3TDZA

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tdzA01
3CWGA 1PULA 2I94A 3PN7B 3I5HC 2L2EA 1JFJA 1F8HA 3I5GC 2CTNA 3WHUB 2JZIA 3SIBA 1S5GY 1L2OC 3SG7A 2M29A 1BJFA 1J1EA 1XFYO 1C07A 3PSRA 4CFRA 1SY9A 4GUKA 1AK8A 2H2KA 4PE4A 1KSOA 3BOWA 2LVVA 2PMYA 1A2XA 2Q4UA 1K96A 1E8AA 1OZSA 4ORAB 1DMOA 2SCPA 3SG3A 2L51A 2M1KB 3TUYB 2LP2A 3SIAA 4AOMA 1B8CA 4OKHA 1IQ5A 4PHJA 2K2FA 1ZOTB 2PASA 1A4PA 1YX8A 4NDDA 1MXEA 1Y0VH 1SNLA 4C0JA 2M9GA 1JFKA 5CSFA 1NUBA 1R6PA 1TNWA 3PATA 3WXAA 2Y4QA 3VROA 5GQQC 2WNDA 1ODBA 1SRAA 1MXLC 1B1GA 1JWDA 2CBLA 1SL7A 2R2IA 1AJ4A 4GFTA 4QJ3B 1MWNA 5AANA 3CTNA 1XFZO 3GOFA 1J7PA 2KI6C 4C0LA 4HREE 4DUQA 3JVTC 1UHKA 5DKNA 1XK4C 1QXPA 2L5XB 1N65A 1IJ5A 2KAXA 1N0YA 2K2AA 3M0WA 4PHNA 1L7ZA 1GGWA 2KOTA 1H8BA 2KQ6A 1NWDA 1FBVA 1WLZA 1TTXA 2K61A 2KFFA 5CSNA 1B47A 1LVCD 2P6BB 3BUNB 1WY9A 1XFWO 3NSLA 4NQGA 3TDIA 1EL4A 1U5IA 1KK8B 2KAVA 3O6BA 5HLOA 1NX3A 3ZNIA 1YURA 4CFQA 4DIRA 1K9PA 3A8RA 2BBMA 3VRQA 1MUXA 1NIWA 2KI6D 1J7RA 1RK9A 1CMGA 3JTDB 5HYDA 1DTLA 2CXJA 2ZKMX 1TOPA 2KI4C 2MA2A 3BUXB 3LCPC 2MLFC 2KFHA 1TCFA 1VRKA 2EC6B 3I5FC 1QLKA 2KBMA 4OCIA 4YGDB 3CR4X 1OQPA 4NDBA 4HRGA 2AMIA 2BL0B 2KHNA 2OTGC 4N1FA 4Q04A 1EG4A 1M31A 1QTXA 5JJGA 1KK7Y 5G08A 2ISDA 3PLFB 2JULA 1WRLA 1B7TY 3AKAA 2FJUB 4F0ZB 2EGDA 1IGVA 3DF0B 1QS7A 2LMTA 1K9UA 4R1EA 1M45A 3BYAA 1K8UA 2QPTA 2WCEA 1KFXL 5HKZA 3DVKA 4A4BA 1U5IB 1S6JA 3KEVA 4XYNA 4MZLA 3DVEA 3QRXA 1SBJA 2KFGA 2BECA 2JXLA 3I5GB 1K2HA 1OMDA 2SASA 3DD4A 3RLZA 4OV2A 3VRRA 1L2OB 1PVAA 1FI6A 1NCYA 1UUSA 1Y1UA 1RWYA 1NX1A 5D69A 2JOJA 1LA3A 2A4JA 4JWQA 4YGCB 2LHIA 4HSZA 1XA5A 3EK8A 3ICBA 2LNKA 4D1EA 1G33A 2KGBC 5KTYA 1OOJA 3SG2A 3BQ3A 1RECA 2K7CA 2LVJA 4I5KA 1H4BA 1PRWA 2JT0A 1NX0A 4MEWA 1XVJA 1A75B 2M49B 3KO0A 2PRUA 1KQMB 1IQ3A 1JUOA 4ZCVA 1QV0A 4USLA 1QIWA 2V53A 4M2PA 4QJ4B 4MRYA 1CDLA 3NXAA 2TN4A 1SR6B 1DJYA 3HX4A 1EH2A 1F70A 1YVLA 5CSIA 5PALA 4OR9B 1CDMA 2G2BA 2WORA 1SYMA 1MF8B 2Y1MA 1CFCA 1YTZC 1KWOB 2NZ0A 4IL1A 2ZRSA 3D0YA 4JPZB 1NP8A 2L4HA 1ALVA 1TRFA 1RFJA 5F6TA 4CPVA 1IJ6A 1KSMA 1DJIA 3I5IC 4XJKB 1LINA 5HKWA 4C0KA 1TCOB 2K0JA 5ER4X 1JF2A 3KPXA 5I2OA 5CSJA 3RM1A 1FW4A 1SKTA 2JWWA 2Q91A 1QV1A 1Y1AA 1QX2A 2M7LA 3SG4A 2IS9A 1WLMA 4I5NB 5AERA 4WQ2A 4PE1A 2H61A 2M3WA 2HETA 1GJYA 2CT9A 2BCBA 4PHKA 4GGFA 1S5GZ 4MN0A 1CMFA 4L9MA 3PM8A 2BCAA 1IKUA 2LVKA 3IQQA 1F55A 1CLLA 3BXKA 1F54A 1B4CA 2COLB 1S3PA 2FCDA 2MJWB 2VRGA 1GQMA 1FI5A 2KNEA 4ETOA 1DJWA 1KQVA 2NCOA 3WNXB 1KFXS 2BKHB 1PVBA 1BR1B 1M39A 2LCPA 2AUCA 3D0YB 3DF0A 3GK2A 5J3XA 3OB1B 3TDZA 1C7VA 1SCMC 1KFUL 1ALWA 1LA0A 1SL8A 2JQ6A 1B9AA 2O60A 1K90D 1EJ3A 1EXRA 2F8PA 2GGMA 4A4CA 1V1GA 2B1UA 1CLBA 2ZNDA 1JSAA 1M63B 2LM5A 4YI9A 4GGNA 2OTGB 3CZTX 1QJTA 4WQ3A 1IG5A 4AQJA 2KDHA 3LK1A 1Q80A 5CPVA 2K7OA 4ZCUA 1S1EA 2PSRA 4BY5A 1G4YR 2HQ8A 1OSAA 2WCBA 1KCYA 1MQ1A 4WRIA 3OHMB 1DGUA 2KAYA 2LV7A 3GK4X 2LUXA 2EHBA 1UHJA 5I8NA 1WDCB 1A29A 2HQWA 1XFUO 5I2LA 2MAZA 2KSPA 1Y6WA 4MLWA 2BE6A 3TDUA 2JU0A 4FTGA 4U8DA 1PSRA 5AFPA 1A75A 2M8UA 1J1DA 1IWQA 1D1OA 2Y5IA 3GK1A 4UPGA 1WRZA 4E68A 1CB1A 1EG3A 1NX2A 3EVVA 3TS5B 4YGAA 1CFFA 2RGIA 2CCMA 2LUCA 1QX7A 2LLTA 3AAJA 3C1VA 2L50A 2NXQA 3VRNA 1F71A 1YR5A 1YRUB 4GNKB 1AJ5A 1DGVA 3OB2B 2F3ZA 3EVRA 1S36A 2LVIA 3OX5A 3I5HB 1QATA 1QVIY 1SL9A 2L4IA 3FWCA 1YRTB 4XJKA 1XO5A 2JXCA 3K21A 1DJGA 2DOQA 5KU1A 4JQ0D 1F4OA 1QLSA 2ZRTA 2OPOA 1KK7Z 3H4SE 4MRXA 1DVIA 3E3RA 1IH0A 2KBIA 3JTDC 3PFVA 5D7FA 1AVSA 3CR5X 1DT7B 1CDNA 1K95A 1B7TZ 2CNPA 1NCXA 3SG5A 3VGOA 3KHEA 2BCXA 2F2PA 4PDZA 4QJ5B 2F2OA 1YUSA 1RTP1 2BL0C 2MBXA 2M97A 2GV5A 1B8LA 1TIZA 1WRKA 2KQYA 4HRHA 2M0RA 3BUOB 1A03A 4PHMA 3CS1A 4MVFA 2O5GA 1LKJA 1KFUS 1SPYA 1W7JB 2MRDA 2ZNEA 2M7NA 3O4YA 4AQIA 1AUIB 2E30A 2JNXA 3BUWB 3FS7A 1OZOA 1BT6A 2F3YA 1MR8A 1N2DA 1CM1A 4GAOA 1JF0A 3NSOA 1ZMZA 4I5LB 4MSPA 1YVHA 1DJXA 4N5XA 1CFPA 1F4QA 1MHOA 2OS8C 2E6WA 3EK4A 1TNPA 3CR2A 4P2YB 1UHHA 2LAPA 4ICBA 1PSBA 2JRFA 3JVTB 1K94A 3CLNA 1OE9B 1V1FA 1YX7A 2JTTA 3LLEA 2LMUA 1YUTA 4CLNA 2LC5A 1TNQA 2F33A 5K89A 1SCMB 1DJHA 3AKBA 5I2QA 1ZUZA 4ORCB 1PALA 1XFVO 5DKRA 1C7WA 1BG1A 3PN7C 3DVJA 1BODA 2L0PA 1KQMC 4M2QA 4YGBB 3FWBA 1K9KA 1SCVA 1W7IB 4FQOA 1CNPA 1B8RA 1SR6C 1TN4A 4CIDA 3OP0A 2BE4A 1UHNA 2WCFA 4YGEB 4YI8A 1CM4A 1PK0D 1UP5A 3LL8B 5BPJA 1JC2A 2JTZA 1NSHA 1OMVA 3TZ1A 2GGZA 1KWOC 2PVBA 3EKHA 1Y1XA 2KI4B 2L98A 4DS7A 3PALA 5B8IB 1JBAA 1QX5B 3I5FB 1K93D 1FF1A 3TUYC 1DF0A 1J7OA 2D8NA 2ZN8A 1QIVA 3LK0A 3NSIA 1SW8A 2MLEC 1BU3A 3DVMA 5KSZA 1XFXO 3HCMA 3MSEB 1R2UA 2HPSA 2ZFDA 1LXFC 3BOWB 2HF5A 3O2PA 4MZJA 2JC2A 4MBEA 4TNCA 3WHTB 2NCPA 1CTRA 1CLMA 1G8IA 1SMGA 2LMVA 5AEQA 1ZACA 1BOCA 1X02A 3SG6A 1CKKA 2QACA 4YRUA 3EVUA 3IF7A 4GBAA 4OVNF 1RROA 5IBWA 3D10A 1SK6D 2I18A 3ZWHA 1XYDA 2NLNA 1YUUA 2LP3A 4ORBB 1IRJA 3AAKA 1HQVA 5HLVA 1J7QA 2ZN9A 2JT3A 1CDPA 3O78A 2LE9B 2KYFA 4I5JA 1UWOA 4DRWA 4NDCA 2JNFA 1DF0B 2JT8A 1ZFSA 1J55A 1BLQA 1FPWA 1OMRA 1QASA 1CFDA 2LANA 4YBHB 2KYCA 2PALA 5ER5A 5JOLA 4BY4A 1NPQA 4PE0A 1HT9A 1KK8C 2AAOA 2K7BA 1TNXA 3SJSA 3IQOA 2BBNA 5FYXA 1RJVA 2H61C 1NCZA 2WC8A 4GPLB 4GGFC 1DJZA 2FOTA 4DCKA 1AP4A 3EKJA 2I2RE 2LHLA 3KF9A 5TNCA 2JPTA 1XK4A 2LLUA 1BR4B 1WDCC 1NYAA 2MHHA 4PE7A 1S6IA 1UHIA 2K7DA 1S26D 2EC6C 3BUMB 3CGAA 1UURA 4MZKA 4P5OE 4PALA 3A4UB 3F45A 3I5IB 2G9BA 2OS8B 2K8MB 5HKYA 3NSKA 2I7AA 2M1UA 1AHRA 1BMOA 1GGZA 1M46A 2LLSA 5AXIA 3OX6A 2FCEA 2Y1NA 1QVIZ 1S6CA 1BF5A 4N1GA 3TS5C 4PCWA 2KGRA 4M2OA 3FIAA 5DKQA 2BKIB 3VRPA 2WOSA 3EK7A
