1EH2A

Structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS15
publication title Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1998-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eh2A00
1MUXA 3IQOA 1BU3A 3BQ3A 1YRTB 3JTDC 4A4BA 1J7QA 1PVAA 1UHIA 1V1GA 3LCPC 3OB1B 5HLVA 1YTZC 3AKAA 1ZMZA 2JT8A 2JT0A 1K93D 1CFCA 1XA5A 4ZCVA 2A4JA 1NX3A 2LV7A 2Y5IA 3F45A 1F8HA 1KSMA 1N2DA 4DIRA 2KYFA 1CDNA 3DF0B 1CTRA 2KAXA 2PVBA 2MRDA 4CFRA 2LUCA 3SG4A 3SG3A 2PALA 1XFVO 5CSIA 1QX5B 1SCVA 2QPTA 1B47A 2OTGB 1IRJA 3KPXA 3LK0A 3O78A 2BE6A 2JPTA 4DS7A 1DJWA 3BOWA 3NSLA 1DJGA 1OE9B 4MN0A 4MEWA 4PDZA 2M7LA 1KFUS 3I5GC 5AXIA 2AAOA 1MWNA 4ORBB 1TNQA 2F8PA 5K89A 3BUOB 1QV1A 1U5IB 5J3XA 3SJSA 1BT6A 3GK2A 4OKHA 2LAPA 1AJ5A 5JJGA 1EG4A 3MSEB 4USLA 2JTZA 1F4OA 3IF7A 1HT9A 1QIVA 4GGFA 3TDIA 1DGUA 4C0KA 1XFUO 4D1EA 1FF1A 4CFQA 2OS8C 5DKQA 3OX6A 4MBEA 2KQYA 1IJ5A 2MHHA 3A4UB 3SG6A 3QRXA 4N5XA 1A03A 3EK4A 4ETOA 3M0WA 4YGBB 1F70A 2KHNA 1G4YR 1TCFA 1KK8C 3OHMB 3A8RA 1UHHA 1NYAA 4MZJA 3TZ1A 1B1GA 1KQMC 3SIAA 1QS7A 3BXKA 1XO5A 1WDCC 1NCYA 1A2XA 3I5IC 2LVIA 4I5NB 1CLBA 2H61A 2JXLA 1RFJA 2KI4C 1WY9A 1JF0A 2FCDA 1MXLC 4N1GA 1QLKA 1TOPA 3AKBA 1TCOB 2L50A 4OV2A 2TN4A 4I5JA 2NLNA 2Y1NA 1TNXA 2K2AA 1QTXA 4MRYA 4OR9B 1A75B 1BR4B 2GGMA 3D10A 1J1EA 1CFPA 1NX0A 2Q91A 2M1UA 1DF0B 2IS9A 1UUSA 4AOMA 3BYAA 1YVHA 4MVFA 1CFFA 3I5GB 1J55A 2MA2A 4M2OA 3VRNA 1K9PA 1SR6C 2F3ZA 5CPVA 4TNCA 4QJ5B 3RLZA 2KAVA 1KFXL 1DJHA 1BODA 4PHMA 1TTXA 1CMFA 1K2HA 1DTLA 1QASA 5I2QA 2DOQA 1JBAA 3VROA 2K7BA 3C1VA 3PALA 1MR8A 1DMOA 1GQMA 1L7ZA 2M0RA 3LL8B 2BBMA 1OMVA 1LA3A 3O6BA 1S3PA 1AHRA 3E3RA 3CWGA 1BOCA 1S5GZ 2E6WA 1L2OB 1BJFA 1S5GY 1YX8A 1Y1XA 4NDCA 2LP2A 3TUYB 1BR1B 1OMRA 1R6PA 2BCXA 2KFHA 2ZKMX 1ODBA 1EJ3A 1Y6WA 4CLNA 1SW8A 3OX5A 1LA0A 5KTYA 1WDCB 3I5HB 2L2EA 2JT3A 1NCXA 1YUSA 4JQ0D 4N1FA 5CSFA 4L9MA 5HKYA 2M7NA 4GGFC 2LNKA 1CM4A 2NCOA 1X02A 2CTNA 3EVUA 4HRGA 4YGEB 2LE9B 4PHNA 2F2PA 5ER4X 1KQVA 1M31A 3DD4A 2ZRTA 5HYDA 2JC2A 2K7OA 4PE0A 4IL1A 5ER5A 2HQ8A 2WCFA 1DT7B 3TS5C 2PASA 4HSZA 1AP4A 3I5FC 2M29A 1SR6B 1BG1A 1ALWA 2L4IA 3CGAA 3WXAA 3DVMA 3EKJA 1DJIA 3DF0A 1QX2A 2COLB 4WQ2A 4I5KA 4PHKA 1YUUA 2K7CA 2KDHA 1OQPA 2LM5A 3ICBA 1W7JB 2WNDA 1KWOC 3NSKA 2BL0C 1CLMA 1IQ5A 1K94A 1XVJA 1IG5A 1TN4A 1M39A 2B1UA 1CDMA 1YR5A 2LHLA 4XYNA 3EK8A 1XK4C 4XJKB 3PM8A 1B9AA 3CS1A 1WLMA 1Y0VH 2I94A 1GJYA 2JQ6A 4PE1A 3BUNB 3VRRA 3VRPA 4NQGA 1FPWA 1AK8A 1NPQA 1U5IA 1EH2A 4C0JA 3SG2A 1TNPA 5KU1A 3CZTX 1FBVA 1SCMB 1DVIA 2KBMA 5BPJA 4Q04A 2L5XB 2LANA 2ZNDA 4M2QA 1WRKA 1YURA 4GAOA 4QJ3B 4ICBA 1KFUL 4E68A 2ZNEA 4A4CA 1JF2A 1XFYO 1IKUA 1MXEA 2LVKA 1S26D 3KF9A 2L51A 3CR2A 3JTDB 4M2PA 3CTNA 1FI5A 1Q80A 1XFZO 1NX1A 4PE7A 4YI9A 5IBWA 1M45A 2BKHB 2HETA 2HPSA 1UWOA 1C7VA 2KAYA 1LINA 2GV5A 1K90D 4CPVA 4ORCB 3JVTC 4YGCB 1ALVA 2LHIA 1WLZA 1SNLA 2V53A 1JUOA 4DCKA 1XFXO 3PN7C 2PSRA 2I7AA 3PATA 4UPGA 5AEQA 2K0JA 1B8LA 4R1EA 1G8IA 1C07A 1H4BA 1M63B 2KSPA 5PALA 1F4QA 2G9BA 1S6IA 2NZ0A 1DGVA 1UURA 3D0YB 5D7FA 1UHNA 1A75A 1NX2A 1CLLA 1RROA 4CIDA 1AVSA 1DF0A 2PMYA 4FQOA 4AQJA 1PVBA 2VRGA 5DKRA 2KI6D 1XYDA 3D0YA 2LMTA 1JSAA 3CR5X 1N65A 1K9UA 5D69A 2NXQA 4P2YB 1CKKA 2M1KB 1SKTA 2JOJA 4MZLA 1UHKA 1JFJA 1SMGA 3BUWB 1A4PA 2M3WA 4PALA 3TDUA 3K21A 4GFTA 3GOFA 2GGZA 2OS8B 3OB2B 4F0ZB 2LC5A 1BLQA 2M49B 1EL4A 2KYCA 2WCBA 3PLFB 2MJWB 1SRAA 5JOLA 3HX4A 5CSJA 1SL9A 5G08A 2CCMA 2D8NA 3NSIA 3SIBA 1SL7A 5FYXA 2OTGC 4YI8A 3H4SE 2MLFC 1SY9A 1SYMA 1KK8B 1SPYA 3DVEA 1H8BA 1FI6A 3O2PA 1KQMB 2F2OA 5B8IB 2KGBC 3I5IB 4YGDB 4NDDA 5DKNA 2MLEC 2MAZA 2R2IA 1SL8A 2ISDA 2KI4B 1GGZA 1EG3A 4MLWA 1KSOA 2ZFDA 3GK4X 1ZOTB 1PULA 1YX7A 2EGDA 1NSHA 3KO0A 4PE4A 1RK9A 1FW4A 1NUBA 1ZACA 2BE4A 1QLSA 1TIZA 1S6CA 2ZRSA 3OP0A 1D1OA 3LK1A 4JPZB 2AMIA 1LXFC 2JZIA 2ZN8A 3WHUB 1IWQA 4PCWA 1BMOA 4DRWA 3BUMB 1KK7Z 2G2BA 1KK7Y 1OMDA 2H61C 2O5GA 1QATA 1S6JA 2BECA 2M8UA 2QACA 1IJ6A 3FWCA 2RGIA 4P5OE 1R2UA 5I2LA 3HCMA 2LLTA 4I5LB 1GGWA 1K8UA 3NSOA 1IGVA 2K61A 2OPOA 3O4YA 1JC2A 2AUCA 2FJUB 1F54A 1NWDA 1C7WA 3PFVA 2SCPA 2KFFA 3BOWB 5KSZA 4XJKA 4DUQA 2K8MB 2NCPA 1Y1AA 1Y1UA 4WQ3A 2LLUA 1PRWA 2H2KA 5I2OA 2EC6C 1M46A 1SBJA 3FS7A 2K7DA 3CLNA 4MZKA 1NIWA 1SK6D 2I18A 2JXCA 5AANA 1CNPA 1RECA 2KOTA 2M97A 1N0YA 4WRIA 4YBHB 2LMVA 3ZNIA 1K9KA 4YGAA 3DVJA 3LLEA 5AERA 3FWBA 2KBIA 1VRKA 1B8RA 2BCBA 2L0PA 1BF5A 1QXPA 1KCYA 3TDZA 1TRFA 4OVNF 1CDPA 1EXRA 2WCEA 1XFWO 4U8DA 2CNPA 4ZCUA 2BBNA 2BKIB 1S36A 2LUXA 2Q4UA 3EKHA 3KHEA 4NDBA 5GQQC 2JNFA 1PK0D 1MQ1A 1K96A 1QJTA 1J7RA 1E8AA 1MF8B 1RJVA 2WC8A 3BUXB 3TS5B 2FOTA 1L2OC 3I5FB 2WORA 3SG5A 2P6BB 2SASA 1J1DA 1G33A 2BCAA 1WRZA 2HF5A 2JWWA 3TUYC 1IQ3A 2MBXA 1ZUZA 1DJZA 1F55A 1RWYA 3AAJA 5HKWA 1ZFSA 1YUTA 1RTP1 2CBLA 3EVRA 1F71A 3I5HC 1CDLA 1KWOB 2BL0B 2JU0A 1OOJA 2KFGA 1DJYA 1QV0A 1AJ4A 2EHBA 1J7PA 1KFXS 2FCEA 3PSRA 4YRUA 1B8CA 4HREE 1CB1A 3IQQA 4ORAB 1LKJA 2JTTA 2JULA 2Y4QA 1XK4A 1YVLA 2I2RE 5TNCA 1WRLA 2LLSA 4BY4A 2EC6B 4AQIA 1NCZA 5F6TA 3FIAA 1UP5A 3GK1A 4GBAA 1PSRA 2LVVA 4PHJA 2F33A 1QX7A 1HQVA 1V1FA 3WNXB 2JRFA 2LP3A 4GGNA 2CXJA 2KNEA 4OCIA 3KEVA 3NXAA 3RM1A 4GNKB 2E30A 2ZN9A 1A29A 2L98A 3ZWHA 1QIWA 4C0LA 5AFPA 1JWDA 2HQWA 5I8NA 1J7OA 1CFDA 3EVVA 2LVJA 2KI6C 2L4HA 2KQ6A 1UHJA 2Y1MA 1QVIZ 1LVCD 4MRXA 3WHTB 1NP8A 1PSBA 1QVIY 2F3YA 3JVTB 3DVKA 1S1EA 5HKZA 1MHOA 2CT9A 1W7IB 2O60A 3SG7A 2PRUA 2LCPA 1PALA 1TNWA 4GPLB 2KGRA 3PN7B 4BY5A 1YRUB 2WOSA 2LMUA 3EK7A 3AAKA 5CSNA 1K95A 2K2FA 3VRQA 4QJ4B 1DJXA 3CR4X 1CMGA 1SCMC 1OSAA 4HRHA 4FTGA 4MSPA 3VGOA 1OZOA 1IH0A 1OZSA 4GUKA 4JWQA 1B7TZ 1B7TY 1CM1A 1JFKA 2M9GA 1B4CA 5HLOA 1AUIB 2JNXA
