1EH2A

Structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding
molecule keywords EPS15
publication title Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1998-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eh2A00
2EC6C 2K7CA 5CSIA 1L2OC 4OVNF 3BOWA 2K2FA 5CSNA 4PE7A 2O60A 2F8PA 3KF9A 1K93D 2CTNA 3LL8B 1CNPA 2KI4C 2Q91A 1MR8A 1NSHA 2LUXA 2IS9A 2ZNDA 4MBEA 5CSJA 2LVIA 1JSAA 2JWWA 1K9KA 1SR6C 3GK1A 1DMOA 3JTDC 2MRDA 4M2OA 1BG1A 1WLMA 1CTRA 5CSFA 5TNCA 2EHBA 3IF7A 3TS5C 2WCEA 1Y6WA 2KAYA 1DVIA 1BR4B 3JVTC 4ETOA 1PRWA 4XJKA 5BPJA 1F54A 1EG4A 1QX5B 4I5JA 3SIAA 4UPGA 1A75B 2KOTA 3EK8A 4AQJA 5AERA 1YRUB 2JXCA 2MA2A 4PHMA 4QJ5B 2I18A 1UHJA 3CWGA 2LP2A 5D7FA 2LCPA 2WCFA 4QJ4B 1AJ4A 1XA5A 2A4JA 2KBMA 1PALA 1QV1A 3FIAA 3A4UB 2FCEA 2PRUA 3E3RA 1CDMA 5ER5A 2OS8C 2ZN9A 3CR4X 1EXRA 3CR2A 1KFXS 2F2PA 1QASA 3EVVA 4YGEB 3VRRA 2L50A 2BECA 1A29A 3DD4A 2LMTA 2JZIA 2JC2A 1FBVA 3LK0A 2G2BA 1JBAA 2ZNEA 1V1FA 2JT8A 2BKIB 1EL4A 1CFFA 3BUOB 1N2DA 2JTTA 4JQ0D 2CNPA 2EC6B 3WXAA 2F3ZA 1K96A 2E30A 4DUQA 1CFCA 4NDCA 3SJSA 1L7ZA 1SNLA 3H4SE 2Y4QA 2M7NA 1RWYA 3BXKA 4NDDA 1CDPA 1F55A 1FI5A 2KAXA 5HKZA 5HKYA 2KQYA 3WHTB 2K0JA 3I5HC 3NSIA 4E68A 4FQOA 2SASA 1NYAA 1XFVO 2GGMA 2BBNA 2BL0B 1OZSA 2HQWA 1IJ5A 2HQ8A 2KI4B 5GQQC 1XFUO 4FTGA 2OPOA 4PHKA 1MWNA 2F2OA 2LV7A 4PE0A 1AHRA 3VGOA 3JTDB 5KU1A 1YX7A 1CM1A 4HRHA 1QVIZ 1LINA 1NX1A 1UHKA 1CDNA 3BOWB 2JXLA 4N1GA 5HLVA 3NSOA 3TS5B 1Y1XA 1B8CA 1M31A 3I5FC 2NZ0A 3OB1B 4MRXA 3AKBA 2M29A 1TN4A 1YR5A 2KNEA 1XO5A 1DJZA 3PATA 3DVJA 1C7VA 3AAJA 4YI8A 2KBIA 1CLBA 1XK4C 2EGDA 5K89A 1XYDA 2ZRSA 2OS8B 2CXJA 3EVUA 1UP5A 4CFQA 1NCXA 2JTZA 2OTGC 3ZNIA 1JFJA 1WDCB 1H4BA 3RLZA 4F0ZB 1K90D 1OMRA 2LHLA 4OKHA 4XJKB 3VRNA 4C0JA 2KYFA 2KDHA 2ZN8A 1SL8A 4MZLA 5JOLA 1AUIB 1N65A 1RROA 1PK0D 1KCYA 1DJWA 4TNCA 4WQ3A 2JNFA 1B8LA 3BUXB 5IBWA 3ICBA 1SRAA 5ER4X 4USLA 2LC5A 3D0YA 2TN4A 1TNXA 1B47A 1GGWA 1YUTA 2M1UA 1NCZA 1SY9A 1Y1UA 2KGBC 1OMDA 2WC8A 2HPSA 3I5HB 3OX6A 1S26D 3VRQA 2BBMA 5HLOA 4OV2A 4YGDB 4ICBA 1BMOA 4A4CA 3VRPA 2RGIA 4WRIA 3EK4A 1IGVA 1J1EA 1RECA 4WQ2A 3CS1A 4P5OE 2KFHA 4HRGA 1WLZA 1ALWA 1SW8A 2JOJA 3D10A 5PALA 2FOTA 1KK7Y 1B7TZ 1DGVA 2M0RA 2JU0A 1KK7Z 2Y1MA 3QRXA 1NUBA 4CIDA 1DJIA 3PM8A 1CFPA 1JFKA 1JWDA 2K7DA 1OE9B 2PASA 1E8AA 3GK2A 1DJHA 3DVKA 1LKJA 3I5FB 3LCPC 1HQVA 3A8RA 2JT0A 1J7QA 4I5KA 2L98A 1ZOTB 1Q80A 2ZFDA 5F6TA 1QTXA 2WORA 1A03A 4ORBB 2I7AA 5JJGA 3KO0A 1SCMC 1BODA 1GQMA 1SL7A 2ZRTA 1ALVA 1LA3A 2HETA 1UURA 1V1GA 5FYXA 1K9PA 3HX4A 1J1DA 1TIZA 3I5GC 2OTGB 1DJYA 1PULA 2PVBA 3NSKA 1DJXA 4P2YB 4YGCB 5B8IB 4NDBA 2JRFA 2L2EA 2JT3A 2BCXA 1OOJA 2LLTA 3NXAA 1H8BA 1UHIA 3F45A 1MHOA 3KHEA 3BQ3A 4PE1A 5AEQA 2LMUA 1IWQA 1RJVA 1MXLC 1SPYA 4GAOA 3EKJA 1TNPA 3BYAA 1L2OB 4GPLB 1QS7A 2LE9B 4M2QA 4N1FA 5KSZA 2KSPA 2PSRA 1WRLA 1IRJA 2FJUB 2QPTA 1KQMC 1EG3A 4C0LA 4XYNA 1QLSA 1NCYA 1SR6B 3D0YB 1NX3A 1RK9A 1M63B 1PVAA 1QVIY 1XK4A 1DF0A 2JNXA 2LLUA 1YRTB 2M3WA 2WOSA 2Y5IA 4MEWA 4ZCUA 3BUNB 1OZOA 1QX7A 4L9MA 4JPZB 2LVKA 4GGNA 4MZKA 2NCOA 2KFFA 3JVTB 1J55A 2M9GA 1CLMA 1NWDA 1ODBA 2F33A 3I5IC 2MBXA 1IQ3A 1GGZA 4ORCB 4PCWA 2K8MB 1F4QA 4ORAB 1MQ1A 1Y0VH 4YI9A 1SCMB 3LLEA 1YURA 4I5NB 4QJ3B 1IQ5A 1TNQA 2KHNA 1TNWA 4PHNA 4BY5A 1IG5A 2LVJA 1KQVA 1K8UA 2K2AA 4DS7A 3FS7A 1QXPA 1QLKA 2LANA 3TDIA 2NCPA 5G08A 4R1EA 1ZUZA 1BJFA 2BCAA 1JF2A 1M45A 5CPVA 1W7JB 3DVEA 4MSPA 4D1EA 2L5XB 3FWCA 4PHJA 3GOFA 2MHHA 1SYMA 4CLNA 2AMIA 1KSOA 2WCBA 1BR1B 1BLQA 1CMGA 5AXIA 1QJTA 2JPTA 5I8NA 2PALA 1U5IA 3PN7C 1F70A 3IQOA 1CDLA 1KFUL 5HYDA 3SG7A 1S6CA 1NP8A 1UHHA 1DGUA 2P6BB 2AAOA 3SG5A 1K94A 1EJ3A 2GV5A 1CFDA 1OSAA 1ZACA 1DJGA 2L4IA 2QACA 2LLSA 3NSLA 4U8DA 1KWOC 2LNKA 1J7PA 1AP4A 4GFTA 1W7IB 2F3YA 3GK4X 4GGFA 4PALA 2K7BA 2M97A 2NXQA 1YVHA 3SIBA 3CLNA 1DT7B 1J7OA 1F8HA 3DVMA 5KTYA 1B8RA 1QATA 1K95A 4YBHB 2HF5A 1B7TY 1F4OA 1UWOA 1CB1A 4CFRA 4PDZA 3OB2B 1QV0A 2MJWB 2BE6A 1LA0A 1XFYO 1YVLA 3TDUA 2O5GA 1TTXA 1ZMZA 1KFXL 2I94A 3DF0A 3PFVA 3PALA 3RM1A 3I5IB 1UHNA 2NLNA 5I2OA 1LVCD 2WNDA 1SMGA 1XFZO 4MLWA 4DIRA 2BL0C 1D1OA 1KK8C 2LUCA 4YGBB 3TUYC 1QIVA 4N5XA 1CLLA 1LXFC 4A4BA 4GGFC 3IQQA 4PE4A 1RTP1 2MLEC 1DF0B 3SG3A 1RFJA 1KFUS 1PSBA 2DOQA 3SG6A 2CT9A 5AFPA 4IL1A 1IH0A 1SL9A 2M7LA 2KYCA 3SG2A 3OX5A 4GBAA 3WNXB 1BF5A 1OMVA 2CCMA 1NIWA 1BT6A 1SKTA 2Q4UA 2MAZA 1A2XA 1B4CA 2LP3A 2KGRA 1S6JA 4OCIA 2BKHB 3C1VA 1OQPA 1A4PA 1HT9A 4JWQA 1AJ5A 1QIWA 1CKKA 3KEVA 4CPVA 2L51A 3O6BA 5I2LA 5DKRA 3O2PA 3PN7B 4M2PA 3ZWHA 2LM5A 4ZCVA 1TRFA 1GJYA 4AQIA 1MXEA 3EVRA 3SG4A 1WDCC 1AVSA 1R2UA 3EKHA 4YGAA 3PSRA 1AK8A 1M39A 3M0WA 2FCDA 2KFGA 3PLFB 3MSEB 4OR9B 2LAPA 1B1GA 1MUXA 1KWOB 3CR5X 1PVBA 3BUWB 5D69A 1SBJA 1DTLA 3BUMB 1B9AA 1U5IB 3CZTX 2JULA 1J7RA 1WY9A 3KPXA 2E6WA 5J3XA 3FWBA 1M46A 2ISDA 2JQ6A 4NQGA 2KI6C 5I2QA 2GGZA 2M1KB 1YUUA 1K2HA 4AOMA 3O78A 2AUCA 1R6PA 1SK6D 5AANA 4C0KA 1A75A 1F71A 2KQ6A 2LMVA 3TZ1A 2G9BA 1KK8B 1JC2A 1IJ6A 1G4YR 3TUYB 4DCKA 3CGAA 4MRYA 1TCOB 2SCPA 1C07A 2V53A 4MN0A 2COLB 4DRWA 3O4YA 1YTZC 1FPWA 1JUOA 3VROA 1IKUA 1S36A 2H61A 1TCFA 2K7OA 3CTNA 1SCVA 1UUSA 1FF1A 3I5GB 1BU3A 3LK1A 2LVVA 1Y1AA 5DKQA 3TDZA 4GUKA 3DF0B 1S1EA 1YX8A 1JF0A 2CBLA 2LHIA 2L4HA 2B1UA 2BCBA 4Q04A 1BOCA 1CM4A 1XFXO 3OP0A 1FI6A 4MVFA 1C7WA 1KSMA 2I2RE 2KAVA 1EH2A 2MLFC 1G33A 4BY4A 3K21A 1NPQA 2M49B 3HCMA 1X02A 2VRGA 1XVJA 1YUSA 2BE4A 1K9UA 1NX0A 2H2KA 1CMFA 1NX2A 1S5GY 2R2IA 2L0PA 3AAKA 1S6IA 2H61C 1XFWO 2ZKMX 1S5GZ 4HREE 4GNKB 4HSZA 1QX2A 1TOPA 3OHMB 2D8NA 1N0YA 2M8UA 3AKAA 4MZJA 2PMYA 1FW4A 2KI6D 1WRZA 2Y1NA 5DKNA 1VRKA 4YRUA 5HKWA 1KQMB 4I5LB 1G8IA 1ZFSA 1MF8B 1PSRA 1S3PA 1WRKA 3EK7A 3WHUB 2K61A
