3TDZA

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/inhibitor
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tdzA01
2BECA 5DKRA 2K7BA 1YUUA 1JF2A 3JVTC 2LHIA 5DKNA 4JWQA 2MAZA 3SIBA 1EXRA 2CNPA 1B8CA 1K9PA 2WORA 4TNCA 3EKJA 3WHTB 3IF7A 4NQGA 1KK8C 1RFJA 2O5GA 3GK2A 3KPXA 2MA2A 4OR9B 2BBMA 4ETOA 1CM4A 4WRIA 4P2YB 1BT6A 4QJ5B 1XVJA 1KQMC 1W7IB 2L0PA 3WXAA 1CB1A 2NCOA 1OOJA 1CKKA 5GQQC 1OQPA 1NWDA 1M39A 5KU1A 1XFVO 3A8RA 3K21A 1B7TZ 2Y4QA 4BY4A 2D8NA 3NSKA 4QJ3B 1MF8B 2CT9A 2OS8C 3I5HB 1QJTA 2I94A 4MLWA 4OV2A 3WNXB 1CFFA 1H4BA 1BJFA 2F33A 4GUKA 1LA3A 4XYNA 3M0WA 1J1EA 2AAOA 1J1DA 1TRFA 3DVKA 3OX6A 2HETA 4A4CA 1M45A 1UHKA 1TNQA 1ODBA 1FPWA 1D1OA 1IQ5A 1FI5A 3NSOA 4AOMA 1J7PA 2KI4C 2E30A 3TDIA 3KO0A 1NYAA 1YVLA 4ORBB 1S1EA 1L2OC 2E6WA 3BOWB 1IH0A 3EKHA 1QVIY 1NIWA 1FI6A 3BUNB 2GGMA 2QACA 2M97A 2WCBA 3CR2A 2JNFA 1WLMA 2BE6A 3VRPA 2P6BB 1DT7B 5J3XA 3I5GC 4WQ3A 1S3PA 1FBVA 2LVVA 2M9GA 1CLBA 4GGFC 1JWDA 4FTGA 5CSFA 2JPTA 2AUCA 2BE4A 1R6PA 1B4CA 1TNWA 3F45A 3D10A 1PK0D 1YUSA 3TS5B 2FCDA 1HT9A 1XFYO 1AJ4A 3O4YA 1A03A 3RLZA 2GGZA 2F2PA 1Y6WA 1BU3A 1BR4B 2LVIA 3JTDB 2KFHA 1BLQA 1WY9A 2K2AA 1A2XA 2OTGC 1JFJA 3EVUA 2LE9B 2PALA 1PSRA 1DF0B 1LVCD 4YGAA 4HRHA 3TDUA 2EC6B 2WOSA 2JTTA 2M8UA 3I5FB 1DJXA 4ZCVA 3NSLA 4OVNF 1A29A 1TTXA 2JU0A 2LCPA 2SASA 2EGDA 2K2FA 1F4OA 5BPJA 1KK7Y 1SL9A 3O78A 3LCPC 3LL8B 3KF9A 3SG5A 4P5OE 2KAYA 4JPZB 4PALA 2MLEC 1DJGA 1SYMA 1QASA 4GNKB 1CFCA 2KDHA 1QVIZ 4YGEB 1EH2A 1G8IA 2K61A 1JC2A 1B47A 3O6BA 1WRZA 1IRJA 1W7JB 3C1VA 3PN7C 3CR4X 1RTP1 2JT8A 1B8RA 3FWCA 3IQQA 1UP5A 5HLOA 3NXAA 3JVTB 2KOTA 4C0KA 1LKJA 1PVAA 1U5IB 2M3WA 4MZLA 3SG6A 1DGVA 4AQJA 1BG1A 1MXEA 2K7OA 2JNXA 2L4IA 4D1EA 4C0JA 2TN4A 1KK8B 1SMGA 1QLSA 2H61A 2WCFA 3FWBA 4PDZA 1KFXS 2KYFA 1KQVA 2ZRTA 1PVBA 1BODA 4PHJA 3FIAA 4DRWA 1S6IA 4DS7A 2LM5A 2SCPA 2KI6C 3DF0B 4BY5A 1PSBA 1SR6C 1AP4A 1G4YR 4MZJA 1KQMB 2JT3A 2PASA 4R1EA 1OE9B 1SL7A 2HF5A 1F8HA 2COLB 3CS1A 4MRXA 5KSZA 2BCXA 1YRUB 1PALA 1QX5B 5AEQA 3SJSA 1UHIA 2PMYA 4ORCB 2JT0A 2MHHA 1KK7Z 4PHMA 4XJKB 4CPVA 1YR5A 2OS8B 2M1UA 4IL1A 1WLZA 1WRLA 1PRWA 1R2UA 1TNXA 2QPTA 4NDBA 3VROA 1KFUL 1MXLC 2HQWA 1ZACA 3DVEA 1CLMA 4HREE 3D0YB 1SPYA 3EK8A 1NX1A 1NP8A 3PATA 3SG2A 1MQ1A 2LLUA 4M2PA 2H2KA 2HPSA 2KSPA 4YGCB 2KBMA 2LMVA 4GGNA 2LP2A 1K96A 3I5IC 2LNKA 5B8IB 4GFTA 1JUOA 2KBIA 5TNCA 4PHNA 1ZMZA 2F3YA 1XA5A 1L2OB 2LV7A 2K8MB 1NUBA 3VRNA 1N2DA 4AQIA 1QIVA 5D69A 1EL4A 3KEVA 2ZNEA 1DJIA 2ISDA 2BL0C 3I5GB 2WC8A 3IQOA 4QJ4B 3EK7A 2Q91A 2KAVA 3DVJA 1S5GY 3OHMB 3AKBA 4YBHB 1DJYA 5CSJA 1CMGA 2CXJA 1N0YA 4CFQA 1XFZO 2AMIA 1JBAA 1OMVA 1NX2A 3VGOA 2G9BA 3TUYC 3LK0A 3DVMA 3CGAA 1B1GA 5D7FA 1X02A 3CR5X 1GGZA 1BR1B 1QV0A 3CTNA 1YVHA 3CWGA 1AVSA 5IBWA 4I5LB 1QIWA 2L5XB 1QV1A 1CDMA 1YUTA 3OP0A 3LLEA 5AXIA 1CTRA 2G2BA 2KI6D 4I5JA 1DJZA 3WHUB 2OTGB 1QXPA 1DF0A 3SIAA 5I2QA 2EHBA 1E8AA 4HRGA 2BCAA 1NSHA 1NCYA 1K94A 3SG3A 1KWOC 2FJUB 1CDPA 1DMOA 2MJWB 1A4PA 3BXKA 1EG4A 3E3RA 1NCZA 5AFPA 3PM8A 5HKWA 1WDCC 2KGBC 5ER5A 4U8DA 4I5KA 1Y1AA 1UHJA 4CLNA 2L4HA 3O2PA 3QRXA 2K0JA 1BF5A 1QTXA 1J7OA 1SCMC 4PE1A 1S6CA 1KSMA 2A4JA 1XFXO 2K7CA 4MRYA 1OZOA 3TS5C 1JF0A 2CCMA 2BKHB 5HYDA 2OPOA 2JC2A 3BUMB 2NZ0A 1OMDA 1U5IA 1SCVA 4YGDB 4OKHA 4DUQA 1M31A 2CBLA 2PVBA 5HLVA 3SG4A 1IKUA 2ZN8A 1ALWA 1XK4A 1F4QA 1L7ZA 3AAKA 3EVRA 4N1FA 3LK1A 1K90D 2JXCA 2Y5IA 3DF0A 3OB1B 2F8PA 2EC6C 2LP3A 3I5FC 4GPLB 5JOLA 1GGWA 1AJ5A 1MUXA 1B7TY 1NPQA 1UHHA 4JQ0D 1SBJA 1F54A 4ICBA 1CDNA 5JJGA 1ZUZA 1CLLA 1DJWA 1PULA 1TCOB 2HQ8A 2ZRSA 3PSRA 1EJ3A 1LXFC 4XJKA 1MWNA 2M49B 5I2LA 3HX4A 3NSIA 2LC5A 4YI8A 1QATA 1XFWO 1CDLA 1IGVA 2KHNA 2KFFA 4PE7A 3EVVA 3D0YA 4MSPA 1CNPA 1AK8A 1RJVA 4M2OA 1TNPA 1K2HA 1Y1UA 1BOCA 1M46A 1F55A 1V1GA 2JRFA 3GK1A 1IWQA 1QS7A 1CMFA 1YX7A 1WRKA 1CFPA 1A75B 2KGRA 3I5IB 5FYXA 1C7WA 3CLNA 4UPGA 1TOPA 2M0RA 2DOQA 3TZ1A 5I2OA 1Y1XA 4PHKA 4YGBB 2LLSA 1FW4A 1J55A 2ZN9A 4F0ZB 2ZKMX 4USLA 1K93D 1XK4C 5DKQA 1IJ6A 2JXLA 1Y0VH 3BQ3A 2BL0B 3EK4A 3FS7A 2KI4B 1C07A 3ZWHA 3HCMA 2WCEA 2V53A 3BOWA 4GAOA 4GGFA 1BMOA 1RECA 2H61C 2VRGA 4FQOA 4MBEA 1TCFA 1SL8A 4ZCUA 1B8LA 2GV5A 3A4UB 3MSEB 1RWYA 1Q80A 1AUIB 4DIRA 2I7AA 2LUCA 1B9AA 2RGIA 3TUYB 2LHLA 5K89A 1QX2A 1OMRA 1YURA 2LVJA 3GK4X 5AANA 1IQ3A 3SG7A 2JOJA 1MR8A 3VRQA 2MBXA 2PSRA 1TIZA 5PALA 1JFKA 1QX7A 1GQMA 3RM1A 2FOTA 1AHRA 3OB2B 1H8BA 3GOFA 1SY9A 1DGUA 1M63B 1KCYA 1TN4A 2KAXA 2PRUA 3I5HC 1NCXA 3DD4A 2M7NA 5F6TA 1K8UA 2BCBA 1YRTB 1LINA 1RROA 2Y1NA 3PALA 1K9UA 1KWOB 2NXQA 4E68A 3VRRA 1QLKA 3TDZA 4MVFA 4DCKA 1UUSA 1CFDA 5G08A 1ALVA 5ER4X 1DVIA 2JZIA 4PCWA 1N65A 3ZNIA 1WDCB 4CIDA 5HKYA 1SKTA 1UURA 2F3ZA 4MZKA 5KTYA 1XYDA 2ZFDA 1KFXL 1IJ5A 1J7QA 4A4BA 1SNLA 2KYCA 2Q4UA 4MN0A 3ICBA 1JSAA 2JULA 1SK6D 1SCMB 5CPVA 2KQ6A 2LLTA 1KFUS 1CM1A 2MRDA 1GJYA 1HQVA 1KSOA 1UHNA 1V1FA 1S36A 1VRKA 2K7DA 2L51A 2CTNA 3BUOB 4MEWA 1XFUO 3BUWB 1S6JA 2WNDA 1OZSA 3PN7B 1SW8A 2KNEA 4I5NB 1SRAA 1F71A 2B1UA 2LVKA 2Y1MA 4YI9A 1NX0A 2LMUA 1S5GZ 2JTZA 2NCPA 5I8NA 3H4SE 2NLNA 3PLFB 1S26D 1G33A 2JWWA 2R2IA 1YTZC 2IS9A 3AKAA 4Q04A 4N1GA 2M1KB 2LUXA 2KQYA 3JTDC 1DTLA 2M29A 4ORAB 2L50A 5CSNA 3AAJA 4C0LA 4YRUA 1OSAA 1ZFSA 1K95A 2JQ6A 1C7VA 4N5XA 2I2RE 1XO5A 1SR6B 2F2OA 2L2EA 4NDCA 2MLFC 2LANA 5HKZA 1IG5A 1RK9A 4CFRA 3BYAA 2M7LA 3CZTX 1YX8A 1UWOA 2BKIB 3KHEA 1J7RA 4GBAA 4M2QA 1FF1A 1F70A 1NX3A 1K9KA 4OCIA 3OX5A 2BBNA 2LAPA 4HSZA 4WQ2A 2ZNDA 5CSIA 3BUXB 4PE4A 1MHOA 4L9MA 1LA0A 1DJHA 1A75A 2KFGA 3PFVA 1EG3A 2O60A 4NDDA 2I18A 2L98A 1ZOTB 2LMTA 4PE0A 2FCEA 5AERA