chains in the Genus database with same CATH superfamily
1MUXA 3IQOA 1BU3A 3BQ3A 1YRTB 3JTDC 4A4BA 1J7QA 1PVAA 1UHIA 1V1GA 3LCPC 3OB1B 5HLVA 1YTZC 3AKAA 1ZMZA 2JT8A 1TWOA 2JT0A 1K93D 1CFCA 1XA5A 4ZCVA 2A4JA 1NX3A 2LV7A 2Y5IA 3F45A 1F8HA 1KSMA 1N2DA 4DIRA 2KYFA 1CDNA 3DF0B 4PT1A 1CTRA 2KAXA 2PVBA 2MRDA 3BFHA 4CFRA 2LUCA 3SG4A 3SG3A 2PALA 1XFVO 5CSIA 1QX5B 1SCVA 3SS3A 3B88A 2QPTA 1B47A 2OTGB 1IRJA 2WCMA 3KPXA 3LK0A 3NGVA 3O78A 2BE6A 2JPTA 4DS7A 1DJWA 3BOWA 3NSLA 1DJGA 1OE9B 4MN0A 4MEWA 4PDZA 2M7LA 1KFUS 3I5GC 5AXIA 2AAOA 1MWNA 4ORBB 1TNQA 2F8PA 5K89A 3BUOB 1QV1A 1U5IB 5J3XA 3SJSA 1BT6A 3GK2A 4OKHA 2LAPA 1AJ5A 5JJGA 1EG4A 3MSEB 4USLA 2JTZA 1F4OA 3IF7A 1HT9A 1OOHA 2WCJA 1QIVA 4GGFA 3TDIA 1DGUA 4C0KA 1XFUO 4INXA 4D1EA 4CFQA 2OS8C 5DKQA 1FF1A 3OX6A 3D73A 4MBEA 2KQYA 1IJ5A 2MHHA 3A4UB 3SG6A 3QRXA 4N5XA 1A03A 3EK4A 4ETOA 3M0WA 4YGBB 1F70A 2KHNA 1G4YR 1TCFA 1KK8C 3OHMB 3DY9A 5GQQC 3A8RA 1UHHA 1NYAA 4MZJA 3TZ1A 1B1GA 1KQMC 3SIAA 1QS7A 3BXKA 1XO5A 1WDCC 1NCYA 1A2XA 3I5IC 1Z4HA 2LVIA 4I5NB 1CLBA 2H61A 2JXLA 1RFJA 2KI4C 1WY9A 1JF0A 2FCDA 1MXLC 4N1GA 1QLKA 3Q8IA 3R1OA 1TOPA 3AKBA 1TCOB 2L50A 3BFBA 4OV2A 1SSEB 2TN4A 4I5JA 3DXLA 2FJYA 2NLNA 2Y1NA 1TNXA 2K2AA 1QTXA 4MRYA 4OR9B 1A75B 5FI2A 1BR4B 2GGMA 3D10A 1J1EA 3R1VA 1CFPA 1NX0A 2Q91A 2M1UA 1DF0B 2IS9A 3VB1A 1UUSA 4AOMA 3BYAA 1YVHA 4MVFA 1CFFA 3I5GB 1J55A 2MA2A 4M2OA 3VRNA 1K9PA 1SR6C 1TUZA 2F3ZA 5CPVA 4TNCA 4JD9A 4QJ5B 3RLZA 2KAVA 1KFXL 1DJHA 2QEBA 2PYQA 1DQEA 1TTXA 4PHMA 1BODA 3S0FA 1CMFA 1K2HA 3EG5B 1DTLA 1XFRA 1QASA 5I2QA 2DOQA 1JBAA 3VROA 3D74A 2K7BA 3C1VA 3R72A 3PALA 3DZTA 1MR8A 1DMOA 1GQMA 1L7ZA 2M0RA 3D75A 2BBMA 1OMVA 1LA3A 3LL8B 3O6BA 1S3PA 1AHRA 3E3RA 3CWGA 1BOCA 1S5GZ 2E6WA 1L2OB 1BJFA 1S5GY 1YX8A 1Y1XA 4NDCA 2LP2A 3TUYB 1BR1B 2KPHA 1OMRA 1R6PA 2BCXA 3D77A 1ORGA 2KFHA 1ODBA 1EJ3A 1OOFA 1Y6WA 2ZKMX 1SW8A 4CLNA 3OX5A 1LA0A 5KTYA 1WDCB 3I5HB 2L2EA 2JT3A 1NCXA 1YUSA 4JQ0D 4N1FA 5CSFA 4L9MA 2L2CA 5HKYA 2M7NA 4GGFC 2LNKA 1CM4A 2NCOA 1X02A 3K1EA 2CTNA 3EVUA 4KYNA 4HRGA 3S0AA 4YGEB 2LE9B 2YGUA 4PHNA 4INWA 2F2PA 5ER4X 1KQVA 1M31A 1DELA 3DD4A 2ZRTA 1C3ZA 2JC2A 5HYDA 2K7OA 4PE0A 4IL1A 5ER5A 2HQ8A 2WCFA 5FI6A 1DT7B 3TS5C 2PASA 4HSZA 1AP4A 3I5FC 2M29A 1SR6B 1BG1A 1ALWA 2L4IA 1QWVA 3CGAA 3S0GA 3D76A 3WXAA 3DVMA 3EKJA 1DJIA 3DF0A 1QX2A 2COLB 4WQ2A 4I5KA 4PHKA 1YUUA 2K7CA 2KDHA 1OQPA 2LM5A 3ICBA 3SS5A 1W7JB 2WNDA 1KWOC 3NSKA 2BL0C 1CLMA 1IQ5A 1K94A 1XVJA 1IG5A 1TN4A 1M39A 2B1UA 1CDMA 1YR5A 2LHLA 2KLDA 4XYNA 2JPOA 2P70A 1XK4C 2QEHA 3EK8A 4XJKB 1P28A 1B9AA 3PM8A 3CS1A 1WLMA 1Y0VH 2I94A 1GJYA 2JQ6A 4PE1A 3BUNB 2BAPA 3VRRA 3VRPA 4NQGA 1FPWA 1AK8A 1NPQA 1U5IA 5DICA 1EH2A 4C0JA 3SG2A 1TNPA 2KLEA 5KU1A 3CZTX 1FBVA 1SCMB 1DVIA 3S0BA 1T14A 2KBMA 5BPJA 4Q04A 2L5XB 2LANA 3CZ1A 2ZNDA 4M2QA 1WRKA 1YURA 4GAOA 4QJ3B 4ICBA 1KFUL 4E68A 2ZNEA 4A4CA 1JF2A 1XFYO 3UNWA 1IKUA 1MXEA 2LVKA 1S26D 3KF9A 2L51A 3CR2A 3JTDB 4M2PA 4OZDA 3CTNA 1FI5A 1Q80A 1XFZO 1NX1A 4PE7A 2WCLA 4YI9A 5IBWA 1M45A 2BKHB 2HETA 2HPSA 2WCHA 1UWOA 1C7VA 2KAYA 1LINA 2GV5A 1K90D 4CPVA 4ORCB 3JVTC 4YGCB 3CYZA 1ALVA 2LHIA 1WLZA 3NHTA 1SNLA 2V53A 1JUOA 1OOIX 4DCKA 1XFXO 3PN7C 2PSRA 2I7AA 3PATA 4UPGA 5AEQA 2K0JA 1B8LA 4R1EA 1G8IA 1C07A 1H4BA 1M63B 2KSPA 3PJIA 5PALA 3BJHA 1F4QA 2G9BA 2P71A 1S6IA 2NZ0A 2PQLA 1DGVA 1UURA 3D0YB 5D7FA 1UHNA 1A75A 1GM0A 1NX2A 3B86A 1LS8A 1CLLA 3UO9A 1RROA 4CIDA 1AVSA 1DF0A 2PMYA 4FQOA 4AQJA 1PVBA 2VRGA 5DKRA 2KI6D 1XYDA 3D0YA 1W9ZA 2LMTA 1JSAA 3CR5X 1N65A 1K9UA 5D69A 2NXQA 4P2YB 1CKKA 3IVTA 2M1KB 1SKTA 2JOJA 4MZLA 1UHKA 1JFJA 1SMGA 3BUWB 1A4PA 2M3WA 3OGNA 4PALA 3TDUA 3K21A 4GFTA 3GOFA 2GGZA 2OS8B 3OB2B 4F0ZB 2LC5A 1BLQA 2M49B 1EL4A 3BFAA 2KYCA 2WCBA 3PLFB 3N7HA 1TUJA 1SRAA 2MJWB 5JOLA 3HX4A 5CSJA 1SL9A 5G08A 2CCMA 2D8NA 3NSIA 3SIBA 1SL7A 3PM2A 4FQTA 5FYXA 2OTGC 4YI8A 3H4SE 2MLFC 1SY9A 1SYMA 1KK8B 1SPYA 3S0DA 3DVEA 1H8BA 1FI6A 3O2PA 1KQMB 2F2OA 5B8IB 2KGBC 3I5IB 3S0EA 4YGDB 4NDDA 5DKNA 2MLEC 2MAZA 2R2IA 1SL8A 1OOGA 2KI4B 2ISDA 3SS4A 1GGZA 1EG3A 4MLWA 1KSOA 2ZFDA 2H8VA 3GK4X 3CZ2A 1ZOTB 1C3YA 1PULA 1YX7A 2EGDA 1NSHA 3KO0A 2WCKA 1RK9A 4PE4A 1FW4A 3QMEA 1NUBA 1ZACA 2BE4A 1QLSA 1TIZA 1S6CA 2ZRSA 2QEVA 2K60A 3B87A 3OP0A 1D1OA 3L47A 3LK1A 4JPZB 2AMIA 1LXFC 2JZIA 3FE8A 2ZN8A 3DYEA 3B7AA 3WHUB 1IWQA 4PCWA 1BMOA 4DRWA 1DEKA 3BUMB 1KK7Z 2G2BA 1KK7Y 3L4AA 1OMDA 2H61C 2O5GA 1QATA 1S6JA 2BECA 2M8UA 3NHIA 2QACA 1IJ6A 3FWCA 2RGIA 4P5OE 1R2UA 5I2LA 3HCMA 2LLTA 4I5LB 1GGWA 1K8UA 3NSOA 1IGVA 2K61A 2OPOA 3L4LA 3O4YA 1JC2A 2AUCA 2FJUB 1F54A 1NWDA 1C7WA 3PFVA 2WC6A 2SCPA 2KFFA 2BNXA 3BOWB 5KSZA 3CZ0A 4XJKA 4DUQA 3V2LA 2K8MB 2NCPA 4JKTA 1Y1AA 1Y1UA 4WQ3A 2LLUA 1PRWA 2H2KA 5I2OA 2EC6C 1M46A 1SBJA 3FS7A 2K7DA 3CLNA 4MZKA 1NIWA 1SK6D 2I18A 2JXCA 5AANA 1CNPA 1RECA 2KOTA 2M97A 1N0YA 4WRIA 4YBHB 2LMVA 3ZNIA 1K9KA 4YGAA 1IIOA 3DVJA 3FE9A 2GTEA 3LLEA 5AERA 3FWBA 2KBIA 1VRKA 1B8RA 2BCBA 2L0PA 1BF5A 1QXPA 1KCYA 3TDZA 1TRFA 4OVNF 1CDPA 3O4XA 1EXRA 2WCEA 1XFWO 4U8DA 2CNPA 4ZCUA 2BBNA 2BKIB 1S36A 2LUXA 2Q4UA 3EKHA 3KHEA 4NDBA 5FI7A 2JNFA 1PK0D 1MQ1A 1K96A 1QJTA 1J7RA 1E8AA 1MF8B 1RJVA 2QDIA 2WC8A 3BUXB 1Z2CB 3TS5B 2FOTA 1L2OC 3I5FB 2WORA 3SG5A 