1UHK A;  1UP5 A;  2LV7 A;  4DUQ A;  1EXR A;  2WC8 A;  2GV5 A;  3C1V A;  5CSN A;  3CZT X;  1KSO A;  1H8B A;  3NSO A;  3DXL A;  2F2O A;  1C3Y A;  2JPO A;  3WHU B;  1KCY A;  3DZT A;  1B9A A;  1DEK A;  1KSM A;  4MEW A;  1SPY A;  2BCB A;  2CBL A;  4Q04 A;  4C0J A;  1A4P A;  1DJZ A;  2P70 A;  2ZND A;  1K2H A;  2NLN A;  3S0G A;  5DIC A;  1KFU S;  1TWO A;  3QME A;  4OV2 A;  2ERB A;  2KLE A;  5FI6 A;  1ZUZ A;  3VRP A;  1Y6W A;  1J7O A;  1Y1A A;  1QLS A;  1DC1 A;  3D75 A;  1KFU L;  2QDI A;  5G08 A;  1JF2 A;  1OMR A;  2LP2 A;  2QPT A;  3TUY B;  1WDC B;  1WRL A;  2M29 A;  2NZ0 A;  3TS5 B;  3ICB A;  3VRR A;  4IL1 A;  3PSR A;  1K9P A;  3N7H A;  4PHK A;  5PAL A;  1B7T Y;  3GOF A;  2KHN A;  3QRX A;  3S0F A;  5DKQ A;  1K95 A;  2MRD A;  3RZS A;  3FS7 A;  3I5I B;  2FJY A;  1PSB A;  4PE7 A;  1B47 A;  2M7L A;  3GK4 X;  1OQP A;  2WOS A;  4BY5 A;  1VRK A;  2BEC A;  3H4S E;  2ISD A;  2PYQ A;  2CT9 A;  4GBA A;  2Y1M A;  2RGI A;  3BFB A;  1CFP A;  5ER5 A;  2H2K A;  2KGB C;  2L51 A;  3OX5 A;  2SAS A;  1A2X A;  2FJU B;  3D77 A;  1XFY O;  3AAJ A;  2I94 A;  3GK1 A;  3WNX B;  3SS5 A;  1OOG A;  2D8N A;  1YX8 A;  2KSP A;  1KWO B;  5ER4 X;  4ETO A;  2SCP A;  3DVE A;  1F54 A;  1OSA A;  1K93 D;  3KHE A;  1QVI Y;  4GGN A;  2PVB A;  4C0K A;  3JTD C;  3OX6 A;  1QIV A;  1DJI A;  1QS7 A;  5CSI A;  3VB1 A;  1BMO A;  1IIO A;  3EVU A;  3RM1 A;  1BOC A;  1BJF A;  2JWW A;  3VRO A;  2AUC A;  2JC2 A;  2PAS A;  3D73 A;  2FCE A;  4PT1 A;  2JNF A;  2LUX A;  1RWY A;  1LS8 A;  2BNX A;  4ICB A;  1EG4 A;  2BBN A;  2WCB A;  2BCX A;  2MHH A;  5D69 A;  5JOL A;  4JQ0 D;  1TNQ A;  4L9M A;  4INX A;  3LK0 A;  2BL0 C;  2LHI A;  3EK7 A;  2ZN8 A;  2Q91 A;  3NGV A;  5I2O A;  3R72 A;  3V2L A;  1JBA A;  1SR6 C;  2CXJ A;  2HET A;  1JSA A;  1BF5 A;  2M8U A;  3S0A A;  3LLE A;  1YVL A;  1IH0 A;  3DVM A;  1CDP A;  3SG5 A;  1DJG A;  1ORG A;  5CSJ A;  5K89 A;  5DKR A;  4AQJ A;  2HPS A;  5GQQ C;  2WCE A;  2BKI B;  3ZWH A;  2GGM A;  4ZCU A;  4AOM A;  1F70 A;  1Z4H A;  1V1F A;  1OE9 B;  1IRJ A;  1SCM B;  4CPV A;  1MF8 B;  2BKH B;  1CTR A;  1NP8 A;  2QEH A;  3SIA A;  2F3Y A;  2WCF A;  3BQ3 