chains in the Genus database with same CATH superfamily
2EC6C 2K7CA 5CSIA 3L4LA 1L2OC 2P70A 4OVNF 3BOWA 2K2FA 5CSNA 4PE7A 2O60A 2F8PA 3KF9A 2H8VA 1K93D 2QEVA 2CTNA 3LL8B 1CNPA 2KI4C 2Q91A 1MR8A 1NSHA 2LUXA 2IS9A 2ZNDA 4MBEA 5CSJA 2LVIA 1QWVA 2JWWA 1JSAA 1K9KA 1SR6C 3GK1A 1DMOA 3FE8A 3L47A 3JTDC 2MRDA 4M2OA 1BG1A 1WLMA 1CTRA 5CSFA 5TNCA 2EHBA 3IF7A 3TS5C 2WCEA 1Y6WA 2KAYA 3R72A 1DVIA 1BR4B 3JVTC 4ETOA 1PRWA 4XJKA 5BPJA 1F54A 1EG4A 1QX5B 4I5JA 3SIAA 4UPGA 1A75B 2KOTA 3EK8A 4AQJA 5AERA 1TWOA 1YRUB 2JXCA 2MA2A 4PHMA 4QJ5B 2I18A 1UHJA 3CWGA 2LP2A 5D7FA 2LCPA 2WCFA 4QJ4B 1AJ4A 1XA5A 2A4JA 2KBMA 1PALA 3B7AA 1QV1A 3S0FA 3FIAA 3A4UB 2FCEA 2PRUA 3E3RA 1CDMA 5ER5A 2OS8C 2ZN9A 3CR4X 1EXRA 3CR2A 1KFXS 2F2PA 1QASA 3EVVA 4YGEB 3VRRA 2L50A 2BECA 4PT1A 1A29A 1OW4A 3DD4A 2LMTA 2JZIA 2JC2A 1FBVA 3LK0A 2G2BA 3SS3A 1JBAA 2ZNEA 1V1FA 2JT8A 1EL4A 2BKIB 1CFFA 3BUOB 1N2DA 2JTTA 4JQ0D 2CNPA 1OOHA 2PYQA 2EC6B 3WXAA 2F3ZA 1K96A 2E30A 4DUQA 1CFCA 4NDCA 3SJSA 1L7ZA 1SNLA 3H4SE 2Y4QA 2M7NA 1RWYA 3BXKA 3CABA 1CDPA 4NDDA 1F55A 1FI5A 2KAXA 5HKZA 5HKYA 2KQYA 3WHTB 2K0JA 3CDNA 3I5HC 3SS4A 3FE9A 3NHIA 3NSIA 4E68A 4FQOA 2SASA 1NYAA 1XFVO 2KPHA 2GGMA 2FJYA 2BBNA 2BL0B 1OZSA 2HQWA 1IJ5A 2HQ8A 2KI4B 5GQQC 1XFUO 4FTGA 2L2CA 2OPOA 2QEOA 4PHKA 1MWNA 2F2OA 2LV7A 4PE0A 1AHRA 3VGOA 3JTDB 5KU1A 1C3YA 1YX7A 1CM1A 4HRHA 1QVIZ 1LINA 1NX1A 1UHKA 1CDNA 3BOWB 2JXLA 4N1GA 5HLVA 1XFRA 3NSOA 3TS5B 1Y1XA 1B8CA 1M31A 3I5FC 2NZ0A 3OB1B 4MRXA 3AKBA 2M29A 3K1EA 1TN4A 1W9ZA 3R1OA 1YR5A 2BAPA 2KNEA 1XO5A 1DJZA 2BNXA 3DVJA 3PATA 3AAJA 4YI8A 1C7VA 4OZDA 1DEKA 2KBIA 3D78A 3EG5B 1CLBA 1XK4C 2EGDA 5K89A 2WCMA 1XYDA 2ZRSA 2OS8B 2CXJA 3EVUA 1UP5A 4CFQA 3UNWA 1NCXA 2JTZA 2OTGC 3ZNIA 1JFJA 1WDCB 3D73A 3RLZA 4F0ZB 1H4BA 1K90D 1OMRA 2LHLA 4OKHA 4XJKB 3VRNA 3S0BA 4C0JA 2KYFA 2KDHA 2ZN8A 1SL8A 4MZLA 5JOLA 1AUIB 1N65A 1RROA 1PK0D 1KCYA 1DJWA 4TNCA 4WQ3A 2JNFA 1B8LA 3BUXB 5IBWA 3ICBA 1SRAA 4KYNA 5ER4X 4USLA 2LC5A 3D0YA 2TN4A 2KLDA 1TNXA 1B47A 1GGWA 1YUTA 2M1UA 1NCZA 1SY9A 1Y1UA 2KGBC 1LS8A 1T14A 1OMDA 2WC8A 2HPSA 3I5HB 3OX6A 1S26D 3VRQA 3CZ2A 2BBMA 4INXA 5HLOA 4OV2A 2WCLA 4YGDB 4ICBA 1BMOA 4A4CA 3VRPA 2RGIA 4WRIA 3EK4A 1IGVA 1J1EA 1RECA 4WQ2A 2QEHA 3B86A 3CS1A 2KFHA 4HRGA 4P5OE 1WLZA 5DICA 1ALWA 1SW8A 2JOJA 3D10A 5PALA 2FOTA 1KK7Y 1B7TZ 3O4XA 1DGVA 2M0RA 2JU0A 1KK7Z 2Y1MA 3QRXA 1NUBA 4CIDA 1DJIA 3PM8A 1DC1A 1JFKA 1CFPA 2ERBA 2QDIA 2K7DA 1JWDA 1OE9B 2PASA 1E8AA 3GK2A 1DJHA 3DVKA 1LKJA 3I5FB 3LCPC 1HQVA 3A8RA 2JT0A 1J7QA 4I5KA 2L98A 1ZOTB 1Q80A 2ZFDA 5F6TA 1QTXA 2WORA 1A03A 3R1VA 4ORBB 2I7AA 5JJGA 3KO0A 1SCMC 1BODA 1GQMA 1SL7A 2ZRTA 1ALVA 1IIOA 1LA3A 2HETA 1UURA 1V1GA 5FYXA 1K9PA 3HX4A 1J1DA 1TIZA 3BFBA 3I5GC 2OTGB 5D3OA 1DJYA 1PULA 2PVBA 3NSKA 1DJXA 3V2LA 4P2YB 4YGCB 5B8IB 4NDBA 1C3ZA 2JRFA 2L2EA 2JT3A 2BCXA 3NGVA 1OOJA 3BFAA 2LLTA 3NXAA 1H8BA 1UHIA 2KLEA 3F45A 1MHOA 3KHEA 3BQ3A 4PE1A 5AEQA 2LMUA 1IWQA 1RJVA 1MXLC 1SPYA 4GAOA 3EKJA 4JD9A 1TNPA 3UO9A 3BYAA 1L2OB 3DYEA 2PQLA 4GPLB 1QS7A 2LE9B 4M2QA 4N1FA 3BFHA 3D75A 5KSZA 2WCJA 2KSPA 2PSRA 3R1PA 1WRLA 1IRJA 3DY9A 3OBVA 2FJUB 2QPTA 1KQMC 1EG3A 4C0LA 4XYNA 2WC6A 1QLSA 1NCYA 4F7FA 1SR6B 3D0YB 1NX3A 1RK9A 1M63B 1PVAA 1QVIY 1XK4A 1DF0A 2JNXA 2LLUA 1YRTB 2M3WA 2WOSA 2Y5IA 3B88A 4ZCUA 3S0GA 3BUNB 1OZOA 1QX7A 4L9MA 4JPZB 2LVKA 4GGNA 4MZKA 3SS5A 2NCOA 2KFFA 3JVTB 1J55A 3S0DA 2M9GA 1CLMA 1NWDA 1ODBA 2F33A 3I5IC 2MBXA 2WCHA 1IQ3A 5I94A 1GGZA 4ORCB 4PCWA 2K8MB 3DXLA 1F4QA 4ORAB 1MQ1A 1Y0VH 4YI9A 3D76A 5HL1A 1SCMB 3LLEA 1YURA 4I5NB 5FI7A 4QJ3B 1IQ5A 1TNQA 3B87A 2KHNA 1TNWA 4PHNA 4BY5A 1IG5A 2LVJA 3S0EA 1KQVA 1K8UA 2K2AA 4DS7A 3FS7A 1QXPA 1QLKA 2LANA 3TDIA 2NCPA 2K60A 5G08A 4R1EA 1ZUZA 1BJFA 2BCAA 2WC5A 1JF2A 1M45A 3D74A 5CPVA 1W7JB 3DVEA 4MSPA 4D1EA 2L5XB 1DT7B 3FWCA 4PHJA 3GOFA 2MHHA 1SYMA 4CLNA 2AMIA 1KSOA 2WCBA 1BR1B 1BLQA 1CMGA 5AXIA 1QJTA 2JPTA 5I8NA 2PALA 1U5IA 3CZ1A 3PN7C 1F70A 3IQOA 1CDLA 1KFUL 5HYDA 3SG7A 1S6CA 1NP8A 1UHHA 1DGUA 5FI6A 2P6BB 2AAOA 5FI2A 3SG5A 1K94A 1EJ3A 2GV5A 1CFDA 1OSAA 1ZACA 1DJGA 3IVTA 2L4IA 2QACA 2LLSA 3NSLA 4U8DA 1KWOC 2LNKA 1J7PA 1AP4A 4GFTA 1W7IB 2F3YA 3GK4X 1SSEB 4GGFA 2K7BA 2M97A 2NXQA 1YVHA 4PALA 1OOIX 3CLNA 3SIBA 1F8HA 3DVMA 1DQEA 1B8RA 1QATA 1K95A 4YBHB 2HF5A 1B7TY 5KTYA 1F4OA 1UWOA 1CB1A 4CFRA 3OGNA 4PDZA 3OB2B 1QV0A 2MJWB 2BE6A 1LA0A 1XFYO 1YVLA 3TDUA 2O5GA 1TTXA 1ZMZA 1KFXL 2I94A 3DF0A 3PFVA 3PALA 3RM1A 3I5IB 1UHNA 2NLNA 5I2OA 1LVCD 2WNDA 1SMGA 1XFZO 4MLWA 4DIRA 2BL0C 2YGUA 1KK8C 1D1OA 2LUCA 4YGBB 3TUYC 1QIVA 4N5XA 1CLLA 1LXFC 4A4BA 4GGFC 3IQQA 4PE4A 1RTP1 2MLEC 1DF0B 3SG3A 1RFJA 1Z2CB 1KFUS 1PSBA 2DOQA 3SG6A 2CT9A 5AFPA 4IL1A 1IH0A 1SL9A 2M7LA 2KYCA 3SG2A 2WCKA 3OX5A 4GBAA 3WNXB 1BF5A 1OMVA 2CCMA 1NIWA 1BT6A 1SKTA 2Q4UA 2MAZA 1A2XA 1B4CA 2LP3A 1TUJA 2KGRA 1S6JA 2P71A 4FQTA 4IJ7A 4OCIA 2BKHB 3C1VA 1OQPA 1A4PA 1HT9A 3B6XA 4JWQA 1AJ5A 1QIWA 3PJIA 1CKKA 3KEVA 3CZ0A 4CPVA 2L51A 3O6BA 5I2LA 3VB1A 5DKRA 1ORGA 3O2PA 3PN7B 4M2PA 3ZWHA 2LM5A 4ZCVA 1TRFA 1GJYA 4AQIA 1GM0A 1MXEA 3EVRA 3SG4A 1TUZA 1WDCC 1AVSA 1R2UA 3EKHA 4YGAA 3PSRA 1AK8A 1M39A 3M0WA 2FCDA 2KFGA 3PLFB 3MSEB 2GTEA 3D77A 4OR9B 