3TDZA

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-stapled acetylated ubc12n complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tdzA01
3BUOB 2JT3A 1MUXA 4N5XA 4PHMA 4JWQA 1DJZA 5HKZA 1UP5A 1YUUA 1GGZA 2KI6C 1NX3A 1SCMB 1L7ZA 1UHHA 1S5GZ 5CSFA 1OE9B 1L2OB 3D0YA 1XYDA 2CT9A 3O4YA 2Y1MA 3OB2B 1ALWA 1KFUS 1M31A 2HQWA 3ICBA 4N1FA 1YRUB 1XVJA 1B7TZ 1XA5A 1A75B 4GGNA 1FI6A 4P5OE 1B8CA 3I5IC 2JT8A 1MWNA 1KFUL 2WCBA 2LMUA 5JOLA 3TDZA 5I8NA 2KBMA 4ORAB 2OPOA 4OR9B 2H61C 4OKHA 5HLVA 1J7PA 3TUYC 1DJYA 4A4CA 1CLMA 2ZNDA 3EK7A 3PLFB 1KK7Z 4DIRA 1SY9A 4AQJA 2ZRTA 1A2XA 1K9PA 2KGRA 3O2PA 1UHIA 1DJIA 2I7AA 4N1GA 1QX2A 1AJ5A 1EG4A 1QASA 4DCKA 1G4YR 2CNPA 3I5HB 2M97A 3JVTC 4ORCB 3SG5A 1NX1A 2KFHA 1G33A 1S36A 2O60A 4OCIA 4JQ0D 3M0WA 1HQVA 4I5JA 2JWWA 2K7CA 4PE1A 1XO5A 1CLLA 2KAVA 1CTRA 1N65A 1F8HA 1B9AA 2M3WA 1KWOB 1W7IB 1M45A 2PMYA 1JF2A 2AAOA 2LANA 1QLKA 2NLNA 1S3PA 1WLMA 3PM8A 2MBXA 3JTDB 1QIWA 4Q04A 1DMOA 1BODA 2BKHB 3AKBA 1NYAA 4PHKA 1R6PA 2CBLA 1CDNA 3OX6A 3BOWB 2PVBA 4ZCUA 2ZKMX 1CMFA 1XFWO 3BUMB 1GGWA 1RFJA 3BUWB 2F3YA 2HPSA 1N0YA 2GGMA 1QVIZ 4L9MA 2F2OA 2JNXA 2L4IA 1KQMB 2EHBA 2AUCA 2BCAA 2JTTA 2LAPA 3PALA 3NSKA 3VRPA 2KI4B 1A29A 2KNEA 3RLZA 1EJ3A 2M9GA 4HSZA 1XFVO 1AUIB 2WCFA 3SG6A 3FIAA 1CB1A 4CFRA 1AK8A 3OB1B 5F6TA 4ETOA 1K95A 2K61A 2M29A 5AANA 3VRRA 2H61A 1DJGA 3CLNA 1PRWA 1WDCC 2KSPA 4GGFA 4XJKA 2LVJA 2IS9A 1Y6WA 2K7OA 3O78A 1J55A 1CKKA 3SJSA 1IJ6A 1NCXA 4C0LA 1RECA 3PN7C 4FTGA 1H4BA 2RGIA 4WRIA 4QJ5B 2Y4QA 3TS5B 1KK8B 1TTXA 2ZRSA 4MZKA 2JTZA 2OTGB 5J3XA 1N2DA 1TOPA 2ZN8A 2MRDA 5AXIA 2M8UA 1W7JB 3LLEA 1FPWA 2L0PA 3BOWA 1C07A 3I5GC 1A4PA 4YGCB 1S1EA 1NCZA 4A4BA 1R2UA 2HQ8A 3EKHA 1H8BA 2LLUA 1BG1A 2BE6A 1NSHA 2BL0B 1ALVA 2KFGA 3H4SE 3I5FB 4DS7A 2KAXA 4TNCA 4CFQA 1SBJA 