chains in the Genus database with same CATH superfamily
2BECA 5DKRA 2K7BA 1YUUA 1JF2A 3JVTC 2LHIA 5DKNA 4JWQA 2MAZA 3SIBA 1EXRA 2CNPA 1B8CA 1K9PA 2P70A 2WORA 4TNCA 5FI2A 3EKJA 3WHTB 3IF7A 4NQGA 1KK8C 1RFJA 2O5GA 3GK2A 3BFHA 3KPXA 2MA2A 4OR9B 1OOIX 2BBMA 4ETOA 1CM4A 4WRIA 4P2YB 1BT6A 4QJ5B 1XVJA 1KQMC 1W7IB 2L0PA 3WXAA 1CB1A 2NCOA 1OOJA 1CKKA 5GQQC 1OQPA 1NWDA 1M39A 5KU1A 3N7HA 3SS3A 1XFVO 3A8RA 3K21A 1B7TZ 2Y4QA 4BY4A 2D8NA 3NSKA 4QJ3B 1MF8B 5DICA 2CT9A 2KPHA 2OS8C 3I5HB 1QJTA 2I94A 4MLWA 4OV2A 3WNXB 1CFFA 1H4BA 4IJ7A 1BJFA 1TWOA 1XFRA 2F33A 4GUKA 1LA3A 4XYNA 3M0WA 1J1EA 2AAOA 1J1DA 1TRFA 3NHIA 3DVKA 3OX6A 2HETA 4A4CA 1M45A 1UHKA 1TNQA 1ODBA 3IVTA 1FPWA 1D1OA 1IQ5A 1FI5A 3NSOA 4AOMA 1J7PA 2KI4C 2E30A 3TDIA 3KO0A 1NYAA 1YVLA 2L2CA 4ORBB 1S1EA 1L2OC 1Z4HA 2E6WA 3BOWB 5HL1A 1IH0A 3EKHA 1QVIY 1NIWA 1FI6A 3BUNB 2GGMA 2QACA 2M97A 2WCBA 3CR2A 1DQEA 2JNFA 1WLMA 2BE6A 3VRPA 2P6BB 1DT7B 5J3XA 3I5GC 3S0EA 3O4XA 4WQ3A 1S3PA 1FBVA 2LVVA 2M9GA 3S0BA 4GGFC 1CLBA 1JWDA 4FTGA 5CSFA 2JPTA 2AUCA 2BE4A 1R6PA 3L4AA 1B4CA 1TNWA 3B7AA 1OOFA 3F45A 2WCKA 1PK0D 1YUSA 1Z2CB 3D10A 3TS5B 2FCDA 1HT9A 1XFYO 1AJ4A 2QEBA 3O4YA 1A03A 3RLZA 2GGZA 1T14A 1Y6WA 2F2PA 1BU3A 1BR4B 2LVIA 3JTDB 2KFHA 1BLQA 1WY9A 3FE6A 2PQLA 2K2AA 1A2XA 2OTGC 1JFJA 3EVUA 2LE9B 2PALA 1PSRA 1DF0B 1LVCD 2QDIA 3QMEA 4YGAA 2ERBA 4HRHA 3TDUA 2EC6B 2WOSA 2JTTA 2M8UA 3B86A 1DJXA 2WC5A 3I5FB 3NSLA 4OVNF 1A29A 2L5YA 4ZCVA 1TTXA 2JU0A 2LCPA 2SASA 2EGDA 2K2FA 1F4OA 5BPJA 1KK7Y 1SL9A 1C3YA 3O78A 3LCPC 3LL8B 3KF9A 3SG5A 3R1VA 4P5OE 2KAYA 4JPZB 4PALA 2MLEC 1DJGA 1SYMA 1QASA 4GNKB 1CFCA 2KDHA 1QVIZ 3R72A 4YGEB 2H8VA 3OGNA 1EH2A 1G8IA 2K61A 1JC2A 1B47A 3O6BA 1WRZA 1IRJA 1W7JB 3C1VA 3Q8IA 3EG5B 3PN7C 3CR4X 1RTP1 3CYZA 1TUJA 2JT8A 1B8RA 3FWCA 3IQQA 3L47A 1UP5A 2BAPA 5HLOA 3NXAA 3JVTB 2KOTA 4C0KA 1LKJA 1PVAA 1U5IB 2M3WA 4MZLA 3SG6A 1DGVA 4AQJA 1BG1A 1MXEA 2K7OA 2JNXA 2L4IA 3D75A 4D1EA 4C0JA 2TN4A 1KK8B 3D78A 1SMGA 1QLSA 2H61A 2WCFA 3FWBA 4PDZA 1DELA 1KFXS 2KYFA 1KQVA 2ZRTA 1PVBA 1BODA 4PHJA 3FIAA 4DRWA 1S6IA 3FE9A 4DS7A 2LM5A 2SCPA 2KI6C 3DF0B 4BY5A 1PSBA 1SR6C 1AP4A 1FF1A 1G4YR 4MZJA 1KQMB 2JT3A 2PASA 4R1EA 1OE9B 1SL7A 2HF5A 1F8HA 2COLB 3CS1A 4MRXA 5KSZA 2BCXA 1YRUB 1PALA 1QX5B 5AEQA 3SJSA 1UHIA 2PMYA 4ORCB 2JT0A 2MHHA 1KK7Z 3CDNA 4PHMA 4PT1A 4XJKB 4CPVA 1YR5A 2OS8B 2M1UA 3DXLA 1WLZA 1WRLA 1PRWA 1R2UA 1TNXA 2QPTA 4NDBA 3VROA 1KFUL 1C3ZA 1MXLC 2HQWA 1ZACA 3DVEA 1CLMA 4HREE 3D0YB 1SPYA 3EK8A 1NX1A 1NP8A 3PATA 3SG2A 1MQ1A 1QWVA 2LLUA 2K60A 4M2PA 2H2KA 2HPSA 2KSPA 4YGCB 1OOGA 2KBMA 2LMVA 4GGNA 2LP2A 1K96A 3UO9A 3I5IC 2LNKA 5B8IB 4GFTA 1JUOA 2KBIA 5TNCA 3BFAA 2P71A 4PHNA 1ZMZA 2F3YA 1XA5A 1L2OB 2LV7A 2K8MB 1NUBA 3VRNA 1N2DA 4AQIA 1QIVA 5D69A 1EL4A 3KEVA 2ZNEA 1DJIA 2ISDA 2BL0C 3I5GB 2WC8A 3IQOA 4QJ4B 5FI7A 3EK7A 3B87A 2Q91A 2KAVA 3DVJA 1S5GY 3OHMB 3AKBA 4YBHB 1DJYA 5CSJA 1CMGA 2CXJA 1N0YA 4CFQA 1XFZO 1OOHA 2AMIA 1JBAA 1OMVA 3BJHA 1NX2A 3VGOA 2G9BA 3TUYC 3LK0A 3PJIA 3DVMA 3CGAA 1B1GA 5D7FA 1X02A 3CR5X 1GGZA 1BR1B 1QV0A 3CTNA 1YVHA 3CWGA 1AVSA 4FQTA 5IBWA 4JD9A 4I5LB 1QIWA 2L5XB 1QV1A 1CDMA 1YUTA 3OP0A 3LLEA 5AXIA 1CTRA 2G2BA 2KI6D 4I5JA 1DJZA 3WHUB 2OTGB 1QXPA 1DF0A 3SIAA 5I2QA 2EHBA 1E8AA 4HRGA 2BCAA 1NSHA 1NCYA 1K94A 3SG3A 1KWOC 3OBVA 3RZSA 2FJUB 1CDPA 1DMOA 2MJWB 1A4PA 3BXKA 4INWA 1EG4A 4IL1A 3E3RA 3SS5A 1NCZA 5AFPA 3PM8A 5HKWA 1WDCC 2KGBC 1IIOA 5ER5A 3NGVA 4U8DA 4I5KA 1Y1AA 1UHJA 4CLNA 2L4HA 3O2PA 3QRXA 3K1EA 2K0JA 1BF5A 1QTXA 1J7OA 1SCMC 4PE1A 4F7FA 1S6CA 1KSMA 2A4JA 1XFXO 2QEVA 2K7CA 4MRYA 1OZOA 3TS5C 1JF0A 2CCMA 2BKHB 5HYDA 2OPOA 2JC2A 3BUMB 2NZ0A 1OMDA 1U5IA 1SCVA 4YGDB 4OKHA 4DUQA 1M31A 2CBLA 2PVBA 3NHTA 1LS8A 5HLVA 3SG4A 1IKUA 2ZN8A 3D76A 1ALWA 1XK4A 1F4QA 1L7ZA 3AAKA 3EVRA 4N1FA 2WC6A 3LK1A 1K90D 2JXCA 2Y5IA 3DF0A 3OB1B 2F8PA 2EC6C 2LP3A 3DYEA 3I5FC 4GPLB 5JOLA 1GGWA 1AJ5A 1MUXA 1B7TY 1NPQA 1UHHA 4JQ0D 3CZ2A 1SBJA 1F54A 4ICBA 1CDNA 5JJGA 1ZUZA 1CLLA 1DJWA 1PULA 1TCOB 2HQ8A 2ZRSA 3PSRA 1EJ3A 1LXFC 4XJKA 1MWNA 3S0AA 2M49B 3DZTA 5I2LA 3HX4A 3NSIA 2LC5A 4YI8A 1QATA 1XFWO 1CDLA 1IGVA 2KHNA 2KFFA 3D77A 3EVVA 3D0YA 4MSPA 4PE7A 1AK8A 1CNPA 1RJVA 2WCLA 1TNPA 4M2OA 1K2HA 1Y1UA 1BOCA 1M46A 2JPOA 1F55A 1V1GA 2JRFA 3GK1A 1IWQA 1QS7A 1CMFA 1YX7A 1WRKA 1CFPA 1A75B 2KGRA 3I5IB 5FYXA 4OZDA 1C7WA 3CLNA 1OW4A 4UPGA 1TOPA 2M0RA 2DOQA 3TZ1A 5I2OA 1Y1XA 4PHKA 4YGBB 2LLSA 1FW4A 3R1OA 1J55A 3SS4A 2ZN9A 3D73A 2ZKMX 4USLA 4F0ZB 1K93D 1XK4C 5DKQA 1IJ6A 3UNWA 2JXLA 1Y0VH 3BQ3A 2BL0B 3EK4A 3FS7A 2KI4B 1C07A 2FJYA 3CZ0A 3ZWHA 3HCMA 2WCEA 2V53A 3BOWA 4GAOA 4GGFA 1BMOA 1RECA 2H61C 2VRGA 4FQOA 4MBEA 1TCFA 3B6XA 5D3OA 1SL8A 4ZCUA 1B8LA 2GV5A 3A4UB 3MSEB 1RWYA 1Q80A 1AUIB 4DIRA 2I7AA 2LUCA 1B9AA 2RGIA 3TUYB 2LHLA 3FE8A 5K89A 1QX2A 1OMRA 1YURA 2LVJA 3GK4X 5AANA 3S0DA 1IQ3A 3SG7A 2JOJA 1MR8A 3VRQA 5FI6A 2MBXA 2PSRA 1TIZA 3R1PA 1JFKA 5PALA 1QX7A 1GQMA 3RM1A 2FOTA 5EL2A 1AHRA 3OB2B 1H8BA 2PYQA 3GOFA 1SY9A 1DGUA 1M63B 1KCYA 1TN4A 3VB1A 2KAXA 2PRUA 3B88A 3I5HC 1NCXA 3DD4A 2M7NA 5F6TA 1K8UA 2BCBA 1YRTB 1LINA 1RROA 2Y1NA 3DY9A 3PALA 1K9UA 1KWOB 3PM2A 2NXQA 4E68A 3VRRA 1QLKA 3TDZA 4MVFA 4DCKA 1UUSA 1CFDA 1W9ZA 1ALVA 1SSEB 2KLDA 1DVIA 5ER4X 2JZIA 5G08A 4PCWA 1N65A 4INXA 3ZNIA 