2LAPA 1B1GA 1MUXA 1J7OA 1KWOB 3CR5X 1PVBA 3BUWB 5D69A 1SBJA 1DTLA 3BUMB 1B9AA 3QMEA 1U5IB 3CZTX 2JULA 1J7RA 1WY9A 3KPXA 2E6WA 5J3XA 3FWBA 1M46A 2ISDA 2JQ6A 4NQGA 2KI6C 5I2QA 2GGZA 2M1KB 1YUUA 3BJHA 3Q8IA 1K2HA 4AOMA 3O78A 2AUCA 1R6PA 1SK6D 5AANA 4C0KA 1A75A 1F71A 2KQ6A 2LMVA 3TZ1A 2G9BA 1KK8B 1JC2A 1IJ6A 3CYZA 1G4YR 1OOGA 3TUYB 4DCKA 3CGAA 4MRYA 1TCOB 2SCPA 4MEWA 2V53A 4MN0A 2COLB 1OOFA 1C07A 4DRWA 3O4YA 1YTZC 1FPWA 1JUOA 3VROA 1IKUA 3FE6A 1S36A 2H61A 1TCFA 2K7OA 3CTNA 1SCVA 1UUSA 1FF1A 3I5GB 1BU3A 3LK1A 2LVVA 1Y1AA 5DKQA 3TDZA 4GUKA 3DF0B 3RZSA 3WHUB 1S1EA 1YX8A 1JF0A 2CBLA 2LHIA 3S0AA 2L4HA 2B1UA 2BCBA 4Q04A 1BOCA 1CM4A 1XFXO 3N7HA 3OP0A 1FI6A 4MVFA 1C7WA 1KSMA 2I2RE 2KAVA 5EL2A 3PM2A 1EH2A 2MLFC 2JPOA 1G33A 4BY4A 3K21A 1NPQA 2M49B 1Z4HA 3HCMA 1X02A 2VRGA 1XVJA 1YUSA 1K9UA 1NX0A 2BE4A 2H2KA 1CMFA 1NX2A 1S5GY 2R2IA 2L0PA 3AAKA 1DELA 1S6IA 2H61C 1XFWO 2ZKMX 1S5GZ 4HREE 4GNKB 4INWA 4HSZA 1QX2A 1TOPA 3OHMB 2D8NA 1N0YA 2M8UA 4JKTA 3AKAA 3L4AA 2PMYA 1FW4A 4MZJA 2KI6D 1WRZA 2Y1NA 5DKNA 1VRKA 4YRUA 5HKWA 1KQMB 2L5YA 1P28A 4I5LB 1G8IA 1ZFSA 1MF8B 1PSRA 3DZTA 1S3PA 1WRKA 3EK7A 3NHTA 2QEBA 2K61A
chains in the Genus database with same CATH topology
2EC6C 2K7CA 5CSIA 1L2OC 4OVNF 3BOWA 2K2FA 5CSNA 4PE7A 2O60A 2F8PA 3KF9A 1K93D 2CTNA 3LL8B 1CNPA 2KI4C 2Q91A 1MR8A 1NSHA 2LUXA 2IS9A 2ZNDA 4MBEA 5CSJA 2LVIA 1JSAA 2JWWA 1K9KA 1SR6C 3GK1A 1DMOA 3JTDC 2MRDA 4M2OA 1BG1A 1WLMA 1CTRA 5CSFA 5TNCA 2EHBA 3IF7A 3TS5C 2WCEA 1Y6WA 2KAYA 1DVIA 1BR4B 3JVTC 4ETOA 1PRWA 4XJKA 5BPJA 1F54A 1EG4A 1QX5B 4I5JA 3SIAA 4UPGA 1A75B 2KOTA 3EK8A 4AQJA 5AERA 1YRUB 2JXCA 2MA2A 4PHMA 4QJ5B 2I18A 1UHJA 3CWGA 2LP2A 5D7FA 2LCPA 2WCFA 4QJ4B 1AJ4A 1XA5A 2A4JA 2KBMA 1PALA 1QV1A 3FIAA 3A4UB 2FCEA 2PRUA 3E3RA 1CDMA 5ER5A 2OS8C 2ZN9A 3CR4X 1EXRA 3CR2A 1KFXS 2F2PA 1QASA 3EVVA 4YGEB 3VRRA 2L50A 2BECA 1A29A 3DD4A 2LMTA 2JZIA 2JC2A 1FBVA 3LK0A 2G2BA 1JBAA 2ZNEA 1V1FA 2JT8A 2BKIB 1EL4A 1CFFA 3BUOB 1N2DA 2JTTA 4JQ0D 2CNPA 2EC6B 3WXAA 2F3ZA 1K96A 2E30A 4DUQA 1CFCA 4NDCA 3SJSA 1L7ZA 1SNLA 3H4SE 2Y4QA 2M7NA 1RWYA 3BXKA 4NDDA 1CDPA 1F55A 1FI5A 2KAXA 5HKZA 5HKYA 2KQYA 3WHTB 2K0JA 3I5HC 3NSIA 4E68A 4FQOA 2SASA 1NYAA 1XFVO 2GGMA 2BBNA 2BL0B 1OZSA 2HQWA 1IJ5A 2HQ8A 2KI4B 5GQQC 1XFUO 4FTGA 2OPOA 4PHKA 1MWNA 2F2OA 2LV7A 4PE0A 1AHRA 3VGOA 3JTDB 5KU1A 1YX7A 1CM1A 4HRHA 1QVIZ 1LINA 1NX1A 1UHKA 1CDNA 3BOWB 2JXLA 4N1GA 5HLVA 3NSOA 3TS5B 1Y1XA 1B8CA 1M31A 3I5FC 2NZ0A 3OB1B 4MRXA 3AKBA 2M29A 1TN4A 1YR5A 2KNEA 1XO5A 1DJZA 3PATA 3DVJA 1C7VA 3AAJA 4YI8A 2KBIA 1CLBA 1XK4C 2EGDA 5K89A 1XYDA 2ZRSA 2OS8B 2CXJA 3EVUA 1UP5A 4CFQA 1NCXA 2JTZA 2OTGC 3ZNIA 1JFJA 1WDCB 1H4BA 3RLZA 4F0ZB 1K90D 1OMRA 2LHLA 4OKHA 4XJKB 3VRNA 4C0JA 2KYFA 2KDHA 2ZN8A 1SL8A 4MZLA 5JOLA 1AUIB 1N65A 1RROA 1PK0D 1KCYA 1DJWA 4TNCA 4WQ3A 2JNFA 1B8LA 3BUXB 5IBWA 3ICBA 1SRAA 5ER4X 4USLA 2LC5A 3D0YA 2TN4A 1TNXA 1B47A 1GGWA 1YUTA 2M1UA 1NCZA 1SY9A 1Y1UA 2KGBC 1OMDA 2WC8A 2HPSA 3I5HB 3OX6A 1S26D 3VRQA 2BBMA 5HLOA 4OV2A 4YGDB 4ICBA 1BMOA 4A4CA 3VRPA 2RGIA 4WRIA 3EK4A 1IGVA 1J1EA 1RECA 4WQ2A 3CS1A 4P5OE 2KFHA 4HRGA 1WLZA 1ALWA 1SW8A 2JOJA 3D10A 5PALA 2FOTA 1KK7Y 1B7TZ 1DGVA 2M0RA 2JU0A 1KK7Z 2Y1MA 3QRXA 1NUBA 4CIDA 1DJIA 3PM8A 1CFPA 1JFKA 1JWDA 2K7DA 1OE9B 2PASA 1E8AA 3GK2A 1DJHA 3DVKA 1LKJA 3I5FB 3LCPC 1HQVA 3A8RA 2JT0A 1J7QA 4I5KA 2L98A 1ZOTB 1Q80A 2ZFDA 5F6TA 1QTXA 2WORA 1A03A 4ORBB 2I7AA 5JJGA 3KO0A 1SCMC 1BODA 1GQMA 1SL7A 2ZRTA 1ALVA 1LA3A 2HETA 1UURA 1V1GA 5FYXA 1K9PA 3HX4A 1J1DA 1TIZA 3I5GC 2OTGB 1DJYA 1PULA 2PVBA 3NSKA 1DJXA 4P2YB 4YGCB 5B8IB 4NDBA 2JRFA 2L2EA 2JT3A 2BCXA 1OOJA 2LLTA 3NXAA 1H8BA 1UHIA 3F45A 1MHOA 3KHEA 3BQ3A 4PE1A 5AEQA 2LMUA 1IWQA 1RJVA 1MXLC 1SPYA 4GAOA 3EKJA 1TNPA 3BYAA 1L2OB 4GPLB 1QS7A 2LE9B 4M2QA 4N1FA 5KSZA 2KSPA 2PSRA 1WRLA 1IRJA 2FJUB 2QPTA 1KQMC 1EG3A 4C0LA 4XYNA 1QLSA 1NCYA 1SR6B 3D0YB 1NX3A 1RK9A 1M63B 1PVAA 1QVIY 1XK4A 1DF0A 2JNXA 2LLUA 1YRTB 2M3WA 2WOSA 2Y5IA 4MEWA 4ZCUA 3BUNB 1OZOA 1QX7A 4L9MA 4JPZB 2LVKA 4GGNA 4MZKA 2NCOA 2KFFA 3JVTB 1J55A 2M9GA 1CLMA 1NWDA 1ODBA 2F33A 3I5IC 2MBXA 1IQ3A 1GGZA 4ORCB 4PCWA 2K8MB 1F4QA 4ORAB 1MQ1A 1Y0VH 4YI9A 1SCMB 3LLEA 1YURA 4I5NB 4QJ3B 1IQ5A 1TNQA 2KHNA 1TNWA 4PHNA 4BY5A 1IG5A 2LVJA 1KQVA 1K8UA 2K2AA 4DS7A 3FS7A 1QXPA 1QLKA 2LANA 3TDIA 2NCPA 5G08A 4R1EA 1ZUZA 1BJFA 2BCAA 1JF2A 1M45A 5CPVA 1W7JB 3DVEA 4MSPA 4D1EA 2L5XB 3FWCA 4PHJA 3GOFA 2MHHA 1SYMA 4CLNA 2AMIA 1KSOA 2WCBA 1BR1B 1BLQA 1CMGA 5AXIA 1QJTA 2JPTA 5I8NA 2PALA 1U5IA 3PN7C 1F70A 3IQOA 1CDLA 1KFUL 5HYDA 3SG7A 1S6CA 1NP8A 1UHHA 1DGUA 2P6BB 2AAOA 3SG5A 1K94A 1EJ3A 2GV5A 1CFDA 1OSAA 1ZACA 1DJGA 2L4IA 2QACA 2LLSA 3NSLA 4U8DA 1KWOC 2LNKA 1J7PA 1AP4A 4GFTA 1W7IB 2F3YA 3GK4X 4GGFA 4PALA 2K7BA 2M97A 2NXQA 1YVHA 3SIBA 3CLNA 1DT7B 1J7OA 1F8HA 3DVMA 5KTYA 1B8RA 1QATA 1K95A 4YBHB 2HF5A 1B7TY 1F4OA 1UWOA 1CB1A 4CFRA 4PDZA 3OB2B 1QV0A 2MJWB 2BE6A 1LA0A 1XFYO 1YVLA 3TDUA 2O5GA 1TTXA 1ZMZA 1KFXL 2I94A 3DF0A 3PFVA 3PALA 3RM1A 3I5IB 1UHNA 2NLNA 5I2OA 1LVCD 2WNDA 1SMGA 1XFZO 4MLWA 4DIRA 2BL0C 1D1OA 1KK8C 2LUCA 4YGBB 3TUYC 1QIVA 4N5XA 1CLLA 1LXFC 4A4BA 4GGFC 3IQQA 4PE4A 1RTP1 2MLEC 1DF0B 3SG3A 1RFJA 1KFUS 1PSBA 2DOQA 3SG6A 2CT9A 5AFPA 4IL1A 1IH0A 1SL9A 2M7LA 2KYCA 3SG2A 3OX5A 4GBAA 3WNXB 1BF5A 1OMVA 2CCMA 1NIWA 1BT6A 1SKTA 2Q4UA 2MAZA 1A2XA 1B4CA 2LP3A 2KGRA 1S6JA 4OCIA 2BKHB 3C1VA 1OQPA 1A4PA 1HT9A 4JWQA 1AJ5A 1QIWA 