1EH2A

Structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPS15
publication title Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1998-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eh2A00
2L4IA 2FOTA 1ODBA 1A03A 1UP5A 1KFUS 3A4UB 4YI9A 1N2DA 1NWDA 2KYFA 1QATA 3MSEB 1K90D 2V53A 1CDNA 4ZCVA 4YGAA 3DF0B 1S26D 2H2KA 3GK4X 2MLEC 1J7QA 1KCYA 4AQJA 2BKIB 1K2HA 4YGBB 2BE4A 1RK9A 1PULA 2LNKA 3DVKA 2MAZA 2ZRSA 3TS5C 2HETA 2WC8A 3WXAA 5J3XA 2F2PA 4NDBA 2KGRA 1RROA 2KI4C 4PE0A 5ER4X 4USLA 1C07A 5B8IB 1BODA 3BQ3A 5AERA 4GUKA 1PVBA 2LLSA 1IGVA 1M63B 1DJZA 1ZOTB 3DVJA 2F2OA 3SG3A 1S5GY 5BPJA 4R1EA 2M9GA 4PDZA 2HPSA 4N1GA 1CMFA 4JQ0D 1NCXA 3RLZA 1JFKA 1NP8A 1J1EA 4GFTA 1GGZA 1KFUL 1B7TY 2JTTA 2GGMA 2JNFA 2HF5A 3BOWB 3O4YA 1L2OB 3VRRA 3CR4X 1MHOA 5CSNA 2CXJA 1J55A 3CR5X 1KSOA 3SIAA 1F4QA 3WHTB 4XJKB 2KGBC 2M1KB 2B1UA 3SG7A 3CGAA 5HKYA 2JRFA 1IRJA 4WQ3A 4CFQA 2LE9B 1YRTB 1SL9A 1CFPA 3VRQA 1TCFA 3GK1A 2NLNA 2KHNA 2KQYA 1EL4A 4PE7A 2PALA 1B8RA 3OHMB 4JWQA 1WRZA 5FYXA 3DVMA 3AAJA 4ORAB 1KQMB 2L2EA 4HREE 1Y1AA 1JSAA 2JNXA 3D10A 3AKBA 3FWBA 2M29A 3AKAA 2VRGA 1S6JA 1IG5A 1KK7Y 1RFJA 4JPZB 2R2IA 3CZTX 3EK4A 1AP4A 2LMVA 1XFVO 1B9AA 2ISDA 2I94A 1QV1A 4GPLB 1NX3A 4PE4A 1U5IA 3EVUA 3TS5B 1HT9A 1TOPA 3FIAA 1DJIA 4ORBB 4PE1A 4HSZA 4I5KA 2O5GA 1CNPA 2KI4B 2JT8A 1AK8A 1QJTA 1YVLA 1XYDA 2K7DA 1YR5A 2M97A 1AJ4A 2KBIA 3LL8B 3LLEA 3BUNB 3PSRA 2JXLA 1KK8C 2K7OA 1ALWA 1KFXL 1L2OC 1Y0VH 3CLNA 1NSHA 5KSZA 1RJVA 2Y4QA 3E3RA 3PATA 1WRKA 2K2FA 1EXRA 1YUSA 2IS9A 2NCOA 3HCMA 1N65A 1MUXA 2LV7A 4A4CA 1LKJA 1JC2A 3NSOA 3M0WA 2K0JA 1CDMA 2MRDA 5JOLA 1YVHA 1PALA 3PALA 4P5OE 1BJFA 1B8LA 4DCKA 3PLFB 2MJWB 2LMUA 1A2XA 2ZNDA 1YRUB 1M39A 2E30A 2GV5A 3TDZA 1CKKA 2ZN8A 1PSRA 2EC6C 3EK8A 2L4HA 1RECA 2G2BA 1KQMC 3LCPC 4ETOA 1LINA 1AVSA 2BKHB 4MLWA 1DMOA 5AXIA 3FS7A 1SCVA 1MWNA 2KQ6A 1A75A 3PN7C 1JBAA 4DRWA 5AFPA 2I18A 2LHLA 1CFFA 3TZ1A 2LANA 5HKZA 5PALA 1IH0A 4XYNA 3IQQA 2P6BB 2CNPA 2WCEA 3WNXB 4MZJA 2BL0C 1QX2A 4U8DA 1XFWO 2CT9A 2L50A 4FQOA 2WCFA 2KNEA 1MXLC 2M3WA 1YUTA 4ORCB 4CLNA 1CLLA 1XO5A 4OV2A 3HX4A 3D0YA 2ZFDA 1B47A 1EG4A 1M46A 1F55A 1K9PA 2WOSA 1BU3A 1Y1UA 1DJHA 2OPOA 1DGUA 1K95A 2KDHA 3KEVA 1LVCD 3TDIA 4PHJA 1V1FA 2KSPA 2FCDA 1AHRA 1Y1XA 3NSIA 3SG2A 4AQIA 1G8IA 1QX5B 1BOCA 1PVAA 2GGZA 2ZRTA 5D7FA 1SBJA 1SY9A 2LC5A 2MBXA 1FF1A 1KK8B 4OVNF 1W7JB 5DKNA 1LA3A 1SNLA 1EH2A 4OR9B 1MXEA 2K8MB 2WNDA 3BYAA 1KSMA 2M0RA 1XVJA 1ZFSA 2Y5IA 1PRWA 4M2OA 4MSPA 5ER5A 1DJXA 4F0ZB 3EKHA 2FJUB 2KI6D 1UHNA 4YBHB 1CTRA 1QIVA 3CTNA 2F8PA 5I8NA 3PM8A 5HLVA 1B8CA 2F3ZA 1NYAA 2F33A 1BG1A 3LK0A 1CLBA 1OOJA 2EC6B 2LVIA 4BY4A 2PRUA 2QPTA 1E8AA 2JTZA 2Q4UA 2NZ0A 1F70A 1U5IB 4MZLA 5F6TA 1ALVA 1MF8B 5DKRA 2QACA 3OB2B 3LK1A 3ICBA 4NDDA 1TRFA 1UURA 2I7AA 2H61A 2LHIA 2O60A 2ZN9A 4PALA 4N1FA 1F71A 1UHHA 3PN7B 3VROA 2FCEA 1A4PA 3I5GB 1QVIY 3BOWA 1J7PA 1XFYO 1FI5A 2Y1NA 3VRNA 3DD4A 1BMOA 1KK7Z 3SJSA 3ZNIA 1NIWA 2BL0B 1NCZA 1DGVA 1W7IB 2JT0A 3EVVA 1DF0A 3I5HC 2OTGB 4MBEA 1JWDA 2AUCA 5AANA 2A4JA 4YI8A 1LA0A 1OMRA 2LP2A 2L0PA 4GGFA 1SRAA 1UUSA 3NXAA 1OSAA 2KI6C 4NQGA 2JOJA 3BUWB 5DKQA 1CFDA 5JJGA 3TDUA 3CWGA 3JVTB 1CMGA 3O6BA 1NX0A 1TNXA 2K7CA 3EKJA 1H4BA 3DVEA 2HQ8A 1GQMA 4YGDB 3IQOA 2TN4A 2M8UA 3H4SE 1F4OA 2NCPA 4GAOA 1OQPA 1TNQA 1DJWA 1SL8A 4MRYA 1G33A 2BE6A 2KOTA 4D1EA 1SYMA 1WRLA 1TN4A 4ZCUA 1J1DA 1FBVA 4DUQA 1L7ZA 2JZIA 3KO0A 1OE9B 2PSRA 5I2LA 3NSLA 2LCPA 5CSJA 3TUYC 2LLTA 5HLOA 1RTP1 1DTLA 2COLB 1A75B 1MR8A 2K61A 2KAVA 1G4YR 4I5LB 1IJ6A 2LP3A 2LUXA 1MQ1A 3CR2A 4FTGA 1OMVA 3BUMB 1YURA 2AAOA 4I5NB 2KBMA 1BF5A 1UWOA 3OB1B 2BCAA 2KFFA 5HYDA 1FW4A 2L51A 5AEQA 1S1EA 4YGEB 3I5GC 2G9BA 3I5IC 1K96A 3I5FC 2JPTA 1GGWA 4DIRA 3KF9A 1S6CA 3D0YB 1KWOB 1FI6A 3K21A 1CFCA 1NUBA 2CTNA 1AJ5A 2PVBA 4QJ3B 1K9UA 1M45A 2JT3A 2OTGC 1YX8A 1HQVA 3BUXB 3A8RA 1FPWA 5KTYA 2I2RE 4L9MA 3KPXA 1QIWA 1VRKA 4YGCB 2EHBA 2JQ6A 4WRIA 3IF7A 4MRXA 4P2YB 3I5HB 3O2PA 3KHEA 1SCMB 1NX2A 1YUUA 1D1OA 1B4CA 5GQQC 1WDCC 1OZSA 2Y1MA 3JVTC 4Q04A 1V1GA 4QJ5B 2JC2A 3AAKA 2WCBA 1J7RA 1TNPA 2AMIA 4NDCA 1UHJA 1LXFC 2CCMA 2JWWA 2KFHA 1B1GA 2D8NA 4WQ2A 1OZOA 2LVVA 3BUOB 3GK2A 4E68A 3JTDB 1S5GZ 4QJ4B 4PHKA 4UPGA 4M2QA 3DF0A 5IBWA 3EVRA 2F3YA 4AOMA 3PFVA 1CDLA 1XFXO 1Q80A 1IQ5A 4OCIA 3VRPA 2SASA 1SK6D 1B7TZ 2BBMA 1WY9A 1ZMZA 2LMTA 1C7VA 3FWCA 3OX5A 4IL1A 1QLSA 2DOQA 2MHHA 1XFZO 1QS7A 4M2PA 4HRHA 4GBAA 3SG5A 3TUYB 4C0JA 2OS8C 1TIZA 3SG6A 1OMDA 1N0YA 1BR4B 1NCYA 5KU1A 1BR1B 5D69A 4C0KA 3QRXA 4CIDA 1IJ5A 2M7LA 1RWYA 2E6WA 3SG4A 1IQ3A 1BT6A 1JF2A 4I5JA 2LUCA 2NXQA 1BLQA 1C7WA 1DF0B 1K8UA 1TNWA 1TTXA 2CBLA 1SR6B 2M49B 1KWOC 3C1VA 2JXCA 2KFGA 2LM5A 2SCPA 3SIBA 1QASA 2L5XB 1YX7A 3I5IB 3I5FB 1XK4A 3BXKA 1S3PA 1UHKA 1GJYA 1XFUO 4YRUA 1K94A 2BECA 1CB1A 2EGDA 4XJKA 4MN0A 1QVIZ 2BCBA 1SCMC 1KFXS 4MVFA 1IKUA 1J7OA 2M1UA 3GOFA 4CFRA 1K93D 2RGIA 2Q91A 1IWQA 1EG3A 1JUOA 1QV0A 4GGNA 2WORA 5I2QA 4OKHA 4PHMA 1QTXA 1CLMA 1WDCB 1PK0D 4MZKA 3RM1A 1S36A 2PMYA 2K2AA 2MA2A 3JTDC 1WLZA 3ZWHA 2L98A 2MLFC 1SKTA 2LVJA 1JFJA 2HQWA 4TNCA 1X02A 2JULA 5TNCA 4HRGA 4PCWA 1F8HA 1SL7A 5CSIA 4A4BA 1WLMA 1ZUZA 2BCXA 4C0LA 3EK7A 1CM4A 1A29A 3O78A 1Y6WA 2PASA 5I2OA 2LVKA 5K89A 1PSBA 1DT7B 4CPVA 3F45A 1F54A 1NX1A 1SPYA 2LLUA 3CS1A 2K7BA 2M7NA 2KYCA 1K9KA 2LAPA 4BY5A 3NSKA 2H61C 2JU0A 1DVIA 1H8BA 1UHIA 1JF0A 3OX6A 1XK4C 1M31A 1CM1A 1S6IA 2BBNA 4MEWA 2OS8B 5CPVA 3OP0A 4GNKB 5CSFA 1XA5A 1SMGA 1AUIB 1SR6C 3VGOA 2KAYA 2ZNEA 1TCOB 1DJGA 1DJYA 2ZKMX 4GGFC 1R2UA 1ZACA 4N5XA 1SW8A 1EJ3A 1NPQA 1QXPA 4ICBA 3WHUB 1YTZC 5HKWA 5G08A 4DS7A 1CDPA 1QLKA 2KAXA 1QX7A 1KQVA 4PHNA 1R6PA