1WDCB 4CIDA 5HKYA 1SKTA 1TUZA 1UURA 2F3ZA 4MZKA 3S0GA 1XYDA 2ZFDA 5KTYA 1KFXL 1IJ5A 2YGUA 3L4LA 1J7QA 2QEHA 1SNLA 2KYCA 2Q4UA 4MN0A 3ICBA 4A4BA 1JSAA 2JULA 1SK6D 1SCMB 5CPVA 3V2LA 2KQ6A 2LLTA 1KFUS 1CM1A 2MRDA 1GJYA 3BFBA 1HQVA 1KSOA 1UHNA 1V1FA 1S36A 1DEKA 1VRKA 2K7DA 2CTNA 2L51A 3BUOB 4MEWA 1XFUO 3BUWB 1S6JA 2WNDA 2WCHA 1OZSA 3PN7B 1SW8A 2KNEA 4I5NB 1SRAA 1F71A 2B1UA 1P28A 2LVKA 2Y1MA 4YI9A 1NX0A 2LMUA 1S5GZ 2JTZA 2NCPA 5I8NA 2WCJA 3D74A 3H4SE 2QEOA 2NLNA 3PLFB 1S26D 2KLEA 1G33A 5I94A 2JWWA 2R2IA 4KYNA 3CZ1A 1YTZC 2IS9A 3AKAA 4Q04A 4N1GA 2M1KB 2LUXA 2KQYA 3JTDC 1DTLA 2M29A 4ORAB 2L50A 5CSNA 3AAJA 4C0LA 4YRUA 1OSAA 1ZFSA 1K95A 2JQ6A 1C7VA 4N5XA 2GTEA 1DC1A 2WCMA 2I2RE 1XO5A 1SR6B 2F2OA 2L2EA 4NDCA 2MLFC 2LANA 5HKZA 1IG5A 1RK9A 4CFRA 3BYAA 2M7LA 3CZTX 1YX8A 1UWOA 2BKIB 3KHEA 1J7RA 4GBAA 4JKTA 4M2QA 1F70A 1NX3A 1K9KA 3CABA 4OCIA 3OX5A 2BBNA 2LAPA 4HSZA 1GM0A 4WQ2A 2ZNDA 5CSIA 3BUXB 2BNXA 4PE4A 1ORGA 1MHOA 4L9MA 1LA0A 1DJHA 3S0FA 1A75A 2KFGA 3PFVA 1EG3A 2O60A 4NDDA 2I18A 2L98A 1ZOTB 2LMTA 4PE0A 2FCEA 5AERA
chains in the Genus database with same CATH topology
2BECA 5DKRA 2K7BA 1YUUA 1JF2A 3JVTC 2LHIA 5DKNA 4JWQA 2MAZA 3SIBA 1EXRA 2CNPA 1B8CA 1K9PA 2WORA 4TNCA 3EKJA 3WHTB 3IF7A 4NQGA 1KK8C 1RFJA 2O5GA 3GK2A 3KPXA 2MA2A 4OR9B 2BBMA 4ETOA 1CM4A 4WRIA 4P2YB 1BT6A 4QJ5B 1XVJA 1KQMC 1W7IB 2L0PA 3WXAA 1CB1A 2NCOA 1OOJA 1CKKA 5GQQC 1OQPA 1NWDA 1M39A 5KU1A 1XFVO 3A8RA 3K21A 1B7TZ 2Y4QA 4BY4A 2D8NA 3NSKA 4QJ3B 1MF8B 2CT9A 2OS8C 3I5HB 1QJTA 2I94A 4MLWA 4OV2A 3WNXB 1CFFA 1H4BA 1BJFA 2F33A 4GUKA 1LA3A 4XYNA 3M0WA 1J1EA 2AAOA 1J1DA 1TRFA 3DVKA 3OX6A 2HETA 4A4CA 1M45A 1UHKA 1TNQA 1ODBA 1FPWA 1D1OA 1IQ5A 1FI5A 3NSOA 4AOMA 1J7PA 2KI4C 2E30A 3TDIA 3KO0A 1NYAA 1YVLA 4ORBB 1S1EA 1L2OC 2E6WA 3BOWB 1IH0A 3EKHA 1QVIY 1NIWA 1FI6A 3BUNB 2GGMA 2QACA 2M97A 2WCBA 3CR2A 2JNFA 1WLMA 2BE6A 3VRPA 2P6BB 1DT7B 5J3XA 3I5GC 4WQ3A 1S3PA 1FBVA 2LVVA 2M9GA 1CLBA 4GGFC 1JWDA 4FTGA 5CSFA 2JPTA 2AUCA 2BE4A 1R6PA 1B4CA 1TNWA 3F45A 3D10A 1PK0D 1YUSA 3TS5B 2FCDA 1HT9A 1XFYO 1AJ4A 3O4YA 1A03A 3RLZA 2GGZA 2F2PA 1Y6WA 1BU3A 1BR4B 2LVIA 3JTDB 2KFHA 1BLQA 1WY9A 2K2AA 1A2XA 2OTGC 1JFJA 3EVUA 2LE9B 2PALA 1PSRA 1DF0B 1LVCD 4YGAA 4HRHA 3TDUA 2EC6B 2WOSA 2JTTA 2M8UA 3I5FB 1DJXA 4ZCVA 3NSLA 4OVNF 1A29A 1TTXA 2JU0A 2LCPA 2SASA 2EGDA 2K2FA 1F4OA 5BPJA 1KK7Y 1SL9A 3O78A 3LCPC 3LL8B 3KF9A 3SG5A 4P5OE 2KAYA 4JPZB 4PALA 2MLEC 1DJGA 1SYMA 1QASA 4GNKB 1CFCA 2KDHA 1QVIZ 4YGEB 1EH2A 1G8IA 2K61A 1JC2A 1B47A 3O6BA 1WRZA 1IRJA 1W7JB 3C1VA 3PN7C 3CR4X 1RTP1 2JT8A 1B8RA 3FWCA 3IQQA 1UP5A 5HLOA 3NXAA 3JVTB 2KOTA 4C0KA 1LKJA 1PVAA 1U5IB 2M3WA 4MZLA 3SG6A 1DGVA 4AQJA 1BG1A 1MXEA 2K7OA 2JNXA 2L4IA 4D1EA 4C0JA 2TN4A 1KK8B 1SMGA 1QLSA 2H61A 2WCFA 3FWBA 4PDZA 1KFXS 2KYFA 1KQVA 2ZRTA 1PVBA 1BODA 4PHJA 3FIAA 4DRWA 1S6IA 4DS7A 2LM5A 2SCPA 2KI6C 3DF0B 4BY5A 1PSBA 1SR6C 1AP4A 1G4YR 4MZJA 1KQMB 2JT3A 2PASA 4R1EA 1OE9B 1SL7A 2HF5A 1F8HA 2COLB 3CS1A 4MRXA 5KSZA 2BCXA 1YRUB 1PALA 1QX5B 5AEQA 3SJSA 1UHIA 2PMYA 4ORCB 2JT0A 2MHHA 1KK7Z 4PHMA 4XJKB 4CPVA 1YR5A 2OS8B 2M1UA 4IL1A 1WLZA 1WRLA 1PRWA 1R2UA 1TNXA 2QPTA 4NDBA 3VROA 1KFUL 1MXLC 2HQWA 1ZACA 3DVEA 1CLMA 4HREE 3D0YB 1SPYA 3EK8A 1NX1A 1NP8A 3PATA 3SG2A 1MQ1A 2LLUA 4M2PA 2H2KA 2HPSA 2KSPA 4YGCB 2KBMA 2LMVA 4GGNA 2LP2A 1K96A 3I5IC 2LNKA 5B8IB 4GFTA 1JUOA 2KBIA 5TNCA 4PHNA 1ZMZA 2F3YA 1XA5A 1L2OB 2LV7A 2K8MB 1NUBA 3VRNA 1N2DA 4AQIA 1QIVA 5D69A 1EL4A 3KEVA 2ZNEA 1DJIA 2ISDA 2BL0C 3I5GB 2WC8A 3IQOA 4QJ4B 3EK7A 2Q91A 2KAVA 3DVJA 1S5GY 3OHMB 3AKBA 4YBHB 1DJYA 5CSJA 1CMGA 2CXJA 1N0YA 4CFQA 1XFZO 2AMIA 1JBAA 1OMVA 1NX2A 3VGOA 2G9BA 3TUYC 3LK0A 3DVMA 3CGAA 1B1GA 5D7FA 1X02A 3CR5X 1GGZA 1BR1B 1QV0A 3CTNA 1YVHA 3CWGA 1AVSA 5IBWA 4I5LB 1QIWA 2L5XB 1QV1A 1CDMA 1YUTA 3OP0A 3LLEA 5AXIA 1CTRA 2G2BA 2KI6D 4I5JA 1DJZA 3WHUB 2OTGB 1QXPA 1DF0A 3SIAA 5I2QA 2EHBA 1E8AA 4HRGA 2BCAA 1NSHA 1NCYA 1K94A 3SG3A 1KWOC 2FJUB 1CDPA 1DMOA 2MJWB 1A4PA 3BXKA 1EG4A 3E3RA 1NCZA 5AFPA 3PM8A 5HKWA 1WDCC 2KGBC 5ER5A 4U8DA 4I5KA 1Y1AA 1UHJA 4CLNA 2L4HA 3O2PA 3QRXA 2K0JA 1BF5A 1QTXA 1J7OA 1SCMC 4PE1A 1S6CA 1KSMA 2A4JA 1XFXO 2K7CA 4MRYA 1OZOA 3TS5C 1JF0A 2CCMA 2BKHB 5HYDA 2OPOA 2JC2A 3BUMB 2NZ0A 1OMDA 1U5IA 1SCVA 4YGDB 4OKHA 4DUQA 1M31A 2CBLA 2PVBA 5HLVA 3SG4A 1IKUA 2ZN8A 1ALWA 1XK4A 1F4QA 1L7ZA 3AAKA 3EVRA 4N1FA 3LK1A 1K90D 2JXCA 2Y5IA 3DF0A 3OB1B 2F8PA 2EC6C 2LP3A 3I5FC 4GPLB 5JOLA 1GGWA 1AJ5A 1MUXA 1B7TY 1NPQA 1UHHA 4JQ0D 1SBJA 1F54A 4ICBA 1CDNA 5JJGA 1ZUZA 1CLLA 1DJWA 1PULA 1TCOB 2HQ8A 2ZRSA 3PSRA 1EJ3A 1LXFC 4XJKA 1MWNA 2M49B 5I2LA 3HX4A 3NSIA 2LC5A 4YI8A 1QATA 1XFWO 1CDLA 1IGVA 2KHNA 2KFFA 4PE7A 3EVVA 3D0YA 4MSPA 1CNPA 1AK8A 1RJVA 4M2OA 1TNPA 1K2HA 1Y1UA 1BOCA 1M46A 1F55A 1V1GA 2JRFA 3GK1A 1IWQA 1QS7A 1CMFA 1YX7A 1WRKA 1CFPA 1A75B 2KGRA 3I5IB 5FYXA 1C7WA 3CLNA 4UPGA 1TOPA 2M0RA 2DOQA 3TZ1A 5I2OA 1Y1XA 4PHKA 4YGBB 2LLSA 1FW4A 1J55A 2ZN9A 4F0ZB 2ZKMX 4USLA 1K93D 1XK4C 5DKQA 1IJ6A 2JXLA 1Y0VH 3BQ3A 2BL0B 3EK4A 3FS7A 2KI4B 1C07A 3ZWHA 3HCMA 2WCEA 2V53A 3BOWA 4GAOA 4GGFA 1BMOA 1RECA 2H61C 2VRGA 4FQOA 4MBEA 1TCFA 1SL8A 4ZCUA 1B8LA 2GV5A 3A4UB 3MSEB 1RWYA 1Q80A 1AUIB 4DIRA 2I7AA 2LUCA 1B9AA 2RGIA 3TUYB 2LHLA 5K89A 1QX2A 1OMRA 1YURA 2LVJA 3GK4X 5AANA 1IQ3A 3SG7A 2JOJA 1MR8A 3VRQA 2MBXA 2PSRA 1TIZA 5PALA 1JFKA 1QX7A 1GQMA 3RM1A 2FOTA 1AHRA 3OB2B 1H8BA 3GOFA 1SY9A 1DGUA 1M63B 