A;  1IQ3 A;  1SKT A;  1QX5 B;  1TNX A;  4C0L A;  2H61 A;  3IVT A;  2QEB A;  1WLM A;  1ALW A;  1IKU A;  2K7O A;  1UHI A;  5HL1 A;  1A03 A;  1NX2 A;  3BFA A;  1C3Z A;  3PAT A;  1C07 A;  1WRZ A;  2P71 A;  2Y5I A;  2KI6 C;  3BUM B;  3JVT B;  3CZ2 A;  3EG5 B;  3R1P A;  1GM0 A;  2WCL A;  4AQI A;  2BCA A;  1F4O A;  3OHM B;  4PDZ A;  4MRX A;  2O5G A;  1SW8 A;  2JNX A;  4FQT A;  2KBI A;  4NQG A;  2PQL A;  1AP4 A;  2MA2 A;  3AKA A;  3I5F C;  4M2Q A;  1AHR A;  2F8P A;  1S26 D;  1V1G A;  3LCP C;  2WCM A;  5AAN A;  1XA5 A;  5KU1 A;  3B7A A;  2R2I A;  4NDD A;  1XYD A;  1YR5 A;  3CZ1 A;  4ORB B;  1F4Q A;  1CFF A;  1ODB A;  3CLN A;  1J7R A;  2Y1N A;  2KPH A;  3HX4 A;  1K96 A;  4YGA A;  1OOJ A;  1XFV O;  1TIZ A;  5I2Q A;  1KQM C;  2A4J A;  2ZRS A;  1NCZ A;  3KEV A;  2MAZ A;  1GJY A;  1K9K A;  4MZK A;  2KNE A;  1W7I B;  2JT0 A;  1HT9 A;  2JXL A;  1DJY A;  4N5X A;  3CTN A;  4M2O A;  2ZRT A;  1LA3 A;  1QV0 A;  4WQ3 A;  3GK2 A;  4HSZ A;  5B8I B;  3I5H B;  3TDZ A;  2KOT A;  2B1U A;  2IS9 A;  2EGD A;  5TNC A;  2EC6 C;  2I2R E;  5HLV A;  3K21 A;  3CR4 X;  1SK6 D;  2HQW A;  2O60 A;  4GGF A;  2KQ6 A;  2MLF C;  2L98 A;  3D76 A;  1SYM A;  1YUS A;  4FTG A;  1XFZ O;  1QWV A;  4MZJ A;  1L2O C;  2MJW B;  2Y4Q A;  1PVB A;  2LCP A;  2ZNE A;  2KI4 B;  3A4U B;  1K8U A;  1CDL A;  1M31 A;  4ORA B;  3TZ1 A;  1F71 A;  3F45 A;  3DYE A;  2K7D A;  4GFT A;  4CLN A;  1S5G Z;  2LUC A;  3OB2 B;  1FW4 A;  1JUO A;  1T14 A;  2H8V A;  1P28 A;  3SS3 A;  1QX7 A;  4N1F A;  1B8L A;  2E30 A;  2LHL A;  1K94 A;  3OB1 B;  3OBV A;  4WRI A;  1XFU O;  2PAL A;  1EG3 A;  1IJ6 A;  2NCO A;  2WOR A;  1W7J B;  1QV1 A;  3I5G B;  4YGB B;  1RRO A;  2JZI A;  3CS1 A;  1TUZ A;  5CPV A;  1KK7 Z;  1CM1 A;  1CLL A;  2ZKM X;  4PE1 A;  3PN7 B;  2KFG A;  2VRG A;  2JQ6 A;  2M7N A;  1TRF A;  2CNP A;  1DJX A;  1PRW A;  1QJT A;  3CR2 A;  1JC2 A;  2M3W A;  1AUI B;  2KYF A;  3PFV A;  1YX7 A;  5I8N A;  3SS4 A;  1TN4 A;  2KQY A;  3BUW B;  3EKJ A;  2JU0 A;  2YGU A;  3RLZ A;  2K7C A;  3D74 A;  1NYA A;  1E8A A;  1QTX A;  1GGZ A;  2COL B;  1IG5 A;  3D78 A;  1DT7 B;  2L5X B;  1KFX S;  2OTG B;  2K2A A;  