3TDZA

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
molecule keywords DCN1-like protein 1
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tdzA01
1EH2A 2NXQA 4CFRA 1A75B 1PSRA 1M46A 2D8NA 4HREE 3SG7A 1BLQA 3VRPA 1UP5A 4XJKB 1S6IA 2BE6A 3BXKA 2PVBA 4I5JA 3OB1B 4CPVA 1OOJA 1J55A 2AUCA 2R2IA 1AUIB 4N1FA 1S5GY 1NX0A 1PULA 1KFXS 1QLSA 1CTRA 1G8IA 3LCPC 2L4HA 3BOWA 2M97A 2H61C 1WDCC 4GFTA 1B7TZ 3OX6A 1K95A 3KHEA 1SNLA 1YX8A 1C7VA 3CR4X 1NIWA 2MLEC 3LL8B 4DCKA 1TOPA 1AJ4A 4PE4A 4AQJA 1XA5A 3KO0A 5KSZA 4E68A 2HPSA 2K7OA 3D0YA 1G33A 2FOTA 4BY5A 1DGUA 4GGFA 1NCXA 1GGWA 5CSJA 1B9AA 2LCPA 1J7PA 1DGVA 1CDMA 1RTP1 1B8CA 1QTXA 1UUSA 2ZNEA 3JTDB 1LXFC 3NSKA 3OP0A 1F4OA 5DKQA 1NWDA 1K90D 1A29A 2K61A 2FCDA 1L2OB 1XFVO 2KDHA 2EC6B 3DVEA 3O78A 3OB2B 5B8IB 4C0JA 2HQWA 1AJ5A 1M39A 2OTGB 3WXAA 1IRJA 1YUTA 1KK8C 5K89A 3NSOA 1LA3A 5BPJA 2CNPA 1TTXA 3JVTB 2OS8C 1K9PA 2KI6C 4ORCB 1J1EA 1TRFA 1CFDA 1FBVA 2FCEA 2KQYA 4OR9B 4C0LA 2NLNA 1Q80A 2F33A 5ER4X 2CCMA 1FI6A 1DJWA 2LAPA 3D0YB 1B8RA 3O2PA 3O6BA 4R1EA 5HYDA 1DJYA 4GPLB 4QJ4B 1S1EA 3BUWB 1EG4A 2LLTA 2K7DA 2RGIA 3SIAA 3BUMB 1QIVA 1QX5B 4MEWA 1YRTB 2KGBC 1K9UA 2LVIA 2O5GA 3WHTB 5HKYA 1JC2A 1RWYA 2CXJA 1KQMC 2WNDA 5J3XA 4Q04A 5AXIA 3SG5A 1FI5A 1LINA 2JNXA 1F55A 2BKIB 1IG5A 1RK9A 1ZMZA 2HQ8A 4OCIA 2M0RA 1TNWA 4USLA 2B1UA 2LP3A 1JUOA 1PVBA 4U8DA 3BUXB 1NSHA 1IQ5A 1NYAA 1UHJA 1YTZC 2F2PA 2KI4C 2MHHA 1CM4A 1JFKA 2CBLA 3FS7A 2L4IA 2JXCA 3BUNB 1XFZO 2L98A 3PFVA 1SK6D 4JWQA 1DVIA 1WDCB 1PK0D 2M8UA 2JZIA 3SG3A 5AERA 1CDLA 1H4BA 1WRZA 2KFGA 3H4SE 3SG2A 2Y4QA 3RM1A 1DJGA 4PHJA 2KQ6A 2KOTA 1CB1A 1C7WA 1MUXA 2JU0A 4UPGA 1OE9B 2HETA 1JSAA 4YI9A 1FW4A 2G9BA 2JNFA 3PALA 2MLFC 1E8AA 4GGFC 1EL4A 1Y0VH 3DD4A 3HX4A 1S3PA 3DVKA 3DVMA 1QIWA 4IL1A 3VRQA 1K2HA 2JTTA 3BUOB 1N0YA 3C1VA 3KF9A 2M7NA 2M49B 2PASA 4CIDA 1GGZA 4MLWA 1X02A 4AOMA 1CFPA 2QPTA 4ICBA 3AAKA 2BL0B 2OPOA 1KFUL 2M1UA 1NCYA 1JFJA 2KBIA 4PE0A 1DJZA 1MHOA 3F45A 1CMFA 3I5IC 2Y1NA 3TDIA 1DJIA 2F2OA 1KK8B 4PALA 1QS7A 2F3YA 1QVIY 1UURA 2OS8B 5AEQA 3OX5A 4NDDA 1BODA 5IBWA 5HLVA 1TNQA 2L50A 1DMOA 2MAZA 5AANA 3GOFA 1LVCD 1OZOA 3OHMB 1IJ5A 1CDPA 2ZRTA 2KGRA 4MZKA 2CTNA 3MSEB 1S6CA 1MXLC 3TS5C 1OQPA 2K8MB 3EVRA 1XFUO 4HSZA 2P6BB 1J7RA 2JT3A 1A03A 3IF7A 2QACA 5KTYA 1AK8A 2BKHB 4YGAA 1CLMA 2GGMA 3A4UB 3CS1A 4BY4A 2LHLA 2DOQA 1KQMB 1CDNA 1BR4B 3IQOA 1PALA 1CNPA 4ORAB 1GJYA 1QV0A 1K96A 1ODBA 2LM5A 4PHKA 1BF5A 4XYNA 5KU1A 2WCBA 4ETOA 3SIBA 4WRIA 2H2KA 3K21A 2JWWA 3EVVA 1PSBA 3PN7C 1J7QA 1SRAA 2BL0C 4PE1A 2KYCA 2LVKA 1KK7Y 1XO5A 2BBMA 2KI4B 4N5XA 1JWDA 2PALA 3VRRA 1QJTA 2LP2A 3BOWB 3CGAA 2KBMA 2ZKMX 4YGCB 1SMGA 4DUQA 2F3ZA 4NDBA 2NCPA 1KQVA 2AMIA 1CLLA 4HRGA 1S6JA 1F4QA 2MBXA 1J1DA 1S5GZ 1YRUB 3WNXB 5G08A 1F54A 1NX2A 3HCMA 1KSOA 1SKTA 2M1KB 1FPWA 1KWOC 1IH0A 4OVNF 1YUSA 2JT8A 3CR5X 5CSIA 1KFXL 2VRGA 3I5GC 1YVHA 2JPTA 4FTGA 2LMUA 2WOSA 3GK4X 1BMOA 3TZ1A 1WY9A 1U5IA 3VRNA 1FF1A 3CLNA 1OMDA 1PVAA 1SYMA 3ZNIA 5HKZA 4GGNA 4GAOA 2L2EA 1BOCA 5HKWA 1BG1A 3QRXA 2Y5IA 1RJVA 1HT9A 3EVUA 2HF5A 1AVSA 2K0JA 3KEVA 2EHBA 3TUYC 1ZACA 2I2RE 2V53A 1TCOB 4YGEB 3FWBA 2PRUA 3E3RA 2FJUB 2ZRSA 2PMYA 4JQ0D 4MVFA 1IQ3A 1UHKA 3TDZA 4OV2A 2WORA 3I5IB 5DKNA 4PCWA 4AQIA 2BECA 5D69A 1B47A 3M0WA 2E6WA 5HLOA 1IKUA 1C07A 1WLZA 1M31A 4PE7A 4DS7A 1RECA 2M3WA 1K9KA 1XK4C 1KK7Z 3EK8A 4M2PA 1LA0A 3FIAA 4OKHA 1KSMA 1W7IB 2KAVA 1YVLA 5GQQC 5CPVA 1Y6WA 2BCAA 2ZN8A 1K93D 1UHIA 3LK1A 1NP8A 4I5NB 4GUKA 2ISDA 1U5IB 1TIZA 5D7FA 1QLKA 3TS5B 2L5XB 2LHIA 2COLB 1EXRA 4JPZB 1XFWO 3AKAA 1DJHA 2GV5A 4C0KA 2K2FA 4CFQA 1SY9A 3CZTX 4PHNA 1K8UA 4TNCA 1EJ3A 3BYAA 2LANA 4PHMA 2LMTA 1SBJA 3GK1A 1KCYA 3PN7B 1IJ6A 1TN4A 4MRYA 1G4YR 2I18A 1S26D 1XFYO 2BE4A 2PSRA 1F70A 1B8LA 1Y1UA 1HQVA 1MR8A 2KNEA 1R6PA 3EKJA 2JQ6A 3I5FC 3RLZA 3ZWHA 2BCBA 1ZOTB 2LV7A 1B4CA 3DF0A 1TNXA 1W7JB 2O60A 1V1GA 2MRDA 1UHHA 1KWOB 1XK4A 2L51A 2LNKA 1SCMC 1SL9A 3CR2A 4N1GA 2L0PA 4WQ3A 1A4PA 2TN4A 4FQOA 1L7ZA 1EG3A 4MN0A 2SASA 1A2XA 1YURA 3I5GB 5I2QA 1QXPA 1BT6A 5PALA 1QX7A 3D10A 1IGVA 3O4YA 4HRHA 3FWCA 4YGBB 5JOLA 4DRWA 3EKHA 4I5KA 4MBEA 1D1OA 2LVVA 3PM8A 4YBHB 1DT7B 3NSIA 1CMGA 4I5LB 3VGOA 1TCFA 2BBNA 1DJXA 4YI8A 1OMRA 1RFJA 1QASA 1SR6B 2LE9B 5JJGA 1OSAA 2ZNDA 4QJ3B 2GGZA 1XFXO 5F6TA 1XVJA 4WQ2A 5DKRA 1WRLA 1F8HA 4MRXA 3TUYB 3WHUB 1JF0A 1UHNA 2LUCA 1ZFSA 1MXEA 4GNKB 1H8BA 4A4CA 1VRKA 3EK4A 2M9GA 3NSLA 4ZCUA 3I5HB 1SL8A 1ALWA 2KI6D 2SCPA 3LK0A 3DF0B 1OZSA 1OMVA 2G2BA 2MJWB 1AP4A 2LLUA 1B1GA 1NX1A 3VROA 2I7AA 4NDCA 2ZN9A 2A4JA 4GBAA 1AHRA 2KHNA 3PATA 2KAYA 2AAOA 1BR1B 5CSNA 3PLFB 1QVIZ 3PSRA 2KFFA 4DIRA 4MZLA 1N2DA 2E30A 2JC2A 3GK2A 4QJ5B 1TNPA 2LMVA 2Y1MA 1NX3A 2JXLA 2MA2A 1JF2A 3SG6A 5I8NA 1F71A 1V1FA 1R2UA 1YX7A 3IQQA 1UWOA 1SPYA 2M29A 1Y1AA 2KFHA 2WCEA 2IS9A 1SR6C 2H61A 4YGDB 1MQ1A 1XYDA 2LLSA 2Q91A 4YRUA 1J7OA 1M63B 1PRWA 4PDZA 3CWGA 1DTLA 1KFUS 2JULA 2KAXA 1IWQA 2Q4UA 3EK7A 1K94A 1SW8A 3I5HC 3KPXA 4F0ZB 5ER5A 2K2AA 2LVJA 2K7CA 2M7LA 3I5FB 4P2YB 3CTNA 1QV1A 2KSPA 2WC8A 4ZCVA 5FYXA 1MF8B 2EGDA 2NZ0A 1CFCA 3SJSA 1DF0A 1CLBA 1CM1A 1SL7A 3TDUA 1GQMA 1NCZA 2ZFDA 4A4BA 3JTDC 2LC5A 5TNCA 2WCFA 1A75A 1SCMB 4L9MA 2K7BA 3SG4A 5AFPA 1B7TY 3A8RA 1L2OC 4XJKA 1NPQA 1RROA 2EC6C 3NXAA 2JOJA 1BJFA 2JRFA 4CLNA 5I2OA 5CSFA 2OTGC 1QX2A 4D1EA 4ORBB 2LUXA 2JTZA 1Y1XA 1N65A 1ALVA 3BQ3A 3JVTC 1CKKA 3AAJA 4M2QA 2JT0A 2KYFA 1CFFA 1BU3A 4P5OE 3DVJA 1WLMA 1MWNA 3ICBA 1WRKA 3AKBA 1LKJA 1ZUZA 4M2OA 1NUBA 1QATA 1YR5A 2NCOA 4MZJA 1M45A 2CT9A 3LLEA 4MSPA 4NQGA 1YUUA 1SCVA 1JBAA 2BCXA 1DF0B 1S36A 2I94A 5I2LA 2F8PA