1CKKA 3KEVA 4CPVA 2L51A 3O6BA 5I2LA 5DKRA 3O2PA 3PN7B 4M2PA 3ZWHA 2LM5A 4ZCVA 1TRFA 1GJYA 4AQIA 1MXEA 3EVRA 3SG4A 1WDCC 1AVSA 1R2UA 3EKHA 4YGAA 3PSRA 1AK8A 1M39A 3M0WA 2FCDA 2KFGA 3PLFB 3MSEB 4OR9B 2LAPA 1B1GA 1MUXA 1KWOB 3CR5X 1PVBA 3BUWB 5D69A 1SBJA 1DTLA 3BUMB 1B9AA 1U5IB 3CZTX 2JULA 1J7RA 1WY9A 3KPXA 2E6WA 5J3XA 3FWBA 1M46A 2ISDA 2JQ6A 4NQGA 2KI6C 5I2QA 2GGZA 2M1KB 1YUUA 1K2HA 4AOMA 3O78A 2AUCA 1R6PA 1SK6D 5AANA 4C0KA 1A75A 1F71A 2KQ6A 2LMVA 3TZ1A 2G9BA 1KK8B 1JC2A 1IJ6A 1G4YR 3TUYB 4DCKA 3CGAA 4MRYA 1TCOB 2SCPA 1C07A 2V53A 4MN0A 2COLB 4DRWA 3O4YA 1YTZC 1FPWA 1JUOA 3VROA 1IKUA 1S36A 2H61A 1TCFA 2K7OA 3CTNA 1SCVA 1UUSA 1FF1A 3I5GB 1BU3A 3LK1A 2LVVA 1Y1AA 5DKQA 3TDZA 4GUKA 3DF0B 1S1EA 1YX8A 1JF0A 2CBLA 2LHIA 2L4HA 2B1UA 2BCBA 4Q04A 1BOCA 1CM4A 1XFXO 3OP0A 1FI6A 4MVFA 1C7WA 1KSMA 2I2RE 2KAVA 1EH2A 2MLFC 1G33A 4BY4A 3K21A 1NPQA 2M49B 3HCMA 1X02A 2VRGA 1XVJA 1YUSA 2BE4A 1K9UA 1NX0A 2H2KA 1CMFA 1NX2A 1S5GY 2R2IA 2L0PA 3AAKA 1S6IA 2H61C 1XFWO 2ZKMX 1S5GZ 4HREE 4GNKB 4HSZA 1QX2A 1TOPA 3OHMB 2D8NA 1N0YA 2M8UA 3AKAA 4MZJA 2PMYA 1FW4A 2KI6D 1WRZA 2Y1NA 5DKNA 1VRKA 4YRUA 5HKWA 1KQMB 4I5LB 1G8IA 1ZFSA 1MF8B 1PSRA 1S3PA 1WRKA 3EK7A 3WHUB 2K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  2K7C A;  5CSI A;  1L2O C;  4OVN F;  3BOW A;  2K2F A;  5CSN A;  4PE7 A;  2O60 A;  2F8P A;  3KF9 A;  1K93 D;  2CTN A;  3LL8 B;  1CNP A;  2KI4 C;  2Q91 A;  1MR8 A;  1NSH A;  2LUX A;  2IS9 A;  2ZND A;  4MBE A;  5CSJ A;  2LVI A;  1JSA A;  2JWW A;  1K9K A;  1SR6 C;  3GK1 A;  1DMO A;  3JTD C;  2MRD A;  4M2O A;  1BG1 A;  1WLM A;  1CTR A;  5CSF A;  5TNC A;  2EHB A;  3IF7 A;  3TS5 C;  2WCE A;  1Y6W A;  2KAY A;  1DVI A;  1BR4 B;  3JVT C;  4ETO A;  1PRW A;  4XJK A;  5BPJ A;  1F54 A;  1EG4 A;  1QX5 B;  4I5J A;  3SIA A;  4UPG A;  1A75 B;  2KOT A;  3EK8 A;  4AQJ A;  5AER A;  1YRU B;  2JXC A;  2MA2 A;  4PHM A;  4QJ5 B;  2I18 A;  1UHJ A;  3CWG A;  2LP2 A;  5D7F A;  2LCP A;  2WCF A;  4QJ4 B;  1AJ4 A;  1XA5 A;  2A4J A;  2KBM A;  1PAL A;  1QV1 A;  3FIA A;  3A4U B;  2FCE A;  2PRU A;  3E3R A;  1CDM A;  5ER5 A;  2OS8 C;  2ZN9 A;  3CR4 X;  1EXR A;  3CR2 A;  1KFX S;  2F2P A;  1QAS A;  3EVV A;  4YGE B;  3VRR A;  2L50 A;  2BEC A;  1A29 A;  3DD4 A;  2LMT A;  2JZI A;  2JC2 A;  1FBV A;  3LK0 A;  2G2B A;  1JBA A;  2ZNE A;  1V1F A;  2JT8 A;  2BKI B;  1EL4 A;  1CFF A;  3BUO B;  1N2D A;  2JTT A;  4JQ0 D;  2CNP A;  2EC6 B;  3WXA A;  2F3Z A;  1K96 A;  2E30 A;  4DUQ A;  1CFC A;  4NDC A;  3SJS A;  1L7Z A;  1SNL A;  3H4S E;  2Y4Q A;  2M7N A;  1RWY A;  3BXK A;  4NDD A;  1CDP A;  1F55 A;  1FI5 A;  2KAX A;  5HKZ A;  5HKY A;  2KQY A;  3WHT B;  2K0J A;  3I5H C;  3NSI A;  4E68 A;  4FQO A;  2SAS A;  1NYA A;  1XFV O;  2GGM A;  2BBN A;  2BL0 B;  1OZS A;  2HQW A;  1IJ5 A;  2HQ8 A;  2KI4 B;  5GQQ C;  1XFU O;  4FTG A;  2OPO A;  4PHK A;  1MWN A;  2F2O A;  2LV7 A;  4PE0 A;  1AHR A;  3VGO A;  3JTD B;  5KU1 A;  1YX7 A;  1CM1 A;  4HRH A;  1QVI Z;  1LIN A;  1NX1 A;  1UHK A;  1CDN A;  3BOW B;  2JXL A;  4N1G A;  5HLV A;  3NSO A;  3TS5 B;  1Y1X A;  1B8C A;  1M31 A;  3I5F C;  2NZ0 A;  3OB1 B;  4MRX A;  3AKB A;  2M29 A;  1TN4 A;  1YR5 A;  2KNE A;  1XO5 A;  1DJZ A;  3PAT A;  3DVJ A;  1C7V A;  3AAJ A;  4YI8 A;  2KBI A;  1CLB A;  1XK4 C;  2EGD A;  5K89 A;  1XYD A;  2ZRS A;  2OS8 B;  2CXJ A;  3EVU A;  1UP5 A;  4CFQ A;  1NCX A;  2JTZ A;  2OTG C;  3ZNI A;  1JFJ A;  1WDC B;  1H4B A;  3RLZ A;  4F0Z B;  1K90 D;  1OMR A;  2LHL A;  4OKH A;  4XJK B;  3VRN A;  4C0J A;  2KYF A;  2KDH A;  2ZN8 A;  1SL8 A;  4MZL A;  5JOL A;  1AUI B;  1N65 A;  1RRO A;  1PK0 D;  1KCY A;  1DJW A;  4TNC A;  4WQ3 A;  2JNF A;  1B8L A;  3BUX B;  5IBW A;  3ICB A;  1SRA A;  5ER4 X;  4USL A;  2LC5 A;  3D0Y A;  2TN4 A;  1TNX A;  1B47 A;  1GGW A;  1YUT A;  2M1U A;  1NCZ A;  1SY9 A;  1Y1U A;  2KGB C;  1OMD A;  2WC8 A;  2HPS A;  3I5H B;  3OX6 A;  1S26 D;  3VRQ A;  2BBM A;  5HLO A;  4OV2 A;  4YGD B;  4ICB A;  1BMO A;  4A4C A;  3VRP A;  2RGI A;  4WRI A;  3EK4 A;  1IGV A;  1J1E A;  1REC A;  4WQ2 A;  3CS1 A;  4P5O E;  2KFH A;  4HRG A;  1WLZ A;  1ALW A;  1SW8 A;  2JOJ A;  3D10 A;  5PAL A;  2FOT A;  1KK7 Y;  1B7T Z;  1DGV A;  2M0R A;  2JU0 A;  1KK7 Z;  2Y1M A;  3QRX A;  1NUB A;  4CID A;  1DJI A;  3PM8 A;  1CFP A;  1JFK A;  1JWD A;  2K7D A;  1OE9 B;  2PAS A;  1E8A A;  3GK2 A;  1DJH A;  3DVK A;  1LKJ A;  3I5F B;  3LCP C;  1HQV A;  3A8R A;  2JT0 A;  1J7Q A;  4I5K A;  2L98 A;  1ZOT B;  1Q80 A;  2ZFD A;  5F6T A;  1QTX A;  2WOR A;  1A03 A;  4ORB B;  2I7A A;  5JJG A;  3KO0 A;  1SCM C;  1BOD A;  1GQM A;  1SL7 A;  2ZRT A;  1ALV A;  1LA3 A;  2HET A;  1UUR A;  1V1G A;  5FYX A;  1K9P A;  3HX4 A;  1J1D A;  1TIZ A;  3I5G C;  2OTG B;  1DJY A;  1PUL A;  2PVB A;  3NSK A;  1DJX A;  4P2Y B;  4YGC B;  5B8I B;  4NDB A;  2JRF A;  2L2E A;  2JT3 A;  2BCX A;  1OOJ A;  2LLT A;  3NXA A;  1H8B A;  1UHI A;  3F45 A;  1MHO A;  3KHE A;  3BQ3 A;  4PE1 A;  5AEQ A;  2LMU A;  1IWQ A;  1RJV A;  1MXL C;  1SPY A;  4GAO A;  3EKJ A;  1TNP A;  3BYA A;  1L2O B;  4GPL B;  1QS7 A;  2LE9 B;  4M2Q A;  4N1F A;  5KSZ A;  2KSP A;  2PSR A;  1WRL A;  1IRJ A;  2FJU B;  2QPT A;  1KQM C;  1EG3 A;  4C0L A;  4XYN A;  1QLS A;  1NCY A;  1SR6 B;  3D0Y B;  1NX3 A;  1RK9 A;  1M63 B;  1PVA A;  1QVI Y;  1XK4 A;  1DF0 A;  2JNX A;  2LLU A;  1YRT B;  2M3W A;  2WOS A;  2Y5I A;  4MEW A;  4ZCU A;  3BUN