chains in the Genus database with same CATH superfamily
2L4IA 2FOTA 1ODBA 1A03A 1UP5A 3CZ2A 1KFUS 3A4UB 4YI9A 3CYZA 1N2DA 1NWDA 2KYFA 1QATA 3MSEB 2WCKA 1K90D 2V53A 5I94A 4ZCVA 4YGAA 1CDNA 3D73A 3DF0B 1QWVA 1S26D 2H2KA 2WCJA 3GK4X 5DICA 2MLEC 1J7QA 3L4LA 1KCYA 4AQJA 3B87A 2BKIB 1K2HA 4YGBB 2BE4A 1RK9A 1PULA 2LNKA 3DVKA 2MAZA 2ZRSA 3TS5C 2HETA 2WC8A 3FE9A 3WXAA 5J3XA 3FE6A 2F2PA 3VB1A 4NDBA 2KGRA 1RROA 2KI4C 4PE0A 5ER4X 4USLA 3RZSA 1C07A 5B8IB 1BODA 3BQ3A 5AERA 4GUKA 1PVBA 2LLSA 1OOIX 1IGVA 1M63B 1DJZA 1ZOTB 3DVJA 2F2OA 3SG3A 1S5GY 5BPJA 4R1EA 2M9GA 4PDZA 2HPSA 4N1GA 1CMFA 4JQ0D 1NCXA 3RLZA 1JFKA 1NP8A 1J1EA 3Q8IA 4GFTA 1GGZA 1KFUL 1B7TY 2JTTA 2GGMA 2JNFA 2HF5A 3BOWB 3O4YA 1L2OB 5FI2A 3VRRA 3CR4X 1MHOA 1SSEB 5CSNA 2CXJA 1J55A 3CR5X 1KSOA 3SIAA 1F4QA 3WHTB 4XJKB 2KGBC 2M1KB 2B1UA 3SG7A 3CGAA 3V2LA 5HKYA 2JRFA 1IRJA 4WQ3A 4CFQA 2LE9B 1YRTB 1SL9A 1CFPA 3VRQA 1TCFA 3GK1A 2NLNA 2KHNA 2K60A 2KQYA 1EL4A 4PE7A 2PALA 1B8RA 3OHMB 4JWQA 1WRZA 5FYXA 3DVMA 3S0EA 1XFRA 3AAJA 4ORAB 1KQMB 2PQLA 2L2EA 4HREE 1Y1AA 1JSAA 2JNXA 3D10A 3AKBA 3FWBA 2M29A 2P70A 3AKAA 2VRGA 1S6JA 1IG5A 1KK7Y 1RFJA 4JPZB 2R2IA 3CZTX 3EK4A 1C3ZA 1AP4A 2LMVA 1XFVO 1B9AA 2ISDA 2I94A 1QV1A 2QEVA 4GPLB 1NX3A 2P71A 3S0AA 5EL2A 4PE4A 1U5IA 4JKTA 3EVUA 3B6XA 3TS5B 1HT9A 1TOPA 3FIAA 1DJIA 1TUZA 4ORBB 4PE1A 4HSZA 4I5KA 2O5GA 1CNPA 4INWA 2KI4B 2JT8A 1AK8A 1QJTA 1YVLA 1XYDA 2K7DA 1YR5A 2M97A 1AJ4A 2KBIA 3LL8B 3LLEA 3BUNB 3PSRA 2JXLA 1KK8C 2K7OA 1ALWA 1KFXL 1L2OC 1Y0VH 3CLNA 1NSHA 5KSZA 1RJVA 2Y4QA 3E3RA 3PATA 1WRKA 3B88A 3QMEA 1DEKA 2K2FA 1EXRA 1YUSA 2IS9A 2NCOA 2YGUA 3HCMA 1N65A 3UNWA 2QDIA 1MUXA 2LV7A 3L47A 1LKJA 4A4CA 1Z2CB 1JC2A 3NSOA 3M0WA 2K0JA 1CDMA 2MRDA 5JOLA 1YVHA 1PALA 3PALA 4P5OE 1BJFA 1B8LA 4DCKA 3PLFB 2MJWB 2LMUA 1A2XA 2ZNDA 1YRUB 1M39A 2E30A 2GV5A 3BFBA 3TDZA 3DXLA 1CKKA 2ZN8A 1PSRA 2EC6C 3EK8A 3DZTA 5FI6A 2L4HA 1RECA 1T14A 1GM0A 2G2BA 1KQMC 3LCPC 2L5YA 4ETOA 1LINA 1AVSA 2BKHB 4MLWA 1DMOA 5AXIA 3FS7A 1SCVA 1MWNA 2KQ6A 1A75A 3PN7C 1JBAA 4DRWA 5AFPA 2I18A 2LHLA 3NHTA 1CFFA 3TZ1A 2LANA 5HKZA 5PALA 1IH0A 3BFAA 4XYNA 3IQQA 2P6BB 2H8VA 2CNPA 2WCEA 3WNXB 4MZJA 2BL0C 1QX2A 2WC5A 4U8DA 1XFWO 2CT9A 2L50A 4FQOA 2WCFA 2KNEA 1MXLC 1IIOA 2M3WA 1YUTA 4ORCB 4CLNA 1CLLA 1XO5A 4OV2A 3HX4A 3D0YA 3CDNA 3L4AA 2ZFDA 1B47A 1EG4A 1M46A 3EG5B 1F55A 1K9PA 2WOSA 1BU3A 1Y1UA 1DJHA 2OPOA 1DGUA 1K95A 2KDHA 3KEVA 2GTEA 1LVCD 3TDIA 4PHJA 1V1FA 2KSPA 2FCDA 1AHRA 1Y1XA 2PYQA 3NSIA 3SG2A 4AQIA 1G8IA 1QX5B 1BOCA 1PVAA 2GGZA 2ZRTA 5D7FA 1SBJA 1SY9A 2LC5A 2MBXA 1FF1A 1KK8B 4OVNF 1W7JB 5DKNA 1LA3A 1SNLA 1EH2A 4OR9B 3UO9A 1MXEA 2K8MB 2WNDA 3B86A 1KSMA 3BYAA 2M0RA 1XVJA 1ZFSA 2Y5IA 1PRWA 4M2OA 3R1VA 4MSPA 3K1EA 5ER5A 1DJXA 4F0ZB 3BFHA 3EKHA 2FJUB 2KI6D 1UHNA 4YBHB 1CTRA 1QIVA 3CTNA 2F8PA 5I8NA 3PM8A 5HLVA 1B8CA 2F3ZA 1NYAA 2F33A 1BG1A 3LK0A 3O4XA 1CLBA 1OOJA 2EC6B 2LVIA 4BY4A 2PRUA 2QPTA 1E8AA 2JTZA 2Q4UA 1P28A 2NZ0A 1U5IB 4MZLA 5F6TA 1ALVA 1MF8B 5DKRA 2QACA 3NHIA 3OB2B 3LK1A 3ICBA 4NDDA 1TRFA 1UURA 2I7AA 2H61A 2LHIA 2O60A 2ZN9A 4PALA 4N1FA 1F71A 1UHHA 3PN7B 3VROA 2FCEA 1A4PA 3I5GB 1QVIY 3BOWA 1J7PA 3D74A 1XFYO 1FI5A 2Y1NA 2BNXA 3VRNA 3DD4A 1BMOA 1KK7Z 3SJSA 3N7HA 3ZNIA 1NIWA 2BL0B 1NCZA 1DGVA 1W7IB 2JT0A 3EVVA 1DF0A 2FJYA 2OTGB 3I5HC 4MBEA 2AUCA 5AANA 1JWDA 2A4JA 4YI8A 1LA0A 1TWOA 1OMRA 2LP2A 2L0PA 4GGFA 1SRAA 1UUSA 3NXAA 1OSAA 2ERBA 2KI6C 4NQGA 2JOJA 2KLEA 3BUWB 5DKQA 1CFDA 3S0BA 5JJGA 3TDUA 3CWGA 3JVTB 1CMGA 3O6BA 1NX0A 1TNXA 4IJ7A 2KPHA 2K7CA 3EKJA 1H4BA 3DVEA 2HQ8A 1GQMA 3R72A 4YGDB 3IQOA 2TN4A 3D77A 2M8UA 3H4SE 1F4OA 2NCPA 1DELA 1ORGA 4GAOA 1OQPA 1TNQA 1DJWA 1SL8A 3R1PA 4MRYA 1G33A 2BE6A 2KOTA 4D1EA 1SYMA 1WRLA 1TN4A 4ZCUA 1J1DA 1FBVA 4DUQA 1L7ZA 2JZIA 3KO0A 1OE9B 2PSRA 3CZ0A 5I2LA 3NSLA 2LCPA 5CSJA 3TUYC 1DQEA 2LLTA 3SS3A 5HLOA 1RTP1 2WCHA 1DTLA 1A75B 1MR8A 2COLB 2K61A 2KAVA 1G4YR 4I5LB 1IJ6A 2WC6A 2LP3A 2LUXA 1MQ1A 3CR2A 4FTGA 1OMVA 3BUMB 1YURA 5FI7A 2AAOA 1C3YA 4I5NB 2KBMA 1W9ZA 1BF5A 1UWOA 3OB1B 2BCAA 2KFFA 5HYDA 1FW4A 2L51A 5AEQA 1S1EA 2WCLA 3R1OA 3I5GC 2G9BA 3I5IC 1K96A 3I5FC 2JPTA 3OBVA 3PJIA 4YGEB 3KF9A 1S6CA 3D0YB 4DIRA 1KWOB 1FI6A 3K21A 1CFCA 1NUBA 2CTNA 2KLDA 1AJ5A 2PVBA 4QJ3B 1K9UA 1M45A 2JT3A 2OTGC 1YX8A 1HQVA 3BUXB 3A8RA 1FPWA 5KTYA 2I2RE 2QEBA 4L9MA 3KPXA 1QIWA 1VRKA 4YGCB 2EHBA 2JQ6A 4WRIA 3IF7A 4MRXA 4P2YB 3I5HB 4JD9A 3O2PA 3KHEA 1SCMB 1NX2A 1YUUA 1D1OA 1B4CA 5GQQC 1WDCC 1OZSA 2Y1MA 3JVTC 4Q04A 1V1GA 3SS4A 4QJ5B 2JC2A 3AAKA 2WCBA 1J7RA 1TNPA 2AMIA 4NDCA 1UHJA 1LXFC 2CCMA 2JWWA 2KFHA 2QEHA 1B1GA 2D8NA 4WQ2A 1OZOA 2LVVA 3BUOB 3GK2A 4E68A 3JTDB 2L2CA 1S5GZ 1LS8A 4PHKA 4QJ4B 3BJHA 4UPGA 4M2QA 3DF0A 5IBWA 3EVRA 2F3YA 4AOMA 3PFVA 1CDLA 1XFXO 1Q80A 1IQ5A 1OOGA 4OCIA 3VRPA 3CZ1A 2SASA 1SK6D 1B7TZ 2BBMA 1OOHA 1WY9A 1ZMZA 2LMTA 3FWCA 3S0GA 1C7VA 3OX5A 4IL1A 3S0DA 1QLSA 2DOQA 2MHHA 1XFZO 1QS7A 4M2PA 4HRHA 4GBAA 3SG5A 3TUYB 4C0JA 3OGNA 2OS8C 1TIZA 3SG6A 1OMDA 1N0YA 1DC1A 1BR4B 1NCYA 5KU1A 1BR1B 2BAPA 5D69A 1GGWA 4C0KA 3QRXA 1OW4A 3NGVA 4CIDA 1IJ5A 2M7LA 1RWYA 2E6WA 3SG4A 1IQ3A 1BT6A 1JF2A 4I5JA 2LUCA 2NXQA 1BLQA 1C7WA 1DF0B 1K8UA 1TNWA 1TTXA 2CBLA 1SR6B 2M49B 1KWOC 3C1VA 2JXCA 