2P6BB 2SASA 1J1DA 1G33A 2BCAA 1WRZA 2HF5A 2JWWA 3TUYC 1IQ3A 2MBXA 1ZUZA 1DJZA 3R1PA 1F55A 1RWYA 3AAJA 5HKWA 1ZFSA 1YUTA 2QEOA 1RTP1 4IJ7A 2CBLA 3EVRA 1F71A 3I5HC 1CDLA 1KWOB 2BL0B 3CDNA 2JU0A 1OOJA 2KFGA 1DJYA 1QV0A 1AJ4A 3FE6A 2EHBA 1J7PA 1KFXS 2FCEA 3PSRA 4YRUA 5D3OA 1B8CA 4HREE 1CB1A 3IQQA 4ORAB 1LKJA 2JTTA 2JULA 2Y4QA 1XK4A 1YVLA 2I2RE 5TNCA 1WRLA 4F7FA 2LLSA 4BY4A 2EC6B 4AQIA 1NCZA 5F6TA 3FIAA 3D78A 1UP5A 3GK1A 3RZSA 4GBAA 1PSRA 2LVVA 4PHJA 2F33A 1QX7A 1HQVA 1V1FA 3WNXB 5HL1A 5I94A 2JRFA 2LP3A 4GGNA 2CXJA 2KNEA 4OCIA 3KEVA 3NXAA 3RM1A 4GNKB 2E30A 5EL2A 2ZN9A 1A29A 2L98A 3ZWHA 1QIWA 4C0LA 5AFPA 1JWDA 2WC5A 2HQWA 5I8NA 1J7OA 1CFDA 3EVVA 2LVJA 2KI6C 2L4HA 2KQ6A 1UHJA 2Y1MA 1QVIZ 1LVCD 4MRXA 3WHTB 1NP8A 1PSBA 1QVIY 2F3YA 2L5YA 3JVTB 1OW4A 3DVKA 1DC1A 1S1EA 5HKZA 1MHOA 2CT9A 1W7IB 2O60A 3SG7A 2PRUA 2LCPA 1PALA 1TNWA 4GPLB 2KGRA 3PN7B 4BY5A 1YRUB 2WOSA 3CABA 3OBVA 2LMUA 3EK7A 3AAKA 5CSNA 1K95A 2K2FA 3VRQA 4QJ4B 1DJXA 3CR4X 1CMGA 1SCMC 1OSAA 4HRHA 4FTGA 4MSPA 3VGOA 1OZOA 3B6XA 1IH0A 1OZSA 4GUKA 4JWQA 1B7TZ 1B7TY 2ERBA 1CM1A 1JFKA 2M9GA 1B4CA 5HLOA 1AUIB 2JNXA
chains in the Genus database with same CATH topology
1MUXA 3IQOA 1BU3A 3BQ3A 1YRTB 3JTDC 4A4BA 1J7QA 1PVAA 1UHIA 1V1GA 3LCPC 3OB1B 5HLVA 1YTZC 3AKAA 1ZMZA 2JT8A 2JT0A 1K93D 1CFCA 1XA5A 4ZCVA 2A4JA 1NX3A 2LV7A 2Y5IA 3F45A 1F8HA 1KSMA 1N2DA 4DIRA 2KYFA 1CDNA 3DF0B 1CTRA 2KAXA 2PVBA 2MRDA 4CFRA 2LUCA 3SG4A 3SG3A 2PALA 1XFVO 5CSIA 1QX5B 1SCVA 2QPTA 1B47A 2OTGB 1IRJA 3KPXA 3LK0A 3O78A 2BE6A 2JPTA 4DS7A 1DJWA 3BOWA 3NSLA 1DJGA 1OE9B 4MN0A 4MEWA 4PDZA 2M7LA 1KFUS 3I5GC 5AXIA 2AAOA 1MWNA 4ORBB 1TNQA 2F8PA 5K89A 3BUOB 1QV1A 1U5IB 5J3XA 3SJSA 1BT6A 3GK2A 4OKHA 2LAPA 1AJ5A 5JJGA 1EG4A 3MSEB 4USLA 2JTZA 1F4OA 3IF7A 1HT9A 1QIVA 4GGFA 3TDIA 1DGUA 4C0KA 1XFUO 4D1EA 1FF1A 4CFQA 2OS8C 5DKQA 3OX6A 4MBEA 2KQYA 1IJ5A 2MHHA 3A4UB 3SG6A 3QRXA 4N5XA 1A03A 3EK4A 4ETOA 3M0WA 4YGBB 1F70A 2KHNA 1G4YR 1TCFA 1KK8C 3OHMB 3A8RA 1UHHA 1NYAA 4MZJA 3TZ1A 1B1GA 1KQMC 3SIAA 1QS7A 3BXKA 1XO5A 1WDCC 1NCYA 1A2XA 3I5IC 2LVIA 4I5NB 1CLBA 2H61A 2JXLA 1RFJA 2KI4C 1WY9A 1JF0A 2FCDA 1MXLC 4N1GA 1QLKA 1TOPA 3AKBA 1TCOB 2L50A 4OV2A 2TN4A 4I5JA 2NLNA 2Y1NA 1TNXA 2K2AA 1QTXA 4MRYA 4OR9B 1A75B 1BR4B 2GGMA 3D10A 1J1EA 1CFPA 1NX0A 2Q91A 2M1UA 1DF0B 2IS9A 1UUSA 4AOMA 3BYAA 1YVHA 4MVFA 1CFFA 3I5GB 1J55A 2MA2A 4M2OA 3VRNA 1K9PA 1SR6C 2F3ZA 5CPVA 4TNCA 4QJ5B 3RLZA 2KAVA 1KFXL 1DJHA 1BODA 4PHMA 1TTXA 1CMFA 1K2HA 1DTLA 1QASA 5I2QA 2DOQA 1JBAA 3VROA 2K7BA 3C1VA 3PALA 1MR8A 1DMOA 1GQMA 1L7ZA 2M0RA 3LL8B 2BBMA 1OMVA 1LA3A 3O6BA 1S3PA 1AHRA 3E3RA 3CWGA 1BOCA 1S5GZ 2E6WA 1L2OB 1BJFA 1S5GY 1YX8A 1Y1XA 4NDCA 2LP2A 3TUYB 1BR1B 1OMRA 1R6PA 2BCXA 2KFHA 2ZKMX 1ODBA 1EJ3A 1Y6WA 4CLNA 1SW8A 3OX5A 1LA0A 5KTYA 1WDCB 3I5HB 2L2EA 2JT3A 1NCXA 1YUSA 4JQ0D 4N1FA 5CSFA 4L9MA 5HKYA 2M7NA 4GGFC 2LNKA 1CM4A 2NCOA 1X02A 2CTNA 3EVUA 4HRGA 4YGEB 2LE9B 4PHNA 2F2PA 5ER4X 1KQVA 1M31A 3DD4A 2ZRTA 5HYDA 2JC2A 2K7OA 4PE0A 4IL1A 5ER5A 2HQ8A 2WCFA 1DT7B 3TS5C 2PASA 4HSZA 1AP4A 3I5FC 2M29A 1SR6B 1BG1A 1ALWA 2L4IA 3CGAA 3WXAA 3DVMA 3EKJA 1DJIA 3DF0A 1QX2A 2COLB 4WQ2A 4I5KA 4PHKA 1YUUA 2K7CA 2KDHA 1OQPA 2LM5A 3ICBA 1W7JB 2WNDA 1KWOC 3NSKA 2BL0C 1CLMA 1IQ5A 1K94A 1XVJA 1IG5A 1TN4A 1M39A 2B1UA 1CDMA 1YR5A 2LHLA 4XYNA 3EK8A 1XK4C 4XJKB 3PM8A 1B9AA 3CS1A 1WLMA 1Y0VH 2I94A 1GJYA 2JQ6A 4PE1A 3BUNB 3VRRA 3VRPA 4NQGA 1FPWA 1AK8A 1NPQA 1U5IA 1EH2A 4C0JA 3SG2A 1TNPA 5KU1A 3CZTX 1FBVA 1SCMB 1DVIA 2KBMA 5BPJA 4Q04A 2L5XB 2LANA 2ZNDA 4M2QA 1WRKA 1YURA 4GAOA 4QJ3B 4ICBA 1KFUL 4E68A 2ZNEA 4A4CA 1JF2A 1XFYO 1IKUA 1MXEA 2LVKA 1S26D 3KF9A 2L51A 3CR2A 3JTDB 4M2PA 3CTNA 1FI5A 1Q80A 1XFZO 1NX1A 4PE7A 4YI9A 5IBWA 1M45A 2BKHB 2HETA 2HPSA 1UWOA 1C7VA 2KAYA 1LINA 2GV5A 1K90D 4CPVA 4ORCB 3JVTC 4YGCB 1ALVA 2LHIA 1WLZA 1SNLA 2V53A 1JUOA 4DCKA 1XFXO 3PN7C 2PSRA 2I7AA 3PATA 4UPGA 5AEQA 2K0JA 1B8LA 4R1EA 1G8IA 1C07A 1H4BA 1M63B 2KSPA 5PALA 1F4QA 2G9BA 1S6IA 2NZ0A 1DGVA 1UURA 3D0YB 5D7FA 1UHNA 1A75A 1NX2A 1CLLA 1RROA 4CIDA 1AVSA 1DF0A 2PMYA 4FQOA 4AQJA 1PVBA 2VRGA 5DKRA 2KI6D 1XYDA 3D0YA 2LMTA 1JSAA 3CR5X 1N65A 1K9UA 5D69A 2NXQA 4P2YB 1CKKA 2M1KB 1SKTA 2JOJA 4MZLA 1UHKA 1JFJA 1SMGA 3BUWB 1A4PA 2M3WA 4PALA 3TDUA 3K21A 4GFTA 3GOFA 2GGZA 2OS8B 3OB2B 4F0ZB 2LC5A 1BLQA 2M49B 1EL4A 2KYCA 2WCBA 3PLFB 2MJWB 1SRAA 5JOLA 3HX4A 5CSJA 1SL9A 5G08A 2CCMA 2D8NA 3NSIA 3SIBA 1SL7A 5FYXA 2OTGC 4YI8A 3H4SE 2MLFC 1SY9A 1SYMA 1KK8B 1SPYA 3DVEA 1H8BA 1FI6A 3O2PA 1KQMB 2F2OA 5B8IB 2KGBC 3I5IB 4YGDB 4NDDA 5DKNA 2MLEC 2MAZA 2R2IA 1SL8A 2ISDA 2KI4B 1GGZA 1EG3A 4MLWA 1KSOA 2ZFDA 3GK4X 1ZOTB 1PULA 1YX7A 2EGDA 1NSHA 3KO0A 4PE4A 1RK9A 1FW4A 1NUBA 1ZACA 2BE4A 1QLSA 1TIZA 1S6CA 2ZRSA 3OP0A 1D1OA 3LK1A 4JPZB 2AMIA 1LXFC 2JZIA 2ZN8A 3WHUB 1IWQA 4PCWA 1BMOA 4DRWA 3BUMB 1KK7Z 2G2BA 1KK7Y 1OMDA 2H61C 2O5GA 1QATA 1S6JA 2BECA 2M8UA 2QACA 1IJ6A 3FWCA 2RGIA 4P5OE 1R2UA 5I2LA 3HCMA 2LLTA 4I5LB 1GGWA 1K8UA 3NSOA 1IGVA 2K61A 2OPOA 3O4YA 1JC2A 2AUCA 2FJUB 1F54A 1NWDA 1C7WA 3PFVA 2SCPA 2KFFA 3BOWB 5KSZA 4XJKA 4DUQA 2K8MB 2NCPA 1Y1AA 1Y1UA 4WQ3A 2LLUA 1PRWA 2H2KA 5I2OA 2EC6C 1M46A 1SBJA 3FS7A 2K7DA 3CLNA 4MZKA 1NIWA 1SK6D 2I18A 2JXCA 5AANA 1CNPA 1RECA 2KOTA 2M97A 1N0YA 4WRIA 4YBHB 2LMVA 3ZNIA 1K9KA 4YGAA 3DVJA 3LLEA 5AERA 3FWBA 2KBIA 1VRKA 1B8RA 2BCBA 2L0PA 1BF5A 1QXPA 1KCYA 3TDZA 1TRFA 4OVNF 1CDPA 1EXRA 2WCEA 1XFWO 4U8DA 2CNPA 4ZCUA 2BBNA 2BKIB 1S36A 2LUXA 2Q4UA 3EKHA 3KHEA 4NDBA 5GQQC 2JNFA 1PK0D 1MQ1A 1K96A 1QJTA 1J7RA 1E8AA 1MF8B 1RJVA 2WC8A 3BUXB 3TS5B 2FOTA 1L2OC 3I5FB 2WORA 3SG5A 2P6BB 2SASA 1J1DA 1G33A 2BCAA 1WRZA 2HF5A 2JWWA 3TUYC 1IQ3A 2MBXA 1ZUZA 1DJZA 1F55A 1RWYA 3AAJA 5HKWA 1ZFSA 1YUTA 1RTP1 2CBLA 3EVRA 1F71A 3I5HC 1CDLA 1KWOB 2BL0B 2JU0A 1OOJA 2KFGA 1DJYA 1QV0A 1AJ4A 2EHBA 1J7PA 1KFXS 2FCEA 3PSRA 4YRUA 1B8CA 4HREE 1CB1A 3IQQA 4ORAB 1LKJA 2JTTA 2JULA 2Y4QA 1XK4A 1YVLA 2I2RE 5TNCA 1WRLA 2LLSA 4BY4A 2EC6B 4AQIA 1NCZA 5F6TA 3FIAA 1UP5A 3GK1A 4GBAA 1PSRA 2LVVA 4PHJA 2F33A 1QX7A 1HQVA 1V1FA 3WNXB 2JRFA 2LP3A 4GGNA 2CXJA 2KNEA 4OCIA 3KEVA 3NXAA 3RM1A 4GNKB 2E30A 2ZN9A 1A29A 2L98A 3ZWHA 1QIWA 4C0LA 5AFPA 1JWDA 2HQWA 5I8NA 1J7OA 1CFDA 3EVVA 2LVJA 2KI6C 2L4HA 2KQ6A 1UHJA 2Y1MA 1QVIZ 1LVCD 4MRXA 3WHTB 1NP8A 1PSBA 1QVIY 2F3YA 3JVTB 3DVKA 1S1EA 5HKZA 1MHOA 2CT9A 1W7IB 2O60A 3SG7A 2PRUA 2LCPA 1PALA 1TNWA 4GPLB 2KGRA 3PN7B 4BY5A 1YRUB 2WOSA 2LMUA 3EK7A 3AAKA 5CSNA 1K95A 2K2FA 3VRQA 4QJ4B 1DJXA 3CR4X 1CMGA 1SCMC 1OSAA 4HRHA 4FTGA 4MSPA 3VGOA 1OZOA 1IH0A 1OZSA 4GUKA 4JWQA 1B7TZ 1B7TY 1CM1A 1JFKA 2M9GA 1B4CA 5HLOA 1AUIB 2JNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUX A;  3IQO A;  1BU3 A;  3BQ3 A;  1YRT B;  3JTD C;  4A4B A;  1J7Q A;  1PVA A;  1UHI A;  1V1G A;  3LCP C;  3OB1 B;  5HLV A;  1YTZ C;  3AKA A;  1ZMZ A;  2JT8 A;  2JT0 A;  1K93 D;  1CFC A;  1XA5 A;  4ZCV A;  2A4J A;  1NX3 A;  2LV7 A;  2Y5I A;  3F45 A;  1F8H A;  1KSM A;  1N2D A;  4DIR A;  2KYF A;  1CDN A;  3DF0 B;  1CTR A;  2KAX A;  2PVB A;  2MRD A;  4CFR A;  2LUC A;  3SG4 A;  3SG3 A;  2PAL A;  1XFV O;  5CSI A;  1QX5 B;  1SCV A;  2QPT A;  1B47 A;  2OTG B;  1IRJ A;  3KPX A;  3LK0 A;  3O78 A;  2BE6 A;  2JPT A;  4DS7 A;  1DJW A;  3BOW A;  3NSL A;  1DJG A;  1OE9 B;  4MN0 A;  4MEW A;  4PDZ A;  2M7L A;  1KFU S;  3I5G C;  5AXI A;  2AAO A;  1MWN A;  4ORB B;  1TNQ A;  2F8P A;  5K89 A;  3BUO B;  1QV1 A;  1U5I B;  5J3X A;  3SJS A;  1BT6 A;  3GK2 A;  4OKH A;  2LAP A;  1AJ5 A;  5JJG A;  1EG4 A;  3MSE B;  4USL A;  2JTZ A;  1F4O A;  3IF7 A;  1HT9 A;  1QIV A;  4GGF A;  3TDI A;  1DGU A;  4C0K A;  1XFU O;  4D1E A;  1FF1 A;  4CFQ A;  2OS8 C;  5DKQ A;  3OX6 A;  4MBE A;  2KQY A;  1IJ5 A;  2MHH A;  3A4U B;  3SG6 A;  3QRX A;  4N5X A;  1A03 A;  3EK4 A;  4ETO A;  3M0W A;  4YGB B;  1F70 A;  2KHN A;  1G4Y R;  1TCF A;  1KK8 C;  3OHM B;  3A8R A;  1UHH A;  1NYA A;  4MZJ A;  3TZ1 A;  1B1G A;  1KQM C;  3SIA A;  1QS7 A;  3BXK A;  1XO5 A;  1WDC C;  1NCY A;  1A2X A;  3I5I C;  2LVI A;  4I5N B;  1CLB A;  2H61 A;  2JXL A;  1RFJ A;  2KI4 C;  1WY9 A;  1JF0 A;  2FCD A;  1MXL C;  4N1G A;  1QLK A;  1TOP A;  3AKB A;  1TCO B;  2L50 A;  4OV2 A;  2TN4 A;  4I5J A;  2NLN A;  2Y1N A;  1TNX A;  2K2A A;  1QTX A;  4MRY A;  4OR9 B;  1A75 B;  1BR4 B;  2GGM A;  3D10 A;  1J1E A;  1CFP A;  1NX0 A;  2Q91 A;  2M1U A;  1DF0 B;  2IS9 A;  1UUS A;  4AOM A;  3BYA A;  1YVH A;  4MVF A;  1CFF A;  3I5G B;  1J55 A;  2MA2 A;  4M2O A;  3VRN A;  1K9P A;  1SR6 C;  2F3Z A;  5CPV A;  4TNC A;  4QJ5 B;  3RLZ A;  2KAV A;  1KFX L;  1DJH A;  1BOD A;  4PHM A;  1TTX A;  1CMF A;  1K2H A;  1DTL A;  1QAS A;  5I2Q A;  2DOQ A;  1JBA A;  3VRO A;  2K7B A;  3C1V A;  3PAL A;  1MR8 A;  1DMO A;  1GQM A;  1L7Z A;  2M0R A;  3LL8 B;  2BBM A;  1OMV A;  1LA3 A;  3O6B A;  1S3P A;  1AHR A;  3E3R A;  3CWG A;  1BOC A;  1S5G Z;  2E6W A;  1L2O B;  1BJF A;  1S5G Y;  1YX8 A;  1Y1X A;  4NDC A;  2LP2 A;  3TUY B;  1BR1 B;  1OMR A;  1R6P A;  2BCX A;  2KFH A;  2ZKM X;  1ODB A;  1EJ3 A;  1Y6W A;  4CLN A;  1SW8 A;  3OX5 A;  1LA0 A;  5KTY A;  1WDC B;  3I5H B;  2L2E A;  2JT3 A;  1NCX A;  1YUS A;  4JQ0 D;  4N1F A;  5CSF A;  4L9M A;  5HKY A;  2M7N A;  4GGF C;  2LNK A;  1CM4 A;  2NCO A;  1X02 A;  2CTN A;  3EVU A;  4HRG A;  4YGE B;  2LE9 B;  4PHN A;  2F2P A;  5ER4 X;  1KQV A;  1M31 A;  3DD4 A;  2ZRT A;  5HYD A;  2JC2 A;  2K7O A;  4PE0 A;  4IL1 A;  5ER5 A;  2HQ8 A;  2WCF A;  1DT7 B;  3TS5 C;  2PAS A;  4HSZ A;  1AP4 A;  3I5F C;  2M29 A;  1SR6 B;  1BG1 A;  1ALW A;  2L4I A;  3CGA A;  3WXA A;  3DVM A;  3EKJ A;  1DJI A;  3DF0 A;  1QX2 A;  2COL B;  4WQ2 A;  4I5K A;  4PHK A;  1YUU A;  2K7C A;  2KDH A;  1OQP A;  2LM5 A;  3ICB A;  1W7J B;  2WND A;  1KWO C;  3NSK A;  2BL0 C;  1CLM A;  1IQ5 A;  1K94 A;  1XVJ A;  1IG5 A;  1TN4 A;  1M39 A;  2B1U A;  1CDM A;  1YR5 A;  2LHL A;  4XYN A;  3EK8 A;  1XK4 C;  4XJK B;  3PM8 A;  1B9A A;  3CS1 A;  1WLM A;  1Y0V H;  2I94 A;  1GJY A;  2JQ6 A;  4PE1 A;  3BUN B;  3VRR A;  3VRP A;  4NQG A;  1FPW A;  1AK8 A;  1NPQ A;  1U5I A;  1EH2 A;  4C0J A;  3SG2 A;  1TNP A;  5KU1 A;  3CZT X;  1FBV A;  1SCM B;  1DVI A;  2KBM A;  5BPJ A;  4Q04 A;  2L5X B;  2LAN A;  2ZND A;  4M2Q A;  1WRK A;  1YUR A;  4GAO A;  4QJ3 B;  4ICB A;  1KFU L;  4E68 A;  2ZNE A;  4A4C A;  1JF2 A;  1XFY O;  1IKU A;  1MXE A;  2LVK A;  1S26 D;  3KF9 A;  2L51 A;  3CR2 A;  3JTD B;  4M2P A;  3CTN A;  1FI5 A;  1Q80 A;  1XFZ O;  1NX1 A;  4PE7 A;  4YI9 A;  5IBW A;  1M45 A;  2BKH B;  2HET A;  2HPS A;  1UWO A;  1C7V A;  2KAY A;  1LIN A;  2GV5 A;  1K90 D;  4CPV A;  4ORC B;  3JVT C;  4YGC B;  1ALV A;  2LHI A;  1WLZ A;  1SNL A;  2V53 A;  1JUO A;  4DCK A;  1XFX O;  3PN7 C;  2PSR A;  2I7A A;  3PAT A;  4UPG A;  5AEQ A;  2K0J A;  1B8L A;  4R1E A;  1G8I A;  1C07 A;  1H4B A;  1M63 B;  2KSP A;  5PAL A;  1F4Q A;  