chains in the Genus database with same CATH superfamily
3CWGA 1PULA 2I94A 3PN7B 3I5HC 2L2EA 1JFJA 1F8HA 3I5GC 2CTNA 3WHUB 2JZIA 3CZ2A 3SIBA 1S5GY 1L2OC 3SG7A 5EL2A 2M29A 1BJFA 1J1EA 3SS4A 1XFYO 1C07A 3PSRA 4CFRA 1SY9A 4GUKA 1AK8A 1P28A 2H2KA 4PE4A 1KSOA 2QEOA 3BOWA 2LVVA 2PMYA 1A2XA 2Q4UA 1K96A 3OGNA 1E8AA 1OZSA 4ORAB 1DMOA 2SCPA 3L4LA 3SG3A 2L51A 2M1KB 3TUYB 2LP2A 1OOHA 1LS8A 3SIAA 4AOMA 1B8CA 4OKHA 1IQ5A 4PHJA 3PM2A 3L47A 2K2FA 1ZOTB 2P70A 2PASA 1A4PA 1YX8A 4NDDA 1MXEA 1Y0VH 2L2CA 1SNLA 4C0JA 2M9GA 1JFKA 5CSFA 1NUBA 1R6PA 1TNWA 3PATA 3BFHA 3WXAA 2Y4QA 3VROA 5GQQC 2WNDA 1ODBA 1SRAA 1MXLC 1B1GA 1JWDA 1OW4A 2CBLA 3CDNA 1SL7A 2R2IA 1AJ4A 4GFTA 4QJ3B 1MWNA 5AANA 3CTNA 1XFZO 5DICA 3GOFA 1J7PA 2KI6C 4C0LA 4HREE 3O4XA 4DUQA 3JVTC 3DYEA 1UHKA 5DKNA 1XK4C 1QXPA 2L5XB 1N65A 2BAPA 1IJ5A 2KAXA 1N0YA 2K2AA 3M0WA 4PHNA 1L7ZA 1GGWA 2KOTA 3K1EA 2KQ6A 1H8BA 1NWDA 1FBVA 1WLZA 1TTXA 2K61A 2KFFA 5CSNA 1B47A 1T14A 2WCJA 1LVCD 3BFAA 2P6BB 3BUNB 1WY9A 1XFWO 3NSLA 4NQGA 3TDIA 1EL4A 3EG5B 1U5IA 1KK8B 2KAVA 3O6BA 3PJIA 1NX3A 5HLOA 1YURA 3UNWA 3ZNIA 4CFQA 1K9PA 3A8RA 4DIRA 2BBMA 2WC6A 3VRQA 1MUXA 1OOGA 3S0FA 1NIWA 2KI6D 4IJ7A 1J7RA 1RK9A 1CMGA 2H8VA 3JTDB 5HYDA 1DTLA 2CXJA 2ZKMX 1TOPA 2KI4C 2MA2A 3BUXB 3LCPC 2MLFC 2KFHA 1QWVA 1TCFA 1VRKA 2EC6B 3I5FC 1QLKA 2KBMA 4OCIA 4YGDB 3CR4X 1OQPA 4NDBA 4HRGA 2AMIA 2BL0B 2KHNA 2OTGC 4N1FA 4Q04A 4JKTA 1EG4A 1M31A 1QTXA 3L4AA 1KK7Y 5G08A 5JJGA 1OOIX 1DEKA 3Q8IA 2ISDA 3PLFB 2JULA 1WRLA 1B7TY 3AKAA 3D76A 2FJUB 4F0ZB 2EGDA 1IGVA 3DF0B 1QS7A 2LMTA 1K9UA 4R1EA 1M45A 3BJHA 3BYAA 1K8UA 2QPTA 2WCEA 3B88A 3BFBA 3CABA 1KFXL 2GTEA 5HKZA 3DVKA 4A4BA 1U5IB 1S6JA 3KEVA 4XYNA 4MZLA 3DVEA 5HL1A 3QRXA 1C3ZA 5FI6A 1SBJA 2KFGA 2BECA 2JXLA 3I5GB 1K2HA 1OMDA 2SASA 3DD4A 3RLZA 4OV2A 3VRRA 1L2OB 1PVAA 3R1VA 3FE9A 1FI6A 1NCYA 1UUSA 1Y1UA 1RWYA 1NX1A 2BNXA 5D69A 4QJ4B 2JOJA 1LA3A 2A4JA 2L5YA 4JWQA 4JD9A 4YGCB 2LHIA 4HSZA 1XA5A 5FI7A 3EK8A 3ICBA 2LNKA 3DY9A 4D1EA 1G33A 2KGBC 5KTYA 2KPHA 1OOJA 3SG2A 4KYNA 1TUZA 3BQ3A 1RECA 2K7CA 2KLDA 2LVJA 4I5KA 1H4BA 1PRWA 2JT0A 1NX0A 3B86A 1XVJA 1A75B 2M49B 3KO0A 2PRUA 1KQMB 4MEWA 1JUOA 4INWA 1QV0A 2QEVA 1QIWA 2V53A 4M2PA 4USLA 4MRYA 1CDLA 4ZCVA 3NXAA 2TN4A 1SR6B 1DJYA 3HX4A 1EH2A 3DZTA 1F70A 3R1OA 1TWOA 1YVLA 5CSIA 5PALA 4OR9B 1CDMA 2G2BA 1SSEB 2WORA 1SYMA 1MF8B 2Y1MA 3SS3A 1CFCA 1YTZC 1KWOB 2NZ0A 4IL1A 2ZRSA 3D0YA 4JPZB 1NP8A 2L4HA 1ALVA 1TRFA 1RFJA 2WCLA 5F6TA 4CPVA 1IJ6A 1KSMA 1DJIA 3I5IC 4XJKB 1LINA 3B87A 5HKWA 1TCOB 4C0KA 2K0JA 5ER4X 1JF2A 3KPXA 5I2OA 5CSJA 2PYQA 3RM1A 1FW4A 1SKTA 2JWWA 2Q91A 1QV1A 1Y1AA 2P71A 3S0GA 3D77A 1QX2A 2M7LA 3SG4A 2IS9A 1WLMA 4I5NB 5AERA 4WQ2A 4PE1A 2H61A 2M3WA 2HETA 1GJYA 2CT9A 2BCBA 4PHKA 4GGFA 1S5GZ 4MN0A 1CMFA 4L9MA 3PM8A 2BCAA 1IKUA 2LVKA 3IQQA 1F55A 1CLLA 3BXKA 1F54A 1B4CA 2COLB 1S3PA 2FCDA 2MJWB 2VRGA 1GQMA 1FI5A 2KNEA 4ETOA 1DJWA 1KQVA 2NCOA 3WNXB 1KFXS 2BKHB 1PVBA 1BR1B 1M39A 2LCPA 2AUCA 3D0YB 3DF0A 3GK2A 1ORGA 3NGVA 3OB1B 3TDZA 1C7VA 1SCMC 1KFUL 1ALWA 1LA0A 1SL8A 3B7AA 2JQ6A 1B9AA 2O60A 1K90D 1EJ3A 1EXRA 2F8PA 2GGMA 4A4CA 1V1GA 2B1UA 1CLBA 2ZNDA 1JSAA 1M63B 2LM5A 4YI9A 4GGNA 2OTGB 3CZTX 2K60A 1QJTA 4WQ3A 1IG5A 1OOFA 4AQJA 2KDHA 3LK1A 1Q80A 5CPVA 2K7OA 4ZCUA 1S1EA 2PSRA 4BY5A 1G4YR 3SS5A 2HQ8A 1Z2CB 1OSAA 4INXA 2WCBA 1KCYA 1MQ1A 4WRIA 3OHMB 1DGUA 2KAYA 2LV7A 2WCKA 3GK4X 2LUXA 2EHBA 1UHJA 5I8NA 1WDCB 1A29A 2HQWA 3DXLA 1XFUO 5I2LA 2MAZA 2KSPA 1Y6WA 4MLWA 2BE6A 3TDUA 2JU0A 4FTGA 4U8DA 1PSRA 5AFPA 1A75A 2M8UA 1J1DA 1IWQA 1D1OA 1W9ZA 2Y5IA 3GK1A 4UPGA 1WRZA 4E68A 1CB1A 1EG3A 1NX2A 3EVVA 2WCMA 4YGAA 3TS5B 1CFFA 2RGIA 2CCMA 2LUCA 1QX7A 2LLTA 3AAJA 3C1VA 2L50A 2NXQA 3VRNA 1F71A 1YR5A 1YRUB 4GNKB 1AJ5A 1DGVA 3CZ0A 3OB2B 2F3ZA 3EVRA 1S36A 2LVIA 3OX5A 3I5HB 1QATA 1QVIY 1SL9A 1TUJA 2L4IA 3FWCA 1YRTB 2PQLA 4XJKA 1XO5A 2JXCA 3K21A 1DJGA 2DOQA 5KU1A 4JQ0D 1F4OA 1QLSA 2ZRTA 2OPOA 1KK7Z 3H4SE 4MRXA 1DVIA 3E3RA 1IH0A 2KBIA 3JTDC 3PFVA 5D7FA 1AVSA 3CR5X 3D74A 1DT7B 1CDNA 1K95A 1B7TZ 2CNPA 1NCXA 3SG5A 3VGOA 3KHEA 2BCXA 2F2PA 4PDZA 4QJ5B 2F2OA 1YUSA 1RTP1 2BL0C 2MBXA 1DQEA 2M97A 2GV5A 3S0EA 3D75A 1B8LA 1TIZA 1WRKA 3NHIA 2KQYA 4HRHA 2M0RA 3BUOB 1A03A 4PHMA 3CS1A 4MVFA 2O5GA 1LKJA 1KFUS 1SPYA 1W7JB 2MRDA 2ZNEA 2M7NA 3O4YA 4AQIA 1AUIB 2E30A 2FJYA 2JNXA 3BUWB 3FS7A 1OZOA 1BT6A 2F3YA 3UO9A 2QEHA 1MR8A 1N2DA 1CM1A 2JPOA 1JF0A 3NSOA 1ZMZA 3D78A 3CYZA 4GAOA 4I5LB 4MSPA 1YVHA 1DJXA 2WCHA 4N5XA 1CFPA 3B6XA 4F7FA 1F4QA 1MHOA 2OS8C 2YGUA 2E6WA 3EK4A 1TNPA 3CR2A 1DELA 4P2YB 3OBVA 1UHHA 2LAPA 4ICBA 1PSBA 2JRFA 3JVTB 1C3YA 1K94A 3CLNA 1OE9B 1V1FA 1YX7A 2JTTA 3LLEA 2LMUA 3R72A 1YUTA 4CLNA 2LC5A 1TNQA 2F33A 5K89A 1SCMB 1DJHA 3AKBA 5I2QA 1ZUZA 3S0AA 4ORCB 1IQ3A 1PALA 1XFVO 3QMEA 5DKRA 1C7WA 1BG1A 3PN7C 3DVJA 1BODA 2L0PA 1KQMC 4M2QA 1Z4HA 4YGBB 1IIOA 3FWBA 1K9KA 1SCVA 1W7IB 4FQOA 1CNPA 1B8RA 1SR6C 1TN4A 4CIDA 3OP0A 2BE4A 1UHNA 2WCFA 4YGEB 4YI8A 1CM4A 1PK0D 1UP5A 3LL8B 5BPJA 1JC2A 1XFRA 2JTZA 1NSHA 1OMVA 3TZ1A 3R1PA 3IVTA 4PT1A 1DC1A 2GGZA 1KWOC 2PVBA 3EKHA 1Y1XA 2KI4B 2L98A 4DS7A 3PALA 5B8IB 1JBAA 1QX5B 3I5FB 1K93D 1FF1A 3TUYC 1DF0A 1J7OA 2D8NA 2ZN8A 3V2LA 1QIVA 3LK0A 3NSIA 1SW8A 2MLEC 1BU3A 3DVMA 5KSZA 1XFXO 3HCMA 3MSEB 1R2UA 2HPSA 2WC5A 2ZFDA 1LXFC 3BOWB 2HF5A 3O2PA 4MZJA 2JC2A 4MBEA 