2KFGA 2LM5A 2SCPA 3SIBA 1QASA 2L5XB 3S0FA 1YX7A 3I5IB 3I5FB 1XK4A 3BXKA 4OZDA 1S3PA 3SS5A 1UHKA 1GJYA 1XFUO 4YRUA 1K94A 2BECA 1CB1A 2EGDA 3D76A 4XJKA 4MN0A 1QVIZ 2BCBA 1SCMC 1KFXS 4MVFA 1IKUA 1J7OA 2M1UA 1OOFA 3GOFA 1K93D 2RGIA 2JPOA 4CFRA 2Q91A 1IWQA 1EG3A 1JUOA 1QV0A 4GGNA 2WORA 5I2QA 2QEOA 4OKHA 4PHMA 1QTXA 1CLMA 1WDCB 1PK0D 4MZKA 3RM1A 1S36A 2PMYA 2K2AA 2MA2A 3JTDC 4FQTA 1WLZA 3ZWHA 5HL1A 2L98A 1F70A 2MLFC 1SKTA 2LVJA 1JFJA 2HQWA 4TNCA 1X02A 2JULA 5TNCA 4HRGA 4PCWA 1F8HA 1SL7A 5CSIA 3IVTA 1WLMA 1ZUZA 2BCXA 4A4BA 4C0LA 3EK7A 1CM4A 1A29A 3O78A 1Y6WA 2PASA 5I2OA 2LVKA 5K89A 1PSBA 1DT7B 4CPVA 3F45A 1F54A 1NX1A 1SPYA 2LLUA 3CS1A 2K7BA 2M7NA 2KYCA 1K9KA 2LAPA 4BY5A 2WCMA 3NSKA 2H61C 2JU0A 1DVIA 1Z4HA 1H8BA 4F7FA 1UHIA 1JF0A 3OX6A 1XK4C 3D75A 3PM2A 4PT1A 3CABA 1M31A 1CM1A 1S6IA 2BBNA 3D78A 2OS8B 4MEWA 5CPVA 3OP0A 4GNKB 5CSFA 1XA5A 1SMGA 1AUIB 1SR6C 5D3OA 3DY9A 3FE8A 3VGOA 2KAYA 2ZNEA 1TCOB 1DJGA 1DJYA 1TUJA 2ZKMX 4GGFC 1R2UA 1ZACA 4KYNA 4N5XA 1SW8A 1EJ3A 3DYEA 1NPQA 1QXPA 4ICBA 3WHUB 1YTZC 5HKWA 3B7AA 5G08A 4INXA 4DS7A 1CDPA 1QLKA 2KAXA 1QX7A 1KQVA 4PHNA 1R6PA
chains in the Genus database with same CATH topology
2L4IA 2FOTA 1ODBA 1A03A 1UP5A 1KFUS 3A4UB 4YI9A 1N2DA 1NWDA 2KYFA 1QATA 3MSEB 1K90D 2V53A 1CDNA 4ZCVA 4YGAA 3DF0B 1S26D 2H2KA 3GK4X 2MLEC 1J7QA 1KCYA 4AQJA 2BKIB 1K2HA 4YGBB 2BE4A 1RK9A 1PULA 2LNKA 3DVKA 2MAZA 2ZRSA 3TS5C 2HETA 2WC8A 3WXAA 5J3XA 2F2PA 4NDBA 2KGRA 1RROA 2KI4C 4PE0A 5ER4X 4USLA 1C07A 5B8IB 1BODA 3BQ3A 5AERA 4GUKA 1PVBA 2LLSA 1IGVA 1M63B 1DJZA 1ZOTB 3DVJA 2F2OA 3SG3A 1S5GY 5BPJA 4R1EA 2M9GA 4PDZA 2HPSA 4N1GA 1CMFA 4JQ0D 1NCXA 3RLZA 1JFKA 1NP8A 1J1EA 4GFTA 1GGZA 1KFUL 1B7TY 2JTTA 2GGMA 2JNFA 2HF5A 3BOWB 3O4YA 1L2OB 3VRRA 3CR4X 1MHOA 5CSNA 2CXJA 1J55A 3CR5X 1KSOA 3SIAA 1F4QA 3WHTB 4XJKB 2KGBC 2M1KB 2B1UA 3SG7A 3CGAA 5HKYA 2JRFA 1IRJA 4WQ3A 4CFQA 2LE9B 1YRTB 1SL9A 1CFPA 3VRQA 1TCFA 3GK1A 2NLNA 2KHNA 2KQYA 1EL4A 4PE7A 2PALA 1B8RA 3OHMB 4JWQA 1WRZA 5FYXA 3DVMA 3AAJA 4ORAB 1KQMB 2L2EA 4HREE 1Y1AA 1JSAA 2JNXA 3D10A 3AKBA 3FWBA 2M29A 3AKAA 2VRGA 1S6JA 1IG5A 1KK7Y 1RFJA 4JPZB 2R2IA 3CZTX 3EK4A 1AP4A 2LMVA 1XFVO 1B9AA 2ISDA 2I94A 1QV1A 4GPLB 1NX3A 4PE4A 1U5IA 3EVUA 3TS5B 1HT9A 1TOPA 3FIAA 1DJIA 4ORBB 4PE1A 4HSZA 4I5KA 2O5GA 1CNPA 2KI4B 2JT8A 1AK8A 1QJTA 1YVLA 1XYDA 2K7DA 1YR5A 2M97A 1AJ4A 2KBIA 3LL8B 3LLEA 3BUNB 3PSRA 2JXLA 1KK8C 2K7OA 1ALWA 1KFXL 1L2OC 1Y0VH 3CLNA 1NSHA 5KSZA 1RJVA 2Y4QA 3E3RA 3PATA 1WRKA 2K2FA 1EXRA 1YUSA 2IS9A 2NCOA 3HCMA 1N65A 1MUXA 2LV7A 4A4CA 1LKJA 1JC2A 3NSOA 3M0WA 2K0JA 1CDMA 2MRDA 5JOLA 1YVHA 1PALA 3PALA 4P5OE 1BJFA 1B8LA 4DCKA 3PLFB 2MJWB 2LMUA 1A2XA 2ZNDA 1YRUB 1M39A 2E30A 2GV5A 3TDZA 1CKKA 2ZN8A 1PSRA 2EC6C 3EK8A 2L4HA 1RECA 2G2BA 1KQMC 3LCPC 4ETOA 1LINA 1AVSA 2BKHB 4MLWA 1DMOA 5AXIA 3FS7A 1SCVA 1MWNA 2KQ6A 1A75A 3PN7C 1JBAA 4DRWA 5AFPA 2I18A 2LHLA 1CFFA 3TZ1A 2LANA 5HKZA 5PALA 1IH0A 4XYNA 3IQQA 2P6BB 2CNPA 2WCEA 3WNXB 4MZJA 2BL0C 1QX2A 4U8DA 1XFWO 2CT9A 2L50A 4FQOA 2WCFA 2KNEA 1MXLC 2M3WA 1YUTA 4ORCB 4CLNA 1CLLA 1XO5A 4OV2A 3HX4A 3D0YA 2ZFDA 1B47A 1EG4A 1M46A 1F55A 1K9PA 2WOSA 1BU3A 1Y1UA 1DJHA 2OPOA 1DGUA 1K95A 2KDHA 3KEVA 1LVCD 3TDIA 4PHJA 1V1FA 2KSPA 2FCDA 1AHRA 1Y1XA 3NSIA 3SG2A 4AQIA 1G8IA 1QX5B 1BOCA 1PVAA 2GGZA 2ZRTA 5D7FA 1SBJA 1SY9A 2LC5A 2MBXA 1FF1A 1KK8B 4OVNF 1W7JB 5DKNA 1LA3A 1SNLA 1EH2A 4OR9B 1MXEA 2K8MB 2WNDA 3BYAA 1KSMA 2M0RA 1XVJA 1ZFSA 2Y5IA 1PRWA 4M2OA 4MSPA 5ER5A 1DJXA 4F0ZB 3EKHA 2FJUB 2KI6D 1UHNA 4YBHB 1CTRA 1QIVA 3CTNA 2F8PA 5I8NA 3PM8A 5HLVA 1B8CA 2F3ZA 1NYAA 2F33A 1BG1A 3LK0A 1CLBA 1OOJA 2EC6B 2LVIA 4BY4A 2PRUA 2QPTA 1E8AA 2JTZA 2Q4UA 2NZ0A 1F70A 1U5IB 4MZLA 5F6TA 1ALVA 1MF8B 5DKRA 2QACA 3OB2B 3LK1A 3ICBA 4NDDA 1TRFA 1UURA 2I7AA 2H61A 2LHIA 2O60A 2ZN9A 4PALA 4N1FA 1F71A 1UHHA 3PN7B 3VROA 2FCEA 1A4PA 3I5GB 1QVIY 3BOWA 1J7PA 1XFYO 1FI5A 2Y1NA 3VRNA 3DD4A 1BMOA 1KK7Z 3SJSA 3ZNIA 1NIWA 2BL0B 1NCZA 1DGVA 1W7IB 2JT0A 3EVVA 1DF0A 3I5HC 2OTGB 4MBEA 1JWDA 2AUCA 5AANA 2A4JA 4YI8A 1LA0A 1OMRA 2LP2A 2L0PA 4GGFA 1SRAA 1UUSA 3NXAA 1OSAA 2KI6C 4NQGA 2JOJA 3BUWB 5DKQA 1CFDA 5JJGA 3TDUA 3CWGA 3JVTB 1CMGA 3O6BA 1NX0A 1TNXA 2K7CA 3EKJA 1H4BA 3DVEA 2HQ8A 1GQMA 4YGDB 3IQOA 2TN4A 2M8UA 3H4SE 1F4OA 2NCPA 4GAOA 1OQPA 1TNQA 1DJWA 1SL8A 4MRYA 1G33A 2BE6A 2KOTA 4D1EA 1SYMA 1WRLA 1TN4A 4ZCUA 1J1DA 1FBVA 4DUQA 1L7ZA 2JZIA 3KO0A 1OE9B 2PSRA 5I2LA 3NSLA 2LCPA 5CSJA 3TUYC 2LLTA 5HLOA 1RTP1 1DTLA 2COLB 1A75B 1MR8A 2K61A 2KAVA 1G4YR 4I5LB 1IJ6A 2LP3A 2LUXA 1MQ1A 3CR2A 4FTGA 1OMVA 3BUMB 1YURA 2AAOA 4I5NB 2KBMA 1BF5A 1UWOA 3OB1B 2BCAA 2KFFA 5HYDA 1FW4A 2L51A 5AEQA 1S1EA 4YGEB 3I5GC 2G9BA 3I5IC 1K96A 3I5FC 2JPTA 1GGWA 4DIRA 3KF9A 1S6CA 3D0YB 1KWOB 1FI6A 3K21A 1CFCA 1NUBA 2CTNA 1AJ5A 2PVBA 4QJ3B 1K9UA 1M45A 2JT3A 2OTGC 1YX8A 1HQVA 3BUXB 3A8RA 1FPWA 5KTYA 2I2RE 4L9MA 3KPXA 1QIWA 1VRKA 4YGCB 2EHBA 2JQ6A 4WRIA 3IF7A 4MRXA 4P2YB 3I5HB 3O2PA 3KHEA 1SCMB 1NX2A 1YUUA 1D1OA 1B4CA 5GQQC 1WDCC 1OZSA 2Y1MA 3JVTC 4Q04A 1V1GA 4QJ5B 2JC2A 3AAKA 2WCBA 1J7RA 1TNPA 2AMIA 4NDCA 1UHJA 1LXFC 2CCMA 2JWWA 2KFHA 1B1GA 2D8NA 4WQ2A 1OZOA 2LVVA 3BUOB 3GK2A 4E68A 3JTDB 1S5GZ 4QJ4B 4PHKA 4UPGA 4M2QA 3DF0A 5IBWA 3EVRA 2F3YA 4AOMA 3PFVA 1CDLA 1XFXO 1Q80A 1IQ5A 4OCIA 3VRPA 2SASA 1SK6D 1B7TZ 2BBMA 1WY9A 1ZMZA 2LMTA 1C7VA 3FWCA 3OX5A 4IL1A 1QLSA 2DOQA 2MHHA 1XFZO 1QS7A 4M2PA 4HRHA 4GBAA 3SG5A 3TUYB 4C0JA 