B;  1OZO A;  1QX7 A;  4L9M A;  4JPZ B;  2LVK A;  4GGN A;  4MZK A;  2NCO A;  2KFF A;  3JVT B;  1J55 A;  2M9G A;  1CLM A;  1NWD A;  1ODB A;  2F33 A;  3I5I C;  2MBX A;  1IQ3 A;  1GGZ A;  4ORC B;  4PCW A;  2K8M B;  1F4Q A;  4ORA B;  1MQ1 A;  1Y0V H;  4YI9 A;  1SCM B;  3LLE A;  1YUR A;  4I5N B;  4QJ3 B;  1IQ5 A;  1TNQ A;  2KHN A;  1TNW A;  4PHN A;  4BY5 A;  1IG5 A;  2LVJ A;  1KQV A;  1K8U A;  2K2A A;  4DS7 A;  3FS7 A;  1QXP A;  1QLK A;  2LAN A;  3TDI A;  2NCP A;  5G08 A;  4R1E A;  1ZUZ A;  1BJF A;  2BCA A;  1JF2 A;  1M45 A;  5CPV A;  1W7J B;  3DVE A;  4MSP A;  4D1E A;  2L5X B;  3FWC A;  4PHJ A;  3GOF A;  2MHH A;  1SYM A;  4CLN A;  2AMI A;  1KSO A;  2WCB A;  1BR1 B;  1BLQ A;  1CMG A;  5AXI A;  1QJT A;  2JPT A;  5I8N A;  2PAL A;  1U5I A;  3PN7 C;  1F70 A;  3IQO A;  1CDL A;  1KFU L;  5HYD A;  3SG7 A;  1S6C A;  1NP8 A;  1UHH A;  1DGU A;  2P6B B;  2AAO A;  3SG5 A;  1K94 A;  1EJ3 A;  2GV5 A;  1CFD A;  1OSA A;  1ZAC A;  1DJG A;  2L4I A;  2QAC A;  2LLS A;  3NSL A;  4U8D A;  1KWO C;  2LNK A;  1J7P A;  1AP4 A;  4GFT A;  1W7I B;  2F3Y A;  3GK4 X;  4GGF A;  4PAL A;  2K7B A;  2M97 A;  2NXQ A;  1YVH A;  3SIB A;  3CLN A;  1DT7 B;  1J7O A;  1F8H A;  3DVM A;  5KTY A;  1B8R A;  1QAT A;  1K95 A;  4YBH B;  2HF5 A;  1B7T Y;  1F4O A;  1UWO A;  1CB1 A;  4CFR A;  4PDZ A;  3OB2 B;  1QV0 A;  2MJW B;  2BE6 A;  1LA0 A;  1XFY O;  1YVL A;  3TDU A;  2O5G A;  1TTX A;  1ZMZ A;  1KFX L;  2I94 A;  3DF0 A;  3PFV A;  3PAL A;  3RM1 A;  3I5I B;  1UHN A;  2NLN A;  5I2O A;  1LVC D;  2WND A;  1SMG A;  1XFZ O;  4MLW A;  4DIR A;  2BL0 C;  1D1O A;  1KK8 C;  2LUC A;  4YGB B;  3TUY C;  1QIV A;  4N5X A;  1CLL A;  1LXF C;  4A4B A;  4GGF C;  3IQQ A;  4PE4 A;  1RTP 1;  2MLE C;  1DF0 B;  3SG3 A;  1RFJ A;  1KFU S;  1PSB A;  2DOQ A;  3SG6 A;  2CT9 A;  5AFP A;  4IL1 A;  1IH0 A;  1SL9 A;  2M7L A;  2KYC A;  3SG2 A;  3OX5 A;  4GBA A;  3WNX B;  1BF5 A;  1OMV A;  2CCM A;  1NIW A;  1BT6 A;  1SKT A;  2Q4U A;  2MAZ A;  1A2X A;  1B4C A;  2LP3 A;  2KGR A;  1S6J A;  4OCI A;  2BKH B;  3C1V A;  1OQP A;  1A4P A;  1HT9 A;  4JWQ A;  1AJ5 A;  1QIW A;  1CKK A;  3KEV A;  4CPV A;  2L51 A;  3O6B A;  5I2L A;  5DKR A;  3O2P A;  3PN7 B;  4M2P A;  3ZWH A;  2LM5 A;  4ZCV A;  1TRF A;  1GJY A;  4AQI A;  1MXE A;  3EVR A;  3SG4 A;  1WDC C;  1AVS A;  1R2U A;  3EKH A;  4YGA A;  3PSR A;  1AK8 A;  1M39 A;  3M0W A;  2FCD A;  2KFG A;  3PLF B;  3MSE B;  4OR9 B;  2LAP A;  1B1G A;  1MUX A;  1KWO B;  3CR5 X;  1PVB A;  3BUW B;  5D69 A;  1SBJ A;  1DTL A;  3BUM B;  1B9A A;  1U5I B;  3CZT X;  2JUL A;  1J7R A;  1WY9 A;  3KPX A;  2E6W A;  5J3X A;  3FWB A;  1M46 A;  2ISD A;  2JQ6 A;  4NQG A;  2KI6 C;  5I2Q A;  2GGZ A;  2M1K B;  1YUU A;  1K2H A;  4AOM A;  3O78 A;  2AUC A;  1R6P A;  1SK6 D;  5AAN A;  4C0K A;  1A75 A;  1F71 A;  2KQ6 A;  2LMV A;  3TZ1 A;  2G9B A;  1KK8 B;  1JC2 A;  1IJ6 A;  1G4Y R;  3TUY B;  4DCK A;  3CGA A;  4MRY A;  1TCO B;  2SCP A;  1C07 A;  2V53 A;  4MN0 A;  2COL B;  4DRW A;  3O4Y A;  1YTZ C;  1FPW A;  1JUO A;  3VRO A;  1IKU A;  1S36 A;  2H61 A;  1TCF A;  2K7O A;  3CTN A;  1SCV A;  1UUS A;  1FF1 A;  3I5G B;  1BU3 A;  3LK1 A;  2LVV A;  1Y1A A;  5DKQ A;  3TDZ A;  4GUK A;  3DF0 B;  1S1E A;  1YX8 A;  1JF0 A;  2CBL A;  2LHI A;  2L4H A;  2B1U A;  2BCB A;  4Q04 A;  1BOC A;  1CM4 A;  1XFX O;  3OP0 A;  1FI6 A;  4MVF A;  1C7W A;  1KSM A;  2I2R E;  2KAV A;  1EH2 A;  2MLF C;  1G33 A;  4BY4 A;  3K21 A;  1NPQ A;  2M49 B;  3HCM A;  1X02 A;  2VRG A;  1XVJ A;  1YUS A;  2BE4 A;  1K9U A;  1NX0 A;  2H2K A;  1CMF A;  1NX2 A;  1S5G Y;  2R2I A;  2L0P A;  3AAK A;  1S6I A;  2H61 C;  1XFW O;  2ZKM X;  1S5G Z;  4HRE E;  4GNK B;  4HSZ A;  1QX2 A;  1TOP A;  3OHM B;  2D8N A;  1N0Y A;  2M8U A;  3AKA A;  4MZJ A;  2PMY A;  1FW4 A;  2KI6 D;  1WRZ A;  2Y1N A;  5DKN A;  1VRK A;  4YRU A;  5HKW A;  1KQM B;  4I5L B;  1G8I A;  1ZFS A;  1MF8 B;  1PSR A;  1S3P A;  1WRK A;  3EK7 A;  3WHU B;  2K61 A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  2K7C A;  5CSI A;  3L4L A;  1L2O C;  2P70 A;  4OVN F;  3BOW A;  2K2F A;  5CSN A;  4PE7 A;  2O60 A;  2F8P A;  3KF9 A;  2H8V A;  1K93 D;  2QEV A;  2CTN A;  3LL8 B;  1CNP A;  2KI4 C;  2Q91 A;  1MR8 A;  1NSH A;  2LUX A;  2IS9 A;  2ZND A;  4MBE A;  5CSJ A;  2LVI A;  1QWV A;  2JWW A;  1JSA A;  1K9K A;  1SR6 C;  3GK1 A;  1DMO A;  3FE8 A;  3L47 A;  3JTD C;  2MRD A;  4M2O A;  1BG1 A;  1WLM A;  1CTR A;  5CSF A;  5TNC A;  2EHB A;  3IF7 A;  3TS5 C;  2WCE A;  1Y6W A;  2KAY A;  3R72 A;  1DVI A;  1BR4 B;  3JVT C;  4ETO A;  1PRW A;  4XJK A;  5BPJ A;  1F54 A;  1EG4 A;  1QX5 B;  4I5J A;  3SIA A;  4UPG A;  1A75 B;  2KOT A;  3EK8 A;  4AQJ A;  5AER A;  1TWO A;  1YRU B;  2JXC A;  2MA2 A;  4PHM A;  4QJ5 B;  2I18 A;  1UHJ A;  3CWG A;  2LP2 A;  5D7F A;  2LCP A;  2WCF A;  4QJ4 B;  1AJ4 A;  1XA5 A;  2A4J A;  2KBM A;  1PAL A;  3B7A A;  1QV1 A;  3S0F A;  3FIA A;  3A4U B;  2FCE A;  2PRU A;  3E3R A;  1CDM A;  5ER5 A;  2OS8 C;  2ZN9 A;  3CR4 X;  1EXR A;  3CR2 A;  1KFX S;  2F2P A;  1QAS A;  3EVV A;  4YGE B;  3VRR A;  2L50 A;  2BEC A;  4PT1 A;  1A29 A;  1OW4 A;  3DD4 A;  2LMT A;  2JZI A;  2JC2 A;  1FBV A;  3LK0 A;  2G2B A;  3SS3 A;  1JBA A;  2ZNE A;  1V1F A;  2JT8 A;  1EL4 A;  2BKI B;  1CFF A;  3BUO B;  1N2D A;  2JTT A;  4JQ0 D;  2CNP A;  1OOH A;  2PYQ A;  2EC6 B;  3WXA A;  2F3Z A;  1K96 A;  2E30 A;  4DUQ A;  1CFC A;  