1KCYA 1TN4A 2KAXA 2PRUA 3I5HC 1NCXA 3DD4A 2M7NA 5F6TA 1K8UA 2BCBA 1YRTB 1LINA 1RROA 2Y1NA 3PALA 1K9UA 1KWOB 2NXQA 4E68A 3VRRA 1QLKA 3TDZA 4MVFA 4DCKA 1UUSA 1CFDA 5G08A 1ALVA 5ER4X 1DVIA 2JZIA 4PCWA 1N65A 3ZNIA 1WDCB 4CIDA 5HKYA 1SKTA 1UURA 2F3ZA 4MZKA 5KTYA 1XYDA 2ZFDA 1KFXL 1IJ5A 1J7QA 4A4BA 1SNLA 2KYCA 2Q4UA 4MN0A 3ICBA 1JSAA 2JULA 1SK6D 1SCMB 5CPVA 2KQ6A 2LLTA 1KFUS 1CM1A 2MRDA 1GJYA 1HQVA 1KSOA 1UHNA 1V1FA 1S36A 1VRKA 2K7DA 2L51A 2CTNA 3BUOB 4MEWA 1XFUO 3BUWB 1S6JA 2WNDA 1OZSA 3PN7B 1SW8A 2KNEA 4I5NB 1SRAA 1F71A 2B1UA 2LVKA 2Y1MA 4YI9A 1NX0A 2LMUA 1S5GZ 2JTZA 2NCPA 5I8NA 3H4SE 2NLNA 3PLFB 1S26D 1G33A 2JWWA 2R2IA 1YTZC 2IS9A 3AKAA 4Q04A 4N1GA 2M1KB 2LUXA 2KQYA 3JTDC 1DTLA 2M29A 4ORAB 2L50A 5CSNA 3AAJA 4C0LA 4YRUA 1OSAA 1ZFSA 1K95A 2JQ6A 1C7VA 4N5XA 2I2RE 1XO5A 1SR6B 2F2OA 2L2EA 4NDCA 2MLFC 2LANA 5HKZA 1IG5A 1RK9A 4CFRA 3BYAA 2M7LA 3CZTX 1YX8A 1UWOA 2BKIB 3KHEA 1J7RA 4GBAA 4M2QA 1FF1A 1F70A 1NX3A 1K9KA 4OCIA 3OX5A 2BBNA 2LAPA 4HSZA 4WQ2A 2ZNDA 5CSIA 3BUXB 4PE4A 1MHOA 4L9MA 1LA0A 1DJHA 1A75A 2KFGA 3PFVA 1EG3A 2O60A 4NDDA 2I18A 2L98A 1ZOTB 2LMTA 4PE0A 2FCEA 5AERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEC A;  5DKR A;  2K7B A;  1YUU A;  1JF2 A;  3JVT C;  2LHI A;  5DKN A;  4JWQ A;  2MAZ A;  3SIB A;  1EXR A;  2CNP A;  1B8C A;  1K9P A;  2WOR A;  4TNC A;  3EKJ A;  3WHT B;  3IF7 A;  4NQG A;  1KK8 C;  1RFJ A;  2O5G A;  3GK2 A;  3KPX A;  2MA2 A;  4OR9 B;  2BBM A;  4ETO A;  1CM4 A;  4WRI A;  4P2Y B;  1BT6 A;  4QJ5 B;  1XVJ A;  1KQM C;  1W7I B;  2L0P A;  3WXA A;  1CB1 A;  2NCO A;  1OOJ A;  1CKK A;  5GQQ C;  1OQP A;  1NWD A;  1M39 A;  5KU1 A;  1XFV O;  3A8R A;  3K21 A;  1B7T Z;  2Y4Q A;  4BY4 A;  2D8N A;  3NSK A;  4QJ3 B;  1MF8 B;  2CT9 A;  2OS8 C;  3I5H B;  1QJT A;  2I94 A;  4MLW A;  4OV2 A;  3WNX B;  1CFF A;  1H4B A;  1BJF A;  2F33 A;  4GUK A;  1LA3 A;  4XYN A;  3M0W A;  1J1E A;  2AAO A;  1J1D A;  1TRF A;  3DVK A;  3OX6 A;  2HET A;  4A4C A;  1M45 A;  1UHK A;  1TNQ A;  1ODB A;  1FPW A;  1D1O A;  1IQ5 A;  1FI5 A;  3NSO A;  4AOM A;  1J7P A;  2KI4 C;  2E30 A;  3TDI A;  3KO0 A;  1NYA A;  1YVL A;  4ORB B;  1S1E A;  1L2O C;  2E6W A;  3BOW B;  1IH0 A;  3EKH A;  1QVI Y;  1NIW A;  1FI6 A;  3BUN B;  2GGM A;  2QAC A;  2M97 A;  2WCB A;  3CR2 A;  2JNF A;  1WLM A;  2BE6 A;  3VRP A;  2P6B B;  1DT7 B;  5J3X A;  3I5G C;  4WQ3 A;  1S3P A;  1FBV A;  2LVV A;  2M9G A;  1CLB A;  4GGF C;  1JWD A;  4FTG A;  5CSF A;  2JPT A;  2AUC A;  2BE4 A;  1R6P A;  1B4C A;  1TNW A;  3F45 A;  3D10 A;  1PK0 D;  1YUS A;  3TS5 B;  2FCD A;  1HT9 A;  1XFY O;  1AJ4 A;  3O4Y A;  1A03 A;  3RLZ A;  2GGZ A;  2F2P A;  1Y6W A;  1BU3 A;  1BR4 B;  2LVI A;  3JTD B;  2KFH A;  1BLQ A;  1WY9 A;  2K2A A;  1A2X A;  2OTG C;  1JFJ A;  3EVU A;  2LE9 B;  2PAL A;  1PSR A;  1DF0 B;  1LVC D;  4YGA A;  4HRH A;  3TDU A;  2EC6 B;  2WOS A;  2JTT A;  2M8U A;  3I5F B;  1DJX A;  4ZCV A;  3NSL A;  4OVN F;  1A29 A;  1TTX A;  2JU0 A;  2LCP A;  2SAS A;  2EGD A;  2K2F A;  1F4O A;  5BPJ A;  1KK7 Y;  1SL9 A;  3O78 A;  3LCP C;  3LL8 B;  3KF9 A;  3SG5 A;  4P5O E;  2KAY A;  4JPZ B;  4PAL A;  2MLE C;  1DJG A;  1SYM A;  1QAS A;  4GNK B;  1CFC A;  2KDH A;  1QVI Z;  4YGE B;  1EH2 A;  1G8I A;  2K61 A;  1JC2 A;  1B47 A;  3O6B A;  1WRZ A;  1IRJ A;  1W7J B;  3C1V A;  3PN7 C;  3CR4 X;  1RTP 1;  2JT8 A;  1B8R A;  3FWC A;  3IQQ A;  1UP5 A;  5HLO A;  3NXA A;  3JVT B;  2KOT A;  4C0K A;  1LKJ A;  1PVA A;  1U5I B;  2M3W A;  4MZL A;  3SG6 A;  1DGV A;  4AQJ A;  1BG1 A;  1MXE A;  2K7O A;  2JNX A;  2L4I A;  4D1E A;  4C0J A;  2TN4 A;  1KK8 B;  1SMG A;  1QLS A;  2H61 A;  2WCF A;  3FWB A;  4PDZ A;  1KFX S;  2KYF A;  1KQV A;  2ZRT A;  1PVB A;  1BOD A;  4PHJ A;  3FIA A;  4DRW A;  1S6I A;  4DS7 A;  2LM5 A;  2SCP A;  2KI6 C;  3DF0 B;  4BY5 A;  1PSB A;  1SR6 C;  1AP4 A;  1G4Y R;  4MZJ A;  1KQM B;  2JT3 A;  2PAS A;  4R1E A;  1OE9 B;  1SL7 A;  2HF5 A;  1F8H A;  2COL B;  3CS1 A;  4MRX A;  5KSZ A;  2BCX A;  1YRU B;  1PAL A;  1QX5 B;  5AEQ A;  3SJS A;  1UHI A;  2PMY A;  4ORC B;  2JT0 A;  2MHH A;  1KK7 Z;  4PHM A;  4XJK B;  4CPV A;  1YR5 A;  2OS8 B;  2M1U A;  4IL1 A;  1WLZ A;  1WRL A;  1PRW A;  1R2U A;  1TNX A;  2QPT A;  4NDB A;  3VRO A;  1KFU L;  1MXL C;  2HQW A;  1ZAC A;  3DVE A;  1CLM A;  4HRE E;  3D0Y B;  1SPY A;  3EK8 A;  1NX1 A;  1NP8 A;  3PAT A;  3SG2 A;  1MQ1 A;  2LLU A;  4M2P A;  2H2K A;  2HPS A;  2KSP A;  4YGC B;  2KBM A;  2LMV A;  4GGN A;  2LP2 A;  1K96 A;  3I5I C;  2LNK A;  5B8I B;  4GFT A;  1JUO A;  2KBI A;  5TNC A;  4PHN A;  1ZMZ A;  2F3Y A;  1XA5 A;  1L2O B;  2LV7 A;  2K8M B;  1NUB A;  3VRN A;  1N2D A;  4AQI A;  1QIV A;  5D69 A;  1EL4 A;  3KEV A;  2ZNE A;  1DJI A;  2ISD A;  2BL0 C;  3I5G B;  2WC8 A;  3IQO A;  4QJ4 B;  3EK7 A;  2Q91 A;  2KAV A;  3DVJ A;  1S5G Y;  3OHM B;  3AKB A;  4YBH B;  1DJY A;  5CSJ A;  1CMG A;  2CXJ A;  1N0Y A;  4CFQ A;  1XFZ O;  2AMI A;  1JBA A;  1OMV A;  1NX2 A;  3VGO A;  2G9B A;  3TUY C;  3LK0 A;  3DVM A;  3CGA A;  1B1G A;  5D7F A;  1X02 A;  3CR5 X;  1GGZ A;  1BR1 B;  1QV0 A;  3CTN A;  1YVH A;  3CWG A;  1AVS A;  5IBW A;  4I5L B;  1QIW A;  2L5X B;  1QV1 A;  1CDM A;  1YUT A;  3OP0 A;  3LLE A;  5AXI A;  1CTR A;  2G2B A;  2KI6 D;  4I5J A;  1DJZ A;  3WHU B;  2OTG B;  1QXP A;  1DF0 A;  3SIA A;  5I2Q A;  2EHB A;  1E8A A;  4HRG A;  2BCA A;  1NSH A;  1NCY A;  1K94 A;  3SG3 A;  