2G9B A;  1S6I A;  2NZ0 A;  1DGV A;  1UUR A;  3D0Y B;  5D7F A;  1UHN A;  1A75 A;  1NX2 A;  1CLL A;  1RRO A;  4CID A;  1AVS A;  1DF0 A;  2PMY A;  4FQO A;  4AQJ A;  1PVB A;  2VRG A;  5DKR A;  2KI6 D;  1XYD A;  3D0Y A;  2LMT A;  1JSA A;  3CR5 X;  1N65 A;  1K9U A;  5D69 A;  2NXQ A;  4P2Y B;  1CKK A;  2M1K B;  1SKT A;  2JOJ A;  4MZL A;  1UHK A;  1JFJ A;  1SMG A;  3BUW B;  1A4P A;  2M3W A;  4PAL A;  3TDU A;  3K21 A;  4GFT A;  3GOF A;  2GGZ A;  2OS8 B;  3OB2 B;  4F0Z B;  2LC5 A;  1BLQ A;  2M49 B;  1EL4 A;  2KYC A;  2WCB A;  3PLF B;  2MJW B;  1SRA A;  5JOL A;  3HX4 A;  5CSJ A;  1SL9 A;  5G08 A;  2CCM A;  2D8N A;  3NSI A;  3SIB A;  1SL7 A;  5FYX A;  2OTG C;  4YI8 A;  3H4S E;  2MLF C;  1SY9 A;  1SYM A;  1KK8 B;  1SPY A;  3DVE A;  1H8B A;  1FI6 A;  3O2P A;  1KQM B;  2F2O A;  5B8I B;  2KGB C;  3I5I B;  4YGD B;  4NDD A;  5DKN A;  2MLE C;  2MAZ A;  2R2I A;  1SL8 A;  2ISD A;  2KI4 B;  1GGZ A;  1EG3 A;  4MLW A;  1KSO A;  2ZFD A;  3GK4 X;  1ZOT B;  1PUL A;  1YX7 A;  2EGD A;  1NSH A;  3KO0 A;  4PE4 A;  1RK9 A;  1FW4 A;  1NUB A;  1ZAC A;  2BE4 A;  1QLS A;  1TIZ A;  1S6C A;  2ZRS A;  3OP0 A;  1D1O A;  3LK1 A;  4JPZ B;  2AMI A;  1LXF C;  2JZI A;  2ZN8 A;  3WHU B;  1IWQ A;  4PCW A;  1BMO A;  4DRW A;  3BUM B;  1KK7 Z;  2G2B A;  1KK7 Y;  1OMD A;  2H61 C;  2O5G A;  1QAT A;  1S6J A;  2BEC A;  2M8U A;  2QAC A;  1IJ6 A;  3FWC A;  2RGI A;  4P5O E;  1R2U A;  5I2L A;  3HCM A;  2LLT A;  4I5L B;  1GGW A;  1K8U A;  3NSO A;  1IGV A;  2K61 A;  2OPO A;  3O4Y A;  1JC2 A;  2AUC A;  2FJU B;  1F54 A;  1NWD A;  1C7W A;  3PFV A;  2SCP A;  2KFF A;  3BOW B;  5KSZ A;  4XJK A;  4DUQ A;  2K8M B;  2NCP A;  1Y1A A;  1Y1U A;  4WQ3 A;  2LLU A;  1PRW A;  2H2K A;  5I2O A;  2EC6 C;  1M46 A;  1SBJ A;  3FS7 A;  2K7D A;  3CLN A;  4MZK A;  1NIW A;  1SK6 D;  2I18 A;  2JXC A;  5AAN A;  1CNP A;  1REC A;  2KOT A;  2M97 A;  1N0Y A;  4WRI A;  4YBH B;  2LMV A;  3ZNI A;  1K9K A;  4YGA A;  3DVJ A;  3LLE A;  5AER A;  3FWB A;  2KBI A;  1VRK A;  1B8R A;  2BCB A;  2L0P A;  1BF5 A;  1QXP A;  1KCY A;  3TDZ A;  1TRF A;  4OVN F;  1CDP A;  1EXR A;  2WCE A;  1XFW O;  4U8D A;  2CNP A;  4ZCU A;  2BBN A;  2BKI B;  1S36 A;  2LUX A;  2Q4U A;  3EKH A;  3KHE A;  4NDB A;  5GQQ C;  2JNF A;  1PK0 D;  1MQ1 A;  1K96 A;  1QJT A;  1J7R A;  1E8A A;  1MF8 B;  1RJV A;  2WC8 A;  3BUX B;  3TS5 B;  2FOT A;  1L2O C;  3I5F B;  2WOR A;  3SG5 A;  2P6B B;  2SAS A;  1J1D A;  1G33 A;  2BCA A;  1WRZ A;  2HF5 A;  2JWW A;  3TUY C;  1IQ3 A;  2MBX A;  1ZUZ A;  1DJZ A;  1F55 A;  1RWY A;  3AAJ A;  5HKW A;  1ZFS A;  1YUT A;  1RTP 1;  2CBL A;  3EVR A;  1F71 A;  3I5H C;  1CDL A;  1KWO B;  2BL0 B;  2JU0 A;  1OOJ A;  2KFG A;  1DJY A;  1QV0 A;  1AJ4 A;  2EHB A;  1J7P A;  1KFX S;  2FCE A;  3PSR A;  4YRU A;  1B8C A;  4HRE E;  1CB1 A;  3IQQ A;  4ORA B;  1LKJ A;  2JTT A;  2JUL A;  2Y4Q A;  1XK4 A;  1YVL A;  2I2R E;  5TNC A;  1WRL A;  2LLS A;  4BY4 A;  2EC6 B;  4AQI A;  1NCZ A;  5F6T A;  3FIA A;  1UP5 A;  3GK1 A;  4GBA A;  1PSR A;  2LVV A;  4PHJ A;  2F33 A;  1QX7 A;  1HQV A;  1V1F A;  3WNX B;  2JRF A;  2LP3 A;  4GGN A;  2CXJ A;  2KNE A;  4OCI A;  3KEV A;  3NXA A;  3RM1 A;  4GNK B;  2E30 A;  2ZN9 A;  1A29 A;  2L98 A;  3ZWH A;  1QIW A;  4C0L A;  5AFP A;  1JWD A;  2HQW A;  5I8N A;  1J7O A;  1CFD A;  3EVV A;  2LVJ A;  2KI6 C;  2L4H A;  2KQ6 A;  1UHJ A;  2Y1M A;  1QVI Z;  1LVC D;  4MRX A;  3WHT B;  1NP8 A;  1PSB A;  1QVI Y;  2F3Y A;  3JVT B;  3DVK A;  1S1E A;  5HKZ A;  1MHO A;  2CT9 A;  1W7I B;  2O60 A;  3SG7 A;  2PRU A;  2LCP A;  1PAL A;  1TNW A;  4GPL B;  2KGR A;  3PN7 B;  4BY5 A;  1YRU B;  2WOS A;  2LMU A;  3EK7 A;  3AAK A;  5CSN A;  1K95 A;  2K2F A;  3VRQ A;  4QJ4 B;  1DJX A;  3CR4 X;  1CMG A;  1SCM C;  1OSA A;  4HRH A;  4FTG A;  4MSP A;  3VGO A;  1OZO A;  1IH0 A;  1OZS A;  4GUK A;  4JWQ A;  1B7T Z;  1B7T Y;  1CM1 A;  1JFK A;  2M9G A;  1B4C A;  5HLO A;  1AUI B;  2JNX A; 
#chains in the Genus database with same CATH topology
 1MUX A;  3IQO A;  1BU3 A;  3BQ3 A;  1YRT B;  3JTD C;  4A4B A;  1J7Q A;  1PVA A;  1UHI A;  1V1G A;  3LCP C;  3OB1 B;  5HLV A;  1YTZ C;  3AKA A;  1ZMZ A;  2JT8 A;  1TWO A;  2JT0 A;  1K93 D;  1CFC A;  1XA5 A;  4ZCV A;  2A4J A;  1NX3 A;  2LV7 A;  2Y5I A;  3F45 A;  1F8H A;  1KSM A;  1N2D A;  4DIR A;  2KYF A;  1CDN A;  3DF0 B;  4PT1 A;  1CTR A;  2KAX A;  2PVB A;  2MRD A;  3BFH A;  4CFR A;  2LUC A;  3SG4 A;  3SG3 A;  2PAL A;  1XFV O;  5CSI A;  1QX5 B;  1SCV A;  3SS3 A;  3B88 A;  2QPT A;  1B47 A;  2OTG B;  1IRJ A;  2WCM A;  3KPX A;  3LK0 A;  3NGV A;  3O78 A;  2BE6 A;  2JPT A;  4DS7 A;  1DJW A;  3BOW A;  3NSL A;  1DJG A;  1OE9 B;  4MN0 A;  4MEW A;  4PDZ A;  2M7L A;  1KFU S;  3I5G C;  5AXI A;  2AAO A;  1MWN A;  4ORB B;  1TNQ A;  2F8P A;  5K89 A;  3BUO B;  1QV1 A;  1U5I B;  5J3X A;  3SJS A;  1BT6 A;  3GK2 A;  4OKH A;  2LAP A;  1AJ5 A;  5JJG A;  1EG4 A;  3MSE B;  4USL A;  2JTZ A;  1F4O A;  3IF7 A;  1HT9 A;  1OOH A;  2WCJ A;  1QIV A;  4GGF A;  3TDI A;  1DGU A;  4C0K A;  1XFU O;  4INX A;  4D1E A;  4CFQ A;  2OS8 C;  5DKQ A;  1FF1 A;  3OX6 A;  3D73 A;  4MBE A;  2KQY A;  1IJ5 A;  2MHH A;  3A4U B;  3SG6 A;  3QRX A;  4N5X A;  1A03 A;  3EK4 A;  4ETO A;  3M0W A;  4YGB B;  1F70 A;  2KHN A;  1G4Y R;  1TCF A;  1KK8 C;  3OHM B;  3DY9 A;  5GQQ C;  3A8R A;  1UHH A;  1NYA A;  4MZJ A;  3TZ1 A;  1B1G A;  1KQM C;  3SIA A;  1QS7 A;  3BXK