5J3X A;  1IQ5 A;  1J1D A;  1MQ1 A;  1ZMZ A;  4OZD A;  2JT3 A;  1CDN A;  4YGC B;  1ZAC A;  1XK4 A;  2LLS A;  2LVI A;  1FPW A;  2TN4 A;  3TDU A;  1KFX L;  4PE0 A;  1PVA A;  3O4Y A;  2LNK A;  2G2B A;  1FBV A;  5HLO A;  1F55 A;  1FI5 A;  1EH2 A;  1PSR A;  1Z2C B;  1Q80 A;  1M46 A;  3DD4 A;  5F6T A;  1DEL A;  5AEQ A;  5KSZ A;  3B6X A;  2LVK A;  2L5Y A;  1NX1 A;  1HQV A;  1KQV A;  1BR1 B;  1S1E A;  1TCF A;  4MN0 A;  5DKN A;  3KF9 A;  1QIW A; 
#chains in the Genus database with same CATH homology
 1MWN A;  1FI6 A;  2CCM A;  2L0P A;  2M1K B;  5HKY A;  3EKH A;  1B1G A;  3IQQ A;  1CB1 A;  4R1E A;  1R6P A;  1X02 A;  2M1U A;  4YI9 A;  1QLK A;  1DTL A;  2BE6 A;  3EVR A;  3OP0 A;  4UPG A;  1RFJ A;  4JWQ A;  3D10 A;  2KYC A;  1DJW A;  2LP3 A;  3A8R A;  3BUN B;  4PHJ A;  3VGO A;  2KFF A;  3IQO A;  1C7W A;  1S3P A;  1CLM A;  2M0R A;  1IGV A;  1F8H A;  3IF7 A;  3PLF B;  2KBM A;  3EK4 A;  1PAL A;  4U8D A;  2M97 A;  1J7P A;  1G8I A;  4N1G A;  2BE4 A;  1J7Q A;  1OMD A;  1SCV A;  3FIA A;  1J1E A;  1D1O A;  1CLB A;  1BT6 A;  1UUS A;  1LA0 A;  4HRH A;  4E68 A;  3DF0 B;  3JTD B;  5HYD A;  5IBW A;  1QXP A;  3O2P A;  1UHJ A;  1YUU A;  2LAP A;  1DMO A;  1NX0 A;  1R2U A;  1WDC C;  3SG2 A;  1WLZ A;  3HCM A;  3TS5 C;  3TUY C;  1KK8 B;  4PAL A;  2V53 A;  4ORC B;  3BUO B;  1MXE A;  1CMF A;  2CTN A;  1XVJ A;  1YUT A;  2JOJ A;  2LE9 B;  1LXF C;  1RJV A;  2OPO A;  3SJS A;  3I5I C;  4WQ2 A;  4JPZ B;  1TNP A;  2LM5 A;  1WRK A;  1MR8 A;  4PHN A;  1GGW A;  2LMU A;  2JUL A;  1XFW O;  2BL0 B;  5JJG A;  2LMT A;  1GQM A;  1YRU B;  2H61 C;  3SG7 A;  3SG3 A;  4PE4 A;  3BOW B;  1CDM A;  4TNC A;  1RTP 1;  1QAT A;  1BOD A;  2LLU A;  2QAC A;  3PN7 C;  1KWO C;  3VRN A;  4FQO A;  3VRQ A;  2F33 A;  1XO5 A;  1AJ5 A;  3WHT B;  1YRT B;  1SL9 A;  4DCK A;  1B8C A;  1OZS A;  4P5O E;  4BY4 A;  2DOQ A;  2KAV A;  1B7T Z;  2JTT A;  4F0Z B;  4I5J A;  3MSE B;  2KGR A;  4PCW A;  4P2Y B;  4GUK A;  2OTG C;  2F3Z A;  1XFX O;  2G9B A;  1C7V A;  4I5K A;  4A4B A;  1SL7 A;  1CNP A;  3SG6 A;  4QJ4 B;  3TDI A;  2KFH A;  2OS8 B;  1JF0 A;  3EVV A;  3DF0 A;  5HKZ A;  1MHO A;  4XJK B;  