4TNCA 3WHTB 2NCPA 1CTRA 1CLMA 1G8IA 1SMGA 2LMVA 5AEQA 1ZACA 1BOCA 1X02A 3SG6A 1CKKA 5D3OA 2QACA 3NHTA 3FE6A 4YRUA 3EVUA 3IF7A 4FQTA 4GBAA 4OVNF 1RROA 5IBWA 3D10A 1SK6D 2I18A 2QEBA 3ZWHA 1XYDA 2NLNA 1YUUA 2LP3A 4ORBB 1IRJA 3AAKA 1HQVA 5HLVA 1J7QA 2ZN9A 2JT3A 1CDPA 3O78A 2LE9B 3FE8A 2KYFA 4I5JA 1UWOA 4DRWA 4NDCA 2JNFA 5FI2A 1DF0B 2JT8A 1ZFSA 1J55A 1BLQA 3N7HA 3CZ1A 3S0BA 1FPWA 1OMRA 1QASA 1CFDA 2ERBA 2LANA 4YBHB 2KYCA 2PALA 5ER5A 5JOLA 4BY4A 1NPQA 4PE0A 1HT9A 1KK8C 5J3XA 3RZSA 4OZDA 2AAOA 2QDIA 2K7BA 1TNXA 3SJSA 3IQOA 2BBNA 5FYXA 1RJVA 2H61C 1NCZA 2WC8A 4GPLB 4GGFC 1DJZA 2FOTA 4DCKA 1AP4A 3S0DA 2KLEA 3EKJA 2I2RE 2LHLA 3KF9A 5TNCA 2JPTA 1XK4A 2LLUA 1BR4B 1WDCC 1NYAA 2MHHA 4PE7A 1S6IA 1UHIA 2K7DA 5I94A 1S26D 2EC6C 3BUMB 3CGAA 1UURA 4MZKA 4P5OE 4PALA 3A4UB 3F45A 3I5IB 2G9BA 2OS8B 2K8MB 5HKYA 3NSKA 2I7AA 3VB1A 2M1UA 1AHRA 1BMOA 1GGZA 1M46A 2LLSA 5AXIA 3OX6A 2FCEA 2Y1NA 3D73A 1QVIZ 1S6CA 1BF5A 1GM0A 4N1GA 3TS5C 4PCWA 2KGRA 4M2OA 3FIAA 5DKQA 2BKIB 3VRPA 2WOSA 3EK7A
chains in the Genus database with same CATH topology
3CWGA 1PULA 2I94A 3PN7B 3I5HC 2L2EA 1JFJA 1F8HA 3I5GC 2CTNA 3WHUB 2JZIA 3SIBA 1S5GY 1L2OC 3SG7A 2M29A 1BJFA 1J1EA 1XFYO 1C07A 3PSRA 4CFRA 1SY9A 4GUKA 1AK8A 2H2KA 4PE4A 1KSOA 3BOWA 2LVVA 2PMYA 1A2XA 2Q4UA 1K96A 1E8AA 1OZSA 4ORAB 1DMOA 2SCPA 3SG3A 2L51A 2M1KB 3TUYB 2LP2A 3SIAA 4AOMA 1B8CA 4OKHA 1IQ5A 4PHJA 2K2FA 1ZOTB 2PASA 1A4PA 1YX8A 4NDDA 1MXEA 1Y0VH 1SNLA 4C0JA 2M9GA 1JFKA 5CSFA 1NUBA 1R6PA 1TNWA 3PATA 3WXAA 2Y4QA 3VROA 5GQQC 2WNDA 1ODBA 1SRAA 1MXLC 1B1GA 1JWDA 2CBLA 1SL7A 2R2IA 1AJ4A 4GFTA 4QJ3B 1MWNA 5AANA 3CTNA 1XFZO 3GOFA 1J7PA 2KI6C 4C0LA 4HREE 4DUQA 3JVTC 1UHKA 5DKNA 1XK4C 1QXPA 2L5XB 1N65A 1IJ5A 2KAXA 1N0YA 2K2AA 3M0WA 4PHNA 1L7ZA 1GGWA 2KOTA 1H8BA 2KQ6A 1NWDA 1FBVA 1WLZA 1TTXA 2K61A 2KFFA 5CSNA 1B47A 1LVCD 2P6BB 3BUNB 1WY9A 1XFWO 3NSLA 4NQGA 3TDIA 1EL4A 1U5IA 1KK8B 2KAVA 3O6BA 5HLOA 1NX3A 3ZNIA 1YURA 4CFQA 4DIRA 1K9PA 3A8RA 2BBMA 3VRQA 1MUXA 1NIWA 2KI6D 1J7RA 1RK9A 1CMGA 3JTDB 5HYDA 1DTLA 2CXJA 2ZKMX 1TOPA 2KI4C 2MA2A 3BUXB 3LCPC 2MLFC 2KFHA 1TCFA 1VRKA 2EC6B 3I5FC 1QLKA 2KBMA 4OCIA 4YGDB 3CR4X 1OQPA 4NDBA 4HRGA 2AMIA 2BL0B 2KHNA 2OTGC 4N1FA 4Q04A 1EG4A 1M31A 1QTXA 5JJGA 1KK7Y 5G08A 2ISDA 3PLFB 2JULA 1WRLA 1B7TY 3AKAA 2FJUB 4F0ZB 2EGDA 1IGVA 3DF0B 1QS7A 2LMTA 1K9UA 4R1EA 1M45A 3BYAA 1K8UA 2QPTA 2WCEA 1KFXL 5HKZA 3DVKA 4A4BA 1U5IB 1S6JA 3KEVA 4XYNA 4MZLA 3DVEA 3QRXA 1SBJA 2KFGA 2BECA 2JXLA 3I5GB 1K2HA 1OMDA 2SASA 3DD4A 3RLZA 4OV2A 3VRRA 1L2OB 1PVAA 1FI6A 1NCYA 1UUSA 1Y1UA 1RWYA 1NX1A 5D69A 2JOJA 1LA3A 2A4JA 4JWQA 4YGCB 2LHIA 4HSZA 1XA5A 3EK8A 3ICBA 2LNKA 4D1EA 1G33A 2KGBC 5KTYA 1OOJA 3SG2A 3BQ3A 1RECA 2K7CA 2LVJA 4I5KA 1H4BA 1PRWA 2JT0A 1NX0A 4MEWA 1XVJA 1A75B 2M49B 3KO0A 2PRUA 1KQMB 1IQ3A 1JUOA 4ZCVA 1QV0A 4USLA 1QIWA 2V53A 4M2PA 4QJ4B 4MRYA 1CDLA 3NXAA 2TN4A 1SR6B 1DJYA 3HX4A 1EH2A 1F70A 1YVLA 5CSIA 5PALA 4OR9B 1CDMA 2G2BA 2WORA 1SYMA 1MF8B 2Y1MA 1CFCA 1YTZC 1KWOB 2NZ0A 4IL1A 2ZRSA 3D0YA 4JPZB 1NP8A 2L4HA 1ALVA 1TRFA 1RFJA 5F6TA 4CPVA 1IJ6A 1KSMA 1DJIA 3I5IC 4XJKB 1LINA 5HKWA 4C0KA 1TCOB 2K0JA 5ER4X 1JF2A 3KPXA 5I2OA 5CSJA 3RM1A 1FW4A 1SKTA 2JWWA 2Q91A 1QV1A 1Y1AA 1QX2A 2M7LA 3SG4A 2IS9A 1WLMA 4I5NB 5AERA 4WQ2A 4PE1A 2H61A 2M3WA 2HETA 1GJYA 2CT9A 2BCBA 4PHKA 4GGFA 1S5GZ 4MN0A 1CMFA 4L9MA 3PM8A 2BCAA 1IKUA 2LVKA 3IQQA 1F55A 1CLLA 3BXKA 1F54A 1B4CA 2COLB 1S3PA 2FCDA 2MJWB 2VRGA 1GQMA 1FI5A 2KNEA 4ETOA 1DJWA 1KQVA 2NCOA 3WNXB 1KFXS 2BKHB 1PVBA 1BR1B 1M39A 2LCPA 2AUCA 3D0YB 3DF0A 3GK2A 5J3XA 3OB1B 3TDZA 1C7VA 1SCMC 1KFUL 1ALWA 1LA0A 1SL8A 2JQ6A 1B9AA 2O60A 1K90D 1EJ3A 1EXRA 2F8PA 2GGMA 4A4CA 1V1GA 2B1UA 1CLBA 2ZNDA 1JSAA 1M63B 2LM5A 4YI9A 4GGNA 2OTGB 3CZTX 1QJTA 4WQ3A 1IG5A 4AQJA 2KDHA 3LK1A 1Q80A 5CPVA 2K7OA 4ZCUA 1S1EA 2PSRA 4BY5A 1G4YR 2HQ8A 1OSAA 2WCBA 1KCYA 1MQ1A 4WRIA 3OHMB 1DGUA 2KAYA 2LV7A 3GK4X 2LUXA 2EHBA 1UHJA 5I8NA 1WDCB 1A29A 2HQWA 1XFUO 5I2LA 2MAZA 2KSPA 1Y6WA 4MLWA 2BE6A 3TDUA 2JU0A 4FTGA 4U8DA 1PSRA 5AFPA 1A75A 2M8UA 1J1DA 1IWQA 1D1OA 2Y5IA 3GK1A 4UPGA 1WRZA 4E68A 1CB1A 1EG3A 1NX2A 3EVVA 3TS5B 4YGAA 1CFFA 2RGIA 2CCMA 2LUCA 1QX7A 2LLTA 3AAJA 3C1VA 2L50A 2NXQA 3VRNA 1F71A 1YR5A 1YRUB 4GNKB 1AJ5A 1DGVA 3OB2B 2F3ZA 3EVRA 1S36A 2LVIA 3OX5A 3I5HB 1QATA 1QVIY 1SL9A 2L4IA 3FWCA 1YRTB 4XJKA 1XO5A 2JXCA 3K21A 1DJGA 2DOQA 5KU1A 4JQ0D 1F4OA 1QLSA 2ZRTA 2OPOA 1KK7Z 3H4SE 4MRXA 1DVIA 3E3RA 1IH0A 2KBIA 3JTDC 3PFVA 5D7FA 1AVSA 3CR5X 1DT7B 1CDNA 1K95A 1B7TZ 2CNPA 1NCXA 3SG5A 3VGOA 3KHEA 2BCXA 2F2PA 4PDZA 4QJ5B 2F2OA 1YUSA 1RTP1 2BL0C 2MBXA 2M97A 2GV5A 1B8LA 1TIZA 1WRKA 2KQYA 4HRHA 2M0RA 3BUOB 1A03A 4PHMA 3CS1A 4MVFA 2O5GA 1LKJA 1KFUS 1SPYA 1W7JB 2MRDA 2ZNEA 2M7NA 3O4YA 4AQIA 1AUIB 2E30A 2JNXA 3BUWB 3FS7A 1OZOA 1BT6A 2F3YA 1MR8A 1N2DA 1CM1A 4GAOA 1JF0A 3NSOA 1ZMZA 4I5LB 4MSPA 1YVHA 1DJXA 4N5XA 1CFPA 1F4QA 1MHOA 2OS8C 2E6WA 3EK4A 1TNPA 3CR2A 4P2YB 1UHHA 2LAPA 4ICBA 1PSBA 2JRFA 3JVTB 1K94A 3CLNA 1OE9B 1V1FA 1YX7A 2JTTA 3LLEA 2LMUA 1YUTA 4CLNA 2LC5A 1TNQA 2F33A 5K89A 1SCMB 1DJHA 3AKBA 5I2QA 1ZUZA 4ORCB 1PALA 1XFVO 5DKRA 1C7WA 1BG1A 3PN7C 3DVJA 1BODA 2L0PA 1KQMC 4M2QA 4YGBB 3FWBA 1K9KA 1SCVA 1W7IB 4FQOA 1CNPA 1B8RA 1SR6C 1TN4A 4CIDA 3OP0A 2BE4A 1UHNA 2WCFA 4YGEB 4YI8A 1CM4A 1PK0D 1UP5A 3LL8B 5BPJA 1JC2A 2JTZA 1NSHA 1OMVA 3TZ1A 2GGZA 1KWOC 2PVBA 3EKHA 1Y1XA 2KI4B 2L98A 4DS7A 3PALA 