1SL7A 2MHHA 3GK4X 3GK2A 2M1KB 2B1UA 5FYXA 1QV1A 2ZN9A 1SCMC 4PHJA 1WY9A 2Q4UA 2KBIA 1TCFA 3CR4X 3LK0A 5KSZA 3RM1A 1L2OC 1TRFA 3KPXA 2OS8B 4BY4A 5DKQA 4CIDA 2GGZA 2L2EA 1XFXO 3KO0A 4AQIA 2CXJA 4MLWA 4CLNA 3NSIA 2CCMA 2LMTA 1IH0A 4ZCVA 1K9UA 1EH2A 2JQ6A 1XFYO 2M49B 2M7LA 4WQ3A 1CFDA 4PE4A 2M0RA 3CZTX 1QJTA 1CFCA 2JT0A 4PCWA 2ISDA 2KQ6A 1K2HA 3IF7A 1ODBA 2JXLA 2EC6B 2WC8A 2L50A 3SG4A 2CTNA 5CSIA 1EG3A 1OMVA 1CLBA 2JC2A 3K21A 4YGAA 1CFFA 3I5HC 1ZOTB 2QPTA 3A4UB 4GGFC 1KCYA 3AKAA 4MZJA 3BQ3A 1XFZO 4YRUA 1Y1XA 1SRAA 2HF5A 1FBVA 1SYMA 2BE4A 2NXQA 1M63B 1KSMA 2BCBA 1TNXA 2L51A 4YGEB 1AP4A 1CDPA 1JC2A 1JBAA 1IWQA 1Y1UA 1KWOC 2ZFDA 2F33A 2Q91A 3IQQA 3SG2A 1NUBA 4MBEA 3CR2A 1IG5A 1K93D 1TN4A 3JTDC 3NSOA 4M2QA 2KDHA 1TNQA 5I2LA 3PFVA 3SG3A 1IQ5A 1SMGA 1U5IA 2KQYA 1AJ4A 1C7VA 2LVVA 3I5IB 5CSNA 2P6BB 1BMOA 1BLQA 2SCPA 3KEVA 1B4CA 1S6JA 1DTLA 3GOFA 2PSRA 1Y1AA 1YTZC 1NPQA 2NCOA 1NWDA 5TNCA 2FCDA 2MLEC 1KQMC 1UHNA 2M7NA 5IBWA 1CNPA 2NZ0A 1RWYA 3EK8A 1V1GA 1YRTB 2KI4C 1BF5A 2WORA 1NX0A 1SL8A 1CM4A 2LMVA 1D1OA 1A75A 1IJ5A 2JNFA 1OZOA 2LC5A 1EL4A 1IQ3A 1UHJA 1SR6C 1B1GA 3DVJA 3VRNA 5G08A 4R1EA 1BR4B 2LUCA 2E30A 1OSAA 5D7FA 2A4JA 1GJYA 1CDMA 4PDZA 4JPZB 1B7TY 1DJXA 2LP2A 1PULA 3EVUA 4I5NB 1DJWA 5HKWA 1PK0D 2TN4A 1KK8C 2G2BA 1YVLA 3SG7A 1DGVA 2V53A 4UPGA 1SL9A 2EGDA 1YUTA 1ZMZA 1YX8A 3KHEA 2JZIA 1VRKA 1MXEA 1Q80A 2LV7A 1WRKA 3CWGA 4GPLB 4QJ3B 1DGUA 3FWBA 3BYAA 2K0JA 3D10A 4BY5A 1RTP1 3SIAA 1PALA 1X02A 1KSOA 3FWCA 2KFFA 1K94A 3LCPC 1PVAA 3PSRA 3OX5A 1DF0B 1UURA 2BL0C 2WNDA 1SPYA 3I5FC 4XYNA 3AAJA 1NX2A 2I2RE 1MQ1A 1MXLC 3IQOA 1UUSA 1WLZA 3ZWHA 1CFPA 2JULA 4GUKA 3EVVA 1B8LA 3OHMB 2OS8C 2BBNA 2BCXA 1G8IA 1M46A 1PSBA 4F0ZB 5B8IB 2E6WA 2JOJA 1NP8A 5DKRA 4YBHB 1DVIA 2FJUB 3VGOA 1RROA 4YI8A 3MSEB 4IL1A 