chains in the Genus database with same CATH superfamily
1EH2A 2NXQA 4CFRA 1A75B 1PSRA 1M46A 2D8NA 4HREE 3SG7A 1BLQA 3VRPA 1UP5A 4XJKB 1S6IA 2BE6A 3BXKA 2PVBA 4I5JA 3OGNA 3OB1B 4CPVA 1OOJA 1J55A 2AUCA 2R2IA 1AUIB 4N1FA 1S5GY 1NX0A 1PULA 3L4LA 1TUJA 1KFXS 1QLSA 1W9ZA 2YGUA 1CTRA 1G8IA 3LCPC 2L4HA 3BOWA 2M97A 2H61C 1WDCC 3D78A 1B7TZ 3OX6A 1K95A 3KHEA 4GFTA 3V2LA 1SNLA 4FQTA 1YX8A 1C7VA 3CR4X 1NIWA 2MLEC 3B86A 3LL8B 5FI2A 1TOPA 4DCKA 1AJ4A 4PE4A 4AQJA 1XA5A 3KO0A 3FE9A 5FI7A 2QEVA 5KSZA 4E68A 2HPSA 2K7OA 3D0YA 4AQIA 1G33A 2WCJA 2FOTA 1DC1A 4BY5A 1DGUA 4GGFA 1NCXA 1GGWA 5CSJA 1B9AA 2LCPA 1J7PA 3QMEA 1DGVA 1CDMA 1RTP1 1B8CA 1QTXA 1UUSA 2ZNEA 3JTDB 1LXFC 3NSKA 3RZSA 3OP0A 1F4OA 5DKQA 1NWDA 1K90D 3BFAA 1A29A 2K61A 2FCDA 1L2OB 1XFVO 2KDHA 2EC6B 3DVEA 3O78A 3OB2B 5B8IB 4C0JA 2HQWA 3DZTA 1AJ5A 1M39A 2OTGB 3WXAA 1IRJA 1YUTA 3B7AA 3D75A 1KK8C 5K89A 3NSOA 1LA3A 5BPJA 2CNPA 1TTXA 3JVTB 2OS8C 2KLDA 1K9PA 2KI6C 4ORCB 1J1EA 1OW4A 1TRFA 1CFDA 1FBVA 2FCEA 2KQYA 4OR9B 4C0LA 2NLNA 1Q80A 2F33A 5ER4X 3SS5A 3L4AA 2CCMA 1FI6A 1DJWA 2LAPA 3D0YB 1B8RA 3EG5B 3O2PA 3O6BA 3B87A 4R1EA 5HYDA 1DJYA 4GPLB 4QJ4B 1S1EA 3BUWB 1EG4A 2LLTA 2K7DA 2RGIA 3SIAA 3BUMB 1QIVA 1QX5B 4MEWA 1YRTB 2KGBC 1P28A 1K9UA 2LVIA 2O5GA 3WHTB 5HKYA 1QWVA 1JC2A 1RWYA 2CXJA 1KQMC 2WNDA 5J3XA 4Q04A 5AXIA 3SG5A 1FI5A 1LINA 4JKTA 2JNXA 1F55A 1IG5A 2BKIB 1RK9A 1ZMZA 2HQ8A 4OCIA 2M0RA 4JD9A 1TNWA 4USLA 4OZDA 2B1UA 2LP3A 1JUOA 1PVBA 4U8DA 5DICA 3BUXB 3S0EA 1NSHA 1IQ5A 1NYAA 1UHJA 1YTZC 2F2PA 2KI4C 2MHHA 3DXLA 1CM4A 1JFKA 1DQEA 2CBLA 3FS7A 2L4IA 2JXCA 3BUNB 1XFZO 3UO9A 2L98A 3CZ2A 1SK6D 3PFVA 4JWQA 1DVIA 1WDCB 1PK0D 2M8UA 2JZIA 3FE8A 3SG3A 1CDLA 5AERA 1H4BA 1WRZA 3CABA 2KFGA 3H4SE 3SG2A 2Y4QA 3RM1A 1DJGA 4PHJA 2KQ6A 2KOTA 1CB1A 1C7WA 1MUXA 2JU0A 4UPGA 1OE9B 2HETA 1JSAA 4YI9A 1FW4A 2G9BA 2JNFA 3PALA 2MLFC 1E8AA 4GGFC 1EL4A 1Y0VH 3DD4A 3HX4A 1S3PA 1OOHA 3DVKA 3DVMA 1QIWA 4IL1A 3VRQA 1K2HA 2JTTA 3BUOB 1N0YA 3C1VA 3KF9A 2M7NA 2M49B 3SS4A 2ERBA 2PASA 4CIDA 1GGZA 4MLWA 1X02A 4AOMA 2KPHA 1CFPA 3R1OA 2QPTA 4ICBA 3AAKA 2BL0B 2OPOA 1KFUL 3S0GA 2KLEA 2M1UA 1NCYA 1JFJA 2KBIA 4PE0A 1DJZA 1MHOA 3F45A 1CMFA 3I5IC 2Y1NA 3TDIA 1DJIA 2F2OA 1KK8B 3DYEA 4PALA 1QS7A 2F3YA 1QVIY 1UURA 2OS8B 5AEQA 2WC5A 3OX5A 4NDDA 1BODA 5IBWA 5HLVA 1TNQA 2L50A 1DMOA 2MAZA 4PT1A 5AANA 3GOFA 1LVCD 1OZOA 3OHMB 1IJ5A 1CDPA 2ZRTA 2KGRA 4MZKA 2CTNA 3MSEB 1S6CA 3B88A 1C3YA 1MXLC 3TS5C 1OQPA 2K8MB 3EVRA 1XFUO 4HSZA 2P6BB 1J7RA 2JT3A 1A03A 3IF7A 2QACA 5KTYA 1AK8A 2BKHB 4YGAA 1CLMA 2GGMA 3A4UB 3CS1A 4BY4A 2LHLA 2DOQA 1KQMB 1CDNA 1BR4B 3IQOA 1PALA 1CNPA 4ORAB 3NGVA 1GJYA 1QV0A 1K96A 3B6XA 3BJHA 1IKUA 1ODBA 1OOGA 2LM5A 4PHKA 4XYNA 1BF5A 5KU1A 2WCBA 4ETOA 3SIBA 4WRIA 2H2KA 3K21A 2JWWA 3EVVA 1PSBA 3PN7C 1J7QA 1SRAA 2BL0C 4PE1A 2KYCA 2LVKA 1KK7Y 1XO5A 2BBMA 2KI4B 4N5XA 1JWDA 2PALA 3VRRA 1QJTA 2LP2A 3BOWB 3CGAA 3CZ0A 2KBMA 2ZKMX 4YGCB 1SMGA 4DUQA 2F3ZA 4NDBA 2NCPA 1KQVA 2AMIA 2BAPA 1CLLA 4HRGA 1S6JA 1F4QA 2MBXA 1J1DA 1S5GZ 1YRUB 1Z4HA 3WNXB 5G08A 1F54A 1NX2A 3HCMA 1KSOA 1SKTA 2M1KB 1FPWA 1KWOC 1IH0A 4OVNF 1YUSA 2JT8A 3CR5X 3S0FA 5CSIA 1KFXL 2VRGA 3I5GC 1YVHA 2JPTA 4FTGA 2LMUA 2WOSA 3GK4X 1BMOA 3TZ1A 1WY9A 1U5IA 3VRNA 1FF1A 3CLNA 1OMDA 1PVAA 1SYMA 3ZNIA 3N7HA 5HKZA 4GGNA 4GAOA 2PYQA 2L2EA 1BOCA 5HKWA 1BG1A 3QRXA 2Y5IA 1RJVA 1HT9A 2L2CA 3EVUA 5HL1A 2HF5A 1AVSA 2K0JA 2WCLA 3KEVA 2EHBA 3TUYC 1ZACA 2I2RE 2V53A 2H8VA 1TCOB 4YGEB 5EL2A 3FWBA 2PRUA 3D73A 2FJUB 3E3RA 2ZRSA 2PMYA 4JQ0D 4MVFA 1IQ3A 1UHKA 3R72A 3TDZA 2P70A 4OV2A 2WORA 1OOIX 3I5IB 4PCWA 3OBVA 2BECA 2JPOA 1B47A 3M0WA 2E6WA 5D69A 5DKNA 5HLOA 1LS8A 1C07A 1WLZA 1M31A 4PE7A 3R1PA 4DS7A 1RECA 2M3WA 1K9KA 1XK4C 1KK7Z 3EK8A 4M2PA 1LA0A 3FIAA 4OKHA 1KSMA 1W7IB 2KAVA 1YVLA 5GQQC 5CPVA 2QEBA 1Y6WA 1OOFA 2BCAA 2ZN8A 3UNWA 1K93D 1UHIA 3LK1A 3S0DA 1GM0A 1NP8A 4I5NB 4GUKA 5FI6A 2ISDA 1U5IB 1TIZA 5D7FA 1QLKA 2QEOA 3TS5B 2L5XB 2LHIA 2COLB 3NHTA 1EXRA 4JPZB 1XFWO 3AKAA 1DJHA 2GV5A 4C0KA 2K2FA 4CFQA 1SY9A 3CZTX 4PHNA 1K8UA 4TNCA 2QEHA 1EJ3A 1TWOA 3BYAA 2LANA 4PHMA 1SSEB 2LMTA 1SBJA 3GK1A 1KCYA 4KYNA 2QDIA 3PN7B 1IJ6A 1TN4A 4MRYA 1DEKA 1G4YR 2I18A 1S26D 1XFYO 2P71A 2BE4A 2GTEA 2PSRA 1F70A 1B8LA 1Y1UA 1HQVA 1MR8A 2KNEA 1R6PA 3EKJA 2JQ6A 3VB1A 3I5FC 3RLZA 1DELA 3ZWHA 2BCBA 1ZOTB 2LV7A 1B4CA 3BFBA 3DF0A 3CZ1A 1TNXA 1W7JB 2O60A 1IIOA 1V1GA 3FE6A 2MRDA 1UHHA 1KWOB 1XK4A 2L51A 2LNKA 1SCMC 1SL9A 3CR2A 4N1GA 2L0PA 3D77A 4WQ3A 1A4PA 2TN4A 4FQOA 1L7ZA 1EG3A 4MN0A 2SASA 1A2XA 1YURA 3I5GB 5I2QA 1QXPA 1BT6A 5PALA 1QX7A 3D10A 1IGVA 3O4YA 4HRHA 3FWCA 4YGBB 5JOLA 3DY9A 3EKHA 4I5KA 4MBEA 4DRWA 1D1OA 2LVVA 3PM8A 4YBHB 1DT7B 3S0AA 3NSIA 1CMGA 4I5LB 3VGOA 1TCFA 2BBNA 1DJXA 4YI8A 1OMRA 1RFJA 1QASA 1SR6B 2LE9B 5JJGA 1OSAA 2ZNDA 4QJ3B 2GGZA 1XFXO 5F6TA 1XVJA 4WQ2A 5DKRA 1WRLA 1F8HA 4MRXA 3TUYB 3WHUB 1JF0A 1UHNA 2LUCA 1ZFSA 4F7FA 1MXEA 4GNKB 5I94A 1H8BA 4A4CA 2WCKA 1VRKA 3EK4A 2M9GA 3NSLA 4ZCUA 3I5HB 1SL8A 1ALWA 2KI6D 2SCPA 3LK0A 3DF0B 1OZSA 1OMVA 2G2BA 2MJWB 1C3ZA 1AP4A 2LLUA 1B1GA 1NX1A 3VROA 2I7AA 4NDCA 2ZN9A 2A4JA 4GBAA 1AHRA 2KHNA 3PATA 2KAYA 2AAOA 1BR1B 1T14A 5CSNA 3PLFB 4INXA 2WCHA 3D74A 1QVIZ 3PSRA 2KFFA 1XFRA 4DIRA 4MZLA 1N2DA 2E30A 2JC2A 