5B8IB 1JBAA 1QX5B 3I5FB 1K93D 1FF1A 3TUYC 1DF0A 1J7OA 2D8NA 2ZN8A 1QIVA 3LK0A 3NSIA 1SW8A 2MLEC 1BU3A 3DVMA 5KSZA 1XFXO 3HCMA 3MSEB 1R2UA 2HPSA 2ZFDA 1LXFC 3BOWB 2HF5A 3O2PA 4MZJA 2JC2A 4MBEA 4TNCA 3WHTB 2NCPA 1CTRA 1CLMA 1G8IA 1SMGA 2LMVA 5AEQA 1ZACA 1BOCA 1X02A 3SG6A 1CKKA 2QACA 4YRUA 3EVUA 3IF7A 4GBAA 4OVNF 1RROA 5IBWA 3D10A 1SK6D 2I18A 3ZWHA 1XYDA 2NLNA 1YUUA 2LP3A 4ORBB 1IRJA 3AAKA 1HQVA 5HLVA 1J7QA 2ZN9A 2JT3A 1CDPA 3O78A 2LE9B 2KYFA 4I5JA 1UWOA 4DRWA 4NDCA 2JNFA 1DF0B 2JT8A 1ZFSA 1J55A 1BLQA 1FPWA 1OMRA 1QASA 1CFDA 2LANA 4YBHB 2KYCA 2PALA 5ER5A 5JOLA 4BY4A 1NPQA 4PE0A 1HT9A 1KK8C 2AAOA 2K7BA 1TNXA 3SJSA 3IQOA 2BBNA 5FYXA 1RJVA 2H61C 1NCZA 2WC8A 4GPLB 4GGFC 1DJZA 2FOTA 4DCKA 1AP4A 3EKJA 2I2RE 2LHLA 3KF9A 5TNCA 2JPTA 1XK4A 2LLUA 1BR4B 1WDCC 1NYAA 2MHHA 4PE7A 1S6IA 1UHIA 2K7DA 1S26D 2EC6C 3BUMB 3CGAA 1UURA 4MZKA 4P5OE 4PALA 3A4UB 3F45A 3I5IB 2G9BA 2OS8B 2K8MB 5HKYA 3NSKA 2I7AA 2M1UA 1AHRA 1BMOA 1GGZA 1M46A 2LLSA 5AXIA 3OX6A 2FCEA 2Y1NA 1QVIZ 1S6CA 1BF5A 4N1GA 3TS5C 4PCWA 2KGRA 4M2OA 3FIAA 5DKQA 2BKIB 3VRPA 2WOSA 3EK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWG A;  1PUL A;  2I94 A;  3PN7 B;  3I5H C;  2L2E A;  1JFJ A;  1F8H A;  3I5G C;  2CTN A;  3WHU B;  2JZI A;  3SIB A;  1S5G Y;  1L2O C;  3SG7 A;  2M29 A;  1BJF A;  1J1E A;  1XFY O;  1C07 A;  3PSR A;  4CFR A;  1SY9 A;  4GUK A;  1AK8 A;  2H2K A;  4PE4 A;  1KSO A;  3BOW A;  2LVV A;  2PMY A;  1A2X A;  2Q4U A;  1K96 A;  1E8A A;  1OZS A;  4ORA B;  1DMO A;  2SCP A;  3SG3 A;  2L51 A;  2M1K B;  3TUY B;  2LP2 A;  3SIA A;  4AOM A;  1B8C A;  4OKH A;  1IQ5 A;  4PHJ A;  2K2F A;  1ZOT B;  2PAS A;  1A4P A;  1YX8 A;  4NDD A;  1MXE A;  1Y0V H;  1SNL A;  4C0J A;  2M9G A;  1JFK A;  5CSF A;  1NUB A;  1R6P A;  1TNW A;  3PAT A;  3WXA A;  2Y4Q A;  3VRO A;  5GQQ C;  2WND A;  1ODB A;  1SRA A;  1MXL C;  1B1G A;  1JWD A;  2CBL A;  1SL7 A;  2R2I A;  1AJ4 A;  4GFT A;  4QJ3 B;  1MWN A;  5AAN A;  3CTN A;  1XFZ O;  3GOF A;  1J7P A;  2KI6 C;  4C0L A;  4HRE E;  4DUQ A;  3JVT C;  1UHK A;  5DKN A;  1XK4 C;  1QXP A;  2L5X B;  1N65 A;  1IJ5 A;  2KAX A;  1N0Y A;  2K2A A;  3M0W A;  4PHN A;  1L7Z A;  1GGW A;  2KOT A;  1H8B A;  2KQ6 A;  1NWD A;  1FBV A;  1WLZ A;  1TTX A;  2K61 A;  2KFF A;  5CSN A;  1B47 A;  1LVC D;  2P6B B;  3BUN B;  1WY9 A;  1XFW O;  3NSL A;  4NQG A;  3TDI A;  1EL4 A;  1U5I A;  1KK8 B;  2KAV A;  3O6B A;  5HLO A;  1NX3 A;  3ZNI A;  1YUR A;  4CFQ A;  4DIR A;  1K9P A;  3A8R A;  2BBM A;  3VRQ A;  1MUX A;  1NIW A;  2KI6 D;  1J7R A;  1RK9 A;  1CMG A;  3JTD B;  5HYD A;  1DTL A;  2CXJ A;  2ZKM X;  1TOP A;  2KI4 C;  2MA2 A;  3BUX B;  3LCP C;  2MLF C;  2KFH A;  1TCF A;  1VRK A;  2EC6 B;  3I5F C;  1QLK A;  2KBM A;  4OCI A;  4YGD B;  3CR4 X;  1OQP A;  4NDB A;  4HRG A;  2AMI A;  2BL0 B;  2KHN A;  2OTG C;  4N1F A;  4Q04 A;  1EG4 A;  1M31 A;  1QTX A;  5JJG A;  1KK7 Y;  5G08 A;  2ISD A;  3PLF B;  2JUL A;  1WRL A;  1B7T Y;  3AKA A;  2FJU B;  4F0Z B;  2EGD A;  1IGV A;  3DF0 B;  1QS7 A;  2LMT A;  1K9U A;  4R1E A;  1M45 A;  3BYA A;  1K8U A;  2QPT A;  2WCE A;  1KFX L;  5HKZ A;  3DVK A;  4A4B A;  1U5I B;  1S6J A;  3KEV A;  4XYN A;  4MZL A;  3DVE A;  3QRX A;  1SBJ A;  2KFG A;  2BEC A;  2JXL A;  3I5G B;  1K2H A;  1OMD A;  2SAS A;  3DD4 A;  3RLZ A;  4OV2 A;  3VRR A;  1L2O B;  1PVA A;  1FI6 A;  1NCY A;  1UUS A;  1Y1U A;  1RWY A;  1NX1 A;  5D69 A;  2JOJ A;  1LA3 A;  2A4J A;  4JWQ A;  4YGC B;  2LHI A;  4HSZ A;  1XA5 A;  3EK8 A;  3ICB A;  2LNK A;  4D1E A;  1G33 A;  2KGB C;  5KTY A;  1OOJ A;  3SG2 A;  3BQ3 A;  1REC A;  2K7C A;  2LVJ A;  4I5K A;  1H4B A;  1PRW A;  2JT0 A;  1NX0 A;  4MEW A;  1XVJ A;  1A75 B;  2M49 B;  3KO0 A;  2PRU A;  1KQM B;  1IQ3 A;  1JUO A;  4ZCV A;  1QV0 A;  4USL A;  1QIW A;  2V53 A;  4M2P A;  4QJ4 B;  4MRY A;  1CDL A;  3NXA A;  2TN4 A;  1SR6 B;  1DJY A;  3HX4 A;  1EH2 A;  1F70 A;  1YVL A;  5CSI A;  5PAL A;  4OR9 B;  1CDM A;  2G2B A;  2WOR A;  1SYM A;  1MF8 B;  2Y1M A;  1CFC A;  1YTZ C;  1KWO B;  2NZ0 A;  4IL1 A;  2ZRS A;  3D0Y A;  4JPZ B;  1NP8 A;  2L4H A;  1ALV A;  1TRF A;  1RFJ A;  5F6T A;  4CPV A;  1IJ6 A;  1KSM A;  1DJI A;  3I5I C;  4XJK B;  1LIN A;  5HKW A;  4C0K A;  1TCO B;  2K0J A;  5ER4 X;  1JF2 A;  3KPX A;  5I2O A;  5CSJ A;  3RM1 A;  1FW4 A;  1SKT A;  2JWW A;  2Q91 A;  1QV1 A;  1Y1A A;  1QX2 A;  2M7L A;  3SG4 A;  2IS9 A;  1WLM A;  4I5N B;  5AER A;  4WQ2 A;  4PE1 A;  2H61 A;  2M3W A;  2HET A;  1GJY A;  2CT9 A;  2BCB A;  4PHK A;  4GGF A;  1S5G Z;  4MN0 A;  1CMF A;  4L9M A;  3PM8 A;  2BCA A;  1IKU A;  2LVK A;  3IQQ A;  1F55 A;  1CLL A;  3BXK A;  1F54 A;  1B4C A;  2COL B;  1S3P A;  2FCD A;  2MJW B;  2VRG A;  1GQM A;  1FI5 A;  2KNE A;  4ETO A;  1DJW A;  1KQV A;  2NCO A;  3WNX B;  1KFX S;  2BKH B;  1PVB A;  1BR1 B;  1M39 A;  2LCP A;  2AUC A;  3D0Y B;  3DF0 A;  3GK2 A;  5J3X A;  3OB1 B;  3TDZ A;  1C7V A;  1SCM C;  1KFU L;  1ALW A;  1LA0 A;  1SL8 A;  2JQ6 A;  1B9A A;  2O60 A;  1K90 D;  1EJ3 A;  1EXR A;  2F8P A;  2GGM A;  4A4C A;  1V1G A;  2B1U A;  1CLB A;  2ZND A;  1JSA A;  1M63 B;  2LM5 A;  4YI9 A;  4GGN A;  2OTG B;  3CZT X;  1QJT A;  4WQ3 A;  1IG5 A;  4AQJ A;  2KDH A;  3LK1 A;  1Q80 A;  5CPV A;  2K7O A;  4ZCU A;  1S1E A;  2PSR A;  4BY5 A;  1G4Y R;  2HQ8 A;  1OSA A;  2WCB A;  1KCY A;  1MQ1 A;  4WRI A;  3OHM B;  1DGU A;  2KAY A;  2LV7 A;  3GK4 X;  2LUX