4NDC A;  3SJS A;  1L7Z A;  1SNL A;  3H4S E;  2Y4Q A;  2M7N A;  1RWY A;  3BXK A;  3CAB A;  1CDP A;  4NDD A;  1F55 A;  1FI5 A;  2KAX A;  5HKZ A;  5HKY A;  2KQY A;  3WHT B;  2K0J A;  3CDN A;  3I5H C;  3SS4 A;  3FE9 A;  3NHI A;  3NSI A;  4E68 A;  4FQO A;  2SAS A;  1NYA A;  1XFV O;  2KPH A;  2GGM A;  2FJY A;  2BBN A;  2BL0 B;  1OZS A;  2HQW A;  1IJ5 A;  2HQ8 A;  2KI4 B;  5GQQ C;  1XFU O;  4FTG A;  2L2C A;  2OPO A;  2QEO A;  4PHK A;  1MWN A;  2F2O A;  2LV7 A;  4PE0 A;  1AHR A;  3VGO A;  3JTD B;  5KU1 A;  1C3Y A;  1YX7 A;  1CM1 A;  4HRH A;  1QVI Z;  1LIN A;  1NX1 A;  1UHK A;  1CDN A;  3BOW B;  2JXL A;  4N1G A;  5HLV A;  1XFR A;  3NSO A;  3TS5 B;  1Y1X A;  1B8C A;  1M31 A;  3I5F C;  2NZ0 A;  3OB1 B;  4MRX A;  3AKB A;  2M29 A;  3K1E A;  1TN4 A;  1W9Z A;  3R1O A;  1YR5 A;  2BAP A;  2KNE A;  1XO5 A;  1DJZ A;  2BNX A;  3DVJ A;  3PAT A;  3AAJ A;  4YI8 A;  1C7V A;  4OZD A;  1DEK A;  2KBI A;  3D78 A;  3EG5 B;  1CLB A;  1XK4 C;  2EGD A;  5K89 A;  2WCM A;  1XYD A;  2ZRS A;  2OS8 B;  2CXJ A;  3EVU A;  1UP5 A;  4CFQ A;  3UNW A;  1NCX A;  2JTZ A;  2OTG C;  3ZNI A;  1JFJ A;  1WDC B;  3D73 A;  3RLZ A;  4F0Z B;  1H4B A;  1K90 D;  1OMR A;  2LHL A;  4OKH A;  4XJK B;  3VRN A;  3S0B A;  4C0J A;  2KYF A;  2KDH A;  2ZN8 A;  1SL8 A;  4MZL A;  5JOL A;  1AUI B;  1N65 A;  1RRO A;  1PK0 D;  1KCY A;  1DJW A;  4TNC A;  4WQ3 A;  2JNF A;  1B8L A;  3BUX B;  5IBW A;  3ICB A;  1SRA A;  4KYN A;  5ER4 X;  4USL A;  2LC5 A;  3D0Y A;  2TN4 A;  2KLD A;  1TNX A;  1B47 A;  1GGW A;  1YUT A;  2M1U A;  1NCZ A;  1SY9 A;  1Y1U A;  2KGB C;  1LS8 A;  1T14 A;  1OMD A;  2WC8 A;  2HPS A;  3I5H B;  3OX6 A;  1S26 D;  3VRQ A;  3CZ2 A;  2BBM A;  4INX A;  5HLO A;  4OV2 A;  2WCL A;  4YGD B;  4ICB A;  1BMO A;  4A4C A;  3VRP A;  2RGI A;  4WRI A;  3EK4 A;  1IGV A;  1J1E A;  1REC A;  4WQ2 A;  2QEH A;  3B86 A;  3CS1 A;  2KFH A;  4HRG A;  4P5O E;  1WLZ A;  5DIC A;  1ALW A;  1SW8 A;  2JOJ A;  3D10 A;  5PAL A;  2FOT A;  1KK7 Y;  1B7T Z;  3O4X A;  1DGV A;  2M0R A;  2JU0 A;  1KK7 Z;  2Y1M A;  3QRX A;  1NUB A;  4CID A;  1DJI A;  3PM8 A;  1DC1 A;  1JFK A;  1CFP A;  2ERB A;  2QDI A;  2K7D A;  1JWD A;  1OE9 B;  2PAS A;  1E8A A;  3GK2 A;  1DJH A;  3DVK A;  1LKJ A;  3I5F B;  3LCP C;  1HQV A;  3A8R A;  2JT0 A;  1J7Q A;  4I5K A;  2L98 A;  1ZOT B;  1Q80 A;  2ZFD A;  5F6T A;  1QTX A;  2WOR A;  1A03 A;  3R1V A;  4ORB B;  2I7A A;  5JJG A;  3KO0 A;  1SCM C;  1BOD A;  1GQM A;  1SL7 A;  2ZRT A;  1ALV A;  1IIO A;  1LA3 A;  2HET A;  1UUR A;  1V1G A;  5FYX A;  1K9P A;  3HX4 A;  1J1D A;  1TIZ A;  3BFB A;  3I5G C;  2OTG B;  5D3O A;  1DJY A;  1PUL A;  2PVB A;  3NSK A;  1DJX A;  3V2L A;  4P2Y B;  4YGC B;  5B8I B;  4NDB A;  1C3Z A;  2JRF A;  2L2E A;  2JT3 A;  2BCX A;  3NGV A;  1OOJ A;  3BFA A;  2LLT A;  3NXA A;  1H8B A;  1UHI A;  2KLE A;  3F45 A;  1MHO A;  3KHE A;  3BQ3 A;  4PE1 A;  5AEQ A;  2LMU A;  1IWQ A;  1RJV A;  1MXL C;  1SPY A;  4GAO A;  3EKJ A;  4JD9 A;  1TNP A;  3UO9 A;  3BYA A;  1L2O B;  3DYE A;  2PQL A;  4GPL B;  1QS7 A;  2LE9 B;  4M2Q A;  4N1F A;  3BFH A;  3D75 A;  5KSZ A;  2WCJ A;  2KSP A;  2PSR A;  3R1P A;  1WRL A;  1IRJ A;  3DY9 A;  3OBV A;  2FJU B;  2QPT A;  1KQM C;  1EG3 A;  4C0L A;  4XYN A;  2WC6 A;  1QLS A;  1NCY A;  4F7F A;  1SR6 B;  3D0Y B;  1NX3 A;  1RK9 A;  1M63 B;  1PVA A;  1QVI Y;  1XK4 A;  1DF0 A;  2JNX A;  2LLU A;  1YRT B;  2M3W A;  2WOS A;  2Y5I A;  3B88 A;  4ZCU A;  3S0G A;  3BUN B;  1OZO A;  1QX7 A;  4L9M A;  4JPZ B;  2LVK A;  4GGN A;  4MZK A;  3SS5 A;  2NCO A;  2KFF A;  3JVT B;  1J55 A;  3S0D A;  2M9G A;  1CLM A;  1NWD A;  1ODB A;  2F33 A;  3I5I C;  2MBX A;  2WCH A;  1IQ3 A;  5I94 A;  1GGZ A;  4ORC B;  4PCW A;  2K8M B;  3DXL A;  1F4Q A;  4ORA B;  1MQ1 A;  1Y0V H;  4YI9 A;  3D76 A;  5HL1 A;  1SCM B;  3LLE A;  1YUR A;  4I5N B;  5FI7 A;  4QJ3 B;  1IQ5 A;  1TNQ A;  3B87 A;  2KHN A;  1TNW A;  4PHN A;  4BY5 A;  1IG5 A;  2LVJ A;  3S0E A;  1KQV A;  1K8U A;  2K2A A;  4DS7 A;  3FS7 A;  1QXP A;  1QLK A;  2LAN A;  3TDI A;  2NCP A;  2K60 A;  5G08 A;  4R1E A;  1ZUZ A;  1BJF A;  2BCA A;  2WC5 A;  1JF2 A;  1M45 A;  3D74 A;  5CPV A;  1W7J B;  3DVE A;  4MSP A;  4D1E A;  2L5X B;  1DT7 B;  3FWC A;  4PHJ A;  3GOF A;  2MHH A;  1SYM A;  4CLN A;  2AMI A;  1KSO A;  2WCB A;  1BR1 B;  1BLQ A;  1CMG A;  5AXI A;  1QJT A;  2JPT A;  5I8N A;  2PAL A;  1U5I A;  3CZ1 A;  3PN7 C;  1F70 A;  3IQO A;  1CDL A;  1KFU L;  5HYD A;  3SG7 A;  1S6C A;  1NP8 A;  1UHH A;  1DGU A;  5FI6 A;  2P6B B;  2AAO A;  5FI2 A;  3SG5 A;  1K94 A;  1EJ3 A;  2GV5 A;  1CFD A;  1OSA A;  1ZAC A;  1DJG A;  3IVT A;  2L4I A;  2QAC A;  2LLS A;  3NSL A;  4U8D A;  1KWO C;  2LNK A;  1J7P A;  1AP4 A;  4GFT A;  1W7I B;  2F3Y A;  3GK4 X;  1SSE B;  4GGF A;  2K7B A;  2M97 A;  2NXQ A;  1YVH A;  4PAL A;  1OOI X;  3CLN A;  3SIB A;  1F8H A;  3DVM A;  1DQE A;  1B8R A;  1QAT A;  1K95 A;  4YBH B;  2HF5 A;  1B7T Y;  5KTY A;  1F4O A;  1UWO A;  1CB1 A;  4CFR A;  3OGN A;  4PDZ A;  3OB2 B;  1QV0 A;  2MJW B;  2BE6 A;  1LA0 A;  1XFY O;  1YVL A;  3TDU A;  2O5G A;  1TTX A;  1ZMZ A;  1KFX L;  2I94 A;  3DF0 A;  3PFV A;  3PAL A;  3RM1 A;  3I5I B;  1UHN A;  2NLN A;  5I2O A;  1LVC D;  2WND A;  1SMG A;  1XFZ O;  4MLW A;  4DIR A;  2BL0 C;  2YGU A;  1KK8 C;  1D1O A;  2LUC A;  4YGB B;  3TUY C;  1QIV A;  4N5X A;  1CLL A;  1LXF C;  4A4B A;  4GGF C;  3IQQ A;  4PE4 A;  1RTP 