3QRXA 1KQVA 4P2YB 4YGBB 1C7WA 2AMIA 1F71A 1SK6D 4MVFA 1B47A 3BXKA 1F55A 5KTYA 1K8UA 3NSLA 4MEWA 1QX7A 1ZACA 2Y1NA 2MLFC 1F54A 1DJHA 3AAKA 1CDLA 2LLSA 1LA0A 5ER5A 3F45A 3A8RA 2G9BA 3VROA 1WRZA 4GFTA 5K89A 1M39A 3E3RA 3NXAA 1LKJA 3WNXB 4USLA 2JRFA 1K96A 2PASA 5DKNA 1IGVA 2R2IA 1LA3A 1LVCD 4NDBA 5KU1A 1QLSA 4M2PA 1BR1B 1XK4A 1YURA 2LLTA 4HREE 4MN0A 5I2QA 1DF0A 2F3ZA 2L98A 4MRYA 4HRGA 3WHTB 4DRWA 3CS1A 1OZSA 1DT7B 3C1VA 2JU0A 2KAYA 3CGAA 2K2FA 1WRLA 1MHOA 1OMDA 2HETA 2NCPA 4MRXA 4PHNA 4YI9A 4NDDA 4NDCA 5D69A 1Y0VH 3EVRA 3WHUB 5BPJA 3EK4A 5HLOA 1SKTA 1EXRA 1K9KA 1S6IA 5CPVA 1SW8A 2Y5IA 4C0JA 1F4OA 4M2OA 1JUOA 1OMRA 1A03A 2PALA 3TZ1A 2FOTA 5AFPA 2M1UA 4I5LB 1AHRA 4NQGA 4XJKB 3TUYB 2LP3A 3O6BA 2I18A 4OV2A 1QATA 4PE0A 5AERA 2LVIA 2MAZA 1JFJA 2LM5A 3JVTB 2JXCA 2LE9B 2KGBC 3DVMA 3CR5X 3HCMA 1FF1A 2K2AA 5GQQC 1J1DA 4HRHA 3VRQA 2KHNA 1S5GY 1JF0A 1E8AA 3DVKA 5AEQA 2H2KA 1UWOA 2WCEA 4MZLA 1FW4A 3WXAA 2PRUA 1K90D 4GNKB 4ORBB 2MA2A 1BOCA 3DF0B 3EKJA 5HKYA 1BU3A 3HX4A 3BUXB 4E68A 2L4HA 3TS5C 5ER4X 2WOSA 2F2PA 4PE7A 1XK4C 3BUNB 4MSPA 2LVKA 1OOJA 2MJWB 1QXPA 2OTGC 1IRJA 1IKUA 2LNKA 1F4QA 3FS7A 1QIVA 4PALA 1UHKA 1KK7Y 3LL8B 4QJ4B 3GK1A 1BJFA 4YGDB 1RJVA 2COLB 2BECA 2ZNEA 2KOTA 3DVEA 2QACA 3KF9A 2D8NA 1ZFSA 4I5KA 4OVNF 3D0YB 1KFXS 1SR6B 1ZUZA 5JJGA 1BT6A 1OQPA 1TCOB 2LHIA 2LUXA 1LINA 5PALA 1QX5B 3SIBA 1PSRA 1KFXL 1LXFC 1YVHA 2JPTA 1JSAA 1RK9A 1NIWA 1HT9A 1J7RA 1J7QA 5HYDA 1TIZA 1MR8A 1QTXA 2L5XB 5CSJA 1J7OA 1WDCB 1V1FA 1QV0A 2K8MB 1JFKA 4ICBA 4DUQA 2KI6D 2KYFA 1YR5A 4U8DA 1FI5A 1S26D 1YX7A 2DOQA 2LHLA 3OP0A 1GQMA 1F70A 1QS7A 4GBAA 3PN7B 3DD4A 1AVSA 1B8RA 2SASA 3CTNA 4C0KA 2EC6C 1S6CA 2I94A 3LK1A 1CMGA 2KYCA 2VRGA 3ZNIA 2O5GA 2FCEA 1J1EA 1YUSA 1QVIY 3TDIA 4CPVA 2F8PA 3DF0A 1XFUO 1TNWA 4GAOA 1CM1A 1JWDA 1PVBA 2K7BA 4AOMA 1NCYA 1SNLA 2BKIB 4D1EA 1U5IB 1SCVA 1MF8B 3TDUA 3I5GB 2LCPA 3PATA 5I2OA 1TNPA 4FQOA 2BBMA 2GV5A 2K7DA 4WQ2A