1KWO C;  2FJU B;  1CDP A;  1DMO A;  2MJW B;  1A4P A;  3BXK A;  1EG4 A;  3E3R A;  1NCZ A;  5AFP A;  3PM8 A;  5HKW A;  1WDC C;  2KGB C;  5ER5 A;  4U8D A;  4I5K A;  1Y1A A;  1UHJ A;  4CLN A;  2L4H A;  3O2P A;  3QRX A;  2K0J A;  1BF5 A;  1QTX A;  1J7O A;  1SCM C;  4PE1 A;  1S6C A;  1KSM A;  2A4J A;  1XFX O;  2K7C A;  4MRY A;  1OZO A;  3TS5 C;  1JF0 A;  2CCM A;  2BKH B;  5HYD A;  2OPO A;  2JC2 A;  3BUM B;  2NZ0 A;  1OMD A;  1U5I A;  1SCV A;  4YGD B;  4OKH A;  4DUQ A;  1M31 A;  2CBL A;  2PVB A;  5HLV A;  3SG4 A;  1IKU A;  2ZN8 A;  1ALW A;  1XK4 A;  1F4Q A;  1L7Z A;  3AAK A;  3EVR A;  4N1F A;  3LK1 A;  1K90 D;  2JXC A;  2Y5I A;  3DF0 A;  3OB1 B;  2F8P A;  2EC6 C;  2LP3 A;  3I5F C;  4GPL B;  5JOL A;  1GGW A;  1AJ5 A;  1MUX A;  1B7T Y;  1NPQ A;  1UHH A;  4JQ0 D;  1SBJ A;  1F54 A;  4ICB A;  1CDN A;  5JJG A;  1ZUZ A;  1CLL A;  1DJW A;  1PUL A;  1TCO B;  2HQ8 A;  2ZRS A;  3PSR A;  1EJ3 A;  1LXF C;  4XJK A;  1MWN A;  2M49 B;  5I2L A;  3HX4 A;  3NSI A;  2LC5 A;  4YI8 A;  1QAT A;  1XFW O;  1CDL A;  1IGV A;  2KHN A;  2KFF A;  4PE7 A;  3EVV A;  3D0Y A;  4MSP A;  1CNP A;  1AK8 A;  1RJV A;  4M2O A;  1TNP A;  1K2H A;  1Y1U A;  1BOC A;  1M46 A;  1F55 A;  1V1G A;  2JRF A;  3GK1 A;  1IWQ A;  1QS7 A;  1CMF A;  1YX7 A;  1WRK A;  1CFP A;  1A75 B;  2KGR A;  3I5I B;  5FYX A;  1C7W A;  3CLN A;  4UPG A;  1TOP A;  2M0R A;  2DOQ A;  3TZ1 A;  5I2O A;  1Y1X A;  4PHK A;  4YGB B;  2LLS A;  1FW4 A;  1J55 A;  2ZN9 A;  4F0Z B;  2ZKM X;  4USL A;  1K93 D;  1XK4 C;  5DKQ A;  1IJ6 A;  2JXL A;  1Y0V H;  3BQ3 A;  2BL0 B;  3EK4 A;  3FS7 A;  2KI4 B;  1C07 A;  3ZWH A;  3HCM A;  2WCE A;  2V53 A;  3BOW A;  4GAO A;  4GGF A;  1BMO A;  1REC A;  2H61 C;  2VRG A;  4FQO A;  4MBE A;  1TCF A;  1SL8 A;  4ZCU A;  1B8L A;  2GV5 A;  3A4U B;  3MSE B;  1RWY A;  1Q80 A;  1AUI B;  4DIR A;  2I7A A;  2LUC A;  1B9A A;  2RGI A;  3TUY B;  2LHL A;  5K89 A;  1QX2 A;  1OMR A;  1YUR A;  2LVJ A;  3GK4 X;  5AAN A;  1IQ3 A;  3SG7 A;  2JOJ A;  1MR8 A;  3VRQ A;  2MBX A;  2PSR A;  1TIZ A;  5PAL A;  1JFK A;  1QX7 A;  1GQM A;  3RM1 A;  2FOT A;  1AHR A;  3OB2 B;  1H8B A;  3GOF A;  1SY9 A;  1DGU A;  1M63 B;  1KCY A;  1TN4 A;  2KAX A;  2PRU A;  3I5H C;  1NCX A;  3DD4 A;  2M7N A;  5F6T A;  1K8U A;  2BCB A;  1YRT B;  1LIN A;  1RRO A;  2Y1N A;  3PAL A;  1K9U A;  1KWO B;  2NXQ A;  4E68 A;  3VRR A;  1QLK A;  3TDZ A;  4MVF A;  4DCK A;  1UUS A;  1CFD A;  5G08 A;  1ALV A;  5ER4 X;  1DVI A;  2JZI A;  4PCW A;  1N65 A;  3ZNI A;  1WDC B;  4CID A;  5HKY A;  1SKT A;  1UUR A;  2F3Z A;  4MZK A;  5KTY A;  1XYD A;  2ZFD A;  1KFX L;  1IJ5 A;  1J7Q A;  4A4B A;  1SNL A;  2KYC A;  2Q4U A;  4MN0 A;  3ICB A;  1JSA A;  2JUL A;  1SK6 D;  1SCM B;  5CPV A;  2KQ6 A;  2LLT A;  1KFU S;  1CM1 A;  2MRD A;  1GJY A;  1HQV A;  1KSO A;  1UHN A;  1V1F A;  1S36 A;  1VRK A;  2K7D A;  2L51 A;  2CTN A;  3BUO B;  4MEW A;  1XFU O;  3BUW B;  1S6J A;  2WND A;  1OZS A;  3PN7 B;  1SW8 A;  2KNE A;  4I5N B;  1SRA A;  1F71 A;  2B1U A;  2LVK A;  2Y1M A;  4YI9 A;  1NX0 A;  2LMU A;  1S5G Z;  2JTZ A;  2NCP A;  5I8N A;  3H4S E;  2NLN A;  3PLF B;  1S26 D;  1G33 A;  2JWW A;  2R2I A;  1YTZ C;  2IS9 A;  3AKA A;  4Q04 A;  4N1G A;  2M1K B;  2LUX A;  2KQY A;  3JTD C;  1DTL A;  2M29 A;  4ORA B;  2L50 A;  5CSN A;  3AAJ A;  4C0L A;  4YRU A;  1OSA A;  1ZFS A;  1K95 A;  2JQ6 A;  1C7V A;  4N5X A;  2I2R E;  1XO5 A;  1SR6 B;  2F2O A;  2L2E A;  4NDC A;  2MLF C;  2LAN A;  5HKZ A;  1IG5 A;  1RK9 A;  4CFR A;  3BYA A;  2M7L A;  3CZT X;  1YX8 A;  1UWO A;  2BKI B;  3KHE A;  1J7R A;  4GBA A;  4M2Q A;  1FF1 A;  1F70 A;  1NX3 A;  1K9K A;  4OCI A;  3OX5 A;  2BBN A;  2LAP A;  4HSZ A;  4WQ2 A;  2ZND A;  5CSI A;  3BUX B;  4PE4 A;  1MHO A;  4L9M A;  1LA0 A;  1DJH A;  1A75 A;  2KFG A;  3PFV A;  1EG3 A;  2O60 A;  4NDD A;  2I18 A;  2L98 A;  1ZOT B;  2LMT A;  4PE0 A;  2FCE A;  5AER A; 
#chains in the Genus database with same CATH topology
 2BEC A;  5DKR A;  2K7B A;  1YUU A;  1JF2 A;  3JVT C;  2LHI A;  5DKN A;  4JWQ A;  2MAZ A;  3SIB A;  1EXR A;  2CNP A;  1B8C A;  1K9P A;  2P70 A;  2WOR A;  4TNC A;  5FI2 A;  3EKJ A;  3WHT B;  3IF7 A;  4NQG A;  1KK8 C;  1RFJ A;  2O5G A;  3GK2 A;  3BFH A;  3KPX A;  2MA2 A;  4OR9 B;  1OOI X;  2BBM A;  4ETO A;  1CM4 A;  4WRI A;  4P2Y B;  1BT6 A;  4QJ5 B;  1XVJ A;  1KQM C;  1W7I B;  2L0P A;  3WXA A;  1CB1 A;  2NCO A;  1OOJ A;  1CKK A;  5GQQ C;  1OQP A;  1NWD A;  1M39 A;  5KU1 A;  3N7H A;  3SS3 A;  1XFV O;  3A8R A;  3K21 A;  1B7T Z;  2Y4Q A;  4BY4 A;  2D8N A;  3NSK A;  4QJ3 B;  1MF8 B;  5DIC A;  2CT9 A;  2KPH A;  2OS8 C;  3I5H B;  1QJT A;  2I94 A;  4MLW A;  4OV2 A;  3WNX B;  1CFF A;  1H4B A;  4IJ7 A;  1BJF A;  1TWO A;  1XFR A;  2F33 A;  4GUK A;  1LA3 A;  4XYN A;  3M0W A;  1J1E A;  2AAO A;  1J1D A;  1TRF A;  3NHI A;  3DVK A;  3OX6 A;  2HET A;  4A4C A;  1M45 A;  1UHK A;  1TNQ A;  1ODB A;  3IVT A;  1FPW A;  1D1O A;  1IQ5 A;  1FI5 A;  3NSO A;  4AOM A;  1J7P A;  2KI4 C;  2E30 A;  3TDI A;  3KO0 A;  1NYA A;  1YVL A;  2L2C A;  4ORB B;  1S1E A;  1L2O C;  1Z4H A;  2E6W A;  3BOW B;  5HL1 A;  1IH0 A;  3EKH A;  1QVI Y;  1NIW A;  1FI6 A;  3BUN B;  2GGM A;  2QAC A;  2M97 A;  2WCB A;  3CR2 A;  1DQE A;  2JNF A;  1WLM A;  2BE6 A;  3VRP A;  2P6B B;  1DT7 B;  5J3X A;  3I5G C;  3S0E A;  3O4X A;  4WQ3 A;  1S3P A;  1FBV A;  2LVV A;  2M9G A;  3S0B A;  4GGF C;  1CLB