A;  1XO5 A;  1WDC C;  1NCY A;  1A2X A;  3I5I C;  1Z4H A;  2LVI A;  4I5N B;  1CLB A;  2H61 A;  2JXL A;  1RFJ A;  2KI4 C;  1WY9 A;  1JF0 A;  2FCD A;  1MXL C;  4N1G A;  1QLK A;  3Q8I A;  3R1O A;  1TOP A;  3AKB A;  1TCO B;  2L50 A;  3BFB A;  4OV2 A;  1SSE B;  2TN4 A;  4I5J A;  3DXL A;  2FJY A;  2NLN A;  2Y1N A;  1TNX A;  2K2A A;  1QTX A;  4MRY A;  4OR9 B;  1A75 B;  5FI2 A;  1BR4 B;  2GGM A;  3D10 A;  1J1E A;  3R1V A;  1CFP A;  1NX0 A;  2Q91 A;  2M1U A;  1DF0 B;  2IS9 A;  3VB1 A;  1UUS A;  4AOM A;  3BYA A;  1YVH A;  4MVF A;  1CFF A;  3I5G B;  1J55 A;  2MA2 A;  4M2O A;  3VRN A;  1K9P A;  1SR6 C;  1TUZ A;  2F3Z A;  5CPV A;  4TNC A;  4JD9 A;  4QJ5 B;  3RLZ A;  2KAV A;  1KFX L;  1DJH A;  2QEB A;  2PYQ A;  1DQE A;  1TTX A;  4PHM A;  1BOD A;  3S0F A;  1CMF A;  1K2H A;  3EG5 B;  1DTL A;  1XFR A;  1QAS A;  5I2Q A;  2DOQ A;  1JBA A;  3VRO A;  3D74 A;  2K7B A;  3C1V A;  3R72 A;  3PAL A;  3DZT A;  1MR8 A;  1DMO A;  1GQM A;  1L7Z A;  2M0R A;  3D75 A;  2BBM A;  1OMV A;  1LA3 A;  3LL8 B;  3O6B A;  1S3P A;  1AHR A;  3E3R A;  3CWG A;  1BOC A;  1S5G Z;  2E6W A;  1L2O B;  1BJF A;  1S5G Y;  1YX8 A;  1Y1X A;  4NDC A;  2LP2 A;  3TUY B;  1BR1 B;  2KPH A;  1OMR A;  1R6P A;  2BCX A;  3D77 A;  1ORG A;  2KFH A;  1ODB A;  1EJ3 A;  1OOF A;  1Y6W A;  2ZKM X;  1SW8 A;  4CLN A;  3OX5 A;  1LA0 A;  5KTY A;  1WDC B;  3I5H B;  2L2E A;  2JT3 A;  1NCX A;  1YUS A;  4JQ0 D;  4N1F A;  5CSF A;  4L9M A;  2L2C A;  5HKY A;  2M7N A;  4GGF C;  2LNK A;  1CM4 A;  2NCO A;  1X02 A;  3K1E A;  2CTN A;  3EVU A;  4KYN A;  4HRG A;  3S0A A;  4YGE B;  2LE9 B;  2YGU A;  4PHN A;  4INW A;  2F2P A;  5ER4 X;  1KQV A;  1M31 A;  1DEL A;  3DD4 A;  2ZRT A;  1C3Z A;  2JC2 A;  5HYD A;  2K7O A;  4PE0 A;  4IL1 A;  5ER5 A;  2HQ8 A;  2WCF A;  5FI6 A;  1DT7 B;  3TS5 C;  2PAS A;  4HSZ A;  1AP4 A;  3I5F C;  2M29 A;  1SR6 B;  1BG1 A;  1ALW A;  2L4I A;  1QWV A;  3CGA A;  3S0G A;  3D76 A;  3WXA A;  3DVM A;  3EKJ A;  1DJI A;  3DF0 A;  1QX2 A;  2COL B;  4WQ2 A;  4I5K A;  4PHK A;  1YUU A;  2K7C A;  2KDH A;  1OQP A;  2LM5 A;  3ICB A;  3SS5 A;  1W7J B;  2WND A;  1KWO C;  3NSK A;  2BL0 C;  1CLM A;  1IQ5 A;  1K94 A;  1XVJ A;  1IG5 A;  1TN4 A;  1M39 A;  2B1U A;  1CDM A;  1YR5 A;  2LHL A;  2KLD A;  4XYN A;  2JPO A;  2P70 A;  1XK4 C;  2QEH A;  3EK8 A;  4XJK B;  1P28 A;  1B9A A;  3PM8 A;  3CS1 A;  1WLM A;  1Y0V H;  2I94 A;  1GJY A;  2JQ6 A;  4PE1 A;  3BUN B;  2BAP A;  3VRR A;  3VRP A;  4NQG A;  1FPW A;  1AK8 A;  1NPQ A;  1U5I A;  5DIC A;  1EH2 A;  4C0J A;  3SG2 A;  1TNP A;  2KLE A;  5KU1 A;  3CZT X;  1FBV A;  1SCM B;  1DVI A;  3S0B A;  1T14 A;  2KBM A;  5BPJ A;  4Q04 A;  2L5X B;  2LAN A;  3CZ1 A;  2ZND A;  4M2Q A;  1WRK A;  1YUR A;  4GAO A;  4QJ3 B;  4ICB A;  1KFU L;  4E68 A;  2ZNE A;  4A4C A;  1JF2 A;  1XFY O;  3UNW A;  1IKU A;  1MXE A;  2LVK A;  1S26 D;  3KF9 A;  2L51 A;  3CR2 A;  3JTD B;  4M2P A;  4OZD A;  3CTN A;  1FI5 A;  1Q80 A;  1XFZ O;  1NX1 A;  4PE7 A;  2WCL A;  4YI9 A;  5IBW A;  1M45 A;  2BKH B;  2HET A;  2HPS A;  2WCH A;  1UWO A;  1C7V A;  2KAY A;  1LIN A;  2GV5 A;  1K90 D;  4CPV A;  4ORC B;  3JVT C;  4YGC B;  3CYZ A;  1ALV A;  2LHI A;  1WLZ A;  3NHT A;  1SNL A;  2V53 A;  1JUO A;  1OOI X;  4DCK A;  1XFX O;  3PN7 C;  2PSR A;  2I7A A;  3PAT A;  4UPG A;  5AEQ A;  2K0J A;  1B8L A;  4R1E A;  1G8I A;  1C07 A;  1H4B A;  1M63 B;  2KSP A;  3PJI A;  5PAL A;  3BJH A;  1F4Q A;  2G9B A;  2P71 A;  1S6I A;  2NZ0 A;  2PQL A;  1DGV A;  1UUR A;  3D0Y B;  5D7F A;  1UHN A;  1A75 A;  1GM0 A;  1NX2 A;  3B86 A;  1LS8 A;  1CLL A;  3UO9 A;  1RRO A;  4CID A;  1AVS A;  1DF0 A;  2PMY A;  4FQO A;  4AQJ A;  1PVB A;  2VRG A;  5DKR A;  2KI6 D;  1XYD A;  3D0Y A;  1W9Z A;  2LMT A;  1JSA A;  3CR5 X;  1N65 A;  1K9U A;  5D69 A;  2NXQ A;  4P2Y B;  1CKK A;  3IVT A;  2M1K B;  1SKT A;  2JOJ A;  4MZL A;  1UHK A;  1JFJ A;  1SMG A;  3BUW B;  1A4P A;  2M3W A;  3OGN A;  4PAL A;  3TDU A;  3K21 A;  4GFT A;  3GOF A;  2GGZ A;  2OS8 B;  3OB2 B;  4F0Z B;  2LC5 A;  1BLQ A;  2M49 B;  1EL4 A;  3BFA A;  2KYC A;  2WCB A;  3PLF B;  3N7H A;  1TUJ A;  1SRA A;  2MJW B;  5JOL A;  3HX4 A;  5CSJ A;  1SL9 A;  5G08 A;  2CCM A;  2D8N A;  3NSI A;  3SIB A;  1SL7 A;  3PM2 A;  4FQT A;  5FYX A;  2OTG C;  4YI8 A;  3H4S E;  2MLF C;  1SY9 A;  1SYM A;  1KK8 B;  1SPY A;  3S0D A;  3DVE A;  1H8B A;  1FI6 A;  3O2P A;  1KQM B;  2F2O A;  5B8I B;  2KGB C;  3I5I B;  3S0E A;  4YGD B;  4NDD A;  5DKN A;  2MLE C;  2MAZ A;  2R2I A;  1SL8 A;  1OOG A;  2KI4 B;  2ISD A;  3SS4 A;  1GGZ A;  1EG3 A;  4MLW A;  1KSO A;  2ZFD A;  2H8V A;  3GK4 X;  3CZ2 A;  1ZOT B;  1C3Y A;  1PUL A;  1YX7 A;  2EGD A;  1NSH A;  3KO0 A;  2WCK A;  1RK9 A;  4PE4 A;  1FW4 A;  3QME A;  1NUB A;  1ZAC A;  2BE4 A;  1QLS A;  1TIZ A;  1S6C A;  2ZRS A;  2QEV A;  2K60 A;  3B87 A;  3OP0 A;  1D1O A;  3L47 A;  3LK1 A;  4JPZ B;  2AMI A;  1LXF C;  2JZI A;  3FE8 A;  2ZN8 A;  3DYE A;  3B7A A;  3WHU B;  1IWQ A;  4PCW A;  1BMO A;  4DRW A;  1DEK A;  3BUM B;  1KK7 Z;  2G2B A;  1KK7 Y;  3L4A A;  1OMD A;  2H61 C;  2O5G A;  1QAT A;  1S6J A;  2BEC A;  2M8U A;  3NHI A;  2QAC A;  1IJ6 A;  3FWC A;  2RGI A;  4P5O E;  1R2U A;  5I2L A;  3HCM A;  2LLT A;  4I5L B;  1GGW A;  1K8U A;  3NSO A;  1IGV A;  2K61 A;  2OPO A;  3L4L A;  3O4Y A;  1JC2 A;  2AUC A;  2FJU B;  1F54 A;  1NWD A;  1C7W A;  3PFV A;  2WC6 A;  2SCP A;  2KFF A;  2BNX A;  