3GK2A 4QJ5B 3L47A 1TNPA 2LMVA 2Y1MA 1NX3A 2JXLA 2MA2A 1JF2A 3SG6A 5I8NA 1F71A 2BNXA 1V1FA 1R2UA 1YX7A 3IQQA 1UWOA 1SPYA 2M29A 1Y1AA 2KFHA 2WCEA 2IS9A 1SR6C 2H61A 1Z2CB 2K60A 2L5YA 2FJYA 4YGDB 1MQ1A 1XYDA 3BFHA 2LLSA 1TUZA 2Q91A 4YRUA 1J7OA 1M63B 1PRWA 4PDZA 3CWGA 3S0BA 1DTLA 1KFUS 2JULA 2KAXA 1IWQA 2Q4UA 3EK7A 1K94A 1SW8A 3I5HC 3KPXA 4F0ZB 5ER5A 2K2AA 2LVJA 2K7CA 2M7LA 3I5FB 4P2YB 3CTNA 1QV1A 2KSPA 2WC8A 4ZCVA 5FYXA 1MF8B 2EGDA 2NZ0A 3CYZA 1CFCA 3SJSA 1DF0A 1CLBA 1CM1A 1SL7A 3O4XA 3TDUA 1GQMA 1NCZA 2ZFDA 4A4BA 3JTDC 2LC5A 4INWA 5TNCA 1ORGA 2WCFA 1A75A 3PJIA 1SCMB 4L9MA 2K7BA 3SG4A 5AFPA 1B7TY 3A8RA 3IVTA 1L2OC 4XJKA 1NPQA 1RROA 2EC6C 2PQLA 3NXAA 2JOJA 1BJFA 2JRFA 4CLNA 5I2OA 5CSFA 2OTGC 1QX2A 2WC6A 3CDNA 4ORBB 2LUXA 4D1EA 2JTZA 1Y1XA 1N65A 1ALVA 3BQ3A 3JVTC 4IJ7A 1CKKA 3AAJA 4M2QA 2JT0A 2KYFA 1CFFA 1BU3A 3PM2A 4P5OE 3DVJA 1WLMA 1MWNA 3ICBA 1WRKA 3AKBA 3NHIA 1LKJA 1ZUZA 4M2OA 3SS3A 1NUBA 1QATA 1YR5A 2NCOA 5D3OA 4MZJA 1M45A 2CT9A 2WCMA 3LLEA 4MSPA 3R1VA 4NQGA 1YUUA 1SCVA 3D76A 1JBAA 2BCXA 1DF0B 1S36A 2I94A 5I2LA 3Q8IA 2F8PA 3K1EA
chains in the Genus database with same CATH topology
1EH2A 2NXQA 4CFRA 1A75B 1PSRA 1M46A 2D8NA 4HREE 3SG7A 1BLQA 3VRPA 1UP5A 4XJKB 1S6IA 2BE6A 3BXKA 2PVBA 4I5JA 3OB1B 4CPVA 1OOJA 1J55A 2AUCA 2R2IA 1AUIB 4N1FA 1S5GY 1NX0A 1PULA 1KFXS 1QLSA 1CTRA 1G8IA 3LCPC 2L4HA 3BOWA 2M97A 2H61C 1WDCC 4GFTA 1B7TZ 3OX6A 1K95A 3KHEA 1SNLA 1YX8A 1C7VA 3CR4X 1NIWA 2MLEC 3LL8B 4DCKA 1TOPA 1AJ4A 4PE4A 4AQJA 1XA5A 3KO0A 5KSZA 4E68A 2HPSA 2K7OA 3D0YA 1G33A 2FOTA 4BY5A 1DGUA 4GGFA 1NCXA 1GGWA 5CSJA 1B9AA 2LCPA 1J7PA 1DGVA 1CDMA 1RTP1 1B8CA 1QTXA 1UUSA 2ZNEA 3JTDB 1LXFC 3NSKA 3OP0A 1F4OA 5DKQA 1NWDA 1K90D 1A29A 2K61A 2FCDA 1L2OB 1XFVO 2KDHA 2EC6B 3DVEA 3O78A 3OB2B 5B8IB 4C0JA 2HQWA 1AJ5A 1M39A 2OTGB 3WXAA 1IRJA 1YUTA 1KK8C 5K89A 3NSOA 1LA3A 5BPJA 2CNPA 1TTXA 3JVTB 2OS8C 1K9PA 2KI6C 4ORCB 1J1EA 1TRFA 1CFDA 1FBVA 2FCEA 2KQYA 4OR9B 4C0LA 2NLNA 1Q80A 2F33A 5ER4X 2CCMA 1FI6A 1DJWA 2LAPA 3D0YB 1B8RA 3O2PA 3O6BA 4R1EA 5HYDA 1DJYA 4GPLB 4QJ4B 1S1EA 3BUWB 1EG4A 2LLTA 2K7DA 2RGIA 3SIAA 3BUMB 1QIVA 1QX5B 4MEWA 1YRTB 2KGBC 1K9UA 2LVIA 2O5GA 3WHTB 5HKYA 1JC2A 1RWYA 2CXJA 1KQMC 2WNDA 5J3XA 4Q04A 5AXIA 3SG5A 1FI5A 1LINA 2JNXA 1F55A 2BKIB 1IG5A 1RK9A 1ZMZA 2HQ8A 4OCIA 2M0RA 1TNWA 4USLA 2B1UA 2LP3A 1JUOA 1PVBA 4U8DA 3BUXB 1NSHA 1IQ5A 1NYAA 1UHJA 1YTZC 2F2PA 2KI4C 2MHHA 1CM4A 1JFKA 2CBLA 3FS7A 2L4IA 2JXCA 3BUNB 1XFZO 2L98A 3PFVA 1SK6D 4JWQA 1DVIA 1WDCB 1PK0D 2M8UA 2JZIA 3SG3A 5AERA 1CDLA 1H4BA 1WRZA 2KFGA 3H4SE 3SG2A 2Y4QA 3RM1A 1DJGA 4PHJA 2KQ6A 2KOTA 1CB1A 1C7WA 1MUXA 2JU0A 4UPGA 1OE9B 2HETA 1JSAA 4YI9A 1FW4A 2G9BA 2JNFA 3PALA 2MLFC 1E8AA 4GGFC 1EL4A 1Y0VH 3DD4A 3HX4A 1S3PA 3DVKA 3DVMA 1QIWA 4IL1A 3VRQA 1K2HA 2JTTA 3BUOB 1N0YA 3C1VA 3KF9A 2M7NA 2M49B 2PASA 4CIDA 1GGZA 4MLWA 1X02A 4AOMA 1CFPA 2QPTA 4ICBA 3AAKA 2BL0B 2OPOA 1KFUL 2M1UA 1NCYA 1JFJA 2KBIA 4PE0A 1DJZA 1MHOA 3F45A 1CMFA 3I5IC 2Y1NA 3TDIA 1DJIA 2F2OA 1KK8B 4PALA 1QS7A 2F3YA 1QVIY 1UURA 2OS8B 5AEQA 3OX5A 4NDDA 1BODA 5IBWA 5HLVA 1TNQA 2L50A 1DMOA 2MAZA 5AANA 3GOFA 1LVCD 1OZOA 3OHMB 1IJ5A 1CDPA 2ZRTA 2KGRA 4MZKA 2CTNA 3MSEB 1S6CA 1MXLC 3TS5C 1OQPA 2K8MB 3EVRA 1XFUO 4HSZA 2P6BB 1J7RA 2JT3A 1A03A 3IF7A 2QACA 5KTYA 1AK8A 2BKHB 4YGAA 1CLMA 2GGMA 3A4UB 3CS1A 4BY4A 2LHLA 2DOQA 1KQMB 1CDNA 1BR4B 3IQOA 1PALA 1CNPA 4ORAB 1GJYA 1QV0A 1K96A 1ODBA 2LM5A 4PHKA 1BF5A 4XYNA 5KU1A 2WCBA 4ETOA 3SIBA 4WRIA 2H2KA 3K21A 2JWWA 3EVVA 1PSBA 3PN7C 1J7QA 1SRAA 2BL0C 4PE1A 2KYCA 2LVKA 1KK7Y 1XO5A 2BBMA 2KI4B 4N5XA 1JWDA 2PALA 3VRRA 1QJTA 2LP2A 3BOWB 3CGAA 2KBMA 2ZKMX 4YGCB 1SMGA 4DUQA 2F3ZA 4NDBA 2NCPA 1KQVA 2AMIA 1CLLA 4HRGA 1S6JA 1F4QA 2MBXA 1J1DA 1S5GZ 1YRUB 3WNXB 5G08A 1F54A 1NX2A 3HCMA 1KSOA 1SKTA 2M1KB 1FPWA 1KWOC 1IH0A 4OVNF 1YUSA 2JT8A 3CR5X 5CSIA 1KFXL 2VRGA 3I5GC 1YVHA 2JPTA 4FTGA 2LMUA 2WOSA 3GK4X 1BMOA 3TZ1A 1WY9A 1U5IA 3VRNA 1FF1A 3CLNA 1OMDA 1PVAA 1SYMA 3ZNIA 5HKZA 4GGNA 4GAOA 2L2EA 1BOCA 5HKWA 1BG1A 3QRXA 2Y5IA 1RJVA 1HT9A 3EVUA 2HF5A 1AVSA 2K0JA 3KEVA 2EHBA 3TUYC 1ZACA 2I2RE 2V53A 1TCOB 4YGEB 3FWBA 2PRUA 3E3RA 2FJUB 2ZRSA 2PMYA 4JQ0D 4MVFA 1IQ3A 1UHKA 3TDZA 4OV2A 2WORA 3I5IB 5DKNA 4PCWA 4AQIA 2BECA 5D69A 1B47A 3M0WA 2E6WA 5HLOA 1IKUA 1C07A 1WLZA 1M31A 4PE7A 4DS7A 1RECA 2M3WA 1K9KA 1XK4C 1KK7Z 3EK8A 4M2PA 1LA0A 3FIAA 4OKHA 1KSMA 1W7IB 2KAVA 1YVLA 5GQQC 5CPVA 1Y6WA 2BCAA 2ZN8A 1K93D 1UHIA 3LK1A 1NP8A 4I5NB 4GUKA 2ISDA 1U5IB 1TIZA 5D7FA 1QLKA 3TS5B 2L5XB 2LHIA 2COLB 1EXRA 4JPZB 1XFWO 3AKAA 1DJHA 2GV5A 4C0KA 2K2FA 4CFQA 1SY9A 3CZTX 4PHNA 1K8UA 4TNCA 1EJ3A 3BYAA 2LANA 4PHMA 2LMTA 1SBJA 3GK1A 1KCYA 3PN7B 1IJ6A 1TN4A 4MRYA 1G4YR 2I18A 1S26D 1XFYO 2BE4A 2PSRA 1F70A 1B8LA 1Y1UA 1HQVA 1MR8A 2KNEA 1R6PA 3EKJA 2JQ6A 3I5FC 3RLZA 3ZWHA 2BCBA 1ZOTB 2LV7A 1B4CA 3DF0A 1TNXA 1W7JB 2O60A 1V1GA 2MRDA 1UHHA 1KWOB 1XK4A 2L51A 2LNKA 1SCMC 1SL9A 3CR2A 4N1GA 2L0PA 4WQ3A 1A4PA 2TN4A 4FQOA 1L7ZA 1EG3A 4MN0A 2SASA 1A2XA 1YURA 3I5GB 5I2QA 1QXPA 1BT6A 5PALA 1QX7A 3D10A 1IGVA 3O4YA 4HRHA 3FWCA 4YGBB 5JOLA 4DRWA 3EKHA 4I5KA 4MBEA 1D1OA 2LVVA 3PM8A 4YBHB 1DT7B 3NSIA 1CMGA 4I5LB 3VGOA 1TCFA 2BBNA 1DJXA 4YI8A 1OMRA 1RFJA 1QASA 1SR6B 2LE9B 5JJGA 1OSAA 2ZNDA 4QJ3B 2GGZA 1XFXO 5F6TA 1XVJA 4WQ2A 5DKRA 1WRLA 1F8HA 4MRXA 3TUYB 3WHUB 1JF0A 1UHNA 2LUCA 1ZFSA 1MXEA 4GNKB 1H8BA 4A4CA 1VRKA 3EK4A 2M9GA 3NSLA 4ZCUA 