A;  1JWD A;  4FTG A;  5CSF A;  2JPT A;  2AUC A;  2BE4 A;  1R6P A;  3L4A A;  1B4C A;  1TNW A;  3B7A A;  1OOF A;  3F45 A;  2WCK A;  1PK0 D;  1YUS A;  1Z2C B;  3D10 A;  3TS5 B;  2FCD A;  1HT9 A;  1XFY O;  1AJ4 A;  2QEB A;  3O4Y A;  1A03 A;  3RLZ A;  2GGZ A;  1T14 A;  1Y6W A;  2F2P A;  1BU3 A;  1BR4 B;  2LVI A;  3JTD B;  2KFH A;  1BLQ A;  1WY9 A;  3FE6 A;  2PQL A;  2K2A A;  1A2X A;  2OTG C;  1JFJ A;  3EVU A;  2LE9 B;  2PAL A;  1PSR A;  1DF0 B;  1LVC D;  2QDI A;  3QME A;  4YGA A;  2ERB A;  4HRH A;  3TDU A;  2EC6 B;  2WOS A;  2JTT A;  2M8U A;  3B86 A;  1DJX A;  2WC5 A;  3I5F B;  3NSL A;  4OVN F;  1A29 A;  2L5Y A;  4ZCV A;  1TTX A;  2JU0 A;  2LCP A;  2SAS A;  2EGD A;  2K2F A;  1F4O A;  5BPJ A;  1KK7 Y;  1SL9 A;  1C3Y A;  3O78 A;  3LCP C;  3LL8 B;  3KF9 A;  3SG5 A;  3R1V A;  4P5O E;  2KAY A;  4JPZ B;  4PAL A;  2MLE C;  1DJG A;  1SYM A;  1QAS A;  4GNK B;  1CFC A;  2KDH A;  1QVI Z;  3R72 A;  4YGE B;  2H8V A;  3OGN A;  1EH2 A;  1G8I A;  2K61 A;  1JC2 A;  1B47 A;  3O6B A;  1WRZ A;  1IRJ A;  1W7J B;  3C1V A;  3Q8I A;  3EG5 B;  3PN7 C;  3CR4 X;  1RTP 1;  3CYZ A;  1TUJ A;  2JT8 A;  1B8R A;  3FWC A;  3IQQ A;  3L47 A;  1UP5 A;  2BAP A;  5HLO A;  3NXA A;  3JVT B;  2KOT A;  4C0K A;  1LKJ A;  1PVA A;  1U5I B;  2M3W A;  4MZL A;  3SG6 A;  1DGV A;  4AQJ A;  1BG1 A;  1MXE A;  2K7O A;  2JNX A;  2L4I A;  3D75 A;  4D1E A;  4C0J A;  2TN4 A;  1KK8 B;  3D78 A;  1SMG A;  1QLS A;  2H61 A;  2WCF A;  3FWB A;  4PDZ A;  1DEL A;  1KFX S;  2KYF A;  1KQV A;  2ZRT A;  1PVB A;  1BOD A;  4PHJ A;  3FIA A;  4DRW A;  1S6I A;  3FE9 A;  4DS7 A;  2LM5 A;  2SCP A;  2KI6 C;  3DF0 B;  4BY5 A;  1PSB A;  1SR6 C;  1AP4 A;  1FF1 A;  1G4Y R;  4MZJ A;  1KQM B;  2JT3 A;  2PAS A;  4R1E A;  1OE9 B;  1SL7 A;  2HF5 A;  1F8H A;  2COL B;  3CS1 A;  4MRX A;  5KSZ A;  2BCX A;  1YRU B;  1PAL A;  1QX5 B;  5AEQ A;  3SJS A;  1UHI A;  2PMY A;  4ORC B;  2JT0 A;  2MHH A;  1KK7 Z;  3CDN A;  4PHM A;  4PT1 A;  4XJK B;  4CPV A;  1YR5 A;  2OS8 B;  2M1U A;  3DXL A;  1WLZ A;  1WRL A;  1PRW A;  1R2U A;  1TNX A;  2QPT A;  4NDB A;  3VRO A;  1KFU L;  1C3Z A;  1MXL C;  2HQW A;  1ZAC A;  3DVE A;  1CLM A;  4HRE E;  3D0Y B;  1SPY A;  3EK8 A;  1NX1 A;  1NP8 A;  3PAT A;  3SG2 A;  1MQ1 A;  1QWV A;  2LLU A;  2K60 A;  4M2P A;  2H2K A;  2HPS A;  2KSP A;  4YGC B;  1OOG A;  2KBM A;  2LMV A;  4GGN A;  2LP2 A;  1K96 A;  3UO9 A;  3I5I C;  2LNK A;  5B8I B;  4GFT A;  1JUO A;  2KBI A;  5TNC A;  3BFA A;  2P71 A;  4PHN A;  1ZMZ A;  2F3Y A;  1XA5 A;  1L2O B;  2LV7 A;  2K8M B;  1NUB A;  3VRN A;  1N2D A;  4AQI A;  1QIV A;  5D69 A;  1EL4 A;  3KEV A;  2ZNE A;  1DJI A;  2ISD A;  2BL0 C;  3I5G B;  2WC8 A;  3IQO A;  4QJ4 B;  5FI7 A;  3EK7 A;  3B87 A;  2Q91 A;  2KAV A;  3DVJ A;  1S5G Y;  3OHM B;  3AKB A;  4YBH B;  1DJY A;  5CSJ A;  1CMG A;  2CXJ A;  1N0Y A;  4CFQ A;  1XFZ O;  1OOH A;  2AMI A;  1JBA A;  1OMV A;  3BJH A;  1NX2 A;  3VGO A;  2G9B A;  3TUY C;  3LK0 A;  3PJI A;  3DVM A;  3CGA A;  1B1G A;  5D7F A;  1X02 A;  3CR5 X;  1GGZ A;  1BR1 B;  1QV0 A;  3CTN A;  1YVH A;  3CWG A;  1AVS A;  4FQT A;  5IBW A;  4JD9 A;  4I5L B;  1QIW A;  2L5X B;  1QV1 A;  1CDM A;  1YUT A;  3OP0 A;  3LLE A;  5AXI A;  1CTR A;  2G2B A;  2KI6 D;  4I5J A;  1DJZ A;  3WHU B;  2OTG B;  1QXP A;  1DF0 A;  3SIA A;  5I2Q A;  2EHB A;  1E8A A;  4HRG A;  2BCA A;  1NSH A;  1NCY A;  1K94 A;  3SG3 A;  1KWO C;  3OBV A;  3RZS A;  2FJU B;  1CDP A;  1DMO A;  2MJW B;  1A4P A;  3BXK A;  4INW A;  1EG4 A;  4IL1 A;  3E3R A;  3SS5 A;  1NCZ A;  5AFP A;  3PM8 A;  5HKW A;  1WDC C;  2KGB C;  1IIO A;  5ER5 A;  3NGV A;  4U8D A;  4I5K A;  1Y1A A;  1UHJ A;  4CLN A;  2L4H A;  3O2P A;  3QRX A;  3K1E A;  2K0J A;  1BF5 A;  1QTX A;  1J7O A;  1SCM C;  4PE1 A;  4F7F A;  1S6C A;  1KSM A;  2A4J A;  1XFX O;  2QEV A;  2K7C A;  4MRY A;  1OZO A;  3TS5 C;  1JF0 A;  2CCM A;  2BKH B;  5HYD A;  2OPO A;  2JC2 A;  3BUM B;  2NZ0 A;  1OMD A;  1U5I A;  1SCV A;  4YGD B;  4OKH A;  4DUQ A;  1M31 A;  2CBL A;  2PVB A;  3NHT A;  1LS8 A;  5HLV A;  3SG4 A;  1IKU A;  2ZN8 A;  3D76 A;  1ALW A;  1XK4 A;  1F4Q A;  1L7Z A;  3AAK A;  3EVR A;  4N1F A;  2WC6 A;  3LK1 A;  1K90 D;  2JXC A;  2Y5I A;  3DF0 A;  3OB1 B;  2F8P A;  2EC6 C;  2LP3 A;  3DYE A;  3I5F C;  4GPL B;  5JOL A;  1GGW A;  1AJ5 A;  1MUX A;  1B7T Y;  1NPQ A;  1UHH A;  4JQ0 D;  3CZ2 A;  1SBJ A;  1F54 A;  4ICB A;  1CDN A;  5JJG A;  1ZUZ A;  1CLL A;  1DJW A;  1PUL A;  1TCO B;  2HQ8 A;  2ZRS A;  3PSR A;  1EJ3 A;  1LXF C;  4XJK A;  1MWN A;  3S0A A;  2M49 B;  3DZT A;  5I2L A;  3HX4 A;  3NSI A;  2LC5 A;  4YI8 A;  1QAT A;  1XFW O;  1CDL A;  1IGV A;  2KHN A;  2KFF A;  3D77 A;  3EVV A;  3D0Y A;  4MSP A;  4PE7 A;  1AK8 A;  1CNP A;  1RJV A;  2WCL A;  1TNP A;  4M2O A;  1K2H A;  1Y1U A;  1BOC A;  1M46 A;  2JPO A;  1F55 A;  1V1G A;  2JRF A;  3GK1 A;  1IWQ A;  1QS7 A;  1CMF A;  1YX7 A;  1WRK A;  1CFP A;  1A75 B;  2KGR A;  3I5I B;  5FYX A;  4OZD A;  1C7W A;  3CLN A;  1OW4 A;  4UPG A;  1TOP A;  2M0R A;  2DOQ A;  3TZ1 A;  5I2O A;  1Y1X A;  4PHK A;  4YGB B;  2LLS A;  1FW4 A;  3R1O A;  1J55 A;  3SS4 A;  2ZN9 A;  3D73 A;  2ZKM X;  4USL A;  4F0Z B;  1K93 D;  1XK4 C;  5DKQ A;  1IJ6 A;  3UNW A;  2JXL A;  1Y0V H;  3BQ3 A;  2BL0 B;  3EK4 A;  3FS7 A;  2KI4 B;  1C07 A;  2FJY A;  3CZ0 A;  3ZWH A;  3HCM A;  2WCE A;  2V53 A;  3BOW A;  4GAO A;  4GGF A;  1BMO A;  1REC A;  