3BOW B;  5KSZ A;  3CZ0 A;  4XJK A;  4DUQ A;  3V2L A;  2K8M B;  2NCP A;  4JKT A;  1Y1A A;  1Y1U A;  4WQ3 A;  2LLU A;  1PRW A;  2H2K A;  5I2O A;  2EC6 C;  1M46 A;  1SBJ A;  3FS7 A;  2K7D A;  3CLN A;  4MZK A;  1NIW A;  1SK6 D;  2I18 A;  2JXC A;  5AAN A;  1CNP A;  1REC A;  2KOT A;  2M97 A;  1N0Y A;  4WRI A;  4YBH B;  2LMV A;  3ZNI A;  1K9K A;  4YGA A;  1IIO A;  3DVJ A;  3FE9 A;  2GTE A;  3LLE A;  5AER A;  3FWB A;  2KBI A;  1VRK A;  1B8R A;  2BCB A;  2L0P A;  1BF5 A;  1QXP A;  1KCY A;  3TDZ A;  1TRF A;  4OVN F;  1CDP A;  3O4X A;  1EXR A;  2WCE A;  1XFW O;  4U8D A;  2CNP A;  4ZCU A;  2BBN A;  2BKI B;  1S36 A;  2LUX A;  2Q4U A;  3EKH A;  3KHE A;  4NDB A;  5FI7 A;  2JNF A;  1PK0 D;  1MQ1 A;  1K96 A;  1QJT A;  1J7R A;  1E8A A;  1MF8 B;  1RJV A;  2QDI A;  2WC8 A;  3BUX B;  1Z2C B;  3TS5 B;  2FOT A;  1L2O C;  3I5F B;  2WOR A;  3SG5 A;  2P6B B;  2SAS A;  1J1D A;  1G33 A;  2BCA A;  1WRZ A;  2HF5 A;  2JWW A;  3TUY C;  1IQ3 A;  2MBX A;  1ZUZ A;  1DJZ A;  3R1P A;  1F55 A;  1RWY A;  3AAJ A;  5HKW A;  1ZFS A;  1YUT A;  2QEO A;  1RTP 1;  4IJ7 A;  2CBL A;  3EVR A;  1F71 A;  3I5H C;  1CDL A;  1KWO B;  2BL0 B;  3CDN A;  2JU0 A;  1OOJ A;  2KFG A;  1DJY A;  1QV0 A;  1AJ4 A;  3FE6 A;  2EHB A;  1J7P A;  1KFX S;  2FCE A;  3PSR A;  4YRU A;  5D3O A;  1B8C A;  4HRE E;  1CB1 A;  3IQQ A;  4ORA B;  1LKJ A;  2JTT A;  2JUL A;  2Y4Q A;  1XK4 A;  1YVL A;  2I2R E;  5TNC A;  1WRL A;  4F7F A;  2LLS A;  4BY4 A;  2EC6 B;  4AQI A;  1NCZ A;  5F6T A;  3FIA A;  3D78 A;  1UP5 A;  3GK1 A;  3RZS A;  4GBA A;  1PSR A;  2LVV A;  4PHJ A;  2F33 A;  1QX7 A;  1HQV A;  1V1F A;  3WNX B;  5HL1 A;  5I94 A;  2JRF A;  2LP3 A;  4GGN A;  2CXJ A;  2KNE A;  4OCI A;  3KEV A;  3NXA A;  3RM1 A;  4GNK B;  2E30 A;  5EL2 A;  2ZN9 A;  1A29 A;  2L98 A;  3ZWH A;  1QIW A;  4C0L A;  5AFP A;  1JWD A;  2WC5 A;  2HQW A;  5I8N A;  1J7O A;  1CFD A;  3EVV A;  2LVJ A;  2KI6 C;  2L4H A;  2KQ6 A;  1UHJ A;  2Y1M A;  1QVI Z;  1LVC D;  4MRX A;  3WHT B;  1NP8 A;  1PSB A;  1QVI Y;  2F3Y A;  2L5Y A;  3JVT B;  1OW4 A;  3DVK A;  1DC1 A;  1S1E A;  5HKZ A;  1MHO A;  2CT9 A;  1W7I B;  2O60 A;  3SG7 A;  2PRU A;  2LCP A;  1PAL A;  1TNW A;  4GPL B;  2KGR A;  3PN7 B;  4BY5 A;  1YRU B;  2WOS A;  3CAB A;  3OBV A;  2LMU A;  3EK7 A;  3AAK A;  5CSN A;  1K95 A;  2K2F A;  3VRQ A;  4QJ4 B;  1DJX A;  3CR4 X;  1CMG A;  1SCM C;  1OSA A;  4HRH A;  4FTG A;  4MSP A;  3VGO A;  1OZO A;  3B6X A;  1IH0 A;  1OZS A;  4GUK A;  4JWQ A;  1B7T Z;  1B7T Y;  2ERB A;  1CM1 A;  1JFK A;  2M9G A;  1B4C A;  5HLO A;  1AUI B;  2JNX A; 
#chains in the Genus database with same CATH homology
 1MUX A;  3IQO A;  1BU3 A;  3BQ3 A;  1YRT B;  3JTD C;  4A4B A;  1J7Q A;  1PVA A;  1UHI A;  1V1G A;  3LCP C;  3OB1 B;  5HLV A;  1YTZ C;  3AKA A;  1ZMZ A;  2JT8 A;  2JT0 A;  1K93 D;  1CFC A;  1XA5 A;  4ZCV A;  2A4J A;  1NX3 A;  2LV7 A;  2Y5I A;  3F45 A;  1F8H A;  1KSM A;  1N2D A;  4DIR A;  2KYF A;  1CDN A;  3DF0 B;  1CTR A;  2KAX A;  2PVB A;  2MRD A;  4CFR A;  2LUC A;  3SG4 A;  3SG3 A;  2PAL A;  1XFV O;  5CSI A;  1QX5 B;  1SCV A;  2QPT A;  1B47 A;  2OTG B;  1IRJ A;  3KPX A;  3LK0 A;  3O78 A;  2BE6 A;  2JPT A;  4DS7 A;  1DJW A;  3BOW A;  3NSL A;  1DJG A;  1OE9 B;  4MN0 A;  4MEW A;  4PDZ A;  2M7L A;  1KFU S;  3I5G C;  5AXI A;  2AAO A;  1MWN A;  4ORB B;  1TNQ A;  2F8P A;  5K89 A;  3BUO B;  1QV1 A;  1U5I B;  5J3X A;  3SJS A;  1BT6 A;  3GK2 A;  4OKH A;  2LAP A;  1AJ5 A;  5JJG A;  1EG4 A;  3MSE B;  4USL A;  2JTZ A;  1F4O A;  3IF7 A;  1HT9 A;  1QIV A;  4GGF A;  3TDI A;  1DGU A;  4C0K A;  1XFU O;  4D1E A;  1FF1 A;  4CFQ A;  2OS8 C;  5DKQ A;  3OX6 A;  4MBE A;  2KQY A;  1IJ5 A;  2MHH A;  3A4U B;  3SG6 A;  3QRX A;  4N5X A;  1A03 A;  3EK4 A;  4ETO A;  3M0W A;  4YGB B;  1F70 A;  2KHN A;  1G4Y R;  1TCF A;  1KK8 C;  3OHM B;  3A8R A;  1UHH A;  1NYA A;  4MZJ A;  3TZ1 A;  1B1G A;  1KQM C;  3SIA A;  1QS7 A;  3BXK A;  1XO5 A;  1WDC C;  1NCY A;  1A2X A;  3I5I C;  2LVI A;  4I5N B;  1CLB A;  2H61 A;  2JXL A;  1RFJ A;  2KI4 C;  1WY9 A;  1JF0 A;  2FCD A;  1MXL C;  4N1G A;  1QLK A;  1TOP A;  3AKB A;  1TCO B;  2L50 A;  4OV2 A;  2TN4 A;  4I5J A;  2NLN A;  2Y1N A;  1TNX A;  2K2A A;  1QTX A;  4MRY A;  4OR9 B;  1A75 B;  1BR4 B;  2GGM A;  3D10 A;  1J1E A;  1CFP A;  1NX0 A;  2Q91 A;  2M1U A;  1DF0 B;  2IS9 A;  1UUS A;  4AOM A;  3BYA A;  1YVH A;  4MVF A;  1CFF A;  3I5G B;  1J55 A;  2MA2 A;  4M2O A;  3VRN A;  1K9P A;  1SR6 C;  2F3Z A;  5CPV A;  4TNC A;  4QJ5 B;  3RLZ A;  2KAV A;  1KFX L;  1DJH A;  1BOD A;  4PHM A;  1TTX A;  1CMF A;  1K2H A;  1DTL A;  1QAS A;  5I2Q A;  2DOQ A;  1JBA A;  3VRO A;  2K7B A;  3C1V A;  3PAL A;  1MR8 A;  1DMO A;  1GQM A;  1L7Z A;  2M0R A;  3LL8 B;  2BBM A;  1OMV A;  1LA3 A;  3O6B A;  1S3P A;  1AHR A;  3E3R A;  3CWG A;  1BOC A;  1S5G Z;  2E6W A;  1L2O B;  1BJF A;  1S5G Y;  1YX8 A;  1Y1X A;  4NDC A;  2LP2 A;  3TUY B;  1BR1 B;  1OMR A;  1R6P A;  2BCX A;  2KFH A;  2ZKM X;  1ODB A;  1EJ3 A;  1Y6W A;  4CLN A;  1SW8 A;  3OX5 A;  1LA0 A;  5KTY A;  1WDC B;  3I5H B;  2L2E A;  2JT3 A;  1NCX A;  1YUS A;  4JQ0 D;  4N1F A;  5CSF A;  4L9M A;  5HKY A;  2M7N A;  4GGF C;  2LNK A;  1CM4 A;  2NCO A;  1X02 A;  2CTN A;  3EVU A;  4HRG A;  4YGE B;  2LE9 B;  4PHN A;  2F2P A;  5ER4 X;  1KQV A;  1M31 A;  3DD4 A;  2ZRT A;  5HYD A;  2JC2 A;  2K7O A;  4PE0 A;  4IL1 A;  5ER5 A;  2HQ8 A;  