chains in the Genus database with same CATH superfamily
3BUOB 2JT3A 1MUXA 4N5XA 4PHMA 4JWQA 1DJZA 3S0EA 5HKZA 1UP5A 1YUUA 1GGZA 2WCHA 2KI6C 1NX3A 1SCMB 1L7ZA 1UHHA 1S5GZ 5CSFA 1OE9B 1L2OB 3D0YA 1XYDA 2CT9A 3N7HA 2Y1MA 3O4YA 1ALWA 3OB2B 1KFUS 1M31A 2HQWA 3ICBA 4N1FA 1YRUB 1XVJA 5HL1A 1B7TZ 1XA5A 4JKTA 1A75B 4GGNA 1FI6A 4P5OE 1B8CA 3I5IC 2JT8A 1MWNA 3FE6A 1KFUL 2WCBA 2LMUA 5JOLA 3TDZA 5I8NA 2KBMA 4ORAB 4PT1A 2OPOA 4OR9B 2H61C 4OKHA 5HLVA 1J7PA 3TUYC 1DJYA 4A4CA 1CLMA 2ZNDA 3EK7A 3PLFB 1KK7Z 2PQLA 1SY9A 4AQJA 2ZRTA 4DIRA 1A2XA 1K9PA 2KGRA 3O2PA 1UHIA 1DJIA 2I7AA 4N1GA 1QX2A 1AJ5A 3D75A 1EG4A 1QASA 2QEBA 4DCKA 1G4YR 2CNPA 3I5HB 2M97A 3JVTC 4ORCB 3SG5A 4E68A 1NX1A 2KFHA 1G33A 1S36A 2O60A 4OCIA 4JQ0D 3M0WA 3DXLA 1HQVA 4I5JA 2JWWA 2K7CA 4PE1A 1XO5A 1CLLA 2KAVA 1CTRA 1N65A 3NHTA 1B9AA 1F8HA 2M3WA 1KWOB 1W7IB 1M45A 2PMYA 1JF2A 2AAOA 2LANA 1QLKA 2GTEA 2NLNA 1S3PA 1WLMA 3PM8A 2MBXA 3JTDB 1QIWA 2WCLA 4Q04A 1SSEB 1DMOA 1J7OA 1BODA 2BKHB 3AKBA 1NYAA 4PHKA 1R6PA 2CBLA 1CDNA 3OX6A 3BOWB 2PVBA 4ZCUA 2JPOA 2ZKMX 1CMFA 1XFWO 3BUMB 1OOIX 1GGWA 1RFJA 3BUWB 2F3YA 2HPSA 1N0YA 3CYZA 3PM2A 2GGMA 1QVIZ 4L9MA 2F2OA 2JNXA 2L4IA 2L2CA 1KQMB 2EHBA 2AUCA 2BCAA 2JTTA 3R1PA 2LAPA 3BFBA 3NSKA 3PALA 3R1OA 2KI4B 3VRPA 1A29A 2KNEA 3RLZA 1EJ3A 2M9GA 4HSZA 1XFVO 1AUIB 2WCFA 3SG6A 3FIAA 1CB1A 4CFRA 2QEOA 1AK8A 3OB1B 5F6TA 4ETOA 1K95A 2K61A 2M29A 5AANA 3VRRA 2H61A 1DJGA 3CLNA 1PRWA 1WDCC 2KSPA 4GGFA 4XJKA 2LVJA 2IS9A 3D73A 1Y6WA 2K7OA 3O78A 1J55A 1CKKA 3SJSA 1IJ6A 1NCXA 3SS5A 4C0LA 1RECA 3EG5B 3PN7C 4FTGA 1H4BA 2RGIA 4WRIA 4QJ5B 2Y4QA 3TS5B 1KK8B 1TTXA 2ZRSA 4MZKA 2JTZA 2OTGB 5J3XA 