A;  2EHB A;  1UHJ A;  5I8N A;  1WDC B;  1A29 A;  2HQW A;  1XFU O;  5I2L A;  2MAZ A;  2KSP A;  1Y6W A;  4MLW A;  2BE6 A;  3TDU A;  2JU0 A;  4FTG A;  4U8D A;  1PSR A;  5AFP A;  1A75 A;  2M8U A;  1J1D A;  1IWQ A;  1D1O A;  2Y5I A;  3GK1 A;  4UPG A;  1WRZ A;  4E68 A;  1CB1 A;  1EG3 A;  1NX2 A;  3EVV A;  3TS5 B;  4YGA A;  1CFF A;  2RGI A;  2CCM A;  2LUC A;  1QX7 A;  2LLT A;  3AAJ A;  3C1V A;  2L50 A;  2NXQ A;  3VRN A;  1F71 A;  1YR5 A;  1YRU B;  4GNK B;  1AJ5 A;  1DGV A;  3OB2 B;  2F3Z A;  3EVR A;  1S36 A;  2LVI A;  3OX5 A;  3I5H B;  1QAT A;  1QVI Y;  1SL9 A;  2L4I A;  3FWC A;  1YRT B;  4XJK A;  1XO5 A;  2JXC A;  3K21 A;  1DJG A;  2DOQ A;  5KU1 A;  4JQ0 D;  1F4O A;  1QLS A;  2ZRT A;  2OPO A;  1KK7 Z;  3H4S E;  4MRX A;  1DVI A;  3E3R A;  1IH0 A;  2KBI A;  3JTD C;  3PFV A;  5D7F A;  1AVS A;  3CR5 X;  1DT7 B;  1CDN A;  1K95 A;  1B7T Z;  2CNP A;  1NCX A;  3SG5 A;  3VGO A;  3KHE A;  2BCX A;  2F2P A;  4PDZ A;  4QJ5 B;  2F2O A;  1YUS A;  1RTP 1;  2BL0 C;  2MBX A;  2M97 A;  2GV5 A;  1B8L A;  1TIZ A;  1WRK A;  2KQY A;  4HRH A;  2M0R A;  3BUO B;  1A03 A;  4PHM A;  3CS1 A;  4MVF A;  2O5G A;  1LKJ A;  1KFU S;  1SPY A;  1W7J B;  2MRD A;  2ZNE A;  2M7N A;  3O4Y A;  4AQI A;  1AUI B;  2E30 A;  2JNX A;  3BUW B;  3FS7 A;  1OZO A;  1BT6 A;  2F3Y A;  1MR8 A;  1N2D A;  1CM1 A;  4GAO A;  1JF0 A;  3NSO A;  1ZMZ A;  4I5L B;  4MSP A;  1YVH A;  1DJX A;  4N5X A;  1CFP A;  1F4Q A;  1MHO A;  2OS8 C;  2E6W A;  3EK4 A;  1TNP A;  3CR2 A;  4P2Y B;  1UHH A;  2LAP A;  4ICB A;  1PSB A;  2JRF A;  3JVT B;  1K94 A;  3CLN A;  1OE9 B;  1V1F A;  1YX7 A;  2JTT A;  3LLE A;  2LMU A;  1YUT A;  4CLN A;  2LC5 A;  1TNQ A;  2F33 A;  5K89 A;  1SCM B;  1DJH A;  3AKB A;  5I2Q A;  1ZUZ A;  4ORC B;  1PAL A;  1XFV O;  5DKR A;  1C7W A;  1BG1 A;  3PN7 C;  3DVJ A;  1BOD A;  2L0P A;  1KQM C;  4M2Q A;  4YGB B;  3FWB A;  1K9K A;  1SCV A;  1W7I B;  4FQO A;  1CNP A;  1B8R A;  1SR6 C;  1TN4 A;  4CID A;  3OP0 A;  2BE4 A;  1UHN A;  2WCF A;  4YGE B;  4YI8 A;  1CM4 A;  1PK0 D;  1UP5 A;  3LL8 B;  5BPJ A;  1JC2 A;  2JTZ A;  1NSH A;  1OMV A;  3TZ1 A;  2GGZ A;  1KWO C;  2PVB A;  3EKH A;  1Y1X A;  2KI4 B;  2L98 A;  4DS7 A;  3PAL A;  5B8I B;  1JBA A;  1QX5 B;  3I5F B;  1K93 D;  1FF1 A;  3TUY C;  1DF0 A;  1J7O A;  2D8N A;  2ZN8 A;  1QIV A;  3LK0 A;  3NSI A;  1SW8 A;  2MLE C;  1BU3 A;  3DVM A;  5KSZ A;  1XFX O;  3HCM A;  3MSE B;  1R2U A;  2HPS A;  2ZFD A;  1LXF C;  3BOW B;  2HF5 A;  3O2P A;  4MZJ A;  2JC2 A;  4MBE A;  4TNC A;  3WHT B;  2NCP A;  1CTR A;  1CLM A;  1G8I A;  1SMG A;  2LMV A;  5AEQ A;  1ZAC A;  1BOC A;  1X02 A;  3SG6 A;  1CKK A;  2QAC A;  4YRU A;  3EVU A;  3IF7 A;  4GBA A;  4OVN F;  1RRO A;  5IBW A;  3D10 A;  1SK6 D;  2I18 A;  3ZWH A;  1XYD A;  2NLN A;  1YUU A;  2LP3 A;  4ORB B;  1IRJ A;  3AAK A;  1HQV A;  5HLV A;  1J7Q A;  2ZN9 A;  2JT3 A;  1CDP A;  3O78 A;  2LE9 B;  2KYF A;  4I5J A;  1UWO A;  4DRW A;  4NDC A;  2JNF A;  1DF0 B;  2JT8 A;  1ZFS A;  1J55 A;  1BLQ A;  1FPW A;  1OMR A;  1QAS A;  1CFD A;  2LAN A;  4YBH B;  2KYC A;  2PAL A;  5ER5 A;  5JOL A;  4BY4 A;  1NPQ A;  4PE0 A;  1HT9 A;  1KK8 C;  2AAO A;  2K7B A;  1TNX A;  3SJS A;  3IQO A;  2BBN A;  5FYX A;  1RJV A;  2H61 C;  1NCZ A;  2WC8 A;  4GPL B;  4GGF C;  1DJZ A;  2FOT A;  4DCK A;  1AP4 A;  3EKJ A;  2I2R E;  2LHL A;  3KF9 A;  5TNC A;  2JPT A;  1XK4 A;  2LLU A;  1BR4 B;  1WDC C;  1NYA A;  2MHH A;  4PE7 A;  1S6I A;  1UHI A;  2K7D A;  1S26 D;  2EC6 C;  3BUM B;  3CGA A;  1UUR A;  4MZK A;  4P5O E;  4PAL A;  3A4U B;  3F45 A;  3I5I B;  2G9B A;  2OS8 B;  2K8M B;  5HKY A;  3NSK A;  2I7A A;  2M1U A;  1AHR A;  1BMO A;  1GGZ A;  1M46 A;  2LLS A;  5AXI A;  3OX6 A;  2FCE A;  2Y1N A;  1QVI Z;  1S6C A;  1BF5 A;  4N1G A;  3TS5 C;  4PCW A;  2KGR A;  4M2O A;  3FIA A;  5DKQ A;  2BKI B;  3VRP A;  2WOS A;  3EK7 A; 
#chains in the Genus database with same CATH topology
 3CWG A;  1PUL A;  2I94 A;  3PN7 B;  3I5H C;  2L2E A;  1JFJ A;  1F8H A;  3I5G C;  2CTN A;  3WHU B;  2JZI A;  3CZ2 A;  3SIB A;  1S5G Y;  1L2O C;  3SG7 A;  5EL2 A;  2M29 A;  1BJF A;  1J1E A;  3SS4 A;  1XFY O;  1C07 A;  3PSR A;  4CFR A;  1SY9 A;  4GUK A;  1AK8 A;  1P28 A;  2H2K A;  4PE4 A;  1KSO A;  2QEO A;  3BOW A;  2LVV A;  2PMY A;  1A2X A;  2Q4U A;  1K96 A;  3OGN A;  1E8A A;  1OZS A;  4ORA B;  1DMO A;  2SCP A;  3L4L A;  3SG3 A;  2L51 A;  2M1K B;  3TUY B;  2LP2 A;  1OOH A;  1LS8 A;  3SIA A;  4AOM A;  1B8C A;  4OKH A;  1IQ5 A;  4PHJ A;  3PM2 A;  3L47 A;  2K2F A;  1ZOT B;  2P70 A;  2PAS A;  1A4P A;  1YX8 A;  4NDD A;  1MXE A;  1Y0V H;  2L2C A;  1SNL A;  4C0J A;  2M9G A;  1JFK A;  5CSF A;  1NUB A;  1R6P A;  1TNW A;  3PAT A;  3BFH A;  3WXA A;  2Y4Q A;  3VRO A;  5GQQ C;  2WND A;  1ODB A;  1SRA A;  1MXL C;  1B1G A;  1JWD A;  1OW4 A;  2CBL A;  3CDN A;  1SL7 A;  2R2I A;  1AJ4 A;  4GFT A;  4QJ3 B;  1MWN A;  5AAN A;  3CTN A;  1XFZ O;  5DIC A;  3GOF A;  1J7P A;  2KI6 C;  4C0L A;  4HRE E;  3O4X A;  4DUQ A;  3JVT C;  3DYE A;  1UHK A;  5DKN A;  1XK4 C;  1QXP A;  2L5X B;  1N65 A;  2BAP A;  1IJ5 A;  2KAX A;  1N0Y A;  2K2A A;  3M0W A;  4PHN A;  1L7Z A;  1GGW A;  2KOT A;  3K1E A;  2KQ6 A;  1H8B A;  1NWD A;  1FBV A;  1WLZ A;  1TTX A;  2K61 A;  2KFF A;  5CSN A;  1B47 A;  1T14 A;  2WCJ A;  1LVC D;  3BFA A;  2P6B B;  3BUN B;  1WY9 A;  1XFW O;  3NSL A;  4NQG A;  3TDI A;  1EL4 A;  3EG5 B;  1U5I A;  1KK8 B;  2KAV A;  3O6B A;  3PJI A;  1NX3 A;  5HLO A;  1YUR A;  3UNW A;  3ZNI A;  4CFQ A;  1K9P A;  3A8R A;  4DIR A;  2BBM A;  2WC6 A;  3VRQ A;  1MUX A;  1OOG A;  3S0F A;  1NIW A;  2KI6 D;  4IJ7 A;  1J7R A;  1RK9 A;  1CMG A;  2H8V A;  3JTD B;  5HYD A;  1DTL A;  2CXJ A;  2ZKM X;  1TOP A;  2KI4 C;  2MA2 A;  3BUX B;  3LCP C;  2MLF C;  2KFH A;  1QWV A;  1TCF A;  1VRK A;  2EC6 B;  3I5F C;  1QLK A;  2KBM A;  4OCI A;  4YGD B;  3CR4 X;  1OQP A;  4NDB A;  4HRG A;  2AMI A;  2BL0 B;  2KHN A;  2OTG C;  4N1F A;  4Q04 A;  4JKT A;  1EG4 A;  1M31 A;  1QTX A;  3L4A A;  1KK7 Y;  5G08 A;  5JJG A;  1OOI X;  1DEK A;  3Q8I A;  2ISD A;  3PLF B;  2JUL A;  1WRL A;  1B7T Y;  3AKA A;  3D76 A;  2FJU B;  4F0Z B;  2EGD A;  1IGV A;  3DF0 B;  1QS7 A;  2LMT A;  1K9U A;  4R1E A;  1M45 A;  3BJH A;  3BYA A;  1K8U A;  2QPT A;  2WCE A;  3B88 A;  3BFB A;  3CAB A;  1KFX L;  2GTE A;  5HKZ A;  3DVK A;  4A4B A;  1U5I B;  1S6J A;  3KEV A;  4XYN A;  4MZL A;  3DVE A;  5HL1 A;  3QRX A;  1C3Z A;  5FI6 A;  1SBJ A;  2KFG A;  2BEC A;  2JXL A;  3I5G B;  1K2H A;  1OMD A;  2SAS A;  3DD4 A;  3RLZ A;  4OV2 A;  3VRR A;  1L2O B;  1PVA A;  3R1V A;  3FE9 A;  1FI6 A;  1NCY A;  1UUS A;  1Y1U A;  1RWY A;  1NX1 A;  2BNX A;  5D69 A;  4QJ4 B;  2JOJ A;  1LA3 A;  2A4J A;  2L5Y A;  4JWQ A;  4JD9 A;  4YGC B;  2LHI A;  4HSZ A;  1XA5 A;  5FI7 A;  3EK8 A;  3ICB A;  2LNK A;  3DY9 A;  4D1E A;  1G33 A;  2KGB C;  5KTY A;  2KPH A;  1OOJ A;  3SG2 A;  4KYN A;  1TUZ A;  3BQ3 A;  1REC A;  2K7C A;  2KLD A;  2LVJ A;  4I5K A;  1H4B A;  1PRW A;  2JT0 A;  1NX0 A;  3B86 A;  1XVJ A;  1A75 B;  2M49 B;  3KO0 A;  2PRU A;  1KQM B;  4MEW A;  1JUO A;  4INW A;  1QV0 A;  2QEV A;  1QIW A;  2V53 A;  4M2P A;  4USL A;  4MRY A;  1CDL A;  4ZCV A;  3NXA A;  2TN4 A;  1SR6 B;  1DJY A;  3HX4 A;  1EH2 A;  3DZT A;  1F70 A;  3R1O A;  1TWO A;  1YVL A;  5CSI A;  5PAL A;  4OR9 B;  1CDM A;  2G2B A;  1SSE B;  2WOR A;  1SYM A;  1MF8 B;  2Y1M A;  3SS3 A;  1CFC A;  1YTZ C;  1KWO B;  2NZ0 A;  4IL1 A;  2ZRS A;  3D0Y A;  4JPZ B;  1NP8 A;  2L4H A;  1ALV A;  1TRF A;  1RFJ A;  2WCL A;  5F6T A;  4CPV A;  1IJ6 A;  1KSM A;  1DJI A;  3I5I C;  4XJK B;  1LIN A;  3B87 A;  5HKW A;  1TCO B;  4C0K A;  2K0J A;  5ER4 X;  1JF2 A;  3KPX A;  5I2O A;  5CSJ A;  2PYQ A;  3RM1 A;  1FW4 A;  1SKT A;  2JWW A;  2Q91 A;  1QV1 A;  1Y1A A;  2P71 A;  3S0G A;  3D77 A;  1QX2 A;  2M7L A;  3SG4 A;  2IS9 A;  1WLM A;  4I5N B;  5AER A;  4WQ2 A;  4PE1 A;  2H61 A;  2M3W A;  2HET A;  1GJY A;  2CT9 A;  2BCB A;  4PHK A;  4GGF A;  1S5G Z;  4MN0 A;  1CMF A;  4L9M A;  3PM8 A;  2BCA A;  1IKU A;  2LVK A;  3IQQ A;  1F55 A;  1CLL A;  3BXK A;  1F54 A;  1B4C A;  2COL B;  1S3P A;  2FCD A;  2MJW B;  2VRG A;  1GQM A;  1FI5 A;  2KNE A;  4ETO A;  1DJW A;  1KQV A;  2NCO A;  3WNX B;  1KFX S;  2BKH B;  1PVB A;  1BR1 B;  1M39 A;  2LCP A;  2AUC A;  3D0Y B;  3DF0 A;  3GK2 A;  1ORG A;  3NGV A;  3OB1 B;  3TDZ A;  1C7V A;  1SCM C;  1KFU L;  1ALW A;  1LA0 A;  1SL8 A;  3B7A A;  2JQ6 A;  1B9A A;  2O60 A;  1K90 D;  1EJ3 A;  1EXR A;  2F8P A;  2GGM A;  4A4C A;  1V1G A;  2B1U A;  1CLB A;  2ZND A;  1JSA A;  1M63 B;  2LM5 A;  4YI9 A;  4GGN A;  2OTG B;  3CZT X;  2K60 A;  1QJT A;  4WQ3 A;  1IG5 A;  1OOF A;  4AQJ A;  2KDH A;  3LK1 A;  1Q80 A;  5CPV A;  2K7O A;  4ZCU A;  1S1E A;  2PSR A;  4BY5 A;  1G4Y R;  3SS5 A;  2HQ8 A;  1Z2C B;  1OSA A;  4INX A;  2WCB A;  1KCY A;  1MQ1 A;  4WRI A;  3OHM B;  1DGU A;  2KAY A;  2LV7 A;  2WCK A;  3GK4 X;  2LUX A;  2EHB A;  1UHJ A;  5I8N A;  1WDC B;  1A29 A;  2HQW A;  3DXL A;  1XFU O;  5I2L A;  2MAZ A;  2KSP A;  1Y6W A;  4MLW A;  2BE6 A;  3TDU A;  2JU0 A;  4FTG A;  4U8D A;  1PSR A;  5AFP A;  1A75 A;  2M8U A;  1J1D A;  1IWQ A;  1D1O A;  1W9Z A;  2Y5I A;  3GK1 A;  4UPG A;  1WRZ A;  4E68 A;  1CB1 A;  1EG3 A;  1NX2 A;  3EVV A;  2WCM A;  4YGA A;  3TS5 B;  1CFF A;  2RGI A;  2CCM A;  2LUC A;  1QX7 A;  2LLT A;  3AAJ A;  3C1V A;  2L50 A;  2NXQ A;  3VRN A;  1F71 A;  1YR5 A;  1YRU B;  4GNK B;  1AJ5 A;  1DGV A;  3CZ0 A;  3OB2 B;  2F3Z A;  3EVR A;  1S36 A;  2LVI A;  3OX5 A;  3I5H B;  1QAT A;  1QVI Y;  1SL9 A;  1TUJ A;  2L4I A;  3FWC A;  1YRT B;  2PQL A;  4XJK A;  1XO5 A;  2JXC A;  3K21 A;  1DJG A;  2DOQ A;  5KU1 A;  4JQ0 D;  1F4O A;  1QLS A;  2ZRT A;  2OPO A;  1KK7 Z;  3H4S E;  4MRX A;  1DVI A;  3E3R A;  1IH0 A;  2KBI A;  3JTD C;  3PFV A;  5D7F A;  1AVS A;  3CR5 X;  3D74 A;  1DT7 B;  1CDN A;  1K95 A;  1B7T Z;  2CNP A;  1NCX A;  3SG5 A;  3VGO A;  3KHE A;  2BCX A;  2F2P A;  4PDZ A;  4QJ5 B;  2F2O A;  1YUS A;  1RTP 1;  2BL0 C;  2MBX A;  1DQE A;  2M97 A;  2GV5 A;  3S0E A;  3D75 A;  1B8L A;  1TIZ A;  1WRK A;  3NHI A;  2KQY A;  4HRH A;  2M0R A;  3BUO B;  1A03 A;  4PHM A;  3CS1 A;  4MVF A;  2O5G A;  1LKJ A;  1KFU S;  1SPY A;  1W7J B;  2MRD A;  2ZNE A;  2M7N A;  3O4Y A;  4AQI A;  1AUI B;  2E30 A;  2FJY A;  2JNX A;  3BUW B;  3FS7 A;  1OZO A;  1BT6 A;  2F3Y A;  3UO9 A;  2QEH A;  1MR8 A;  1N2D A;  1CM1 A;  2JPO A;  1JF0 A;  3NSO A;  1ZMZ A;  3D78 A;  3CYZ A;  4GAO A;  4I5L B;  4MSP A;  1YVH A;  1DJX A;  2WCH A;  4N5X A;  1CFP A;  3B6X A;  4F7F A;  1F4Q A;  1MHO A;  2OS8 C;  2YGU A;  2E6W A;  3EK4 A;  1TNP A;  3CR2 A;  1DEL A;  4P2Y B;  3OBV A;  1UHH A;  2LAP A;  4ICB A;  1PSB A;  2JRF A;  3JVT B;  1C3Y A;  1K94 A;  3CLN A;  1OE9 B;  1V1F A;  1YX7 A;  2JTT