2OS8C 1TIZA 3SG6A 1OMDA 1N0YA 1BR4B 1NCYA 5KU1A 1BR1B 5D69A 4C0KA 3QRXA 4CIDA 1IJ5A 2M7LA 1RWYA 2E6WA 3SG4A 1IQ3A 1BT6A 1JF2A 4I5JA 2LUCA 2NXQA 1BLQA 1C7WA 1DF0B 1K8UA 1TNWA 1TTXA 2CBLA 1SR6B 2M49B 1KWOC 3C1VA 2JXCA 2KFGA 2LM5A 2SCPA 3SIBA 1QASA 2L5XB 1YX7A 3I5IB 3I5FB 1XK4A 3BXKA 1S3PA 1UHKA 1GJYA 1XFUO 4YRUA 1K94A 2BECA 1CB1A 2EGDA 4XJKA 4MN0A 1QVIZ 2BCBA 1SCMC 1KFXS 4MVFA 1IKUA 1J7OA 2M1UA 3GOFA 4CFRA 1K93D 2RGIA 2Q91A 1IWQA 1EG3A 1JUOA 1QV0A 4GGNA 2WORA 5I2QA 4OKHA 4PHMA 1QTXA 1CLMA 1WDCB 1PK0D 4MZKA 3RM1A 1S36A 2PMYA 2K2AA 2MA2A 3JTDC 1WLZA 3ZWHA 2L98A 2MLFC 1SKTA 2LVJA 1JFJA 2HQWA 4TNCA 1X02A 2JULA 5TNCA 4HRGA 4PCWA 1F8HA 1SL7A 5CSIA 4A4BA 1WLMA 1ZUZA 2BCXA 4C0LA 3EK7A 1CM4A 1A29A 3O78A 1Y6WA 2PASA 5I2OA 2LVKA 5K89A 1PSBA 1DT7B 4CPVA 3F45A 1F54A 1NX1A 1SPYA 2LLUA 3CS1A 2K7BA 2M7NA 2KYCA 1K9KA 2LAPA 4BY5A 3NSKA 2H61C 2JU0A 1DVIA 1H8BA 1UHIA 1JF0A 3OX6A 1XK4C 1M31A 1CM1A 1S6IA 2BBNA 4MEWA 2OS8B 5CPVA 3OP0A 4GNKB 5CSFA 1XA5A 1SMGA 1AUIB 1SR6C 3VGOA 2KAYA 2ZNEA 1TCOB 1DJGA 1DJYA 2ZKMX 4GGFC 1R2UA 1ZACA 4N5XA 1SW8A 1EJ3A 1NPQA 1QXPA 4ICBA 3WHUB 1YTZC 5HKWA 5G08A 4DS7A 1CDPA 1QLKA 2KAXA 1QX7A 1KQVA 4PHNA 1R6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4I A;  2FOT A;  1ODB A;  1A03 A;  1UP5 A;  1KFU S;  3A4U B;  4YI9 A;  1N2D A;  1NWD A;  2KYF A;  1QAT A;  3MSE B;  1K90 D;  2V53 A;  1CDN A;  4ZCV A;  4YGA A;  3DF0 B;  1S26 D;  2H2K A;  3GK4 X;  2MLE C;  1J7Q A;  1KCY A;  4AQJ A;  2BKI B;  1K2H A;  4YGB B;  2BE4 A;  1RK9 A;  1PUL A;  2LNK A;  3DVK A;  2MAZ A;  2ZRS A;  3TS5 C;  2HET A;  2WC8 A;  3WXA A;  5J3X A;  2F2P A;  4NDB A;  2KGR A;  1RRO A;  2KI4 C;  4PE0 A;  5ER4 X;  4USL A;  1C07 A;  5B8I B;  1BOD A;  3BQ3 A;  5AER A;  4GUK A;  1PVB A;  2LLS A;  1IGV A;  1M63 B;  1DJZ A;  1ZOT B;  3DVJ A;  2F2O A;  3SG3 A;  1S5G Y;  5BPJ A;  4R1E A;  2M9G A;  4PDZ A;  2HPS A;  4N1G A;  1CMF A;  4JQ0 D;  1NCX A;  3RLZ A;  1JFK A;  1NP8 A;  1J1E A;  4GFT A;  1GGZ A;  1KFU L;  1B7T Y;  2JTT A;  2GGM A;  2JNF A;  2HF5 A;  3BOW B;  3O4Y A;  1L2O B;  3VRR A;  3CR4 X;  1MHO A;  5CSN A;  2CXJ A;  1J55 A;  3CR5 X;  1KSO A;  3SIA A;  1F4Q A;  3WHT B;  4XJK B;  2KGB C;  2M1K B;  2B1U A;  3SG7 A;  3CGA A;  5HKY A;  2JRF A;  1IRJ A;  4WQ3 A;  4CFQ A;  2LE9 B;  1YRT B;  1SL9 A;  1CFP A;  3VRQ A;  1TCF A;  3GK1 A;  2NLN A;  2KHN A;  2KQY A;  1EL4 A;  4PE7 A;  2PAL A;  1B8R A;  3OHM B;  4JWQ A;  1WRZ A;  5FYX A;  3DVM A;  3AAJ A;  4ORA B;  1KQM B;  2L2E A;  4HRE E;  1Y1A A;  1JSA A;  2JNX A;  3D10 A;  3AKB A;  3FWB A;  2M29 A;  3AKA A;  2VRG A;  1S6J A;  1IG5 A;  1KK7 Y;  1RFJ A;  4JPZ B;  2R2I A;  3CZT X;  3EK4 A;  1AP4 A;  2LMV A;  1XFV O;  1B9A A;  2ISD A;  2I94 A;  1QV1 A;  4GPL B;  1NX3 A;  4PE4 A;  1U5I A;  3EVU A;  3TS5 B;  1HT9 A;  1TOP A;  3FIA A;  1DJI A;  4ORB B;  4PE1 A;  4HSZ A;  4I5K A;  2O5G A;  1CNP A;  2KI4 B;  2JT8 A;  1AK8 A;  1QJT A;  1YVL A;  1XYD A;  2K7D A;  1YR5 A;  2M97 A;  1AJ4 A;  2KBI A;  3LL8 B;  3LLE A;  3BUN B;  3PSR A;  2JXL A;  1KK8 C;  2K7O A;  1ALW A;  1KFX L;  1L2O C;  1Y0V H;  3CLN A;  1NSH A;  5KSZ A;  1RJV A;  2Y4Q A;  3E3R A;  3PAT A;  1WRK A;  2K2F A;  1EXR A;  1YUS A;  2IS9 A;  2NCO A;  3HCM A;  1N65 A;  1MUX A;  2LV7 A;  4A4C A;  1LKJ A;  1JC2 A;  3NSO A;  3M0W A;  2K0J A;  1CDM A;  2MRD A;  5JOL A;  1YVH A;  1PAL A;  3PAL A;  4P5O E;  1BJF A;  1B8L A;  4DCK A;  3PLF B;  2MJW B;  2LMU A;  1A2X A;  2ZND A;  1YRU B;  1M39 A;  2E30 A;  2GV5 A;  3TDZ A;  1CKK A;  2ZN8 A;  1PSR A;  2EC6 C;  3EK8 A;  2L4H A;  1REC A;  2G2B A;  1KQM C;  3LCP C;  4ETO A;  1LIN A;  1AVS A;  2BKH B;  4MLW A;  1DMO A;  5AXI A;  3FS7 A;  1SCV A;  1MWN A;  2KQ6 A;  1A75 A;  3PN7 C;  1JBA A;  4DRW A;  5AFP A;  2I18 A;  2LHL A;  1CFF A;  3TZ1 A;  2LAN A;  5HKZ A;  5PAL A;  1IH0 A;  4XYN A;  3IQQ A;  2P6B B;  2CNP A;  2WCE A;  3WNX B;  4MZJ A;  2BL0 C;  1QX2 A;  4U8D A;  1XFW O;  2CT9 A;  2L50 A;  4FQO A;  2WCF A;  2KNE A;  1MXL C;  2M3W A;  1YUT A;  4ORC B;  4CLN A;  1CLL A;  1XO5 A;  4OV2 A;  3HX4 A;  3D0Y A;  2ZFD A;  1B47 A;  1EG4 A;  1M46 A;  1F55 A;  1K9P A;  2WOS A;  1BU3 A;  1Y1U A;  1DJH A;  2OPO A;  1DGU A;  1K95 A;  2KDH A;  3KEV A;  1LVC D;  3TDI A;  4PHJ A;  1V1F A;  2KSP A;  2FCD A;  1AHR A;  1Y1X A;  3NSI A;  3SG2 A;  4AQI A;  1G8I A;  1QX5 B;  1BOC A;  1PVA A;  2GGZ A;  2ZRT A;  5D7F A;  1SBJ A;  1SY9 A;  2LC5 A;  2MBX A;  1FF1 A;  1KK8 B;  4OVN F;  1W7J B;  5DKN A;  1LA3 A;  1SNL A;  1EH2 A;  4OR9 B;  1MXE A;  2K8M B;  2WND A;  3BYA A;  1KSM A;  2M0R A;  1XVJ A;  1ZFS A;  2Y5I A;  1PRW A;  4M2O A;  4MSP A;  5ER5 A;  1DJX A;  4F0Z B;  3EKH A;  2FJU B;  2KI6 D;  1UHN A;  4YBH B;  1CTR A;  1QIV A;  3CTN A;  2F8P A;  5I8N A;  3PM8 A;  5HLV A;  1B8C A;  2F3Z A;  1NYA A;  2F33 A;  1BG1 A;  3LK0 A;  1CLB A;  1OOJ A;  2EC6 B;  2LVI A;  4BY4 A;  2PRU A;  2QPT A;  1E8A A;  2JTZ A;  2Q4U A;  2NZ0 A;  1F70 A;  1U5I B;  4MZL A;  5F6T A;  1ALV A;  1MF8 B;  5DKR A;  2QAC A;  3OB2 B;  3LK1 A;  3ICB A;  4NDD A;  1TRF A;  1UUR A;  2I7A A;  2H61 A;  2LHI A;  2O60 A;  2ZN9 A;  4PAL A;  4N1F A;  1F71 A;  1UHH A;  3PN7 B;  3VRO A;  2FCE A;  1A4P A;  3I5G B;  1QVI Y;  3BOW A;  1J7P A;  1XFY O;  1FI5 A;  2Y1N A;  3VRN A;  3DD4 A;  1BMO A;  1KK7 Z;  3SJS A;  3ZNI A;  1NIW A;  2BL0 B;  1NCZ A;  1DGV A;  1W7I B;  2JT0 A;  