3I5HB 1SL8A 1ALWA 2KI6D 2SCPA 3LK0A 3DF0B 1OZSA 1OMVA 2G2BA 2MJWB 1AP4A 2LLUA 1B1GA 1NX1A 3VROA 2I7AA 4NDCA 2ZN9A 2A4JA 4GBAA 1AHRA 2KHNA 3PATA 2KAYA 2AAOA 1BR1B 5CSNA 3PLFB 1QVIZ 3PSRA 2KFFA 4DIRA 4MZLA 1N2DA 2E30A 2JC2A 3GK2A 4QJ5B 1TNPA 2LMVA 2Y1MA 1NX3A 2JXLA 2MA2A 1JF2A 3SG6A 5I8NA 1F71A 1V1FA 1R2UA 1YX7A 3IQQA 1UWOA 1SPYA 2M29A 1Y1AA 2KFHA 2WCEA 2IS9A 1SR6C 2H61A 4YGDB 1MQ1A 1XYDA 2LLSA 2Q91A 4YRUA 1J7OA 1M63B 1PRWA 4PDZA 3CWGA 1DTLA 1KFUS 2JULA 2KAXA 1IWQA 2Q4UA 3EK7A 1K94A 1SW8A 3I5HC 3KPXA 4F0ZB 5ER5A 2K2AA 2LVJA 2K7CA 2M7LA 3I5FB 4P2YB 3CTNA 1QV1A 2KSPA 2WC8A 4ZCVA 5FYXA 1MF8B 2EGDA 2NZ0A 1CFCA 3SJSA 1DF0A 1CLBA 1CM1A 1SL7A 3TDUA 1GQMA 1NCZA 2ZFDA 4A4BA 3JTDC 2LC5A 5TNCA 2WCFA 1A75A 1SCMB 4L9MA 2K7BA 3SG4A 5AFPA 1B7TY 3A8RA 1L2OC 4XJKA 1NPQA 1RROA 2EC6C 3NXAA 2JOJA 1BJFA 2JRFA 4CLNA 5I2OA 5CSFA 2OTGC 1QX2A 4D1EA 4ORBB 2LUXA 2JTZA 1Y1XA 1N65A 1ALVA 3BQ3A 3JVTC 1CKKA 3AAJA 4M2QA 2JT0A 2KYFA 1CFFA 1BU3A 4P5OE 3DVJA 1WLMA 1MWNA 3ICBA 1WRKA 3AKBA 1LKJA 1ZUZA 4M2OA 1NUBA 1QATA 1YR5A 2NCOA 4MZJA 1M45A 2CT9A 3LLEA 4MSPA 4NQGA 1YUUA 1SCVA 1JBAA 2BCXA 1DF0B 1S36A 2I94A 5I2LA 2F8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH2 A;  2NXQ A;  4CFR A;  1A75 B;  1PSR A;  1M46 A;  2D8N A;  4HRE E;  3SG7 A;  1BLQ A;  3VRP A;  1UP5 A;  4XJK B;  1S6I A;  2BE6 A;  3BXK A;  2PVB A;  4I5J A;  3OB1 B;  4CPV A;  1OOJ A;  1J55 A;  2AUC A;  2R2I A;  1AUI B;  4N1F A;  1S5G Y;  1NX0 A;  1PUL A;  1KFX S;  1QLS A;  1CTR A;  1G8I A;  3LCP C;  2L4H A;  3BOW A;  2M97 A;  2H61 C;  1WDC C;  4GFT A;  1B7T Z;  3OX6 A;  1K95 A;  3KHE A;  1SNL A;  1YX8 A;  1C7V A;  3CR4 X;  1NIW A;  2MLE C;  3LL8 B;  4DCK A;  1TOP A;  1AJ4 A;  4PE4 A;  4AQJ A;  1XA5 A;  3KO0 A;  5KSZ A;  4E68 A;  2HPS A;  2K7O A;  3D0Y A;  1G33 A;  2FOT A;  4BY5 A;  1DGU A;  4GGF A;  1NCX A;  1GGW A;  5CSJ A;  1B9A A;  2LCP A;  1J7P A;  1DGV A;  1CDM A;  1RTP 1;  1B8C A;  1QTX A;  1UUS A;  2ZNE A;  3JTD B;  1LXF C;  3NSK A;  3OP0 A;  1F4O A;  5DKQ A;  1NWD A;  1K90 D;  1A29 A;  2K61 A;  2FCD A;  1L2O B;  1XFV O;  2KDH A;  2EC6 B;  3DVE A;  3O78 A;  3OB2 B;  5B8I B;  4C0J A;  2HQW A;  1AJ5 A;  1M39 A;  2OTG B;  3WXA A;  1IRJ A;  1YUT A;  1KK8 C;  5K89 A;  3NSO A;  1LA3 A;  5BPJ A;  2CNP A;  1TTX A;  3JVT B;  2OS8 C;  1K9P A;  2KI6 C;  4ORC B;  1J1E A;  1TRF A;  1CFD A;  1FBV A;  2FCE A;  2KQY A;  4OR9 B;  4C0L A;  2NLN A;  1Q80 A;  2F33 A;  5ER4 X;  2CCM A;  1FI6 A;  1DJW A;  2LAP A;  3D0Y B;  1B8R A;  3O2P A;  3O6B A;  4R1E A;  5HYD A;  1DJY A;  4GPL B;  4QJ4 B;  1S1E A;  3BUW B;  1EG4 A;  2LLT A;  2K7D A;  2RGI A;  3SIA A;  3BUM B;  1QIV A;  1QX5 B;  4MEW A;  1YRT B;  2KGB C;  1K9U A;  2LVI A;  2O5G A;  3WHT B;  5HKY A;  1JC2 A;  1RWY A;  2CXJ A;  1KQM C;  2WND A;  5J3X A;  4Q04 A;  5AXI A;  3SG5 A;  1FI5 A;  1LIN A;  2JNX A;  1F55 A;  2BKI B;  1IG5 A;  1RK9 A;  1ZMZ A;  2HQ8 A;  4OCI A;  2M0R A;  1TNW A;  4USL A;  2B1U A;  2LP3 A;  1JUO A;  1PVB A;  4U8D A;  3BUX B;  1NSH A;  1IQ5 A;  1NYA A;  1UHJ A;  1YTZ C;  2F2P A;  2KI4 C;  2MHH A;  1CM4 A;  1JFK A;  2CBL A;  3FS7 A;  2L4I A;  2JXC A;  3BUN B;  1XFZ O;  2L98 A;  3PFV A;  1SK6 D;  4JWQ A;  1DVI A;  1WDC B;  1PK0 D;  2M8U A;  2JZI A;  3SG3 A;  5AER A;  1CDL A;  1H4B A;  1WRZ A;  2KFG A;  3H4S E;  3SG2 A;  2Y4Q A;  3RM1 A;  1DJG A;  4PHJ A;  2KQ6 A;  2KOT A;  1CB1 A;  1C7W A;  1MUX A;  2JU0 A;  4UPG A;  1OE9 B;  2HET A;  1JSA A;  4YI9 A;  1FW4 A;  2G9B A;  2JNF A;  3PAL A;  2MLF C;  1E8A A;  4GGF C;  1EL4 A;  1Y0V H;  3DD4 A;  3HX4 A;  1S3P A;  3DVK A;  3DVM A;  1QIW A;  4IL1 A;  3VRQ A;  1K2H A;  2JTT A;  3BUO B;  1N0Y A;  3C1V A;  3KF9 A;  2M7N A;  2M49 B;  2PAS A;  4CID A;  1GGZ A;  4MLW A;  1X02 A;  4AOM A;  1CFP A;  2QPT A;  4ICB A;  3AAK A;  2BL0 B;  2OPO A;  1KFU L;  2M1U A;  1NCY A;  1JFJ A;  2KBI A;  4PE0 A;  1DJZ A;  1MHO A;  3F45 A;  1CMF A;  3I5I C;  2Y1N A;  3TDI A;  1DJI A;  2F2O A;  1KK8 B;  4PAL A;  1QS7 A;  2F3Y A;  1QVI Y;  1UUR A;  2OS8 B;  5AEQ A;  3OX5 A;  4NDD A;  1BOD A;  5IBW A;  5HLV A;  1TNQ A;  2L50 A;  1DMO A;  2MAZ A;  5AAN A;  3GOF A;  1LVC D;  1OZO A;  3OHM B;  1IJ5 A;  1CDP A;  2ZRT A;  2KGR A;  4MZK A;  2CTN A;  3MSE B;  1S6C A;  1MXL C;  3TS5 C;  1OQP A;  2K8M B;  3EVR A;  1XFU O;  4HSZ A;  2P6B B;  1J7R A;  2JT3 A;  1A03 A;  3IF7 A;  2QAC A;  5KTY A;  1AK8 A;  2BKH B;  4YGA A;  1CLM A;  2GGM A;  3A4U B;  3CS1 A;  4BY4 A;  2LHL A;  2DOQ A;  1KQM B;  1CDN A;  1BR4 B;  3IQO A;  1PAL A;  1CNP A;  4ORA B;  1GJY A;  1QV0 A;  1K96 A;  1ODB A;  2LM5 A;  4PHK A;  1BF5 A;  4XYN A;  5KU1 A;  2WCB A;  4ETO A;  3SIB A;  4WRI A;  2H2K A;  3K21 A;  2JWW A;  3EVV A;  1PSB A;  3PN7 C;  1J7Q A;  1SRA A;  2BL0 C;  4PE1 A;  2KYC A;  2LVK A;  1KK7 Y;  1XO5 A;  2BBM A;  2KI4 B;  4N5X A;  1JWD A;  2PAL A;  3VRR A;  1QJT A;  2LP2 A;  3BOW B;  3CGA A;  2KBM A;  2ZKM X;  4YGC B;  1SMG A;  4DUQ A;  2F3Z A;  4NDB A;  2NCP A;  1KQV A;  2AMI A;  1CLL A;  4HRG A;  1S6J A;  1F4Q A;  2MBX A;  1J1D A;  1S5G Z;  1YRU B;  3WNX B;  5G08 A;  1F54 A;  1NX2 A;  3HCM A;  1KSO A;  1SKT A;  2M1K B;  1FPW A;  1KWO C;  1IH0 A;  4OVN F;  1YUS A;  2JT8 A;  3CR5 X;  5CSI A;  1KFX L;  2VRG A;  3I5G C;  1YVH A;  2JPT A;  4FTG A;  2LMU A;  2WOS A;  3GK4 X;  1BMO A;  3TZ1 A;  1WY9 A;  1U5I A;  3VRN A;  1FF1 A;  3CLN