1;  2MLE C;  1DF0 B;  3SG3 A;  1RFJ A;  1Z2C B;  1KFU S;  1PSB A;  2DOQ A;  3SG6 A;  2CT9 A;  5AFP A;  4IL1 A;  1IH0 A;  1SL9 A;  2M7L A;  2KYC A;  3SG2 A;  2WCK A;  3OX5 A;  4GBA A;  3WNX B;  1BF5 A;  1OMV A;  2CCM A;  1NIW A;  1BT6 A;  1SKT A;  2Q4U A;  2MAZ A;  1A2X A;  1B4C A;  2LP3 A;  1TUJ A;  2KGR A;  1S6J A;  2P71 A;  4FQT A;  4IJ7 A;  4OCI A;  2BKH B;  3C1V A;  1OQP A;  1A4P A;  1HT9 A;  3B6X A;  4JWQ A;  1AJ5 A;  1QIW A;  3PJI A;  1CKK A;  3KEV A;  3CZ0 A;  4CPV A;  2L51 A;  3O6B A;  5I2L A;  3VB1 A;  5DKR A;  1ORG A;  3O2P A;  3PN7 B;  4M2P A;  3ZWH A;  2LM5 A;  4ZCV A;  1TRF A;  1GJY A;  4AQI A;  1GM0 A;  1MXE A;  3EVR A;  3SG4 A;  1TUZ A;  1WDC C;  1AVS A;  1R2U A;  3EKH A;  4YGA A;  3PSR A;  1AK8 A;  1M39 A;  3M0W A;  2FCD A;  2KFG A;  3PLF B;  3MSE B;  2GTE A;  3D77 A;  4OR9 B;  2LAP A;  1B1G A;  1MUX A;  1J7O A;  1KWO B;  3CR5 X;  1PVB A;  3BUW B;  5D69 A;  1SBJ A;  1DTL A;  3BUM B;  1B9A A;  3QME A;  1U5I B;  3CZT X;  2JUL A;  1J7R A;  1WY9 A;  3KPX A;  2E6W A;  5J3X A;  3FWB A;  1M46 A;  2ISD A;  2JQ6 A;  4NQG A;  2KI6 C;  5I2Q A;  2GGZ A;  2M1K B;  1YUU A;  3BJH A;  3Q8I A;  1K2H A;  4AOM A;  3O78 A;  2AUC A;  1R6P A;  1SK6 D;  5AAN A;  4C0K A;  1A75 A;  1F71 A;  2KQ6 A;  2LMV A;  3TZ1 A;  2G9B A;  1KK8 B;  1JC2 A;  1IJ6 A;  3CYZ A;  1G4Y R;  1OOG A;  3TUY B;  4DCK A;  3CGA A;  4MRY A;  1TCO B;  2SCP A;  4MEW A;  2V53 A;  4MN0 A;  2COL B;  1OOF A;  1C07 A;  4DRW A;  3O4Y A;  1YTZ C;  1FPW A;  1JUO A;  3VRO A;  1IKU A;  3FE6 A;  1S36 A;  2H61 A;  1TCF A;  2K7O A;  3CTN A;  1SCV A;  1UUS A;  1FF1 A;  3I5G B;  1BU3 A;  3LK1 A;  2LVV A;  1Y1A A;  5DKQ A;  3TDZ A;  4GUK A;  3DF0 B;  3RZS A;  3WHU B;  1S1E A;  1YX8 A;  1JF0 A;  2CBL A;  2LHI A;  3S0A A;  2L4H A;  2B1U A;  2BCB A;  4Q04 A;  1BOC A;  1CM4 A;  1XFX O;  3N7H A;  3OP0 A;  1FI6 A;  4MVF A;  1C7W A;  1KSM A;  2I2R E;  2KAV A;  5EL2 A;  3PM2 A;  1EH2 A;  2MLF C;  2JPO A;  1G33 A;  4BY4 A;  3K21 A;  1NPQ A;  2M49 B;  1Z4H A;  3HCM A;  1X02 A;  2VRG A;  1XVJ A;  1YUS A;  1K9U A;  1NX0 A;  2BE4 A;  2H2K A;  1CMF A;  1NX2 A;  1S5G Y;  2R2I A;  2L0P A;  3AAK A;  1DEL A;  1S6I A;  2H61 C;  1XFW O;  2ZKM X;  1S5G Z;  4HRE E;  4GNK B;  4INW A;  4HSZ A;  1QX2 A;  1TOP A;  3OHM B;  2D8N A;  1N0Y A;  2M8U A;  4JKT A;  3AKA A;  3L4A A;  2PMY A;  1FW4 A;  4MZJ A;  2KI6 D;  1WRZ A;  2Y1N A;  5DKN A;  1VRK A;  4YRU A;  5HKW A;  1KQM B;  2L5Y A;  1P28 A;  4I5L B;  1G8I A;  1ZFS A;  1MF8 B;  1PSR A;  3DZT A;  1S3P A;  1WRK A;  3EK7 A;  3NHT A;  2QEB A;  2K61 A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  2K7C A;  5CSI A;  1L2O C;  4OVN F;  3BOW A;  2K2F A;  5CSN A;  4PE7 A;  2O60 A;  2F8P A;  3KF9 A;  1K93 D;  2CTN A;  3LL8 B;  1CNP A;  2KI4 C;  2Q91 A;  1MR8 A;  1NSH A;  2LUX A;  2IS9 A;  2ZND A;  4MBE A;  5CSJ A;  2LVI A;  1JSA A;  2JWW A;  1K9K A;  1SR6 C;  3GK1 A;  1DMO A;  3JTD C;  2MRD A;  4M2O A;  1BG1 A;  1WLM A;  1CTR A;  5CSF A;  5TNC A;  2EHB A;  3IF7 A;  3TS5 C;  2WCE A;  1Y6W A;  2KAY A;  1DVI A;  1BR4 B;  3JVT C;  4ETO A;  1PRW A;  4XJK A;  5BPJ A;  1F54 A;  1EG4 A;  1QX5 B;  4I5J A;  3SIA A;  4UPG A;  1A75 B;  2KOT A;  3EK8 A;  4AQJ A;  5AER A;  1YRU B;  2JXC A;  2MA2 A;  4PHM A;  4QJ5 B;  2I18 A;  1UHJ A;  3CWG A;  2LP2 A;  5D7F A;  2LCP A;  2WCF A;  4QJ4 B;  1AJ4 A;  1XA5 A;  2A4J A;  2KBM A;  1PAL A;  1QV1 A;  3FIA A;  3A4U B;  2FCE A;  2PRU A;  3E3R A;  1CDM A;  5ER5 A;  2OS8 C;  2ZN9 A;  3CR4 X;  1EXR A;  3CR2 A;  1KFX S;  2F2P A;  1QAS A;  3EVV A;  4YGE B;  3VRR A;  2L50 A;  2BEC A;  1A29 A;  3DD4 A;  2LMT A;  2JZI A;  2JC2 A;  1FBV A;  3LK0 A;  2G2B A;  1JBA A;  2ZNE A;  1V1F A;  2JT8 A;  2BKI B;  1EL4 A;  1CFF A;  3BUO B;  1N2D A;  2JTT A;  4JQ0 D;  2CNP A;  2EC6 B;  3WXA A;  2F3Z A;  1K96 A;  2E30 A;  4DUQ A;  1CFC A;  4NDC A;  3SJS A;  1L7Z A;  1SNL A;  3H4S E;  2Y4Q A;  2M7N A;  1RWY A;  3BXK A;  4NDD A;  1CDP A;  1F55 A;  1FI5 A;  2KAX A;  5HKZ A;  5HKY A;  2KQY A;  3WHT B;  2K0J A;  3I5H C;  3NSI A;  4E68 A;  4FQO A;  2SAS A;  1NYA A;  1XFV O;  2GGM A;  2BBN A;  2BL0 B;  1OZS A;  2HQW A;  1IJ5 A;  2HQ8 A;  2KI4 B;  5GQQ C;  1XFU O;  4FTG A;  2OPO A;  4PHK A;  1MWN A;  2F2O A;  2LV7 A;  4PE0 A;  1AHR A;  3VGO A;  3JTD B;  5KU1 A;  1YX7 A;  1CM1 A;  4HRH A;  1QVI Z;  1LIN A;  1NX1 A;  1UHK A;  1CDN A;  3BOW B;  2JXL A;  4N1G A;  5HLV A;  3NSO A;  3TS5 B;  1Y1X A;  1B8C A;  1M31 A;  3I5F C;  2NZ0 A;  3OB1 B;  4MRX A;  3AKB A;  2M29 A;  1TN4 A;  1YR5 A;  2KNE A;  1XO5 A;  1DJZ A;  3PAT A;  3DVJ A;  1C7V A;  3AAJ A;  4YI8 A;  2KBI A;  1CLB A;  1XK4 C;  2EGD A;  5K89 A;  1XYD A;  2ZRS A;  2OS8 B;  2CXJ A;  3EVU A;  1UP5 A;  4CFQ A;  1NCX A;  2JTZ A;  2OTG C;  3ZNI A;  1JFJ A;  1WDC B;  1H4B A;  3RLZ A;  4F0Z B;  1K90 D;  1OMR A;  2LHL A;  4OKH A;  4XJK B;  3VRN A;  4C0J A;  2KYF A;  2KDH A;  2ZN8 A;  1SL8 A;  4MZL A;  5JOL A;  1AUI B;  1N65 A;  1RRO A;  1PK0 D;  1KCY A;  1DJW A;  4TNC A;  4WQ3 A;  2JNF A;  1B8L A;  3BUX B;  5IBW A;  3ICB A;  1SRA A;  5ER4 X;  4USL A;  2LC5 A;  3D0Y A;  2TN4 A;  1TNX A;  1B47 A;  1GGW A;  1YUT A;  2M1U A;  1NCZ A;  1SY9 A;  1Y1U A;  2KGB C;  1OMD A;  2WC8 A;  2HPS A;  3I5H B;  3OX6 A;  1S26 D;  3VRQ A;  2BBM A;  5HLO A;  4OV2 A;  4YGD B;  4ICB A;  1BMO A;  4A4C A;  3VRP A;  2RGI A;  