3EVV A;  1DF0 A;  3I5H C;  2OTG B;  4MBE A;  1JWD A;  2AUC A;  5AAN A;  2A4J A;  4YI8 A;  1LA0 A;  1OMR A;  2LP2 A;  2L0P A;  4GGF A;  1SRA A;  1UUS A;  3NXA A;  1OSA A;  2KI6 C;  4NQG A;  2JOJ A;  3BUW B;  5DKQ A;  1CFD A;  5JJG A;  3TDU A;  3CWG A;  3JVT B;  1CMG A;  3O6B A;  1NX0 A;  1TNX A;  2K7C A;  3EKJ A;  1H4B A;  3DVE A;  2HQ8 A;  1GQM A;  4YGD B;  3IQO A;  2TN4 A;  2M8U A;  3H4S E;  1F4O A;  2NCP A;  4GAO A;  1OQP A;  1TNQ A;  1DJW A;  1SL8 A;  4MRY A;  1G33 A;  2BE6 A;  2KOT A;  4D1E A;  1SYM A;  1WRL A;  1TN4 A;  4ZCU A;  1J1D A;  1FBV A;  4DUQ A;  1L7Z A;  2JZI A;  3KO0 A;  1OE9 B;  2PSR A;  5I2L A;  3NSL A;  2LCP A;  5CSJ A;  3TUY C;  2LLT A;  5HLO A;  1RTP 1;  1DTL A;  2COL B;  1A75 B;  1MR8 A;  2K61 A;  2KAV A;  1G4Y R;  4I5L B;  1IJ6 A;  2LP3 A;  2LUX A;  1MQ1 A;  3CR2 A;  4FTG A;  1OMV A;  3BUM B;  1YUR A;  2AAO A;  4I5N B;  2KBM A;  1BF5 A;  1UWO A;  3OB1 B;  2BCA A;  2KFF A;  5HYD A;  1FW4 A;  2L51 A;  5AEQ A;  1S1E A;  4YGE B;  3I5G C;  2G9B A;  3I5I C;  1K96 A;  3I5F C;  2JPT A;  1GGW A;  4DIR A;  3KF9 A;  1S6C A;  3D0Y B;  1KWO B;  1FI6 A;  3K21 A;  1CFC A;  1NUB A;  2CTN A;  1AJ5 A;  2PVB A;  4QJ3 B;  1K9U A;  1M45 A;  2JT3 A;  2OTG C;  1YX8 A;  1HQV A;  3BUX B;  3A8R A;  1FPW A;  5KTY A;  2I2R E;  4L9M A;  3KPX A;  1QIW A;  1VRK A;  4YGC B;  2EHB A;  2JQ6 A;  4WRI A;  3IF7 A;  4MRX A;  4P2Y B;  3I5H B;  3O2P A;  3KHE A;  1SCM B;  1NX2 A;  1YUU A;  1D1O A;  1B4C A;  5GQQ C;  1WDC C;  1OZS A;  2Y1M A;  3JVT C;  4Q04 A;  1V1G A;  4QJ5 B;  2JC2 A;  3AAK A;  2WCB A;  1J7R A;  1TNP A;  2AMI A;  4NDC A;  1UHJ A;  1LXF C;  2CCM A;  2JWW A;  2KFH A;  1B1G A;  2D8N A;  4WQ2 A;  1OZO A;  2LVV A;  3BUO B;  3GK2 A;  4E68 A;  3JTD B;  1S5G Z;  4QJ4 B;  4PHK A;  4UPG A;  4M2Q A;  3DF0 A;  5IBW A;  3EVR A;  2F3Y A;  4AOM A;  3PFV A;  1CDL A;  1XFX O;  1Q80 A;  1IQ5 A;  4OCI A;  3VRP A;  2SAS A;  1SK6 D;  1B7T Z;  2BBM A;  1WY9 A;  1ZMZ A;  2LMT A;  1C7V A;  3FWC A;  3OX5 A;  4IL1 A;  1QLS A;  2DOQ A;  2MHH A;  1XFZ O;  1QS7 A;  4M2P A;  4HRH A;  4GBA A;  3SG5 A;  3TUY B;  4C0J A;  2OS8 C;  1TIZ A;  3SG6 A;  1OMD A;  1N0Y A;  1BR4 B;  1NCY A;  5KU1 A;  1BR1 B;  5D69 A;  4C0K A;  3QRX A;  4CID A;  1IJ5 A;  2M7L A;  1RWY A;  2E6W A;  3SG4 A;  1IQ3 A;  1BT6 A;  1JF2 A;  4I5J A;  2LUC A;  2NXQ A;  1BLQ A;  1C7W A;  1DF0 B;  1K8U A;  1TNW A;  1TTX A;  2CBL A;  1SR6 B;  2M49 B;  1KWO C;  3C1V A;  2JXC A;  2KFG A;  2LM5 A;  2SCP A;  3SIB A;  1QAS A;  2L5X B;  1YX7 A;  3I5I B;  3I5F B;  1XK4 A;  3BXK A;  1S3P A;  1UHK A;  1GJY A;  1XFU O;  4YRU A;  1K94 A;  2BEC A;  1CB1 A;  2EGD A;  4XJK A;  4MN0 A;  1QVI Z;  2BCB A;  1SCM C;  1KFX S;  4MVF A;  1IKU A;  1J7O A;  2M1U A;  3GOF A;  4CFR A;  1K93 D;  2RGI A;  2Q91 A;  1IWQ A;  1EG3 A;  1JUO A;  1QV0 A;  4GGN A;  2WOR A;  5I2Q A;  4OKH A;  4PHM A;  1QTX A;  1CLM A;  1WDC B;  1PK0 D;  4MZK A;  3RM1 A;  1S36 A;  2PMY A;  2K2A A;  2MA2 A;  3JTD C;  1WLZ A;  3ZWH A;  2L98 A;  2MLF C;  1SKT A;  2LVJ A;  1JFJ A;  2HQW A;  4TNC A;  1X02 A;  2JUL A;  5TNC A;  4HRG A;  4PCW A;  1F8H A;  1SL7 A;  5CSI A;  4A4B A;  1WLM A;  1ZUZ A;  2BCX A;  4C0L A;  3EK7 A;  1CM4 A;  1A29 A;  3O78 A;  1Y6W A;  2PAS A;  5I2O A;  2LVK A;  5K89 A;  1PSB A;  1DT7 B;  4CPV A;  3F45 A;  1F54 A;  1NX1 A;  1SPY A;  2LLU A;  3CS1 A;  2K7B A;  2M7N A;  2KYC A;  1K9K A;  2LAP A;  4BY5 A;  3NSK A;  2H61 C;  2JU0 A;  1DVI A;  1H8B A;  1UHI A;  1JF0 A;  3OX6 A;  1XK4 C;  1M31 A;  1CM1 A;  1S6I A;  2BBN A;  4MEW A;  2OS8 B;  5CPV A;  3OP0 A;  4GNK B;  5CSF A;  1XA5 A;  1SMG A;  1AUI B;  1SR6 C;  3VGO A;  2KAY A;  2ZNE A;  1TCO B;  1DJG A;  1DJY A;  2ZKM X;  4GGF C;  1R2U A;  1ZAC A;  4N5X A;  1SW8 A;  1EJ3 A;  1NPQ A;  1QXP A;  4ICB A;  3WHU B;  1YTZ C;  5HKW A;  5G08 A;  4DS7 A;  1CDP A;  1QLK A;  2KAX A;  1QX7 A;  1KQV A;  4PHN A;  1R6P A; 
#chains in the Genus database with same CATH topology
 2L4I A;  2FOT A;  1ODB A;  1A03 A;  1UP5 A;  3CZ2 A;  1KFU S;  3A4U B;  4YI9 A;  3CYZ A;  1N2D A;  1NWD A;  2KYF A;  1QAT A;  3MSE B;  2WCK A;  1K90 D;  2V53 A;  5I94 A;  4ZCV A;  4YGA A;  1CDN A;  3D73 A;  3DF0 B;  1QWV A;  1S26 D;  2H2K A;  2WCJ A;  3GK4 X;  5DIC A;  2MLE C;  1J7Q A;  3L4L A;  1KCY A;  4AQJ A;  3B87 A;  2BKI B;  1K2H A;  4YGB B;  2BE4 A;  1RK9 A;  1PUL A;  2LNK A;  3DVK A;  2MAZ A;  2ZRS A;  3TS5 C;  2HET A;  2WC8 A;  3FE9 A;  3WXA A;  5J3X A;  3FE6 A;  2F2P A;  3VB1 A;  4NDB A;  2KGR A;  1RRO A;  2KI4 C;  4PE0 A;  5ER4 X;  4USL A;  3RZS A;  1C07 A;  5B8I B;  1BOD A;  3BQ3 A;  5AER A;  4GUK A;  1PVB A;  2LLS A;  1OOI X;  1IGV A;  1M63 B;  1DJZ A;  1ZOT B;  3DVJ A;  2F2O A;  3SG3 A;  1S5G Y;  5BPJ A;  4R1E A;  2M9G A;  4PDZ A;  2HPS A;  4N1G A;  1CMF A;  4JQ0 D;  1NCX A;  3RLZ A;  1JFK A;  1NP8 A;  1J1E A;  3Q8I A;  4GFT A;  1GGZ A;  1KFU L;  1B7T Y;  2JTT A;  2GGM A;  2JNF A;  2HF5 A;  3BOW B;  3O4Y A;  1L2O B;  5FI2 A;  3VRR A;  3CR4 X;  1MHO A;  1SSE B;  5CSN A;  2CXJ A;  1J55 A;  3CR5 X;  1KSO A;  3SIA A;  1F4Q A;  3WHT B;  4XJK B;  2KGB C;  2M1K B;  2B1U A;  3SG7 A;  3CGA A;  3V2L A;  5HKY A;  2JRF A;  1IRJ A;  4WQ3 A;  4CFQ A;  2LE9 B;  1YRT B;  1SL9 A;  1CFP A;  3VRQ A;  1TCF A;  3GK1 A;  2NLN A;  2KHN A;  2K60 A;  2KQY A;  1EL4 A;  4PE7 A;  2PAL A;  1B8R A;  3OHM B;  4JWQ A;  1WRZ A;  5FYX A;  3DVM A;  3S0E A;  1XFR A;  3AAJ A;  4ORA B;  1KQM B;  2PQL A;  2L2E A;  4HRE E;  1Y1A A;  1JSA A;  2JNX A;  3D10 A;  3AKB A;  3FWB A;  2M29 A;  2P70 A;  3AKA A;  2VRG A;  1S6J A;  1IG5 A;  1KK7 Y;  1RFJ A;  4JPZ B;  2R2I A;  3CZT X;  3EK4 A;  1C3Z A;  1AP4 A;  2LMV A;  1XFV O;  1B9A A;  2ISD A;  2I94 A;  1QV1 A;  2QEV A;  4GPL B;  1NX3 A;  2P71 A;  3S0A A;  5EL2 A;  4PE4 A;  1U5I A;  4JKT A;  3EVU A;  3B6X A;  3TS5 B;  1HT9 A;  1TOP A;  3FIA A;  1DJI A;  1TUZ A;  4ORB B;  4PE1 A;  4HSZ A;  4I5K A;  2O5G A;  1CNP A;  4INW A;  2KI4 B;  2JT8 A;  1AK8 A;  1QJT A;  1YVL A;  1XYD A;  2K7D A;  1YR5 A;  2M97 A;  1AJ4 A;  2KBI A;  3LL8 B;  3LLE A;  3BUN B;  3PSR A;  2JXL A;  1KK8 C;  2K7O A;  1ALW A;  1KFX L;  1L2O C;  1Y0V H;  3CLN A;  1NSH A;  5KSZ A;  1RJV A;  2Y4Q A;  3E3R A;  3PAT A;  1WRK A;  3B88 A;  3QME A;  1DEK A;  2K2F A;  1EXR A;  1YUS A;  2IS9 A;  2NCO A;  2YGU A;  3HCM A;  1N65 A;  3UNW A;  2QDI A;  1MUX A;  2LV7 A;  3L47 A;  1LKJ A;  4A4C A;  1Z2C B;  1JC2 A;  3NSO A;  3M0W A;  2K0J A;  1CDM A;  2MRD A;  5JOL A;  1YVH A;  1PAL A;  3PAL A;  4P5O E;  1BJF A;  1B8L A;  4DCK A;  3PLF B;  2MJW B;  2LMU A;  1A2X A;  2ZND A;  1YRU B;  1M39 A;  2E30 A;  2GV5 A;  3BFB A;  3TDZ A;  3DXL A;  1CKK A;  2ZN8 A;  1PSR A;  2EC6 C;  3EK8 A;  3DZT A;  5FI6 A;  2L4H A;  1REC A;  1T14 A;  1GM0 A;  2G2B A;  1KQM C;  3LCP C;  2L5Y A;  4ETO A;  1LIN A;  1AVS A;  2BKH B;  4MLW A;  1DMO A;  5AXI A;  3FS7 A;  1SCV A;  1MWN A;  2KQ6 A;  1A75 A;  3PN7 C;  1JBA A;  4DRW A;  5AFP A;  2I18 A;  2LHL A;  3NHT A;  1CFF A;  3TZ1 A;  2LAN A;  5HKZ A;  5PAL A;  1IH0 A;  3BFA A;  4XYN A;  3IQQ A;  2P6B B;  2H8V A;  2CNP A;  2WCE A;  3WNX B;  4MZJ A;  2BL0 C;  1QX2 A;  2WC5 A;  4U8D A;  1XFW O;  2CT9 A;  2L50 A;  4FQO A;  2WCF A;  2KNE A;  1MXL C;  1IIO A;  2M3W A;  1YUT A;  4ORC B;  4CLN A;  1CLL A;  1XO5 A;  4OV2 A;  3HX4 A;  3D0Y A;  3CDN A;  3L4A A;  2ZFD A;  1B47 A;  1EG4 A;  1M46 A;  3EG5 B;  1F55 A;  1K9P A;  2WOS A;  1BU3 A;  1Y1U A;  1DJH A;  2OPO A;  1DGU A;  1K95 A;  2KDH A;  3KEV A;  2GTE A;  1LVC D;  3TDI A;  4PHJ A;  1V1F A;  2KSP A;  2FCD A;  1AHR A;  1Y1X A;  2PYQ A;  3NSI A;  3SG2 A;  4AQI A;  1G8I A;  1QX5 B;  1BOC A;  1PVA A;  2GGZ A;  2ZRT A;  5D7F A;  1SBJ A;  1SY9 A;  2LC5 A;  2MBX A;  1FF1 A;  1KK8 B;  4OVN F;  1W7J B;  5DKN A;  1LA3 A;  1SNL A;  1EH2 A;  4OR9 B;  3UO9 A;  1MXE A;  2K8M B;  2WND A;  3B86 A;  1KSM A;  3BYA A;  2M0R A;  1XVJ A;  1ZFS A;  2Y5I A;  1PRW A;  4M2O A;  3R1V A;  4MSP A;  3K1E A;  5ER5 A;  1DJX A;  4F0Z B;  3BFH A;  3EKH A;  2FJU B;  2KI6 D;  1UHN A;  4YBH B;  1CTR A;  1QIV A;  3CTN A;  2F8P A;  5I8N A;  3PM8 A;  5HLV A;  1B8C A;  2F3Z A;  1NYA A;  2F33 A;  1BG1 A;  3LK0 A;  3O4X A;  1CLB A;  1OOJ A;  2EC6 B;  2LVI A;  4BY4 A;  2PRU A;  2QPT A;  1E8A A;  2JTZ A;  2Q4U A;  1P28 A;  2NZ0 A;  1U5I B;  4MZL A;  5F6T A;  1ALV A;  1MF8 B;  5DKR A;  2QAC A;  3NHI A;  3OB2 B;  3LK1 A;  3ICB A;  4NDD A;  1TRF A;  1UUR A;  2I7A A;  2H61 A;  2LHI A;  2O60 A;  2ZN9 A;  4PAL A;  4N1F A;  1F71 A;  1UHH A;  3PN7 B;  3VRO A;  2FCE A;  1A4P A;  3I5G B;  1QVI Y;  3BOW A;  1J7P A;  3D74 A;  1XFY O;  1FI5 A;  2Y1N A;  2BNX A;  3VRN A;  3DD4 A;  1BMO A;  1KK7 Z;  3SJS A;  3N7H A;  3ZNI A;  1NIW A;  2BL0 B;  1NCZ A;  1DGV A;  1W7I B;  2JT0 A;  3EVV A;  1DF0 A;  2FJY A;  2OTG B;  3I5H C;  4MBE A;  2AUC A;  5AAN A;  1JWD A;  2A4J A;  4YI8 A;  1LA0 A;  1TWO A;  1OMR A;  2LP2 A;  2L0P A;  4GGF A;  1SRA A;  1UUS A;  3NXA A;  1OSA A;  2ERB A;  2KI6 C;  4NQG A;  2JOJ A;  2KLE A;  3BUW B;  5DKQ A;  1CFD A;  3S0B A;  5JJG A;  3TDU A;  3CWG A;  3JVT B;  1CMG A;  3O6B A;  1NX0 A;  1TNX A;  4IJ7 A;  2KPH A;  2K7C A;  3EKJ A;  1H4B A;  3DVE A;  2HQ8 A;  1GQM A;  3R72 A;  4YGD B;  3IQO A;  2TN4 A;  3D77 A;  2M8U A;  3H4S E;  1F4O A;  2NCP A;  1DEL A;  1ORG A;  4GAO A;  1OQP A;  1TNQ A;  1DJW A;  1SL8 A;  3R1P A;  4MRY A;  1G33 A;  2BE6 A;  2KOT A;  4D1E A;  1SYM A;  1WRL A;  1TN4 A;  4ZCU A;  1J1D A;  1FBV A;  4DUQ A;  1L7Z A;  2JZI A;  3KO0 A;  1OE9 B;  2PSR A;  3CZ0 A;  5I2L A;  3NSL A;  2LCP A;  5CSJ A;  3TUY C;  1DQE A;  2LLT A;  3SS3 A;  5HLO A;  1RTP 1;  2WCH A;  1DTL A;  1A75 B;  1MR8 A;  2COL B;  2K61 A;  2KAV A;  1G4Y R;  4I5L B;  1IJ6 A;  2WC6 A;  2LP3 A;  2LUX A;  1MQ1 A;  3CR2 A;  4FTG A;  1OMV A;  3BUM B;  1YUR A;  5FI7 A;  2AAO A;  1C3Y A;  4I5N B;  2KBM A;  1W9Z A;  1BF5 A;  1UWO A;  3OB1 B;  2BCA A;  2KFF A;  5HYD A;  1FW4 A;  2L51 A;  5AEQ A;  1S1E A;  2WCL A;  3R1O A;  3I5G C;  2G9B A;  3I5I C;  1K96 A;  3I5F C;  2JPT A;  3OBV A;  3PJI A;  4YGE B;  3KF9 A;  1S6C A;  3D0Y B;  4DIR A;  1KWO B;  1FI6 A;  3K21 A;  1CFC A;  1NUB A;  2CTN A;  2KLD A;  1AJ5 A;  2PVB A;  4QJ3 B;  1K9U A;  1M45 A;  2JT3 A;  2OTG C;  1YX8 A;  1HQV A;  3BUX B;  3A8R A;  1FPW A;  5KTY A;  2I2R E;  2QEB A;  4L9M A;  3KPX A;  1QIW A;  1VRK A;  4YGC B;  2EHB A;  2JQ6 A;  4WRI A;  3IF7 A;  4MRX A;  4P2Y B;  3I5H B;  4JD9 A;  3O2P A;  3KHE A;  1SCM B;  1NX2 A;  1YUU A;  1D1O A;  1B4C A;  5GQQ C;  1WDC C;  1OZS A;  2Y1M A;  3JVT C;  4Q04 A;  1V1G A;  3SS4 A;  4QJ5 B;  2JC2 A;  3AAK A;  2WCB A;  1J7R A;  1TNP A;  2AMI A;  4NDC A;  1UHJ A;  1LXF C;  2CCM A;  2JWW A;  2KFH A;  2QEH A;  1B1G A;  2D8N A;  4WQ2 A;  1OZO A;  2LVV A;  