A;  1OMD A;  1PVA A;  1SYM A;  3ZNI A;  5HKZ A;  4GGN A;  4GAO A;  2L2E A;  1BOC A;  5HKW A;  1BG1 A;  3QRX A;  2Y5I A;  1RJV A;  1HT9 A;  3EVU A;  2HF5 A;  1AVS A;  2K0J A;  3KEV A;  2EHB A;  3TUY C;  1ZAC A;  2I2R E;  2V53 A;  1TCO B;  4YGE B;  3FWB A;  2PRU A;  3E3R A;  2FJU B;  2ZRS A;  2PMY A;  4JQ0 D;  4MVF A;  1IQ3 A;  1UHK A;  3TDZ A;  4OV2 A;  2WOR A;  3I5I B;  5DKN A;  4PCW A;  4AQI A;  2BEC A;  5D69 A;  1B47 A;  3M0W A;  2E6W A;  5HLO A;  1IKU A;  1C07 A;  1WLZ A;  1M31 A;  4PE7 A;  4DS7 A;  1REC A;  2M3W A;  1K9K A;  1XK4 C;  1KK7 Z;  3EK8 A;  4M2P A;  1LA0 A;  3FIA A;  4OKH A;  1KSM A;  1W7I B;  2KAV A;  1YVL A;  5GQQ C;  5CPV A;  1Y6W A;  2BCA A;  2ZN8 A;  1K93 D;  1UHI A;  3LK1 A;  1NP8 A;  4I5N B;  4GUK A;  2ISD A;  1U5I B;  1TIZ A;  5D7F A;  1QLK A;  3TS5 B;  2L5X B;  2LHI A;  2COL B;  1EXR A;  4JPZ B;  1XFW O;  3AKA A;  1DJH A;  2GV5 A;  4C0K A;  2K2F A;  4CFQ A;  1SY9 A;  3CZT X;  4PHN A;  1K8U A;  4TNC A;  1EJ3 A;  3BYA A;  2LAN A;  4PHM A;  2LMT A;  1SBJ A;  3GK1 A;  1KCY A;  3PN7 B;  1IJ6 A;  1TN4 A;  4MRY A;  1G4Y R;  2I18 A;  1S26 D;  1XFY O;  2BE4 A;  2PSR A;  1F70 A;  1B8L A;  1Y1U A;  1HQV A;  1MR8 A;  2KNE A;  1R6P A;  3EKJ A;  2JQ6 A;  3I5F C;  3RLZ A;  3ZWH A;  2BCB A;  1ZOT B;  2LV7 A;  1B4C A;  3DF0 A;  1TNX A;  1W7J B;  2O60 A;  1V1G A;  2MRD A;  1UHH A;  1KWO B;  1XK4 A;  2L51 A;  2LNK A;  1SCM C;  1SL9 A;  3CR2 A;  4N1G A;  2L0P A;  4WQ3 A;  1A4P A;  2TN4 A;  4FQO A;  1L7Z A;  1EG3 A;  4MN0 A;  2SAS A;  1A2X A;  1YUR A;  3I5G B;  5I2Q A;  1QXP A;  1BT6 A;  5PAL A;  1QX7 A;  3D10 A;  1IGV A;  3O4Y A;  4HRH A;  3FWC A;  4YGB B;  5JOL A;  4DRW A;  3EKH A;  4I5K A;  4MBE A;  1D1O A;  2LVV A;  3PM8 A;  4YBH B;  1DT7 B;  3NSI A;  1CMG A;  4I5L B;  3VGO A;  1TCF A;  2BBN A;  1DJX A;  4YI8 A;  1OMR A;  1RFJ A;  1QAS A;  1SR6 B;  2LE9 B;  5JJG A;  1OSA A;  2ZND A;  4QJ3 B;  2GGZ A;  1XFX O;  5F6T A;  1XVJ A;  4WQ2 A;  5DKR A;  1WRL A;  1F8H A;  4MRX A;  3TUY B;  3WHU B;  1JF0 A;  1UHN A;  2LUC A;  1ZFS A;  1MXE A;  4GNK B;  1H8B A;  4A4C A;  1VRK A;  3EK4 A;  2M9G A;  3NSL A;  4ZCU A;  3I5H B;  1SL8 A;  1ALW A;  2KI6 D;  2SCP A;  3LK0 A;  3DF0 B;  1OZS A;  1OMV A;  2G2B A;  2MJW B;  1AP4 A;  2LLU A;  1B1G A;  1NX1 A;  3VRO A;  2I7A A;  4NDC A;  2ZN9 A;  2A4J A;  4GBA A;  1AHR A;  2KHN A;  3PAT A;  2KAY A;  2AAO A;  1BR1 B;  5CSN A;  3PLF B;  1QVI Z;  3PSR A;  2KFF A;  4DIR A;  4MZL A;  1N2D A;  2E30 A;  2JC2 A;  3GK2 A;  4QJ5 B;  1TNP A;  2LMV A;  2Y1M A;  1NX3 A;  2JXL A;  2MA2 A;  1JF2 A;  3SG6 A;  5I8N A;  1F71 A;  1V1F A;  1R2U A;  1YX7 A;  3IQQ A;  1UWO A;  1SPY A;  2M29 A;  1Y1A A;  2KFH A;  2WCE A;  2IS9 A;  1SR6 C;  2H61 A;  4YGD B;  1MQ1 A;  1XYD A;  2LLS A;  2Q91 A;  4YRU A;  1J7O A;  1M63 B;  1PRW A;  4PDZ A;  3CWG A;  1DTL A;  1KFU S;  2JUL A;  2KAX A;  1IWQ A;  2Q4U A;  3EK7 A;  1K94 A;  1SW8 A;  3I5H C;  3KPX A;  4F0Z B;  5ER5 A;  2K2A A;  2LVJ A;  2K7C A;  2M7L A;  3I5F B;  4P2Y B;  3CTN A;  1QV1 A;  2KSP A;  2WC8 A;  4ZCV A;  5FYX A;  1MF8 B;  2EGD A;  2NZ0 A;  1CFC A;  3SJS A;  1DF0 A;  1CLB A;  1CM1 A;  1SL7 A;  3TDU A;  1GQM A;  1NCZ A;  2ZFD A;  4A4B A;  3JTD C;  2LC5 A;  5TNC A;  2WCF A;  1A75 A;  1SCM B;  4L9M A;  2K7B A;  3SG4 A;  5AFP A;  1B7T Y;  3A8R A;  1L2O C;  4XJK A;  1NPQ A;  1RRO A;  2EC6 C;  3NXA A;  2JOJ A;  1BJF A;  2JRF A;  4CLN A;  5I2O A;  5CSF A;  2OTG C;  1QX2 A;  4D1E A;  4ORB B;  2LUX A;  2JTZ A;  1Y1X A;  1N65 A;  1ALV A;  3BQ3 A;  3JVT C;  1CKK A;  3AAJ A;  4M2Q A;  2JT0 A;  2KYF A;  1CFF A;  1BU3 A;  4P5O E;  3DVJ A;  1WLM A;  1MWN A;  3ICB A;  1WRK A;  3AKB A;  1LKJ A;  1ZUZ A;  4M2O A;  1NUB A;  1QAT A;  1YR5 A;  2NCO A;  4MZJ A;  1M45 A;  2CT9 A;  3LLE A;  4MSP A;  4NQG A;  1YUU A;  1SCV A;  1JBA A;  2BCX A;  1DF0 B;  1S36 A;  2I94 A;  5I2L A;  2F8P A; 
#chains in the Genus database with same CATH topology
 1EH2 A;  2NXQ A;  4CFR A;  1A75 B;  1PSR A;  1M46 A;  2D8N A;  4HRE E;  3SG7 A;  1BLQ A;  3VRP A;  1UP5 A;  4XJK B;  1S6I A;  2BE6 A;  3BXK A;  2PVB A;  4I5J A;  3OGN A;  3OB1 B;  4CPV A;  1OOJ A;  1J55 A;  2AUC A;  2R2I A;  1AUI B;  4N1F A;  1S5G Y;  1NX0 A;  1PUL A;  3L4L A;  1TUJ A;  1KFX S;  1QLS A;  1W9Z A;  2YGU A;  1CTR A;  1G8I A;  3LCP C;  2L4H A;  3BOW A;  2M97 A;  2H61 C;  1WDC C;  3D78 A;  1B7T Z;  3OX6 A;  1K95 A;  3KHE A;  4GFT A;  3V2L A;  1SNL A;  4FQT A;  1YX8 A;  1C7V A;  3CR4 X;  1NIW A;  2MLE C;  3B86 A;  3LL8 B;  5FI2 A;  1TOP A;  4DCK A;  1AJ4 A;  4PE4 A;  4AQJ A;  1XA5 A;  3KO0 A;  3FE9 A;  5FI7 A;  2QEV A;  5KSZ A;  4E68 A;  2HPS A;  2K7O A;  3D0Y A;  4AQI A;  1G33 A;  2WCJ A;  2FOT A;  1DC1 A;  4BY5 A;  1DGU A;  4GGF A;  1NCX A;  1GGW A;  5CSJ A;  1B9A A;  2LCP A;  1J7P A;  3QME A;  1DGV A;  1CDM A;  1RTP 1;  1B8C A;  1QTX A;  1UUS A;  2ZNE A;  3JTD B;  1LXF C;  3NSK A;  3RZS A;  3OP0 A;  1F4O A;  5DKQ A;  1NWD A;  1K90 D;  3BFA A;  1A29 A;  2K61 A;  2FCD A;  1L2O B;  1XFV O;  2KDH A;  2EC6 B;  3DVE A;  3O78 A;  3OB2 B;  5B8I B;  4C0J A;  2HQW A;  3DZT A;  1AJ5 A;  1M39 A;  2OTG B;  3WXA A;  1IRJ A;  1YUT A;  3B7A A;  3D75 A;  1KK8 C;  5K89 A;  3NSO A;  1LA3 A;  5BPJ A;  2CNP A;  1TTX A;  3JVT B;  2OS8 C;  2KLD A;  1K9P A;  2KI6 C;  4ORC B;  1J1E A;  1OW4 A;  1TRF A;  1CFD A;  1FBV A;  2FCE A;  2KQY