1N2DA 1TOPA 2ZN8A 2MRDA 5AXIA 2M8UA 1W7JB 3LLEA 1FPWA 2L0PA 1QWVA 3BOWA 1C07A 3I5GC 1A4PA 4YGCB 1S1EA 1NCZA 4A4BA 1R2UA 2HQ8A 3EKHA 1H8BA 2LLUA 1BG1A 2BE6A 1NSHA 2BL0B 1ALVA 2KFGA 3H4SE 3I5FB 4DS7A 2KAXA 4TNCA 4CFQA 1SBJA 1SL7A 2MHHA 3GK4X 3GK2A 2M1KB 2B1UA 5FYXA 1QV1A 2ZN9A 1SCMC 3Q8IA 4PHJA 1WY9A 2Q4UA 2KBIA 1TCFA 3CR4X 3LK0A 5KSZA 3RM1A 1L2OC 1TRFA 3KPXA 2OS8B 4BY4A 5DKQA 4CIDA 2GGZA 2L2EA 1XFXO 3KO0A 4AQIA 2CXJA 4MLWA 4CLNA 3NSIA 2CCMA 2LMTA 1IH0A 4ZCVA 1K9UA 1EH2A 2JQ6A 1XFYO 1DQEA 2M49B 2M7LA 1OOGA 1CFDA 4WQ3A 4PE4A 2M0RA 3CZTX 1QJTA 1CFCA 2JT0A 3FE8A 4PCWA 2KQ6A 2ISDA 1K2HA 3IF7A 1ODBA 2JXLA 2EC6B 3VB1A 2WC8A 2L50A 2QDIA 3SG4A 2CTNA 5CSIA 1EG3A 1OMVA 1CLBA 2JC2A 3K21A 1P28A 4YGAA 1CFFA 3I5HC 1ZOTB 2QPTA 3A4UB 4GGFC 3S0BA 3AKAA 4MZJA 1KCYA 3BQ3A 1XFZO 4YRUA 1Y1XA 1SRAA 2HF5A 1FBVA 1SYMA 2BE4A 2NXQA 1M63B 2PYQA 1KSMA 2BCBA 1TNXA 2L51A 4YGEB 1AP4A 1CDPA 1JC2A 1JBAA 1IWQA 1Y1UA 3L47A 1KWOC 2ZFDA 2F33A 1DELA 2Q91A 3IQQA 3SG2A 1NUBA 4MBEA 3CR2A 3BFHA 1IG5A 1K93D 1TN4A 3JTDC 3NSOA 4M2QA 1ORGA 2KDHA 3V2LA 1TNQA 5I2LA 3PFVA 3SG3A 1IQ5A 1SMGA 1U5IA 2KQYA 1AJ4A 1C7VA 2P71A 2LVVA 3CZ1A 3I5IB 5CSNA 2P6BB 1BMOA 1BLQA 1XFRA 2SCPA 3KEVA 1B4CA 1S6JA 1DTLA 3GOFA 2PSRA 1C3ZA 1Y1AA 1YTZC 1NPQA 2NCOA 2K60A 1NWDA 5TNCA 2FCDA 2MLEC 1KQMC 1UHNA 2M7NA 3PJIA 5IBWA 1CNPA 2WCMA 2NZ0A 1RWYA 3EK8A 1V1GA 1YRTB 2KI4C 1BF5A 2WORA 1NX0A 1SL8A 1CM4A 2LMVA 1D1OA 1A75A 1IJ5A 3D78A 2JNFA 1OZOA 2LC5A 1EL4A 1IIOA 1IQ3A 1UHJA 3L4AA 5FI7A 1SR6C 1B1GA 3DVJA 3VRNA 5G08A 4R1EA 1BR4B 2LUCA 2E30A 1OSAA 5D7FA 2A4JA 3B86A 1GJYA 1CDMA 4PDZA 4JPZB 3IVTA 1B7TY 1DJXA 2LP2A 1PULA 3EVUA 4I5NB 1DJWA 3CZ2A 5HKWA 2YGUA 2QEHA 1PK0D 2TN4A 1KK8C 2G2BA 1YVLA 3SG7A 1DGVA 2V53A 4UPGA 1SL9A 2EGDA 1YUTA 1ZMZA 1YX8A 3KHEA 2JZIA 1VRKA 