2H61 C;  2VRG A;  4FQO A;  4MBE A;  1TCF A;  3B6X A;  5D3O A;  1SL8 A;  4ZCU A;  1B8L A;  2GV5 A;  3A4U B;  3MSE B;  1RWY A;  1Q80 A;  1AUI B;  4DIR A;  2I7A A;  2LUC A;  1B9A A;  2RGI A;  3TUY B;  2LHL A;  3FE8 A;  5K89 A;  1QX2 A;  1OMR A;  1YUR A;  2LVJ A;  3GK4 X;  5AAN A;  3S0D A;  1IQ3 A;  3SG7 A;  2JOJ A;  1MR8 A;  3VRQ A;  5FI6 A;  2MBX A;  2PSR A;  1TIZ A;  3R1P A;  1JFK A;  5PAL A;  1QX7 A;  1GQM A;  3RM1 A;  2FOT A;  5EL2 A;  1AHR A;  3OB2 B;  1H8B A;  2PYQ A;  3GOF A;  1SY9 A;  1DGU A;  1M63 B;  1KCY A;  1TN4 A;  3VB1 A;  2KAX A;  2PRU A;  3B88 A;  3I5H C;  1NCX A;  3DD4 A;  2M7N A;  5F6T A;  1K8U A;  2BCB A;  1YRT B;  1LIN A;  1RRO A;  2Y1N A;  3DY9 A;  3PAL A;  1K9U A;  1KWO B;  3PM2 A;  2NXQ A;  4E68 A;  3VRR A;  1QLK A;  3TDZ A;  4MVF A;  4DCK A;  1UUS A;  1CFD A;  1W9Z A;  1ALV A;  1SSE B;  2KLD A;  1DVI A;  5ER4 X;  2JZI A;  5G08 A;  4PCW A;  1N65 A;  4INX A;  3ZNI A;  1WDC B;  4CID A;  5HKY A;  1SKT A;  1TUZ A;  1UUR A;  2F3Z A;  4MZK A;  3S0G A;  1XYD A;  2ZFD A;  5KTY A;  1KFX L;  1IJ5 A;  2YGU A;  3L4L A;  1J7Q A;  2QEH A;  1SNL A;  2KYC A;  2Q4U A;  4MN0 A;  3ICB A;  4A4B A;  1JSA A;  2JUL A;  1SK6 D;  1SCM B;  5CPV A;  3V2L A;  2KQ6 A;  2LLT A;  1KFU S;  1CM1 A;  2MRD A;  1GJY A;  3BFB A;  1HQV A;  1KSO A;  1UHN A;  1V1F A;  1S36 A;  1DEK A;  1VRK A;  2K7D A;  2CTN A;  2L51 A;  3BUO B;  4MEW A;  1XFU O;  3BUW B;  1S6J A;  2WND A;  2WCH A;  1OZS A;  3PN7 B;  1SW8 A;  2KNE A;  4I5N B;  1SRA A;  1F71 A;  2B1U A;  1P28 A;  2LVK A;  2Y1M A;  4YI9 A;  1NX0 A;  2LMU A;  1S5G Z;  2JTZ A;  2NCP A;  5I8N A;  2WCJ A;  3D74 A;  3H4S E;  2QEO A;  2NLN A;  3PLF B;  1S26 D;  2KLE A;  1G33 A;  5I94 A;  2JWW A;  2R2I A;  4KYN A;  3CZ1 A;  1YTZ C;  2IS9 A;  3AKA A;  4Q04 A;  4N1G A;  2M1K B;  2LUX A;  2KQY A;  3JTD C;  1DTL A;  2M29 A;  4ORA B;  2L50 A;  5CSN A;  3AAJ A;  4C0L A;  4YRU A;  1OSA A;  1ZFS A;  1K95 A;  2JQ6 A;  1C7V A;  4N5X A;  2GTE A;  1DC1 A;  2WCM A;  2I2R E;  1XO5 A;  1SR6 B;  2F2O A;  2L2E A;  4NDC A;  2MLF C;  2LAN A;  5HKZ A;  1IG5 A;  1RK9 A;  4CFR A;  3BYA A;  2M7L A;  3CZT X;  1YX8 A;  1UWO A;  2BKI B;  3KHE A;  1J7R A;  4GBA A;  4JKT A;  4M2Q A;  1F70 A;  1NX3 A;  1K9K A;  3CAB A;  4OCI A;  3OX5 A;  2BBN A;  2LAP A;  4HSZ A;  1GM0 A;  4WQ2 A;  2ZND A;  5CSI A;  3BUX B;  2BNX A;  4PE4 A;  1ORG A;  1MHO A;  4L9M A;  1LA0 A;  1DJH A;  3S0F A;  1A75 A;  2KFG A;  3PFV A;  1EG3 A;  2O60 A;  4NDD A;  2I18 A;  2L98 A;  1ZOT B;  2LMT A;  4PE0 A;  2FCE A;  5AER A; 
#chains in the Genus database with same CATH homology
 2BEC A;  5DKR A;  2K7B A;  1YUU A;  1JF2 A;  3JVT C;  2LHI A;  5DKN A;  4JWQ A;  2MAZ A;  3SIB A;  1EXR A;  2CNP A;  1B8C A;  1K9P A;  2WOR A;  4TNC A;  3EKJ A;  3WHT B;  3IF7 A;  4NQG A;  1KK8 C;  1RFJ A;  2O5G A;  3GK2 A;  3KPX A;  2MA2 A;  4OR9 B;  2BBM A;  4ETO A;  1CM4 A;  4WRI A;  4P2Y B;  1BT6 A;  4QJ5 B;  1XVJ A;  1KQM C;  1W7I B;  2L0P A;  3WXA A;  1CB1 A;  2NCO A;  1OOJ A;  1CKK A;  5GQQ C;  1OQP A;  1NWD A;  1M39 A;  5KU1 A;  1XFV O;  3A8R A;  3K21 A;  1B7T Z;  2Y4Q A;  4BY4 A;  2D8N A;  3NSK A;  4QJ3 B;  1MF8 B;  2CT9 A;  2OS8 C;  3I5H B;  1QJT A;  2I94 A;  4MLW A;  4OV2 A;  3WNX B;  1CFF A;  1H4B A;  1BJF A;  2F33 A;  4GUK A;  1LA3 A;  4XYN A;  3M0W A;  1J1E A;  2AAO A;  1J1D A;  1TRF A;  3DVK A;  3OX6 A;  2HET A;  4A4C A;  1M45 A;  1UHK A;  1TNQ A;  1ODB A;  1FPW A;  1D1O A;  1IQ5 A;  1FI5 A;  3NSO A;  4AOM A;  1J7P A;  2KI4 C;  2E30 A;  3TDI A;  3KO0 A;  1NYA A;  1YVL A;  4ORB B;  1S1E A;  1L2O C;  2E6W A;  3BOW B;  1IH0 A;  3EKH A;  1QVI Y;  1NIW A;  1FI6 A;  3BUN B;  2GGM A;  2QAC A;  2M97 A;  2WCB A;  3CR2 A;  2JNF A;  1WLM A;  2BE6 A;  3VRP A;  2P6B B;  1DT7 B;  5J3X A;  3I5G C;  4WQ3 A;  1S3P A;  1FBV A;  2LVV A;  2M9G A;  1CLB A;  4GGF C;  1JWD A;  4FTG A;  5CSF A;  2JPT A;  2AUC A;  2BE4 A;  1R6P A;  1B4C A;  1TNW A;  3F45 A;  3D10 A;  1PK0 D;  1YUS A;  3TS5 B;  2FCD A;  1HT9 A;  1XFY O;  1AJ4 A;  3O4Y A;  1A03 A;  3RLZ A;  2GGZ A;  2F2P A;  1Y6W A;  1BU3 A;  1BR4 B;  2LVI A;  3JTD B;  2KFH A;  1BLQ A;  1WY9 A;  2K2A A;  1A2X A;  2OTG C;  1JFJ A;  3EVU A;  2LE9 B;  2PAL A;  1PSR A;  1DF0 B;  1LVC D;  4YGA A;  4HRH A;  3TDU A;  2EC6 B;  2WOS A;  2JTT A;  2M8U A;  3I5F B;  1DJX A;  4ZCV A;  3NSL A;  4OVN F;  1A29 A;  1TTX A;  2JU0 A;  2LCP A;  2SAS A;  2EGD A;  2K2F A;  1F4O A;  5BPJ A;  1KK7 Y;  1SL9 A;  3O78 A;  3LCP C;  3LL8 B;  3KF9 A;  3SG5 A;  4P5O E;  2KAY A;  4JPZ B;  4PAL A;  2MLE C;  1DJG A;  1SYM A;  1QAS A;  4GNK B;  1CFC A;  2KDH A;  1QVI Z;  4YGE B;  1EH2 A;  1G8I A;  2K61 A;  1JC2 A;  1B47 A;  3O6B A;  1WRZ A;  1IRJ A;  1W7J B;  3C1V A;  3PN7 C;  3CR4 X;  1RTP 1;  2JT8 A;  1B8R A;  3FWC A;  3IQQ A;  1UP5 A;  5HLO A;  3NXA A;  3JVT B;  2KOT A;  4C0K A;  1LKJ A;  1PVA A;  1U5I B;  2M3W A;  4MZL A;  3SG6 A;  1DGV A;  4AQJ A;  1BG1 A;  1MXE A;  2K7O A;  2JNX A;  2L4I A;  4D1E A;  4C0J A;  2TN4 A;  1KK8 B;  1SMG A;  1QLS A;  2H61 A;  2WCF A;  3FWB A;  4PDZ A;  1KFX S;  2KYF A;  1KQV A;  2ZRT A;  1PVB A;  1BOD A;  4PHJ A;  3FIA A;  4DRW A;  1S6I A;  4DS7 A;  2LM5 A;  2SCP A;  2KI6 C;  3DF0 B;  4BY5 A;  1PSB A;  1SR6 C;  1AP4 A;  1G4Y R;  4MZJ A;  1KQM B;  2JT3 A;  2PAS A;  4R1E A;  1OE9 B;  1SL7 A;  2HF5 A;  1F8H A;  2COL B;  