A;  3LLE A;  2LMU A;  3R72 A;  1YUT A;  4CLN A;  2LC5 A;  1TNQ A;  2F33 A;  5K89 A;  1SCM B;  1DJH A;  3AKB A;  5I2Q A;  1ZUZ A;  3S0A A;  4ORC B;  1IQ3 A;  1PAL A;  1XFV O;  3QME A;  5DKR A;  1C7W A;  1BG1 A;  3PN7 C;  3DVJ A;  1BOD A;  2L0P A;  1KQM C;  4M2Q A;  1Z4H A;  4YGB B;  1IIO A;  3FWB A;  1K9K A;  1SCV A;  1W7I B;  4FQO A;  1CNP A;  1B8R A;  1SR6 C;  1TN4 A;  4CID A;  3OP0 A;  2BE4 A;  1UHN A;  2WCF A;  4YGE B;  4YI8 A;  1CM4 A;  1PK0 D;  1UP5 A;  3LL8 B;  5BPJ A;  1JC2 A;  1XFR A;  2JTZ A;  1NSH A;  1OMV A;  3TZ1 A;  3R1P A;  3IVT A;  4PT1 A;  1DC1 A;  2GGZ A;  1KWO C;  2PVB A;  3EKH A;  1Y1X A;  2KI4 B;  2L98 A;  4DS7 A;  3PAL A;  5B8I B;  1JBA A;  1QX5 B;  3I5F B;  1K93 D;  1FF1 A;  3TUY C;  1DF0 A;  1J7O A;  2D8N A;  2ZN8 A;  3V2L A;  1QIV A;  3LK0 A;  3NSI A;  1SW8 A;  2MLE C;  1BU3 A;  3DVM A;  5KSZ A;  1XFX O;  3HCM A;  3MSE B;  1R2U A;  2HPS A;  2WC5 A;  2ZFD A;  1LXF C;  3BOW B;  2HF5 A;  3O2P A;  4MZJ A;  2JC2 A;  4MBE A;  4TNC A;  3WHT B;  2NCP A;  1CTR A;  1CLM A;  1G8I A;  1SMG A;  2LMV A;  5AEQ A;  1ZAC A;  1BOC A;  1X02 A;  3SG6 A;  1CKK A;  5D3O A;  2QAC A;  3NHT A;  3FE6 A;  4YRU A;  3EVU A;  3IF7 A;  4FQT A;  4GBA A;  4OVN F;  1RRO A;  5IBW A;  3D10 A;  1SK6 D;  2I18 A;  2QEB A;  3ZWH A;  1XYD A;  2NLN A;  1YUU A;  2LP3 A;  4ORB B;  1IRJ A;  3AAK A;  1HQV A;  5HLV A;  1J7Q A;  2ZN9 A;  2JT3 A;  1CDP A;  3O78 A;  2LE9 B;  3FE8 A;  2KYF A;  4I5J A;  1UWO A;  4DRW A;  4NDC A;  2JNF A;  5FI2 A;  1DF0 B;  2JT8 A;  1ZFS A;  1J55 A;  1BLQ A;  3N7H A;  3CZ1 A;  3S0B A;  1FPW A;  1OMR A;  1QAS A;  1CFD A;  2ERB A;  2LAN A;  4YBH B;  2KYC A;  2PAL A;  5ER5 A;  5JOL A;  4BY4 A;  1NPQ A;  4PE0 A;  1HT9 A;  1KK8 C;  5J3X A;  3RZS A;  4OZD A;  2AAO A;  2QDI A;  2K7B A;  1TNX A;  3SJS A;  3IQO A;  2BBN A;  5FYX A;  1RJV A;  2H61 C;  1NCZ A;  2WC8 A;  4GPL B;  4GGF C;  1DJZ A;  2FOT A;  4DCK A;  1AP4 A;  3S0D A;  2KLE A;  3EKJ A;  2I2R E;  2LHL A;  3KF9 A;  5TNC A;  2JPT A;  1XK4 A;  2LLU A;  1BR4 B;  1WDC C;  1NYA A;  2MHH A;  4PE7 A;  1S6I A;  1UHI A;  2K7D A;  5I94 A;  1S26 D;  2EC6 C;  3BUM B;  3CGA A;  1UUR A;  4MZK A;  4P5O E;  4PAL A;  3A4U B;  3F45 A;  3I5I B;  2G9B A;  2OS8 B;  2K8M B;  5HKY A;  3NSK A;  2I7A A;  3VB1 A;  2M1U A;  1AHR A;  1BMO A;  1GGZ A;  1M46 A;  2LLS A;  5AXI A;  3OX6 A;  2FCE A;  2Y1N A;  3D73 A;  1QVI Z;  1S6C A;  1BF5 A;  1GM0 A;  4N1G A;  3TS5 C;  4PCW A;  2KGR A;  4M2O A;  3FIA A;  5DKQ A;  2BKI B;  3VRP A;  2WOS A;  3EK7 A; 
#chains in the Genus database with same CATH homology
 3CWG A;  1PUL A;  2I94 A;  3PN7 B;  3I5H C;  2L2E A;  1JFJ A;  1F8H A;  3I5G C;  2CTN A;  3WHU B;  2JZI A;  3SIB A;  1S5G Y;  1L2O C;  3SG7 A;  2M29 A;  1BJF A;  1J1E A;  1XFY O;  1C07 A;  3PSR A;  4CFR A;  1SY9 A;  4GUK A;  1AK8 A;  2H2K A;  4PE4 A;  1KSO A;  3BOW A;  2LVV A;  2PMY A;  1A2X A;  2Q4U A;  1K96 A;  1E8A A;  1OZS A;  4ORA B;  1DMO A;  2SCP A;  3SG3 A;  2L51 A;  2M1K B;  3TUY B;  2LP2 A;  3SIA A;  4AOM A;  1B8C A;  4OKH A;  1IQ5 A;  4PHJ A;  2K2F A;  1ZOT B;  2PAS A;  1A4P A;  1YX8 A;  4NDD A;  1MXE A;  1Y0V H;  1SNL A;  4C0J A;  2M9G A;  1JFK A;  5CSF A;  1NUB A;  1R6P A;  1TNW A;  3PAT A;  3WXA A;  2Y4Q A;  3VRO A;  5GQQ C;  2WND A;  1ODB A;  1SRA A;  1MXL C;  1B1G A;  1JWD A;  2CBL A;  1SL7 A;  2R2I A;  1AJ4 A;  4GFT A;  4QJ3 B;  1MWN A;  5AAN A;  3CTN A;  1XFZ O;  3GOF A;  1J7P A;  2KI6 C;  4C0L A;  4HRE E;  4DUQ A;  3JVT C;  1UHK A;  5DKN A;  1XK4 C;  1QXP A;  2L5X B;  1N65 A;  1IJ5 A;  2KAX A;  1N0Y A;  2K2A A;  3M0W A;  4PHN A;  1L7Z A;  1GGW A;  2KOT A;  1H8B A;  2KQ6 A;  1NWD A;  1FBV A;  1WLZ A;  1TTX A;  2K61 A;  2KFF A;  5CSN A;  1B47 A;  1LVC D;  2P6B B;  3BUN B;  1WY9 A;  1XFW O;  3NSL A;  4NQG A;  3TDI A;  1EL4 A;  1U5I A;  1KK8 B;  2KAV A;  3O6B A;  5HLO A;  1NX3 A;  3ZNI A;  1YUR A;  4CFQ A;  4DIR A;  1K9P A;  3A8R A;  2BBM A;  3VRQ A;  1MUX A;  1NIW A;  2KI6 D;  1J7R A;  1RK9 A;  1CMG A;  3JTD B;  5HYD A;  1DTL A;  2CXJ A;  2ZKM X;  1TOP A;  2KI4 C;  2MA2 A;  3BUX B;  3LCP C;  2MLF C;  2KFH A;  1TCF A;  1VRK A;  2EC6 B;  3I5F C;  1QLK A;  2KBM A;  4OCI A;  4YGD B;  3CR4 X;  1OQP A;  4NDB A;  4HRG A;  2AMI A;  2BL0 B;  2KHN A;  2OTG C;  4N1F A;  4Q04 A;  1EG4 A;  1M31 A;  1QTX A;  5JJG A;  1KK7 Y;  5G08 A;  2ISD A;  3PLF B;  2JUL A;  1WRL A;  1B7T Y;  3AKA A;  2FJU B;  4F0Z B;  2EGD A;  1IGV A;  3DF0 B;  1QS7 A;  2LMT A;  1K9U A;  4R1E A;  1M45 A;  3BYA A;  1K8U A;  2QPT A;  2WCE A;  1KFX L;  5HKZ A;  3DVK A;  4A4B A;  1U5I B;  1S6J A;  3KEV A;  4XYN A;  4MZL A;  3DVE A;  3QRX A;  1SBJ A;  2KFG A;  2BEC A;  2JXL A;  3I5G B;  1K2H A;  1OMD A;  2SAS A;  3DD4 A;  3RLZ A;  4OV2 A;  3VRR A;  1L2O B;  1PVA A;  1FI6 A;  1NCY A;  1UUS A;  1Y1U A;  1RWY A;  1NX1 A;  5D69 A;  2JOJ A;  1LA3 A;  2A4J A;  4JWQ A;  4YGC B;  2LHI A;  4HSZ A;  1XA5 A;  3EK8 A;  3ICB A;  2LNK A;  4D1E A;  1G33 A;  2KGB C;  5KTY A;  1OOJ A;  3SG2 A;  3BQ3 A;  1REC A;  2K7C A;  2LVJ A;  4I5K A;  1H4B A;  1PRW A;  2JT0 A;  1NX0 A;  4MEW A;  1XVJ A;  1A75 B;  2M49 B;  3KO0 A;  2PRU A;  1KQM B;  1IQ3 A;  1JUO A;  4ZCV A;  1QV0 A;  4USL A;  1QIW A;  2V53 A;  4M2P A;  4QJ4 B;  4MRY A;  1CDL A;  3NXA A;  2TN4 A;  1SR6 B;  1DJY A;  3HX4 A;  1EH2 A;  1F70 A;  1YVL A;  5CSI A;  