3BUO B;  3GK2 A;  4E68 A;  3JTD B;  2L2C A;  1S5G Z;  1LS8 A;  4PHK A;  4QJ4 B;  3BJH A;  4UPG A;  4M2Q A;  3DF0 A;  5IBW A;  3EVR A;  2F3Y A;  4AOM A;  3PFV A;  1CDL A;  1XFX O;  1Q80 A;  1IQ5 A;  1OOG A;  4OCI A;  3VRP A;  3CZ1 A;  2SAS A;  1SK6 D;  1B7T Z;  2BBM A;  1OOH A;  1WY9 A;  1ZMZ A;  2LMT A;  3FWC A;  3S0G A;  1C7V A;  3OX5 A;  4IL1 A;  3S0D A;  1QLS A;  2DOQ A;  2MHH A;  1XFZ O;  1QS7 A;  4M2P A;  4HRH A;  4GBA A;  3SG5 A;  3TUY B;  4C0J A;  3OGN A;  2OS8 C;  1TIZ A;  3SG6 A;  1OMD A;  1N0Y A;  1DC1 A;  1BR4 B;  1NCY A;  5KU1 A;  1BR1 B;  2BAP A;  5D69 A;  1GGW A;  4C0K A;  3QRX A;  1OW4 A;  3NGV A;  4CID A;  1IJ5 A;  2M7L A;  1RWY A;  2E6W A;  3SG4 A;  1IQ3 A;  1BT6 A;  1JF2 A;  4I5J A;  2LUC A;  2NXQ A;  1BLQ A;  1C7W A;  1DF0 B;  1K8U A;  1TNW A;  1TTX A;  2CBL A;  1SR6 B;  2M49 B;  1KWO C;  3C1V A;  2JXC A;  2KFG A;  2LM5 A;  2SCP A;  3SIB A;  1QAS A;  2L5X B;  3S0F A;  1YX7 A;  3I5I B;  3I5F B;  1XK4 A;  3BXK A;  4OZD A;  1S3P A;  3SS5 A;  1UHK A;  1GJY A;  1XFU O;  4YRU A;  1K94 A;  2BEC A;  1CB1 A;  2EGD A;  3D76 A;  4XJK A;  4MN0 A;  1QVI Z;  2BCB A;  1SCM C;  1KFX S;  4MVF A;  1IKU A;  1J7O A;  2M1U A;  1OOF A;  3GOF A;  1K93 D;  2RGI A;  2JPO A;  4CFR A;  2Q91 A;  1IWQ A;  1EG3 A;  1JUO A;  1QV0 A;  4GGN A;  2WOR A;  5I2Q A;  2QEO A;  4OKH A;  4PHM A;  1QTX A;  1CLM A;  1WDC B;  1PK0 D;  4MZK A;  3RM1 A;  1S36 A;  2PMY A;  2K2A A;  2MA2 A;  3JTD C;  4FQT A;  1WLZ A;  3ZWH A;  5HL1 A;  2L98 A;  1F70 A;  2MLF C;  1SKT A;  2LVJ A;  1JFJ A;  2HQW A;  4TNC A;  1X02 A;  2JUL A;  5TNC A;  4HRG A;  4PCW A;  1F8H A;  1SL7 A;  5CSI A;  3IVT A;  1WLM A;  1ZUZ A;  2BCX A;  4A4B A;  4C0L A;  3EK7 A;  1CM4 A;  1A29 A;  3O78 A;  1Y6W A;  2PAS A;  5I2O A;  2LVK A;  5K89 A;  1PSB A;  1DT7 B;  4CPV A;  3F45 A;  1F54 A;  1NX1 A;  1SPY A;  2LLU A;  3CS1 A;  2K7B A;  2M7N A;  2KYC A;  1K9K A;  2LAP A;  4BY5 A;  2WCM A;  3NSK A;  2H61 C;  2JU0 A;  1DVI A;  1Z4H A;  1H8B A;  4F7F A;  1UHI A;  1JF0 A;  3OX6 A;  1XK4 C;  3D75 A;  3PM2 A;  4PT1 A;  3CAB A;  1M31 A;  1CM1 A;  1S6I A;  2BBN A;  3D78 A;  2OS8 B;  4MEW A;  5CPV A;  3OP0 A;  4GNK B;  5CSF A;  1XA5 A;  1SMG A;  1AUI B;  1SR6 C;  5D3O A;  3DY9 A;  3FE8 A;  3VGO A;  2KAY A;  2ZNE A;  1TCO B;  1DJG A;  1DJY A;  1TUJ A;  2ZKM X;  4GGF C;  1R2U A;  1ZAC A;  4KYN A;  4N5X A;  1SW8 A;  1EJ3 A;  3DYE A;  1NPQ A;  1QXP A;  4ICB A;  3WHU B;  1YTZ C;  5HKW A;  3B7A A;  5G08 A;  4INX A;  4DS7 A;  1CDP A;  1QLK A;  2KAX A;  1QX7 A;  1KQV A;  4PHN A;  1R6P A; 
#chains in the Genus database with same CATH homology
 2L4I A;  2FOT A;  1ODB A;  1A03 A;  1UP5 A;  1KFU S;  3A4U B;  4YI9 A;  1N2D A;  1NWD A;  2KYF A;  1QAT A;  3MSE B;  1K90 D;  2V53 A;  1CDN A;  4ZCV A;  4YGA A;  3DF0 B;  1S26 D;  2H2K A;  3GK4 X;  2MLE C;  1J7Q A;  1KCY A;  4AQJ A;  2BKI B;  1K2H A;  4YGB B;  2BE4 A;  1RK9 A;  1PUL A;  2LNK A;  3DVK A;  2MAZ A;  2ZRS A;  3TS5 C;  2HET A;  2WC8 A;  3WXA A;  5J3X A;  2F2P A;  4NDB A;  2KGR A;  1RRO A;  2KI4 C;  4PE0 A;  5ER4 X;  4USL A;  1C07 A;  5B8I B;  1BOD A;  3BQ3 A;  5AER A;  4GUK A;  1PVB A;  2LLS A;  1IGV A;  1M63 B;  1DJZ A;  1ZOT B;  3DVJ A;  2F2O A;  3SG3 A;  1S5G Y;  5BPJ A;  4R1E A;  2M9G A;  4PDZ A;  2HPS A;  4N1G A;  1CMF A;  4JQ0 D;  1NCX A;  3RLZ A;  1JFK A;  1NP8 A;  1J1E A;  4GFT A;  1GGZ A;  1KFU L;  1B7T Y;  2JTT A;  2GGM A;  2JNF A;  2HF5 A;  3BOW B;  3O4Y A;  1L2O B;  3VRR A;  3CR4 X;  1MHO A;  5CSN A;  2CXJ A;  1J55 A;  3CR5 X;  1KSO A;  3SIA A;  1F4Q A;  3WHT B;  4XJK B;  2KGB C;  2M1K B;  2B1U A;  3SG7 A;  3CGA A;  5HKY A;  2JRF A;  1IRJ A;  4WQ3 A;  4CFQ A;  2LE9 B;  1YRT B;  1SL9 A;  1CFP A;  3VRQ A;  1TCF A;  3GK1 A;  2NLN A;  2KHN A;  2KQY A;  1EL4 A;  4PE7 A;  2PAL A;  1B8R A;  3OHM B;  4JWQ A;  1WRZ A;  5FYX A;  3DVM A;  3AAJ A;  4ORA B;  1KQM B;  2L2E A;  4HRE E;  1Y1A A;  1JSA A;  2JNX A;  3D10 A;  3AKB A;  3FWB A;  2M29 A;  3AKA A;  2VRG A;  1S6J A;  1IG5 A;  1KK7 Y;  1RFJ A;  4JPZ B;  2R2I A;  3CZT X;  3EK4 A;  1AP4 A;  2LMV A;  1XFV O;  1B9A A;  2ISD A;  2I94 A;  1QV1 A;  4GPL B;  1NX3 A;  4PE4 A;  1U5I A;  3EVU A;  3TS5 B;  1HT9 A;  1TOP A;  3FIA A;  1DJI A;  4ORB B;  4PE1 A;  4HSZ A;  4I5K A;  2O5G A;  1CNP A;  2KI4 B;  2JT8 A;  1AK8 A;  1QJT A;  1YVL A;  1XYD A;  2K7D A;  1YR5 A;  2M97 A;  1AJ4 A;  2KBI A;  3LL8 B;  3LLE A;  3BUN B;  3PSR A;  2JXL A;  1KK8 C;  2K7O A;  1ALW A;  1KFX L;  1L2O C;  1Y0V H;  3CLN A;  1NSH A;  5KSZ A;  1RJV A;  2Y4Q A;  3E3R A;  3PAT A;  1WRK A;  2K2F A;  1EXR A;  1YUS A;  2IS9 A;  2NCO A;  3HCM A;  1N65 A;  1MUX A;  2LV7 A;  4A4C A;  1LKJ A;  1JC2 A;  3NSO A;  3M0W A;  2K0J A;  1CDM A;  2MRD A;  5JOL A;  1YVH A;  1PAL A;  3PAL A;  4P5O E;  1BJF A;  1B8L A;  4DCK A;  3PLF B;  2MJW B;  2LMU A;  1A2X A;  2ZND A;  1YRU B;  1M39 A;  2E30 A;  2GV5 A;  3TDZ A;  1CKK A;  2ZN8 A;  1PSR A;  2EC6 C;  3EK8 A;  2L4H A;  1REC A;  2G2B A;  1KQM C;  3LCP C;  4ETO A;  1LIN A;  1AVS A;  2BKH B;  4MLW A;  1DMO A;  5AXI A;  3FS7 A;  1SCV A;  1MWN A;  2KQ6 A;  1A75 A;  3PN7 C;  1JBA A;  4DRW A;  5AFP A;  2I18 A;  2LHL A;  1CFF A;  3TZ1 A;  2LAN A;  5HKZ A;  5PAL A;  1IH0 A;  4XYN A;  3IQQ A;  2P6B B;  2CNP A;  2WCE A;  3WNX B;  4MZJ A;  2BL0 C;  1QX2 A;  4U8D A;  1XFW O;  2CT9 A;  2L50 A;  4FQO A;  