1U5I B;  2LMV A;  4MLW A;  1BLQ A;  3E3R A;  3I5F B;  1SRA A;  1REC A;  1NX3 A;  1BG1 A;  3D0Y B;  2Q4U A;  1QVI Z;  4DRW A;  1CFC A;  1M39 A;  2JPT A;  3FWC A;  4DS7 A;  1QX2 A;  5AXI A;  2GGZ A;  1UHH A;  2KAY A;  1A75 B;  2HQ8 A;  4OVN F;  1DF0 B;  1CM4 A;  3ZNI A;  1A29 A;  1SCM C;  1BU3 A;  1EL4 A;  2JT8 A;  4GGF C;  4DIR A;  3SIB A;  1SNL A;  1Y0V H;  1JFK A;  5FYX A;  3CGA A;  1KQM B;  5D7F A;  1B8R A;  1OMV A;  1FF1 A;  2I7A A;  1S5G Y;  3BOW A;  4GAO A;  5BPJ A;  3CR5 X;  2L2E A;  1WY9 A;  5HKW A;  2LVV A;  4MZL A;  4ZCV A;  2K8M B;  2LLT A;  2K7B A;  3JVT C;  2K61 A;  1Y1U A;  2LC5 A;  3EK8 A;  3NSK A;  2KI6 D;  4I5L B;  4PHM A;  4QJ5 B;  2NCP A;  2JTZ A;  4M2P A;  4MSP A;  5AER A;  2I18 A;  4GPL B;  1NPQ A;  2EC6 B;  2L4H A;  1N2D A;  1KK7 Y;  1LKJ A;  1RK9 A;  1Y1X A;  2NXQ A;  4NDB A;  1DGV A;  4MRY A;  4CFR A;  1L2O B;  4YBH B;  3M0W A;  1PUL A;  2FOT A;  1KK8 C;  2K2F A;  1EJ3 A;  2WND A;  1H4B A;  1NIW A;  2F2P A;  1SL8 A;  1CMG A;  4MBE A;  3BYA A;  3PM8 A;  5KTY A;  1LVC D;  2JRF A;  3DVJ A;  3O6B A;  4HRE E;  1S6C A;  1NCX A;  1SBJ A;  3KO0 A;  1MXL C;  2MLE C;  2K0J A;  4XJK A;  1U5I A;  4GNK B;  3PAL A;  1JWD A;  3CWG A;  1DGU A;  3D0Y A;  1NUB A;  1MUX A;  3AAK A;  1YVH A;  3NSL A;  1N0Y A;  2AMI A;  3BUX B;  4YRU A;  3SG4 A;  2KDH A;  1M63 B;  1PK0 D;  1A75 A;  2ZN9 A;  1ALV A;  3I5H C;  1AJ4 A;  1DF0 A;  2MBX A;  1K9U A;  1UUR A;  2BBM A;  1SY9 A;  1ZOT B;  1XK4 C;  2PSR A;  2E6W A;  1L7Z A;  1NSH A;  2ZFD A;  4MVF A;  3FWB A;  1K90 D;  1CKK A;  4YGE B;  4OCI A;  2M49 B;  1S6J A;  1N65 A;  3O78 A;  1JFJ A;  2PRU A;  4XYN A;  1AK8 A;  2LVJ A;  3DVK A;  1UWO A;  2KI4 C;  4YI8 A;  3WXA A;  1BR4 B;  2LAN A;  1OZO A;  1CFD A;  4OR9 B;  4YGD B;  5AFP A;  1SMG A;  4USL A;  4CID A;  3AKB A;  3NSI A;  2M9G A;  2AAO A;  4NDC A;  1G33 A;  1S6I A;  2OS8 C;  4A4C A;  1DVI A;  2EHB A;  1UHN A;  1YTZ C;  4D1E A;  1QAS A;  2KAX A;  2L4I A;  1NWD A;  3I5G C;  1TCO B;  2PMY A;  2FCD A;  1DJH A;  1IJ5 A;  1NCY A;  1TOP A;  1G4Y R;  1SR6 B;  1B4C A;  1J55 A;  1IWQ A;  1TNW A;  3NXA A;  1M45 A;  5I2L A;  4CFQ A;  1YUR A;  3KPX A;  1TTX A;  4HRG A;  1LIN A;  4OKH A;  4I5N B;  3BXK A;  2P6B B;  5CSF A;  2L50 A;  1S36 A;  1ZFS A;  2HF5 A;  3LK1 A;  2JXC A;  3LL8 B;  1AVS A;  4QJ3 B;  1UHK A;  1UP5 A;  2LV7 A;  4DUQ A;  1EXR A;  2WC8 A;  2GV5 A;  3C1V A;  5CSN A;  3CZT X;  1KSO A;  1H8B A;  3NSO A;  2F2O A;  1KCY A;  3WHU B;  1B9A A;  4Q04 A;  1KSM A;  4MEW A;  1SPY A;  2BCB A;  2CBL A;  4C0J A;  1A4P A;  1DJZ A;  2ZND A;  1K2H A;  2NLN A;  1KFU S;  4OV2 A;  1ZUZ A;  3VRP A;  1Y6W A;  1J7O A;  1Y1A A;  1QLS A;  5G08 A;  1KFU L;  1JF2 A;  1OMR A;  2LP2 A;  2QPT A;  3TUY B;  1WDC B;  1WRL A;  2M29 A;  2NZ0 A;  3TS5 B;  3ICB A;  3VRR A;  4IL1 A;  3PSR A;  1K9P A;  4PHK A;  5PAL A;  1B7T Y;  3GOF A;  2KHN A;  3QRX A;  5DKQ A;  1K95 A;  2MRD A;  3FS7 A;  3I5I B;  2M7L A;  1PSB A;  4PE7 A;  1B47 A;  3GK4 X;  1OQP A;  2WOS A;  4BY5 A;  1VRK A;  2BEC A;  3H4S E;  2ISD A;  2CT9 A;  4GBA A;  2Y1M A;  2RGI A;  1CFP A;  5ER5 A;  2H2K A;  2KGB C;  2L51 A;  3OX5 A;  2SAS A;  1A2X A;  2FJU B;  1XFY O;  3AAJ A;  2I94 A;  3GK1 A;  3WNX B;  2D8N A;  1YX8 A;  2KSP A;  1KWO B;  5ER4 X;  4ETO A;  2SCP A;  3DVE A;  1F54 A;  1OSA A;  1K93 D;  3KHE A;  1QVI Y;  4GGN A;  2PVB A;  4C0K A;  3JTD C;  3OX6 A;  1QIV A;  1DJI A;  1QS7 A;  5CSI A;  1BMO A;  3EVU A;  3RM1 A;  1BOC A;  1BJF A;  2JWW A;  3VRO A;  2AUC A;  2JC2 A;  2PAS A;  2FCE A;  2JNF A;  2LUX A;  1RWY A;  4ICB A;  1EG4 A;  2BBN A;  2WCB A;  2BCX A;  2MHH A;  5D69 A;  5JOL A;  4JQ0 D;  1TNQ A;  4L9M A;  3LK0 A;  2BL0 C;  2LHI A;  3EK7 A;  2ZN8 A;  2Q91 A;  5I2O A;  1JBA A;  1SR6 C;  2CXJ A;  2HET A;  1JSA A;  1BF5 A;  2M8U A;  3LLE A;  1YVL A;  1IH0 A;  3DVM A;  1CDP A;  3SG5 A;  1DJG A;  5CSJ A;  5K89 A;  5DKR A;  4AQJ A;  2HPS A;  5GQQ C;  2WCE A;  2BKI B;  3ZWH A;  2GGM A;  4ZCU A;  4AOM A;  1F70 A;  1V1F A;  1OE9 B;  1IRJ A;  1SCM B;  4CPV A;  1MF8 B;  2BKH B;  1CTR A;  1NP8 A;  3SIA A;  2F3Y A;  2WCF A;  3BQ3 A;  1IQ3 A;  1SKT A;  1QX5 B;  1TNX A;  4C0L A;  2H61 A;  1WLM A;  1ALW A;  1IKU A;  2K7O A;  1UHI A;  1A03 A;  1NX2 A;  3PAT A;  1C07 A;  1WRZ A;  2Y5I A;  2KI6 C;  3BUM B;  