5PAL A;  4OR9 B;  1CDM A;  2G2B A;  2WOR A;  1SYM A;  1MF8 B;  2Y1M A;  1CFC A;  1YTZ C;  1KWO B;  2NZ0 A;  4IL1 A;  2ZRS A;  3D0Y A;  4JPZ B;  1NP8 A;  2L4H A;  1ALV A;  1TRF A;  1RFJ A;  5F6T A;  4CPV A;  1IJ6 A;  1KSM A;  1DJI A;  3I5I C;  4XJK B;  1LIN A;  5HKW A;  4C0K A;  1TCO B;  2K0J A;  5ER4 X;  1JF2 A;  3KPX A;  5I2O A;  5CSJ A;  3RM1 A;  1FW4 A;  1SKT A;  2JWW A;  2Q91 A;  1QV1 A;  1Y1A A;  1QX2 A;  2M7L A;  3SG4 A;  2IS9 A;  1WLM A;  4I5N B;  5AER A;  4WQ2 A;  4PE1 A;  2H61 A;  2M3W A;  2HET A;  1GJY A;  2CT9 A;  2BCB A;  4PHK A;  4GGF A;  1S5G Z;  4MN0 A;  1CMF A;  4L9M A;  3PM8 A;  2BCA A;  1IKU A;  2LVK A;  3IQQ A;  1F55 A;  1CLL A;  3BXK A;  1F54 A;  1B4C A;  2COL B;  1S3P A;  2FCD A;  2MJW B;  2VRG A;  1GQM A;  1FI5 A;  2KNE A;  4ETO A;  1DJW A;  1KQV A;  2NCO A;  3WNX B;  1KFX S;  2BKH B;  1PVB A;  1BR1 B;  1M39 A;  2LCP A;  2AUC A;  3D0Y B;  3DF0 A;  3GK2 A;  5J3X A;  3OB1 B;  3TDZ A;  1C7V A;  1SCM C;  1KFU L;  1ALW A;  1LA0 A;  1SL8 A;  2JQ6 A;  1B9A A;  2O60 A;  1K90 D;  1EJ3 A;  1EXR A;  2F8P A;  2GGM A;  4A4C A;  1V1G A;  2B1U A;  1CLB A;  2ZND A;  1JSA A;  1M63 B;  2LM5 A;  4YI9 A;  4GGN A;  2OTG B;  3CZT X;  1QJT A;  4WQ3 A;  1IG5 A;  4AQJ A;  2KDH A;  3LK1 A;  1Q80 A;  5CPV A;  2K7O A;  4ZCU A;  1S1E A;  2PSR A;  4BY5 A;  1G4Y R;  2HQ8 A;  1OSA A;  2WCB A;  1KCY A;  1MQ1 A;  4WRI A;  3OHM B;  1DGU A;  2KAY A;  2LV7 A;  3GK4 X;  2LUX A;  2EHB A;  1UHJ A;  5I8N A;  1WDC B;  1A29 A;  2HQW A;  1XFU O;  5I2L A;  2MAZ A;  2KSP A;  1Y6W A;  4MLW A;  2BE6 A;  3TDU A;  2JU0 A;  4FTG A;  4U8D A;  1PSR A;  5AFP A;  1A75 A;  2M8U A;  1J1D A;  1IWQ A;  1D1O A;  2Y5I A;  3GK1 A;  4UPG A;  1WRZ A;  4E68 A;  1CB1 A;  1EG3 A;  1NX2 A;  3EVV A;  3TS5 B;  4YGA A;  1CFF A;  2RGI A;  2CCM A;  2LUC A;  1QX7 A;  2LLT A;  3AAJ A;  3C1V A;  2L50 A;  2NXQ A;  3VRN A;  1F71 A;  1YR5 A;  1YRU B;  4GNK B;  1AJ5 A;  1DGV A;  3OB2 B;  2F3Z A;  3EVR A;  1S36 A;  2LVI A;  3OX5 A;  3I5H B;  1QAT A;  1QVI Y;  1SL9 A;  2L4I A;  3FWC A;  1YRT B;  4XJK A;  1XO5 A;  2JXC A;  3K21 A;  1DJG A;  2DOQ A;  5KU1 A;  4JQ0 D;  1F4O A;  1QLS A;  2ZRT A;  2OPO A;  1KK7 Z;  3H4S E;  4MRX A;  1DVI A;  3E3R A;  1IH0 A;  2KBI A;  3JTD C;  3PFV A;  5D7F A;  1AVS A;  3CR5 X;  1DT7 B;  1CDN A;  1K95 A;  1B7T Z;  2CNP A;  1NCX A;  3SG5 A;  3VGO A;  3KHE A;  2BCX A;  2F2P A;  4PDZ A;  4QJ5 B;  2F2O A;  1YUS A;  1RTP 1;  2BL0 C;  2MBX A;  2M97 A;  2GV5 A;  1B8L A;  1TIZ A;  1WRK A;  2KQY A;  4HRH A;  2M0R A;  3BUO B;  1A03 A;  4PHM A;  3CS1 A;  4MVF A;  2O5G A;  1LKJ A;  1KFU S;  1SPY A;  1W7J B;  2MRD A;  2ZNE A;  2M7N A;  3O4Y A;  4AQI A;  1AUI B;  2E30 A;  2JNX A;  3BUW B;  3FS7 A;  1OZO A;  1BT6 A;  2F3Y A;  1MR8 A;  1N2D A;  1CM1 A;  4GAO A;  1JF0 A;  3NSO A;  1ZMZ A;  4I5L B;  4MSP A;  1YVH A;  1DJX A;  4N5X A;  1CFP A;  1F4Q A;  1MHO A;  2OS8 C;  2E6W A;  3EK4 A;  1TNP A;  3CR2 A;  4P2Y B;  1UHH A;  2LAP A;  4ICB A;  1PSB A;  2JRF A;  3JVT B;  1K94 A;  3CLN A;  1OE9 B;  1V1F A;  1YX7 A;  2JTT A;  3LLE A;  2LMU A;  1YUT A;  4CLN A;  2LC5 A;  1TNQ A;  2F33 A;  5K89 A;  1SCM B;  1DJH A;  3AKB A;  5I2Q A;  1ZUZ A;  4ORC B;  1PAL A;  1XFV O;  5DKR A;  1C7W A;  1BG1 A;  3PN7 C;  3DVJ A;  1BOD A;  2L0P A;  1KQM C;  4M2Q A;  4YGB B;  3FWB A;  1K9K A;  1SCV A;  1W7I B;  4FQO A;  1CNP A;  1B8R A;  1SR6 C;  1TN4 A;  4CID A;  3OP0 A;  2BE4 A;  1UHN A;  2WCF A;  4YGE B;  4YI8 A;  1CM4 A;  1PK0 D;  1UP5 A;  3LL8 B;  5BPJ A;  1JC2 A;  2JTZ A;  1NSH A;  1OMV A;  3TZ1 A;  2GGZ A;  1KWO C;  2PVB A;  3EKH A;  1Y1X A;  2KI4 B;  2L98 A;  4DS7 A;  3PAL A;  5B8I B;  1JBA A;  1QX5 B;  3I5F B;  1K93 D;  1FF1 A;  3TUY C;  1DF0 A;  1J7O A;  2D8N A;  2ZN8 A;  1QIV A;  3LK0 A;  3NSI A;  1SW8 A;  2MLE C;  1BU3 A;  3DVM A;  5KSZ A;  1XFX O;  3HCM A;  3MSE B;  1R2U A;  2HPS A;  2ZFD A;  1LXF C;  3BOW B;  2HF5 A;  3O2P A;  4MZJ A;  2JC2 A;  4MBE A;  4TNC A;  3WHT B;  2NCP A;  1CTR A;  1CLM A;  1G8I A;  1SMG A;  2LMV A;  5AEQ A;  1ZAC A;  1BOC A;  1X02 A;  3SG6 A;  1CKK A;  2QAC A;  4YRU A;  3EVU A;  3IF7 A;  4GBA A;  4OVN F;  1RRO A;  5IBW A;  3D10 A;  1SK6 D;  2I18 A;  3ZWH A;  1XYD A;  2NLN A;  1YUU A;  2LP3 A;  4ORB B;  1IRJ A;  3AAK A;  1HQV A;  5HLV A;  1J7Q A;  2ZN9 A;  2JT3 A;  1CDP A;  3O78 A;  2LE9 B;  2KYF A;  4I5J A;  1UWO A;  4DRW A;  4NDC A;  2JNF A;  1DF0 B;  2JT8 A;  1ZFS A;  1J55 A;  1BLQ A;  1FPW A;  1OMR A;  1QAS A;  1CFD A;  2LAN A;  4YBH B;  2KYC A;  2PAL A;  5ER5 A;  5JOL A;  4BY4 A;  1NPQ A;  4PE0 A;  1HT9 A;  1KK8 C;  2AAO A;  2K7B A;  1TNX A;  3SJS A;  3IQO A;  2BBN A;  5FYX A;  1RJV A;  2H61 C;  1NCZ A;  2WC8 A;  4GPL B;  4GGF C;  1DJZ A;  2FOT A;  4DCK A;  1AP4 A;  3EKJ A;  2I2R E;  2LHL A;  3KF9 A;  5TNC A;  2JPT A;  1XK4 A;  2LLU A;  1BR4 B;  1WDC C;  1NYA A;  2MHH A;  4PE7 A;  1S6I A;  1UHI A;  2K7D A;  1S26 D;  2EC6 C;  3BUM B;  3CGA A;  1UUR A;  4MZK A;  4P5O E;  4PAL A;  3A4U B;  3F45 A;  3I5I B;  2G9B A;  2OS8 B;  2K8M B;  5HKY A;  3NSK A;  2I7A A;  2M1U A;  1AHR A;  1BMO A;  1GGZ A;  1M46 A;  2LLS A;  5AXI A;  3OX6 A;  2FCE A;  2Y1N A;  1QVI Z;  1S6C A;  1BF5 A;  4N1G A;  3TS5 C;  4PCW A;  2KGR A;  4M2O A;  3FIA A;  5DKQ A;  2BKI B;  3VRP A;  2WOS A;  3EK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...