2WCF A;  2KNE A;  1MXL C;  2M3W A;  1YUT A;  4ORC B;  4CLN A;  1CLL A;  1XO5 A;  4OV2 A;  3HX4 A;  3D0Y A;  2ZFD A;  1B47 A;  1EG4 A;  1M46 A;  1F55 A;  1K9P A;  2WOS A;  1BU3 A;  1Y1U A;  1DJH A;  2OPO A;  1DGU A;  1K95 A;  2KDH A;  3KEV A;  1LVC D;  3TDI A;  4PHJ A;  1V1F A;  2KSP A;  2FCD A;  1AHR A;  1Y1X A;  3NSI A;  3SG2 A;  4AQI A;  1G8I A;  1QX5 B;  1BOC A;  1PVA A;  2GGZ A;  2ZRT A;  5D7F A;  1SBJ A;  1SY9 A;  2LC5 A;  2MBX A;  1FF1 A;  1KK8 B;  4OVN F;  1W7J B;  5DKN A;  1LA3 A;  1SNL A;  1EH2 A;  4OR9 B;  1MXE A;  2K8M B;  2WND A;  3BYA A;  1KSM A;  2M0R A;  1XVJ A;  1ZFS A;  2Y5I A;  1PRW A;  4M2O A;  4MSP A;  5ER5 A;  1DJX A;  4F0Z B;  3EKH A;  2FJU B;  2KI6 D;  1UHN A;  4YBH B;  1CTR A;  1QIV A;  3CTN A;  2F8P A;  5I8N A;  3PM8 A;  5HLV A;  1B8C A;  2F3Z A;  1NYA A;  2F33 A;  1BG1 A;  3LK0 A;  1CLB A;  1OOJ A;  2EC6 B;  2LVI A;  4BY4 A;  2PRU A;  2QPT A;  1E8A A;  2JTZ A;  2Q4U A;  2NZ0 A;  1F70 A;  1U5I B;  4MZL A;  5F6T A;  1ALV A;  1MF8 B;  5DKR A;  2QAC A;  3OB2 B;  3LK1 A;  3ICB A;  4NDD A;  1TRF A;  1UUR A;  2I7A A;  2H61 A;  2LHI A;  2O60 A;  2ZN9 A;  4PAL A;  4N1F A;  1F71 A;  1UHH A;  3PN7 B;  3VRO A;  2FCE A;  1A4P A;  3I5G B;  1QVI Y;  3BOW A;  1J7P A;  1XFY O;  1FI5 A;  2Y1N A;  3VRN A;  3DD4 A;  1BMO A;  1KK7 Z;  3SJS A;  3ZNI A;  1NIW A;  2BL0 B;  1NCZ A;  1DGV A;  1W7I B;  2JT0 A;  3EVV A;  1DF0 A;  3I5H C;  2OTG B;  4MBE A;  1JWD A;  2AUC A;  5AAN A;  2A4J A;  4YI8 A;  1LA0 A;  1OMR A;  2LP2 A;  2L0P A;  4GGF A;  1SRA A;  1UUS A;  3NXA A;  1OSA A;  2KI6 C;  4NQG A;  2JOJ A;  3BUW B;  5DKQ A;  1CFD A;  5JJG A;  3TDU A;  3CWG A;  3JVT B;  1CMG A;  3O6B A;  1NX0 A;  1TNX A;  2K7C A;  3EKJ A;  1H4B A;  3DVE A;  2HQ8 A;  1GQM A;  4YGD B;  3IQO A;  2TN4 A;  2M8U A;  3H4S E;  1F4O A;  2NCP A;  4GAO A;  1OQP A;  1TNQ A;  1DJW A;  1SL8 A;  4MRY A;  1G33 A;  2BE6 A;  2KOT A;  4D1E A;  1SYM A;  1WRL A;  1TN4 A;  4ZCU A;  1J1D A;  1FBV A;  4DUQ A;  1L7Z A;  2JZI A;  3KO0 A;  1OE9 B;  2PSR A;  5I2L A;  3NSL A;  2LCP A;  5CSJ A;  3TUY C;  2LLT A;  5HLO A;  1RTP 1;  1DTL A;  2COL B;  1A75 B;  1MR8 A;  2K61 A;  2KAV A;  1G4Y R;  4I5L B;  1IJ6 A;  2LP3 A;  2LUX A;  1MQ1 A;  3CR2 A;  4FTG A;  1OMV A;  3BUM B;  1YUR A;  2AAO A;  4I5N B;  2KBM A;  1BF5 A;  1UWO A;  3OB1 B;  2BCA A;  2KFF A;  5HYD A;  1FW4 A;  2L51 A;  5AEQ A;  1S1E A;  4YGE B;  3I5G C;  2G9B A;  3I5I C;  1K96 A;  3I5F C;  2JPT A;  1GGW A;  4DIR A;  3KF9 A;  1S6C A;  3D0Y B;  1KWO B;  1FI6 A;  3K21 A;  1CFC A;  1NUB A;  2CTN A;  1AJ5 A;  2PVB A;  4QJ3 B;  1K9U A;  1M45 A;  2JT3 A;  2OTG C;  1YX8 A;  1HQV A;  3BUX B;  3A8R A;  1FPW A;  5KTY A;  2I2R E;  4L9M A;  3KPX A;  1QIW A;  1VRK A;  4YGC B;  2EHB A;  2JQ6 A;  4WRI A;  3IF7 A;  4MRX A;  4P2Y B;  3I5H B;  3O2P A;  3KHE A;  1SCM B;  1NX2 A;  1YUU A;  1D1O A;  1B4C A;  5GQQ C;  1WDC C;  1OZS A;  2Y1M A;  3JVT C;  4Q04 A;  1V1G A;  4QJ5 B;  2JC2 A;  3AAK A;  2WCB A;  1J7R A;  1TNP A;  2AMI A;  4NDC A;  1UHJ A;  1LXF C;  2CCM A;  2JWW A;  2KFH A;  1B1G A;  2D8N A;  4WQ2 A;  1OZO A;  2LVV A;  3BUO B;  3GK2 A;  4E68 A;  3JTD B;  1S5G Z;  4QJ4 B;  4PHK A;  4UPG A;  4M2Q A;  3DF0 A;  5IBW A;  3EVR A;  2F3Y A;  4AOM A;  3PFV A;  1CDL A;  1XFX O;  1Q80 A;  1IQ5 A;  4OCI A;  3VRP A;  2SAS A;  1SK6 D;  1B7T Z;  2BBM A;  1WY9 A;  1ZMZ A;  2LMT A;  1C7V A;  3FWC A;  3OX5 A;  4IL1 A;  1QLS A;  2DOQ A;  2MHH A;  1XFZ O;  1QS7 A;  4M2P A;  4HRH A;  4GBA A;  3SG5 A;  3TUY B;  4C0J A;  2OS8 C;  1TIZ A;  3SG6 A;  1OMD A;  1N0Y A;  1BR4 B;  1NCY A;  5KU1 A;  1BR1 B;  5D69 A;  4C0K A;  3QRX A;  4CID A;  1IJ5 A;  2M7L A;  1RWY A;  2E6W A;  3SG4 A;  1IQ3 A;  1BT6 A;  1JF2 A;  4I5J A;  2LUC A;  2NXQ A;  1BLQ A;  1C7W A;  1DF0 B;  1K8U A;  1TNW A;  1TTX A;  2CBL A;  1SR6 B;  2M49 B;  1KWO C;  3C1V A;  2JXC A;  2KFG A;  2LM5 A;  2SCP A;  3SIB A;  1QAS A;  2L5X B;  1YX7 A;  3I5I B;  3I5F B;  1XK4 A;  3BXK A;  1S3P A;  1UHK A;  1GJY A;  1XFU O;  4YRU A;  1K94 A;  2BEC A;  1CB1 A;  2EGD A;  4XJK A;  4MN0 A;  1QVI Z;  2BCB A;  1SCM C;  1KFX S;  4MVF A;  1IKU A;  1J7O A;  2M1U A;  3GOF A;  4CFR A;  1K93 D;  2RGI A;  2Q91 A;  1IWQ A;  1EG3 A;  1JUO A;  1QV0 A;  4GGN A;  2WOR A;  5I2Q A;  4OKH A;  4PHM A;  1QTX A;  1CLM A;  1WDC B;  1PK0 D;  4MZK A;  3RM1 A;  1S36 A;  2PMY A;  2K2A A;  2MA2 A;  3JTD C;  1WLZ A;  3ZWH A;  2L98 A;  2MLF C;  1SKT A;  2LVJ A;  1JFJ A;  2HQW A;  4TNC A;  1X02 A;  2JUL A;  5TNC A;  4HRG A;  4PCW A;  1F8H A;  1SL7 A;  5CSI A;  4A4B A;  1WLM A;  1ZUZ A;  2BCX A;  4C0L A;  3EK7 A;  1CM4 A;  1A29 A;  3O78 A;  1Y6W A;  2PAS A;  5I2O A;  2LVK A;  5K89 A;  1PSB A;  1DT7 B;  4CPV A;  3F45 A;  1F54 A;  1NX1 A;  1SPY A;  2LLU A;  3CS1 A;  2K7B A;  2M7N A;  2KYC A;  1K9K A;  2LAP A;  4BY5 A;  3NSK A;  2H61 C;  2JU0 A;  1DVI A;  1H8B A;  1UHI A;  1JF0 A;  3OX6 A;  1XK4 C;  1M31 A;  1CM1 A;  1S6I A;  2BBN A;  4MEW A;  2OS8 B;  5CPV A;  3OP0 A;  4GNK B;  5CSF A;  1XA5 A;  1SMG A;  1AUI B;  1SR6 C;  3VGO A;  2KAY A;  2ZNE A;  1TCO B;  1DJG A;  1DJY A;  2ZKM X;  4GGF C;  1R2U A;  1ZAC A;  4N5X A;  1SW8 A;  1EJ3 A;  1NPQ A;  1QXP A;  4ICB A;  3WHU B;  1YTZ C;  5HKW A;  5G08 A;  4DS7 A;  1CDP A;  1QLK A;  2KAX A;  1QX7 A;  1KQV A;  4PHN A;  1R6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...