A;  4OR9 B;  4C0L A;  2NLN A;  1Q80 A;  2F33 A;  5ER4 X;  3SS5 A;  3L4A A;  2CCM A;  1FI6 A;  1DJW A;  2LAP A;  3D0Y B;  1B8R A;  3EG5 B;  3O2P A;  3O6B A;  3B87 A;  4R1E A;  5HYD A;  1DJY A;  4GPL B;  4QJ4 B;  1S1E A;  3BUW B;  1EG4 A;  2LLT A;  2K7D A;  2RGI A;  3SIA A;  3BUM B;  1QIV A;  1QX5 B;  4MEW A;  1YRT B;  2KGB C;  1P28 A;  1K9U A;  2LVI A;  2O5G A;  3WHT B;  5HKY A;  1QWV A;  1JC2 A;  1RWY A;  2CXJ A;  1KQM C;  2WND A;  5J3X A;  4Q04 A;  5AXI A;  3SG5 A;  1FI5 A;  1LIN A;  4JKT A;  2JNX A;  1F55 A;  1IG5 A;  2BKI B;  1RK9 A;  1ZMZ A;  2HQ8 A;  4OCI A;  2M0R A;  4JD9 A;  1TNW A;  4USL A;  4OZD A;  2B1U A;  2LP3 A;  1JUO A;  1PVB A;  4U8D A;  5DIC A;  3BUX B;  3S0E A;  1NSH A;  1IQ5 A;  1NYA A;  1UHJ A;  1YTZ C;  2F2P A;  2KI4 C;  2MHH A;  3DXL A;  1CM4 A;  1JFK A;  1DQE A;  2CBL A;  3FS7 A;  2L4I A;  2JXC A;  3BUN B;  1XFZ O;  3UO9 A;  2L98 A;  3CZ2 A;  1SK6 D;  3PFV A;  4JWQ A;  1DVI A;  1WDC B;  1PK0 D;  2M8U A;  2JZI A;  3FE8 A;  3SG3 A;  1CDL A;  5AER A;  1H4B A;  1WRZ A;  3CAB A;  2KFG A;  3H4S E;  3SG2 A;  2Y4Q A;  3RM1 A;  1DJG A;  4PHJ A;  2KQ6 A;  2KOT A;  1CB1 A;  1C7W A;  1MUX A;  2JU0 A;  4UPG A;  1OE9 B;  2HET A;  1JSA A;  4YI9 A;  1FW4 A;  2G9B A;  2JNF A;  3PAL A;  2MLF C;  1E8A A;  4GGF C;  1EL4 A;  1Y0V H;  3DD4 A;  3HX4 A;  1S3P A;  1OOH A;  3DVK A;  3DVM A;  1QIW A;  4IL1 A;  3VRQ A;  1K2H A;  2JTT A;  3BUO B;  1N0Y A;  3C1V A;  3KF9 A;  2M7N A;  2M49 B;  3SS4 A;  2ERB A;  2PAS A;  4CID A;  1GGZ A;  4MLW A;  1X02 A;  4AOM A;  2KPH A;  1CFP A;  3R1O A;  2QPT A;  4ICB A;  3AAK A;  2BL0 B;  2OPO A;  1KFU L;  3S0G A;  2KLE A;  2M1U A;  1NCY A;  1JFJ A;  2KBI A;  4PE0 A;  1DJZ A;  1MHO A;  3F45 A;  1CMF A;  3I5I C;  2Y1N A;  3TDI A;  1DJI A;  2F2O A;  1KK8 B;  3DYE A;  4PAL A;  1QS7 A;  2F3Y A;  1QVI Y;  1UUR A;  2OS8 B;  5AEQ A;  2WC5 A;  3OX5 A;  4NDD A;  1BOD A;  5IBW A;  5HLV A;  1TNQ A;  2L50 A;  1DMO A;  2MAZ A;  4PT1 A;  5AAN A;  3GOF A;  1LVC D;  1OZO A;  3OHM B;  1IJ5 A;  1CDP A;  2ZRT A;  2KGR A;  4MZK A;  2CTN A;  3MSE B;  1S6C A;  3B88 A;  1C3Y A;  1MXL C;  3TS5 C;  1OQP A;  2K8M B;  3EVR A;  1XFU O;  4HSZ A;  2P6B B;  1J7R A;  2JT3 A;  1A03 A;  3IF7 A;  2QAC A;  5KTY A;  1AK8 A;  2BKH B;  4YGA A;  1CLM A;  2GGM A;  3A4U B;  3CS1 A;  4BY4 A;  2LHL A;  2DOQ A;  1KQM B;  1CDN A;  1BR4 B;  3IQO A;  1PAL A;  1CNP A;  4ORA B;  3NGV A;  1GJY A;  1QV0 A;  1K96 A;  3B6X A;  3BJH A;  1IKU A;  1ODB A;  1OOG A;  2LM5 A;  4PHK A;  4XYN A;  1BF5 A;  5KU1 A;  2WCB A;  4ETO A;  3SIB A;  4WRI A;  2H2K A;  3K21 A;  2JWW A;  3EVV A;  1PSB A;  3PN7 C;  1J7Q A;  1SRA A;  2BL0 C;  4PE1 A;  2KYC A;  2LVK A;  1KK7 Y;  1XO5 A;  2BBM A;  2KI4 B;  4N5X A;  1JWD A;  2PAL A;  3VRR A;  1QJT A;  2LP2 A;  3BOW B;  3CGA A;  3CZ0 A;  2KBM A;  2ZKM X;  4YGC B;  1SMG A;  4DUQ A;  2F3Z A;  4NDB A;  2NCP A;  1KQV A;  2AMI A;  2BAP A;  1CLL A;  4HRG A;  1S6J A;  1F4Q A;  2MBX A;  1J1D A;  1S5G Z;  1YRU B;  1Z4H A;  3WNX B;  5G08 A;  1F54 A;  1NX2 A;  3HCM A;  1KSO A;  1SKT A;  2M1K B;  1FPW A;  1KWO C;  1IH0 A;  4OVN F;  1YUS A;  2JT8 A;  3CR5 X;  3S0F A;  5CSI A;  1KFX L;  2VRG A;  3I5G C;  1YVH A;  2JPT A;  4FTG A;  2LMU A;  2WOS A;  3GK4 X;  1BMO A;  3TZ1 A;  1WY9 A;  1U5I A;  3VRN A;  1FF1 A;  3CLN A;  1OMD A;  1PVA A;  1SYM A;  3ZNI A;  3N7H A;  5HKZ A;  4GGN A;  4GAO A;  2PYQ A;  2L2E A;  1BOC A;  5HKW A;  1BG1 A;  3QRX A;  2Y5I A;  1RJV A;  1HT9 A;  2L2C A;  3EVU A;  5HL1 A;  2HF5 A;  1AVS A;  2K0J A;  2WCL A;  3KEV A;  2EHB A;  3TUY C;  1ZAC A;  2I2R E;  2V53 A;  2H8V A;  1TCO B;  4YGE B;  5EL2 A;  3FWB A;  2PRU A;  3D73 A;  2FJU B;  3E3R A;  2ZRS A;  2PMY A;  4JQ0 D;  4MVF A;  1IQ3 A;  1UHK A;  3R72 A;  3TDZ A;  2P70 A;  4OV2 A;  2WOR A;  1OOI X;  3I5I B;  4PCW A;  3OBV A;  2BEC A;  2JPO A;  1B47 A;  3M0W A;  2E6W A;  5D69 A;  5DKN A;  5HLO A;  1LS8 A;  1C07 A;  1WLZ A;  1M31 A;  4PE7 A;  3R1P A;  4DS7 A;  1REC A;  2M3W A;  1K9K A;  1XK4 C;  1KK7 Z;  3EK8 A;  4M2P A;  1LA0 A;  3FIA A;  4OKH A;  1KSM A;  1W7I B;  2KAV A;  1YVL A;  5GQQ C;  5CPV A;  2QEB A;  1Y6W A;  1OOF A;  2BCA A;  2ZN8 A;  3UNW A;  1K93 D;  1UHI A;  3LK1 A;  3S0D A;  1GM0 A;  1NP8 A;  4I5N B;  4GUK A;  5FI6 A;  2ISD A;  1U5I B;  1TIZ A;  5D7F A;  1QLK A;  2QEO A;  3TS5 B;  2L5X B;  2LHI A;  2COL B;  3NHT A;  1EXR A;  4JPZ B;  1XFW O;  3AKA A;  1DJH A;  2GV5 A;  4C0K A;  2K2F A;  4CFQ A;  1SY9 A;  3CZT X;  4PHN A;  1K8U A;  4TNC A;  2QEH A;  1EJ3 A;  1TWO A;  3BYA A;  2LAN A;  4PHM A;  1SSE B;  2LMT A;  1SBJ A;  3GK1 A;  1KCY A;  4KYN A;  2QDI A;  3PN7 B;  1IJ6 A;  1TN4 A;  4MRY A;  1DEK A;  1G4Y R;  2I18 A;  1S26 D;  1XFY O;  2P71 A;  2BE4 A;  2GTE A;  2PSR A;  1F70 A;  1B8L A;  1Y1U A;  1HQV A;  1MR8 A;  2KNE A;  1R6P A;  3EKJ A;  2JQ6 A;  3VB1 A;  3I5F C;  3RLZ A;  1DEL A;  3ZWH A;  2BCB A;  1ZOT B;  2LV7 A;  1B4C A;  3BFB A;  3DF0 A;  3CZ1 A;  1TNX A;  1W7J B;  2O60 A;  1IIO A;  1V1G A;  3FE6 A;  2MRD A;  1UHH A;  1KWO B;  1XK4 A;  2L51 A;  2LNK A;  1SCM C;  1SL9 A;  3CR2 A;  4N1G A;  2L0P A;  3D77 A;  4WQ3 A;  1A4P A;  2TN4 A;  4FQO A;  1L7Z A;  1EG3 A;  4MN0 A;  2SAS A;  1A2X A;  1YUR A;  3I5G B;  5I2Q A;  1QXP A;  1BT6 A;  5PAL A;  1QX7 A;  3D10 A;  1IGV A;  3O4Y A;  4HRH A;  3FWC A;  4YGB B;  5JOL A;  3DY9 A;  