2WCF A;  1DT7 B;  3TS5 C;  2PAS A;  4HSZ A;  1AP4 A;  3I5F C;  2M29 A;  1SR6 B;  1BG1 A;  1ALW A;  2L4I A;  3CGA A;  3WXA A;  3DVM A;  3EKJ A;  1DJI A;  3DF0 A;  1QX2 A;  2COL B;  4WQ2 A;  4I5K A;  4PHK A;  1YUU A;  2K7C A;  2KDH A;  1OQP A;  2LM5 A;  3ICB A;  1W7J B;  2WND A;  1KWO C;  3NSK A;  2BL0 C;  1CLM A;  1IQ5 A;  1K94 A;  1XVJ A;  1IG5 A;  1TN4 A;  1M39 A;  2B1U A;  1CDM A;  1YR5 A;  2LHL A;  4XYN A;  3EK8 A;  1XK4 C;  4XJK B;  3PM8 A;  1B9A A;  3CS1 A;  1WLM A;  1Y0V H;  2I94 A;  1GJY A;  2JQ6 A;  4PE1 A;  3BUN B;  3VRR A;  3VRP A;  4NQG A;  1FPW A;  1AK8 A;  1NPQ A;  1U5I A;  1EH2 A;  4C0J A;  3SG2 A;  1TNP A;  5KU1 A;  3CZT X;  1FBV A;  1SCM B;  1DVI A;  2KBM A;  5BPJ A;  4Q04 A;  2L5X B;  2LAN A;  2ZND A;  4M2Q A;  1WRK A;  1YUR A;  4GAO A;  4QJ3 B;  4ICB A;  1KFU L;  4E68 A;  2ZNE A;  4A4C A;  1JF2 A;  1XFY O;  1IKU A;  1MXE A;  2LVK A;  1S26 D;  3KF9 A;  2L51 A;  3CR2 A;  3JTD B;  4M2P A;  3CTN A;  1FI5 A;  1Q80 A;  1XFZ O;  1NX1 A;  4PE7 A;  4YI9 A;  5IBW A;  1M45 A;  2BKH B;  2HET A;  2HPS A;  1UWO A;  1C7V A;  2KAY A;  1LIN A;  2GV5 A;  1K90 D;  4CPV A;  4ORC B;  3JVT C;  4YGC B;  1ALV A;  2LHI A;  1WLZ A;  1SNL A;  2V53 A;  1JUO A;  4DCK A;  1XFX O;  3PN7 C;  2PSR A;  2I7A A;  3PAT A;  4UPG A;  5AEQ A;  2K0J A;  1B8L A;  4R1E A;  1G8I A;  1C07 A;  1H4B A;  1M63 B;  2KSP A;  5PAL A;  1F4Q A;  2G9B A;  1S6I A;  2NZ0 A;  1DGV A;  1UUR A;  3D0Y B;  5D7F A;  1UHN A;  1A75 A;  1NX2 A;  1CLL A;  1RRO A;  4CID A;  1AVS A;  1DF0 A;  2PMY A;  4FQO A;  4AQJ A;  1PVB A;  2VRG A;  5DKR A;  2KI6 D;  1XYD A;  3D0Y A;  2LMT A;  1JSA A;  3CR5 X;  1N65 A;  1K9U A;  5D69 A;  2NXQ A;  4P2Y B;  1CKK A;  2M1K B;  1SKT A;  2JOJ A;  4MZL A;  1UHK A;  1JFJ A;  1SMG A;  3BUW B;  1A4P A;  2M3W A;  4PAL A;  3TDU A;  3K21 A;  4GFT A;  3GOF A;  2GGZ A;  2OS8 B;  3OB2 B;  4F0Z B;  2LC5 A;  1BLQ A;  2M49 B;  1EL4 A;  2KYC A;  2WCB A;  3PLF B;  2MJW B;  1SRA A;  5JOL A;  3HX4 A;  5CSJ A;  1SL9 A;  5G08 A;  2CCM A;  2D8N A;  3NSI A;  3SIB A;  1SL7 A;  5FYX A;  2OTG C;  4YI8 A;  3H4S E;  2MLF C;  1SY9 A;  1SYM A;  1KK8 B;  1SPY A;  3DVE A;  1H8B A;  1FI6 A;  3O2P A;  1KQM B;  2F2O A;  5B8I B;  2KGB C;  3I5I B;  4YGD B;  4NDD A;  5DKN A;  2MLE C;  2MAZ A;  2R2I A;  1SL8 A;  2ISD A;  2KI4 B;  1GGZ A;  1EG3 A;  4MLW A;  1KSO A;  2ZFD A;  3GK4 X;  1ZOT B;  1PUL A;  1YX7 A;  2EGD A;  1NSH A;  3KO0 A;  4PE4 A;  1RK9 A;  1FW4 A;  1NUB A;  1ZAC A;  2BE4 A;  1QLS A;  1TIZ A;  1S6C A;  2ZRS A;  3OP0 A;  1D1O A;  3LK1 A;  4JPZ B;  2AMI A;  1LXF C;  2JZI A;  2ZN8 A;  3WHU B;  1IWQ A;  4PCW A;  1BMO A;  4DRW A;  3BUM B;  1KK7 Z;  2G2B A;  1KK7 Y;  1OMD A;  2H61 C;  2O5G A;  1QAT A;  1S6J A;  2BEC A;  2M8U A;  2QAC A;  1IJ6 A;  3FWC A;  2RGI A;  4P5O E;  1R2U A;  5I2L A;  3HCM A;  2LLT A;  4I5L B;  1GGW A;  1K8U A;  3NSO A;  1IGV A;  2K61 A;  2OPO A;  3O4Y A;  1JC2 A;  2AUC A;  2FJU B;  1F54 A;  1NWD A;  1C7W A;  3PFV A;  2SCP A;  2KFF A;  3BOW B;  5KSZ A;  4XJK A;  4DUQ A;  2K8M B;  2NCP A;  1Y1A A;  1Y1U A;  4WQ3 A;  2LLU A;  1PRW A;  2H2K A;  5I2O A;  2EC6 C;  1M46 A;  1SBJ A;  3FS7 A;  2K7D A;  3CLN A;  4MZK A;  1NIW A;  1SK6 D;  2I18 A;  2JXC A;  5AAN A;  1CNP A;  1REC A;  2KOT A;  2M97 A;  1N0Y A;  4WRI A;  4YBH B;  2LMV A;  3ZNI A;  1K9K A;  4YGA A;  3DVJ A;  3LLE A;  5AER A;  3FWB A;  2KBI A;  1VRK A;  1B8R A;  2BCB A;  2L0P A;  1BF5 A;  1QXP A;  1KCY A;  3TDZ A;  1TRF A;  4OVN F;  1CDP A;  1EXR A;  2WCE A;  1XFW O;  4U8D A;  2CNP A;  4ZCU A;  2BBN A;  2BKI B;  1S36 A;  2LUX A;  2Q4U A;  3EKH A;  3KHE A;  4NDB A;  5GQQ C;  2JNF A;  1PK0 D;  1MQ1 A;  1K96 A;  1QJT A;  1J7R A;  1E8A A;  1MF8 B;  1RJV A;  2WC8 A;  3BUX B;  3TS5 B;  2FOT A;  1L2O C;  3I5F B;  2WOR A;  3SG5 A;  2P6B B;  2SAS A;  1J1D A;  1G33 A;  2BCA A;  1WRZ A;  2HF5 A;  2JWW A;  3TUY C;  1IQ3 A;  2MBX A;  1ZUZ A;  1DJZ A;  1F55 A;  1RWY A;  3AAJ A;  5HKW A;  1ZFS A;  1YUT A;  1RTP 1;  2CBL A;  3EVR A;  1F71 A;  3I5H C;  1CDL A;  1KWO B;  2BL0 B;  2JU0 A;  1OOJ A;  2KFG A;  1DJY A;  1QV0 A;  1AJ4 A;  2EHB A;  1J7P A;  1KFX S;  2FCE A;  3PSR A;  4YRU A;  1B8C A;  4HRE E;  1CB1 A;  3IQQ A;  4ORA B;  1LKJ A;  2JTT A;  2JUL A;  2Y4Q A;  1XK4 A;  1YVL A;  2I2R E;  5TNC A;  1WRL A;  2LLS A;  4BY4 A;  2EC6 B;  4AQI A;  1NCZ A;  5F6T A;  3FIA A;  1UP5 A;  3GK1 A;  4GBA A;  1PSR A;  2LVV A;  4PHJ A;  2F33 A;  1QX7 A;  1HQV A;  1V1F A;  3WNX B;  2JRF A;  2LP3 A;  4GGN A;  2CXJ A;  2KNE A;  4OCI A;  3KEV A;  3NXA A;  3RM1 A;  4GNK B;  2E30 A;  2ZN9 A;  1A29 A;  2L98 A;  3ZWH A;  1QIW A;  4C0L A;  5AFP A;  1JWD A;  2HQW A;  5I8N A;  1J7O A;  1CFD A;  3EVV A;  2LVJ A;  2KI6 C;  2L4H A;  2KQ6 A;  1UHJ A;  2Y1M A;  1QVI Z;  1LVC D;  4MRX A;  3WHT B;  1NP8 A;  1PSB A;  1QVI Y;  2F3Y A;  3JVT B;  3DVK A;  1S1E A;  5HKZ A;  1MHO A;  2CT9 A;  1W7I B;  2O60 A;  3SG7 A;  2PRU A;  2LCP A;  1PAL A;  1TNW A;  4GPL B;  2KGR A;  3PN7 B;  4BY5 A;  1YRU B;  2WOS A;  2LMU A;  3EK7 A;  3AAK A;  5CSN A;  1K95 A;  2K2F A;  3VRQ A;  4QJ4 B;  1DJX A;  3CR4 X;  1CMG A;  1SCM C;  1OSA A;  4HRH A;  4FTG A;  4MSP A;  3VGO A;  1OZO A;  1IH0 A;  1OZS A;  4GUK A;  4JWQ A;  1B7T Z;  1B7T Y;  1CM1 A;  1JFK A;  2M9G A;  1B4C A;  5HLO A;  1AUI B;  2JNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...