4WRI A;  3EK4 A;  1IGV A;  1J1E A;  1REC A;  4WQ2 A;  3CS1 A;  4P5O E;  2KFH A;  4HRG A;  1WLZ A;  1ALW A;  1SW8 A;  2JOJ A;  3D10 A;  5PAL A;  2FOT A;  1KK7 Y;  1B7T Z;  1DGV A;  2M0R A;  2JU0 A;  1KK7 Z;  2Y1M A;  3QRX A;  1NUB A;  4CID A;  1DJI A;  3PM8 A;  1CFP A;  1JFK A;  1JWD A;  2K7D A;  1OE9 B;  2PAS A;  1E8A A;  3GK2 A;  1DJH A;  3DVK A;  1LKJ A;  3I5F B;  3LCP C;  1HQV A;  3A8R A;  2JT0 A;  1J7Q A;  4I5K A;  2L98 A;  1ZOT B;  1Q80 A;  2ZFD A;  5F6T A;  1QTX A;  2WOR A;  1A03 A;  4ORB B;  2I7A A;  5JJG A;  3KO0 A;  1SCM C;  1BOD A;  1GQM A;  1SL7 A;  2ZRT A;  1ALV A;  1LA3 A;  2HET A;  1UUR A;  1V1G A;  5FYX A;  1K9P A;  3HX4 A;  1J1D A;  1TIZ A;  3I5G C;  2OTG B;  1DJY A;  1PUL A;  2PVB A;  3NSK A;  1DJX A;  4P2Y B;  4YGC B;  5B8I B;  4NDB A;  2JRF A;  2L2E A;  2JT3 A;  2BCX A;  1OOJ A;  2LLT A;  3NXA A;  1H8B A;  1UHI A;  3F45 A;  1MHO A;  3KHE A;  3BQ3 A;  4PE1 A;  5AEQ A;  2LMU A;  1IWQ A;  1RJV A;  1MXL C;  1SPY A;  4GAO A;  3EKJ A;  1TNP A;  3BYA A;  1L2O B;  4GPL B;  1QS7 A;  2LE9 B;  4M2Q A;  4N1F A;  5KSZ A;  2KSP A;  2PSR A;  1WRL A;  1IRJ A;  2FJU B;  2QPT A;  1KQM C;  1EG3 A;  4C0L A;  4XYN A;  1QLS A;  1NCY A;  1SR6 B;  3D0Y B;  1NX3 A;  1RK9 A;  1M63 B;  1PVA A;  1QVI Y;  1XK4 A;  1DF0 A;  2JNX A;  2LLU A;  1YRT B;  2M3W A;  2WOS A;  2Y5I A;  4MEW A;  4ZCU A;  3BUN B;  1OZO A;  1QX7 A;  4L9M A;  4JPZ B;  2LVK A;  4GGN A;  4MZK A;  2NCO A;  2KFF A;  3JVT B;  1J55 A;  2M9G A;  1CLM A;  1NWD A;  1ODB A;  2F33 A;  3I5I C;  2MBX A;  1IQ3 A;  1GGZ A;  4ORC B;  4PCW A;  2K8M B;  1F4Q A;  4ORA B;  1MQ1 A;  1Y0V H;  4YI9 A;  1SCM B;  3LLE A;  1YUR A;  4I5N B;  4QJ3 B;  1IQ5 A;  1TNQ A;  2KHN A;  1TNW A;  4PHN A;  4BY5 A;  1IG5 A;  2LVJ A;  1KQV A;  1K8U A;  2K2A A;  4DS7 A;  3FS7 A;  1QXP A;  1QLK A;  2LAN A;  3TDI A;  2NCP A;  5G08 A;  4R1E A;  1ZUZ A;  1BJF A;  2BCA A;  1JF2 A;  1M45 A;  5CPV A;  1W7J B;  3DVE A;  4MSP A;  4D1E A;  2L5X B;  3FWC A;  4PHJ A;  3GOF A;  2MHH A;  1SYM A;  4CLN A;  2AMI A;  1KSO A;  2WCB A;  1BR1 B;  1BLQ A;  1CMG A;  5AXI A;  1QJT A;  2JPT A;  5I8N A;  2PAL A;  1U5I A;  3PN7 C;  1F70 A;  3IQO A;  1CDL A;  1KFU L;  5HYD A;  3SG7 A;  1S6C A;  1NP8 A;  1UHH A;  1DGU A;  2P6B B;  2AAO A;  3SG5 A;  1K94 A;  1EJ3 A;  2GV5 A;  1CFD A;  1OSA A;  1ZAC A;  1DJG A;  2L4I A;  2QAC A;  2LLS A;  3NSL A;  4U8D A;  1KWO C;  2LNK A;  1J7P A;  1AP4 A;  4GFT A;  1W7I B;  2F3Y A;  3GK4 X;  4GGF A;  4PAL A;  2K7B A;  2M97 A;  2NXQ A;  1YVH A;  3SIB A;  3CLN A;  1DT7 B;  1J7O A;  1F8H A;  3DVM A;  5KTY A;  1B8R A;  1QAT A;  1K95 A;  4YBH B;  2HF5 A;  1B7T Y;  1F4O A;  1UWO A;  1CB1 A;  4CFR A;  4PDZ A;  3OB2 B;  1QV0 A;  2MJW B;  2BE6 A;  1LA0 A;  1XFY O;  1YVL A;  3TDU A;  2O5G A;  1TTX A;  1ZMZ A;  1KFX L;  2I94 A;  3DF0 A;  3PFV A;  3PAL A;  3RM1 A;  3I5I B;  1UHN A;  2NLN A;  5I2O A;  1LVC D;  2WND A;  1SMG A;  1XFZ O;  4MLW A;  4DIR A;  2BL0 C;  1D1O A;  1KK8 C;  2LUC A;  4YGB B;  3TUY C;  1QIV A;  4N5X A;  1CLL A;  1LXF C;  4A4B A;  4GGF C;  3IQQ A;  4PE4 A;  1RTP 1;  2MLE C;  1DF0 B;  3SG3 A;  1RFJ A;  1KFU S;  1PSB A;  2DOQ A;  3SG6 A;  2CT9 A;  5AFP A;  4IL1 A;  1IH0 A;  1SL9 A;  2M7L A;  2KYC A;  3SG2 A;  3OX5 A;  4GBA A;  3WNX B;  1BF5 A;  1OMV A;  2CCM A;  1NIW A;  1BT6 A;  1SKT A;  2Q4U A;  2MAZ A;  1A2X A;  1B4C A;  2LP3 A;  2KGR A;  1S6J A;  4OCI A;  2BKH B;  3C1V A;  1OQP A;  1A4P A;  1HT9 A;  4JWQ A;  1AJ5 A;  1QIW A;  1CKK A;  3KEV A;  4CPV A;  2L51 A;  3O6B A;  5I2L A;  5DKR A;  3O2P A;  3PN7 B;  4M2P A;  3ZWH A;  2LM5 A;  4ZCV A;  1TRF A;  1GJY A;  4AQI A;  1MXE A;  3EVR A;  3SG4 A;  1WDC C;  1AVS A;  1R2U A;  3EKH A;  4YGA A;  3PSR A;  1AK8 A;  1M39 A;  3M0W A;  2FCD A;  2KFG A;  3PLF B;  3MSE B;  4OR9 B;  2LAP A;  1B1G A;  1MUX A;  1KWO B;  3CR5 X;  1PVB A;  3BUW B;  5D69 A;  1SBJ A;  1DTL A;  3BUM B;  1B9A A;  1U5I B;  3CZT X;  2JUL A;  1J7R A;  1WY9 A;  3KPX A;  2E6W A;  5J3X A;  3FWB A;  1M46 A;  2ISD A;  2JQ6 A;  4NQG A;  2KI6 C;  5I2Q A;  2GGZ A;  2M1K B;  1YUU A;  1K2H A;  4AOM A;  3O78 A;  2AUC A;  1R6P A;  1SK6 D;  5AAN A;  4C0K A;  1A75 A;  1F71 A;  2KQ6 A;  2LMV A;  3TZ1 A;  2G9B A;  1KK8 B;  1JC2 A;  1IJ6 A;  1G4Y R;  3TUY B;  4DCK A;  3CGA A;  4MRY A;  1TCO B;  2SCP A;  1C07 A;  2V53 A;  4MN0 A;  2COL B;  4DRW A;  3O4Y A;  1YTZ C;  1FPW A;  1JUO A;  3VRO A;  1IKU A;  1S36 A;  2H61 A;  1TCF A;  2K7O A;  3CTN A;  1SCV A;  1UUS A;  1FF1 A;  3I5G B;  1BU3 A;  3LK1 A;  2LVV A;  1Y1A A;  5DKQ A;  3TDZ A;  4GUK A;  3DF0 B;  1S1E A;  1YX8 A;  1JF0 A;  2CBL A;  2LHI A;  2L4H A;  2B1U A;  2BCB A;  4Q04 A;  1BOC A;  1CM4 A;  1XFX O;  3OP0 A;  1FI6 A;  4MVF A;  1C7W A;  1KSM A;  2I2R E;  2KAV A;  1EH2 A;  2MLF C;  1G33 A;  4BY4 A;  3K21 A;  1NPQ A;  2M49 B;  3HCM A;  1X02 A;  2VRG A;  1XVJ A;  1YUS A;  2BE4 A;  1K9U A;  1NX0 A;  2H2K A;  1CMF A;  1NX2 A;  1S5G Y;  2R2I A;  2L0P A;  3AAK A;  1S6I A;  2H61 C;  1XFW O;  2ZKM X;  1S5G Z;  4HRE E;  4GNK B;  4HSZ A;  1QX2 A;  1TOP A;  3OHM B;  2D8N A;  1N0Y A;  2M8U A;  3AKA A;  4MZJ A;  2PMY A;  1FW4 A;  2KI6 D;  1WRZ A;  2Y1N A;  5DKN A;  1VRK A;  4YRU A;  5HKW A;  1KQM B;  4I5L B;  1G8I A;  1ZFS A;  1MF8 B;  1PSR A;  1S3P A;  1WRK A;  3EK7 A;  3WHU B;  2K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...