3EKH A;  4I5K A;  4MBE A;  4DRW A;  1D1O A;  2LVV A;  3PM8 A;  4YBH B;  1DT7 B;  3S0A A;  3NSI A;  1CMG A;  4I5L B;  3VGO A;  1TCF A;  2BBN A;  1DJX A;  4YI8 A;  1OMR A;  1RFJ A;  1QAS A;  1SR6 B;  2LE9 B;  5JJG A;  1OSA A;  2ZND A;  4QJ3 B;  2GGZ A;  1XFX O;  5F6T A;  1XVJ A;  4WQ2 A;  5DKR A;  1WRL A;  1F8H A;  4MRX A;  3TUY B;  3WHU B;  1JF0 A;  1UHN A;  2LUC A;  1ZFS A;  4F7F A;  1MXE A;  4GNK B;  5I94 A;  1H8B A;  4A4C A;  2WCK A;  1VRK A;  3EK4 A;  2M9G A;  3NSL A;  4ZCU A;  3I5H B;  1SL8 A;  1ALW A;  2KI6 D;  2SCP A;  3LK0 A;  3DF0 B;  1OZS A;  1OMV A;  2G2B A;  2MJW B;  1C3Z A;  1AP4 A;  2LLU A;  1B1G A;  1NX1 A;  3VRO A;  2I7A A;  4NDC A;  2ZN9 A;  2A4J A;  4GBA A;  1AHR A;  2KHN A;  3PAT A;  2KAY A;  2AAO A;  1BR1 B;  1T14 A;  5CSN A;  3PLF B;  4INX A;  2WCH A;  3D74 A;  1QVI Z;  3PSR A;  2KFF A;  1XFR A;  4DIR A;  4MZL A;  1N2D A;  2E30 A;  2JC2 A;  3GK2 A;  4QJ5 B;  3L47 A;  1TNP A;  2LMV A;  2Y1M A;  1NX3 A;  2JXL A;  2MA2 A;  1JF2 A;  3SG6 A;  5I8N A;  1F71 A;  2BNX A;  1V1F A;  1R2U A;  1YX7 A;  3IQQ A;  1UWO A;  1SPY A;  2M29 A;  1Y1A A;  2KFH A;  2WCE A;  2IS9 A;  1SR6 C;  2H61 A;  1Z2C B;  2K60 A;  2L5Y A;  2FJY A;  4YGD B;  1MQ1 A;  1XYD A;  3BFH A;  2LLS A;  1TUZ A;  2Q91 A;  4YRU A;  1J7O A;  1M63 B;  1PRW A;  4PDZ A;  3CWG A;  3S0B A;  1DTL A;  1KFU S;  2JUL A;  2KAX A;  1IWQ A;  2Q4U A;  3EK7 A;  1K94 A;  1SW8 A;  3I5H C;  3KPX A;  4F0Z B;  5ER5 A;  2K2A A;  2LVJ A;  2K7C A;  2M7L A;  3I5F B;  4P2Y B;  3CTN A;  1QV1 A;  2KSP A;  2WC8 A;  4ZCV A;  5FYX A;  1MF8 B;  2EGD A;  2NZ0 A;  3CYZ A;  1CFC A;  3SJS A;  1DF0 A;  1CLB A;  1CM1 A;  1SL7 A;  3O4X A;  3TDU A;  1GQM A;  1NCZ A;  2ZFD A;  4A4B A;  3JTD C;  2LC5 A;  4INW A;  5TNC A;  1ORG A;  2WCF A;  1A75 A;  3PJI A;  1SCM B;  4L9M A;  2K7B A;  3SG4 A;  5AFP A;  1B7T Y;  3A8R A;  3IVT A;  1L2O C;  4XJK A;  1NPQ A;  1RRO A;  2EC6 C;  2PQL A;  3NXA A;  2JOJ A;  1BJF A;  2JRF A;  4CLN A;  5I2O A;  5CSF A;  2OTG C;  1QX2 A;  2WC6 A;  3CDN A;  4ORB B;  2LUX A;  4D1E A;  2JTZ A;  1Y1X A;  1N65 A;  1ALV A;  3BQ3 A;  3JVT C;  4IJ7 A;  1CKK A;  3AAJ A;  4M2Q A;  2JT0 A;  2KYF A;  1CFF A;  1BU3 A;  3PM2 A;  4P5O E;  3DVJ A;  1WLM A;  1MWN A;  3ICB A;  1WRK A;  3AKB A;  3NHI A;  1LKJ A;  1ZUZ A;  4M2O A;  3SS3 A;  1NUB A;  1QAT A;  1YR5 A;  2NCO A;  5D3O A;  4MZJ A;  1M45 A;  2CT9 A;  2WCM A;  3LLE A;  4MSP A;  3R1V A;  4NQG A;  1YUU A;  1SCV A;  3D76 A;  1JBA A;  2BCX A;  1DF0 B;  1S36 A;  2I94 A;  5I2L A;  3Q8I A;  2F8P A;  3K1E A; 
#chains in the Genus database with same CATH homology
 1EH2 A;  2NXQ A;  4CFR A;  1A75 B;  1PSR A;  1M46 A;  2D8N A;  4HRE E;  3SG7 A;  1BLQ A;  3VRP A;  1UP5 A;  4XJK B;  1S6I A;  2BE6 A;  3BXK A;  2PVB A;  4I5J A;  3OB1 B;  4CPV A;  1OOJ A;  1J55 A;  2AUC A;  2R2I A;  1AUI B;  4N1F A;  1S5G Y;  1NX0 A;  1PUL A;  1KFX S;  1QLS A;  1CTR A;  1G8I A;  3LCP C;  2L4H A;  3BOW A;  2M97 A;  2H61 C;  1WDC C;  4GFT A;  1B7T Z;  3OX6 A;  1K95 A;  3KHE A;  1SNL A;  1YX8 A;  1C7V A;  3CR4 X;  1NIW A;  2MLE C;  3LL8 B;  4DCK A;  1TOP A;  1AJ4 A;  4PE4 A;  4AQJ A;  1XA5 A;  3KO0 A;  5KSZ A;  4E68 A;  2HPS A;  2K7O A;  3D0Y A;  1G33 A;  2FOT A;  4BY5 A;  1DGU A;  4GGF A;  1NCX A;  1GGW A;  5CSJ A;  1B9A A;  2LCP A;  1J7P A;  1DGV A;  1CDM A;  1RTP 1;  1B8C A;  1QTX A;  1UUS A;  2ZNE A;  3JTD B;  1LXF C;  3NSK A;  3OP0 A;  1F4O A;  5DKQ A;  1NWD A;  1K90 D;  1A29 A;  2K61 A;  2FCD A;  1L2O B;  1XFV O;  2KDH A;  2EC6 B;  3DVE A;  3O78 A;  3OB2 B;  5B8I B;  4C0J A;  2HQW A;  1AJ5 A;  1M39 A;  2OTG B;  3WXA A;  1IRJ A;  1YUT A;  1KK8 C;  5K89 A;  3NSO A;  1LA3 A;  5BPJ A;  2CNP A;  1TTX A;  3JVT B;  2OS8 C;  1K9P A;  2KI6 C;  4ORC B;  1J1E A;  1TRF A;  1CFD A;  1FBV A;  2FCE A;  2KQY A;  4OR9 B;  4C0L A;  2NLN A;  1Q80 A;  2F33 A;  5ER4 X;  2CCM A;  1FI6 A;  1DJW A;  2LAP A;  3D0Y B;  1B8R A;  3O2P A;  3O6B A;  4R1E A;  5HYD A;  1DJY A;  4GPL B;  4QJ4 B;  1S1E A;  3BUW B;  1EG4 A;  2LLT A;  2K7D A;  2RGI A;  3SIA A;  3BUM B;  1QIV A;  1QX5 B;  4MEW A;  1YRT B;  2KGB C;  1K9U A;  2LVI A;  2O5G A;  3WHT B;  5HKY A;  1JC2 A;  1RWY A;  2CXJ A;  1KQM C;  2WND A;  5J3X A;  4Q04 A;  5AXI A;  3SG5 A;  1FI5 A;  1LIN A;  2JNX A;  1F55 A;  2BKI B;  1IG5 A;  1RK9 A;  1ZMZ A;  2HQ8 A;  4OCI A;  2M0R A;  1TNW A;  4USL A;  2B1U A;  2LP3 A;  1JUO A;  1PVB A;  4U8D A;  3BUX B;  1NSH A;  1IQ5 A;  1NYA A;  1UHJ A;  1YTZ C;  2F2P A;  2KI4 C;  2MHH A;  1CM4 A;  1JFK A;  2CBL A;  3FS7 A;  2L4I A;  2JXC A;  3BUN B;  1XFZ O;  2L98 A;  3PFV A;  1SK6 D;  4JWQ A;  1DVI A;  1WDC B;  1PK0 D;  2M8U A;  2JZI A;  3SG3 A;  5AER A;  1CDL A;  1H4B A;  1WRZ A;  2KFG A;  3H4S E;  3SG2 A;  2Y4Q A;  3RM1 A;  1DJG A;  4PHJ A;  2KQ6 A;  2KOT A;  1CB1 A;  1C7W A;  1MUX A;  2JU0 A;  4UPG A;  1OE9 B;  2HET A;  1JSA A;  4YI9 A;  1FW4 A;  2G9B A;  2JNF A;  3PAL A;  2MLF C;  1E8A A;  4GGF C;  1EL4 A;  1Y0V H;  3DD4 A;  3HX4 A;  1S3P A;  3DVK A;  3DVM A;  1QIW A;  4IL1 A;  3VRQ A;  1K2H A;  2JTT A;  3BUO B;  1N0Y A;  3C1V A;  3KF9 A;  2M7N A;  2M49 B;  2PAS A;  4CID A;  1GGZ A;  4MLW A;  1X02 A;  4AOM A;  1CFP A;  2QPT A;  4ICB A;  3AAK A;  2BL0 B;  2OPO A;  1KFU L;  2M1U A;  1NCY A;  1JFJ A;  2KBI A;  4PE0 A;  1DJZ A;  1MHO A;  3F45 A;  1CMF A;  3I5I C;  2Y1N A;  3TDI