3JVT B;  4AQI A;  2BCA A;  1F4O A;  3OHM B;  4PDZ A;  4MRX A;  2O5G A;  1SW8 A;  2JNX A;  2KBI A;  4NQG A;  1AP4 A;  2MA2 A;  3AKA A;  3I5F C;  4M2Q A;  1AHR A;  2F8P A;  1S26 D;  1V1G A;  3LCP C;  5AAN A;  1XA5 A;  5KU1 A;  2R2I A;  4NDD A;  1XYD A;  1YR5 A;  4ORB B;  1F4Q A;  1CFF A;  1ODB A;  3CLN A;  1J7R A;  2Y1N A;  3HX4 A;  1K96 A;  4YGA A;  1OOJ A;  1XFV O;  1TIZ A;  5I2Q A;  1KQM C;  2A4J A;  2ZRS A;  1NCZ A;  3KEV A;  2MAZ A;  1GJY A;  1K9K A;  4MZK A;  2KNE A;  1W7I B;  2JT0 A;  1HT9 A;  2JXL A;  1DJY A;  4N5X A;  3CTN A;  4M2O A;  2ZRT A;  1LA3 A;  1QV0 A;  4WQ3 A;  3GK2 A;  4HSZ A;  5B8I B;  3I5H B;  3TDZ A;  2KOT A;  2B1U A;  2IS9 A;  2EGD A;  5TNC A;  2EC6 C;  2I2R E;  5HLV A;  3K21 A;  3CR4 X;  1SK6 D;  2HQW A;  2O60 A;  4GGF A;  2KQ6 A;  2MLF C;  2L98 A;  1SYM A;  1YUS A;  4FTG A;  1XFZ O;  4MZJ A;  1L2O C;  2MJW B;  2Y4Q A;  1PVB A;  2LCP A;  2ZNE A;  2KI4 B;  3A4U B;  1K8U A;  1CDL A;  1M31 A;  4ORA B;  3TZ1 A;  1F71 A;  3F45 A;  2K7D A;  4GFT A;  4CLN A;  1S5G Z;  2LUC A;  3OB2 B;  1FW4 A;  1JUO A;  1QX7 A;  4N1F A;  1B8L A;  2E30 A;  2LHL A;  1K94 A;  3OB1 B;  4WRI A;  1XFU O;  2PAL A;  1EG3 A;  1IJ6 A;  2NCO A;  2WOR A;  1W7J B;  1QV1 A;  3I5G B;  4YGB B;  1RRO A;  2JZI A;  3CS1 A;  5CPV A;  1KK7 Z;  1CM1 A;  1CLL A;  2ZKM X;  4PE1 A;  3PN7 B;  2KFG A;  2VRG A;  2JQ6 A;  2M7N A;  1TRF A;  2CNP A;  1DJX A;  1PRW A;  1QJT A;  3CR2 A;  1JC2 A;  2M3W A;  1AUI B;  2KYF A;  3PFV A;  1YX7 A;  5I8N A;  1TN4 A;  2KQY A;  3BUW B;  3EKJ A;  2JU0 A;  3RLZ A;  2K7C A;  1NYA A;  1E8A A;  1QTX A;  1GGZ A;  2COL B;  1IG5 A;  1DT7 B;  2L5X B;  1KFX S;  2OTG B;  2K2A A;  5J3X A;  1IQ5 A;  1J1D A;  1MQ1 A;  1ZMZ A;  2JT3 A;  1CDN A;  4YGC B;  1ZAC A;  1XK4 A;  2LLS A;  2LVI A;  1FPW A;  2TN4 A;  3TDU A;  1KFX L;  4PE0 A;  1PVA A;  3O4Y A;  2LNK A;  2G2B A;  1FBV A;  5HLO A;  1F55 A;  1FI5 A;  1EH2 A;  1PSR A;  1Q80 A;  1M46 A;  3DD4 A;  5F6T A;  5AEQ A;  5KSZ A;  2LVK A;  1NX1 A;  1HQV A;  1KQV A;  1BR1 B;  1S1E A;  1TCF A;  4MN0 A;  5DKN A;  3KF9 A;  1QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...