3CS1 A;  4MRX A;  5KSZ A;  2BCX A;  1YRU B;  1PAL A;  1QX5 B;  5AEQ A;  3SJS A;  1UHI A;  2PMY A;  4ORC B;  2JT0 A;  2MHH A;  1KK7 Z;  4PHM A;  4XJK B;  4CPV A;  1YR5 A;  2OS8 B;  2M1U A;  4IL1 A;  1WLZ A;  1WRL A;  1PRW A;  1R2U A;  1TNX A;  2QPT A;  4NDB A;  3VRO A;  1KFU L;  1MXL C;  2HQW A;  1ZAC A;  3DVE A;  1CLM A;  4HRE E;  3D0Y B;  1SPY A;  3EK8 A;  1NX1 A;  1NP8 A;  3PAT A;  3SG2 A;  1MQ1 A;  2LLU A;  4M2P A;  2H2K A;  2HPS A;  2KSP A;  4YGC B;  2KBM A;  2LMV A;  4GGN A;  2LP2 A;  1K96 A;  3I5I C;  2LNK A;  5B8I B;  4GFT A;  1JUO A;  2KBI A;  5TNC A;  4PHN A;  1ZMZ A;  2F3Y A;  1XA5 A;  1L2O B;  2LV7 A;  2K8M B;  1NUB A;  3VRN A;  1N2D A;  4AQI A;  1QIV A;  5D69 A;  1EL4 A;  3KEV A;  2ZNE A;  1DJI A;  2ISD A;  2BL0 C;  3I5G B;  2WC8 A;  3IQO A;  4QJ4 B;  3EK7 A;  2Q91 A;  2KAV A;  3DVJ A;  1S5G Y;  3OHM B;  3AKB A;  4YBH B;  1DJY A;  5CSJ A;  1CMG A;  2CXJ A;  1N0Y A;  4CFQ A;  1XFZ O;  2AMI A;  1JBA A;  1OMV A;  1NX2 A;  3VGO A;  2G9B A;  3TUY C;  3LK0 A;  3DVM A;  3CGA A;  1B1G A;  5D7F A;  1X02 A;  3CR5 X;  1GGZ A;  1BR1 B;  1QV0 A;  3CTN A;  1YVH A;  3CWG A;  1AVS A;  5IBW A;  4I5L B;  1QIW A;  2L5X B;  1QV1 A;  1CDM A;  1YUT A;  3OP0 A;  3LLE A;  5AXI A;  1CTR A;  2G2B A;  2KI6 D;  4I5J A;  1DJZ A;  3WHU B;  2OTG B;  1QXP A;  1DF0 A;  3SIA A;  5I2Q A;  2EHB A;  1E8A A;  4HRG A;  2BCA A;  1NSH A;  1NCY A;  1K94 A;  3SG3 A;  1KWO C;  2FJU B;  1CDP A;  1DMO A;  2MJW B;  1A4P A;  3BXK A;  1EG4 A;  3E3R A;  1NCZ A;  5AFP A;  3PM8 A;  5HKW A;  1WDC C;  2KGB C;  5ER5 A;  4U8D A;  4I5K A;  1Y1A A;  1UHJ A;  4CLN A;  2L4H A;  3O2P A;  3QRX A;  2K0J A;  1BF5 A;  1QTX A;  1J7O A;  1SCM C;  4PE1 A;  1S6C A;  1KSM A;  2A4J A;  1XFX O;  2K7C A;  4MRY A;  1OZO A;  3TS5 C;  1JF0 A;  2CCM A;  2BKH B;  5HYD A;  2OPO A;  2JC2 A;  3BUM B;  2NZ0 A;  1OMD A;  1U5I A;  1SCV A;  4YGD B;  4OKH A;  4DUQ A;  1M31 A;  2CBL A;  2PVB A;  5HLV A;  3SG4 A;  1IKU A;  2ZN8 A;  1ALW A;  1XK4 A;  1F4Q A;  1L7Z A;  3AAK A;  3EVR A;  4N1F A;  3LK1 A;  1K90 D;  2JXC A;  2Y5I A;  3DF0 A;  3OB1 B;  2F8P A;  2EC6 C;  2LP3 A;  3I5F C;  4GPL B;  5JOL A;  1GGW A;  1AJ5 A;  1MUX A;  1B7T Y;  1NPQ A;  1UHH A;  4JQ0 D;  1SBJ A;  1F54 A;  4ICB A;  1CDN A;  5JJG A;  1ZUZ A;  1CLL A;  1DJW A;  1PUL A;  1TCO B;  2HQ8 A;  2ZRS A;  3PSR A;  1EJ3 A;  1LXF C;  4XJK A;  1MWN A;  2M49 B;  5I2L A;  3HX4 A;  3NSI A;  2LC5 A;  4YI8 A;  1QAT A;  1XFW O;  1CDL A;  1IGV A;  2KHN A;  2KFF A;  4PE7 A;  3EVV A;  3D0Y A;  4MSP A;  1CNP A;  1AK8 A;  1RJV A;  4M2O A;  1TNP A;  1K2H A;  1Y1U A;  1BOC A;  1M46 A;  1F55 A;  1V1G A;  2JRF A;  3GK1 A;  1IWQ A;  1QS7 A;  1CMF A;  1YX7 A;  1WRK A;  1CFP A;  1A75 B;  2KGR A;  3I5I B;  5FYX A;  1C7W A;  3CLN A;  4UPG A;  1TOP A;  2M0R A;  2DOQ A;  3TZ1 A;  5I2O A;  1Y1X A;  4PHK A;  4YGB B;  2LLS A;  1FW4 A;  1J55 A;  2ZN9 A;  4F0Z B;  2ZKM X;  4USL A;  1K93 D;  1XK4 C;  5DKQ A;  1IJ6 A;  2JXL A;  1Y0V H;  3BQ3 A;  2BL0 B;  3EK4 A;  3FS7 A;  2KI4 B;  1C07 A;  3ZWH A;  3HCM A;  2WCE A;  2V53 A;  3BOW A;  4GAO A;  4GGF A;  1BMO A;  1REC A;  2H61 C;  2VRG A;  4FQO A;  4MBE A;  1TCF A;  1SL8 A;  4ZCU A;  1B8L A;  2GV5 A;  3A4U B;  3MSE B;  1RWY A;  1Q80 A;  1AUI B;  4DIR A;  2I7A A;  2LUC A;  1B9A A;  2RGI A;  3TUY B;  2LHL A;  5K89 A;  1QX2 A;  1OMR A;  1YUR A;  2LVJ A;  3GK4 X;  5AAN A;  1IQ3 A;  3SG7 A;  2JOJ A;  1MR8 A;  3VRQ A;  2MBX A;  2PSR A;  1TIZ A;  5PAL A;  1JFK A;  1QX7 A;  1GQM A;  3RM1 A;  2FOT A;  1AHR A;  3OB2 B;  1H8B A;  3GOF A;  1SY9 A;  1DGU A;  1M63 B;  1KCY A;  1TN4 A;  2KAX A;  2PRU A;  3I5H C;  1NCX A;  3DD4 A;  2M7N A;  5F6T A;  1K8U A;  2BCB A;  1YRT B;  1LIN A;  1RRO A;  2Y1N A;  3PAL A;  1K9U A;  1KWO B;  2NXQ A;  4E68 A;  3VRR A;  1QLK A;  3TDZ A;  4MVF A;  4DCK A;  1UUS A;  1CFD A;  5G08 A;  1ALV A;  5ER4 X;  1DVI A;  2JZI A;  4PCW A;  1N65 A;  3ZNI A;  1WDC B;  4CID A;  5HKY A;  1SKT A;  1UUR A;  2F3Z A;  4MZK A;  5KTY A;  1XYD A;  2ZFD A;  1KFX L;  1IJ5 A;  1J7Q A;  4A4B A;  1SNL A;  2KYC A;  2Q4U A;  4MN0 A;  3ICB A;  1JSA A;  2JUL A;  1SK6 D;  1SCM B;  5CPV A;  2KQ6 A;  2LLT A;  1KFU S;  1CM1 A;  2MRD A;  1GJY A;  1HQV A;  1KSO A;  1UHN A;  1V1F A;  1S36 A;  1VRK A;  2K7D A;  2L51 A;  2CTN A;  3BUO B;  4MEW A;  1XFU O;  3BUW B;  1S6J A;  2WND A;  1OZS A;  3PN7 B;  1SW8 A;  2KNE A;  4I5N B;  1SRA A;  1F71 A;  2B1U A;  2LVK A;  2Y1M A;  4YI9 A;  1NX0 A;  2LMU A;  1S5G Z;  2JTZ A;  2NCP A;  5I8N A;  3H4S E;  2NLN A;  3PLF B;  1S26 D;  1G33 A;  2JWW A;  2R2I A;  1YTZ C;  2IS9 A;  3AKA A;  4Q04 A;  4N1G A;  2M1K B;  2LUX A;  2KQY A;  3JTD C;  1DTL A;  2M29 A;  4ORA B;  2L50 A;  5CSN A;  3AAJ A;  4C0L A;  4YRU A;  1OSA A;  1ZFS A;  1K95 A;  2JQ6 A;  1C7V A;  4N5X A;  2I2R E;  1XO5 A;  1SR6 B;  2F2O A;  2L2E A;  4NDC A;  2MLF C;  2LAN A;  5HKZ A;  1IG5 A;  1RK9 A;  4CFR A;  3BYA A;  2M7L A;  3CZT X;  1YX8 A;  1UWO A;  2BKI B;  3KHE A;  1J7R A;  4GBA A;  4M2Q A;  1FF1 A;  1F70 A;  1NX3 A;  1K9K A;  4OCI A;  3OX5 A;  2BBN A;  2LAP A;  4HSZ A;  4WQ2 A;  2ZND A;  5CSI A;  3BUX B;  4PE4 A;  1MHO A;  4L9M A;  1LA0 A;  1DJH A;  1A75 A;  2KFG A;  3PFV A;  1EG3 A;  2O60 A;  4NDD A;  2I18 A;  2L98 A;  1ZOT B;  2LMT A;  4PE0 A;  2FCE A;  5AER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...