A;  1DJI A;  2F2O A;  1KK8 B;  4PAL A;  1QS7 A;  2F3Y A;  1QVI Y;  1UUR A;  2OS8 B;  5AEQ A;  3OX5 A;  4NDD A;  1BOD A;  5IBW A;  5HLV A;  1TNQ A;  2L50 A;  1DMO A;  2MAZ A;  5AAN A;  3GOF A;  1LVC D;  1OZO A;  3OHM B;  1IJ5 A;  1CDP A;  2ZRT A;  2KGR A;  4MZK A;  2CTN A;  3MSE B;  1S6C A;  1MXL C;  3TS5 C;  1OQP A;  2K8M B;  3EVR A;  1XFU O;  4HSZ A;  2P6B B;  1J7R A;  2JT3 A;  1A03 A;  3IF7 A;  2QAC A;  5KTY A;  1AK8 A;  2BKH B;  4YGA A;  1CLM A;  2GGM A;  3A4U B;  3CS1 A;  4BY4 A;  2LHL A;  2DOQ A;  1KQM B;  1CDN A;  1BR4 B;  3IQO A;  1PAL A;  1CNP A;  4ORA B;  1GJY A;  1QV0 A;  1K96 A;  1ODB A;  2LM5 A;  4PHK A;  1BF5 A;  4XYN A;  5KU1 A;  2WCB A;  4ETO A;  3SIB A;  4WRI A;  2H2K A;  3K21 A;  2JWW A;  3EVV A;  1PSB A;  3PN7 C;  1J7Q A;  1SRA A;  2BL0 C;  4PE1 A;  2KYC A;  2LVK A;  1KK7 Y;  1XO5 A;  2BBM A;  2KI4 B;  4N5X A;  1JWD A;  2PAL A;  3VRR A;  1QJT A;  2LP2 A;  3BOW B;  3CGA A;  2KBM A;  2ZKM X;  4YGC B;  1SMG A;  4DUQ A;  2F3Z A;  4NDB A;  2NCP A;  1KQV A;  2AMI A;  1CLL A;  4HRG A;  1S6J A;  1F4Q A;  2MBX A;  1J1D A;  1S5G Z;  1YRU B;  3WNX B;  5G08 A;  1F54 A;  1NX2 A;  3HCM A;  1KSO A;  1SKT A;  2M1K B;  1FPW A;  1KWO C;  1IH0 A;  4OVN F;  1YUS A;  2JT8 A;  3CR5 X;  5CSI A;  1KFX L;  2VRG A;  3I5G C;  1YVH A;  2JPT A;  4FTG A;  2LMU A;  2WOS A;  3GK4 X;  1BMO A;  3TZ1 A;  1WY9 A;  1U5I A;  3VRN A;  1FF1 A;  3CLN A;  1OMD A;  1PVA A;  1SYM A;  3ZNI A;  5HKZ A;  4GGN A;  4GAO A;  2L2E A;  1BOC A;  5HKW A;  1BG1 A;  3QRX A;  2Y5I A;  1RJV A;  1HT9 A;  3EVU A;  2HF5 A;  1AVS A;  2K0J A;  3KEV A;  2EHB A;  3TUY C;  1ZAC A;  2I2R E;  2V53 A;  1TCO B;  4YGE B;  3FWB A;  2PRU A;  3E3R A;  2FJU B;  2ZRS A;  2PMY A;  4JQ0 D;  4MVF A;  1IQ3 A;  1UHK A;  3TDZ A;  4OV2 A;  2WOR A;  3I5I B;  5DKN A;  4PCW A;  4AQI A;  2BEC A;  5D69 A;  1B47 A;  3M0W A;  2E6W A;  5HLO A;  1IKU A;  1C07 A;  1WLZ A;  1M31 A;  4PE7 A;  4DS7 A;  1REC A;  2M3W A;  1K9K A;  1XK4 C;  1KK7 Z;  3EK8 A;  4M2P A;  1LA0 A;  3FIA A;  4OKH A;  1KSM A;  1W7I B;  2KAV A;  1YVL A;  5GQQ C;  5CPV A;  1Y6W A;  2BCA A;  2ZN8 A;  1K93 D;  1UHI A;  3LK1 A;  1NP8 A;  4I5N B;  4GUK A;  2ISD A;  1U5I B;  1TIZ A;  5D7F A;  1QLK A;  3TS5 B;  2L5X B;  2LHI A;  2COL B;  1EXR A;  4JPZ B;  1XFW O;  3AKA A;  1DJH A;  2GV5 A;  4C0K A;  2K2F A;  4CFQ A;  1SY9 A;  3CZT X;  4PHN A;  1K8U A;  4TNC A;  1EJ3 A;  3BYA A;  2LAN A;  4PHM A;  2LMT A;  1SBJ A;  3GK1 A;  1KCY A;  3PN7 B;  1IJ6 A;  1TN4 A;  4MRY A;  1G4Y R;  2I18 A;  1S26 D;  1XFY O;  2BE4 A;  2PSR A;  1F70 A;  1B8L A;  1Y1U A;  1HQV A;  1MR8 A;  2KNE A;  1R6P A;  3EKJ A;  2JQ6 A;  3I5F C;  3RLZ A;  3ZWH A;  2BCB A;  1ZOT B;  2LV7 A;  1B4C A;  3DF0 A;  1TNX A;  1W7J B;  2O60 A;  1V1G A;  2MRD A;  1UHH A;  1KWO B;  1XK4 A;  2L51 A;  2LNK A;  1SCM C;  1SL9 A;  3CR2 A;  4N1G A;  2L0P A;  4WQ3 A;  1A4P A;  2TN4 A;  4FQO A;  1L7Z A;  1EG3 A;  4MN0 A;  2SAS A;  1A2X A;  1YUR A;  3I5G B;  5I2Q A;  1QXP A;  1BT6 A;  5PAL A;  1QX7 A;  3D10 A;  1IGV A;  3O4Y A;  4HRH A;  3FWC A;  4YGB B;  5JOL A;  4DRW A;  3EKH A;  4I5K A;  4MBE A;  1D1O A;  2LVV A;  3PM8 A;  4YBH B;  1DT7 B;  3NSI A;  1CMG A;  4I5L B;  3VGO A;  1TCF A;  2BBN A;  1DJX A;  4YI8 A;  1OMR A;  1RFJ A;  1QAS A;  1SR6 B;  2LE9 B;  5JJG A;  1OSA A;  2ZND A;  4QJ3 B;  2GGZ A;  1XFX O;  5F6T A;  1XVJ A;  4WQ2 A;  5DKR A;  1WRL A;  1F8H A;  4MRX A;  3TUY B;  3WHU B;  1JF0 A;  1UHN A;  2LUC A;  1ZFS A;  1MXE A;  4GNK B;  1H8B A;  4A4C A;  1VRK A;  3EK4 A;  2M9G A;  3NSL A;  4ZCU A;  3I5H B;  1SL8 A;  1ALW A;  2KI6 D;  2SCP A;  3LK0 A;  3DF0 B;  1OZS A;  1OMV A;  2G2B A;  2MJW B;  1AP4 A;  2LLU A;  1B1G A;  1NX1 A;  3VRO A;  2I7A A;  4NDC A;  2ZN9 A;  2A4J A;  4GBA A;  1AHR A;  2KHN A;  3PAT A;  2KAY A;  2AAO A;  1BR1 B;  5CSN A;  3PLF B;  1QVI Z;  3PSR A;  2KFF A;  4DIR A;  4MZL A;  1N2D A;  2E30 A;  2JC2 A;  3GK2 A;  4QJ5 B;  1TNP A;  2LMV A;  2Y1M A;  1NX3 A;  2JXL A;  2MA2 A;  1JF2 A;  3SG6 A;  5I8N A;  1F71 A;  1V1F A;  1R2U A;  1YX7 A;  3IQQ A;  1UWO A;  1SPY A;  2M29 A;  1Y1A A;  2KFH A;  2WCE A;  2IS9 A;  1SR6 C;  2H61 A;  4YGD B;  1MQ1 A;  1XYD A;  2LLS A;  2Q91 A;  4YRU A;  1J7O A;  1M63 B;  1PRW A;  4PDZ A;  3CWG A;  1DTL A;  1KFU S;  2JUL A;  2KAX A;  1IWQ A;  2Q4U A;  3EK7 A;  1K94 A;  1SW8 A;  3I5H C;  3KPX A;  4F0Z B;  5ER5 A;  2K2A A;  2LVJ A;  2K7C A;  2M7L A;  3I5F B;  4P2Y B;  3CTN A;  1QV1 A;  2KSP A;  2WC8 A;  4ZCV A;  5FYX A;  1MF8 B;  2EGD A;  2NZ0 A;  1CFC A;  3SJS A;  1DF0 A;  1CLB A;  1CM1 A;  1SL7 A;  3TDU A;  1GQM A;  1NCZ A;  2ZFD A;  4A4B A;  3JTD C;  2LC5 A;  5TNC A;  2WCF A;  1A75 A;  1SCM B;  4L9M A;  2K7B A;  3SG4 A;  5AFP A;  1B7T Y;  3A8R A;  1L2O C;  4XJK A;  1NPQ A;  1RRO A;  2EC6 C;  3NXA A;  2JOJ A;  1BJF A;  2JRF A;  4CLN A;  5I2O A;  5CSF A;  2OTG C;  1QX2 A;  4D1E A;  4ORB B;  2LUX A;  2JTZ A;  1Y1X A;  1N65 A;  1ALV A;  3BQ3 A;  3JVT C;  1CKK A;  3AAJ A;  4M2Q A;  2JT0 A;  2KYF A;  1CFF A;  1BU3 A;  4P5O E;  3DVJ A;  1WLM A;  1MWN A;  3ICB A;  1WRK A;  3AKB A;  1LKJ A;  1ZUZ A;  4M2O A;  1NUB A;  1QAT A;  1YR5 A;  2NCO A;  4MZJ A;  1M45 A;  2CT9 A;  3LLE A;  4MSP A;  4NQG A;  1YUU A;  1SCV A;  1JBA A;  2BCX A;  1DF0 B;  1S36 A;  2I94 A;  5I2L A;  2F8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...