1MXEA 1Q80A 2LV7A 1WRKA 3CWGA 4GPLB 4QJ3B 1DGUA 3FWBA 3B88A 3BYAA 1DEKA 2K0JA 3D10A 1RTP1 3SIAA 1PALA 1X02A 1KSOA 4BY5A 3FWCA 2KFFA 1K94A 3LCPC 1PVAA 3PSRA 1OOHA 3OX5A 1DF0B 1UURA 2BL0C 2WNDA 1SPYA 3I5FC 3OBVA 4XYNA 3AAJA 1NX2A 2I2RE 3BFAA 1MQ1A 1MXLC 3IQOA 1UUSA 1WLZA 3ZWHA 1CFPA 2JULA 4GUKA 3EVVA 1B8LA 3OHMB 2OS8C 2BBNA 2BCXA 1G8IA 1M46A 1PSBA 4F0ZB 5B8IB 2E6WA 2JOJA 1NP8A 5DKRA 4YBHB 1DVIA 2FJUB 3VGOA 1RROA 3K1EA 4YI8A 5DICA 3MSEB 4IL1A 3QRXA 1KQVA 4P2YB 4YGBB 1C7WA 2AMIA 1F71A 1SK6D 2ERBA 4MVFA 5I94A 1B47A 3BXKA 1F55A 3D76A 5KTYA 1K8UA 3NSLA 4JD9A 4MEWA 1QX7A 1ZACA 1OW4A 2Y1NA 3CABA 2MLFC 2WC5A 1F54A 1DJHA 3AAKA 1CDLA 2LLSA 1LA0A 5ER5A 3F45A 3A8RA 2G9BA 3SS4A 3VROA 1WRZA 3S0DA 4GFTA 5K89A 1M39A 3E3RA 3NXAA 1LKJA 2WCJA 3R72A 4USLA 3WNXB 2JRFA 5HKYA 1K96A 2PASA 5DKNA 3S0FA 1IGVA 2R2IA 3B6XA 1LA3A 1LVCD 4NDBA 5KU1A 1GM0A 1QLSA 4M2PA 1BR1B 1XK4A 1YURA 2LLTA 1LS8A 4HREE 4MN0A 5I2QA 1DF0A 2F3ZA 2L98A 4MRYA 4HRGA 5FI2A 3WHTB 4DRWA 3DYEA 3CS1A 1OZSA 1DT7B 3C1VA 2JU0A 4IJ7A 2KAYA 3CGAA 2K2FA 1WRLA 1MHOA 1OMDA 2HETA 2NCPA 4MRXA 4PHNA 4YI9A 4NDDA 4NDCA 5D69A 1Y0VH 3EVRA 3WHUB 5BPJA 3EK4A 5HLOA 3NGVA 1SKTA 1EXRA 1K9KA 1S6IA 5CPVA 1SW8A 2Y5IA 4C0JA 1F4OA 4M2OA 4INXA 1JUOA 1OMRA 1A03A 2PALA 3TZ1A 2FOTA 4KYNA 2M1UA 5AFPA 4I5LB 1AHRA 1TWOA 1DC1A 4NQGA 4XJKB 3TUYB 2LP3A 3O6BA 2I18A 4OV2A 1QATA 4PE0A 5AERA 2KLEA 2LVIA 2MAZA 1JFJA 2LM5A 3JVTB 2JXCA 2LE9B 2KGBC 3DVMA 3CR5X 3NHIA 3HCMA 3B7AA 1FF1A 1Z4HA 2K2AA 5GQQC 1J1DA 4HRHA 3VRQA 1T14A 2KHNA 3RZSA 1S5GY 1JF0A 2L5YA 1E8AA 3DVKA 5AEQA 1TUJA 1UWOA 2H2KA 2WCEA 4MZLA 1FW4A 3WXAA 2PRUA 1K90D 1C3YA 4GNKB 4ORBB 2KPHA 2MA2A 3FE9A 1BOCA 3CDNA 3DF0B 1OOFA 5EL2A 3DZTA 3EKJA 1BU3A 2WC6A 3BUXB 3HX4A 2L4HA 3L4LA 4OZDA 5ER4X 3TS5C 2WOSA 2F2PA 2KLDA 4PE7A 1XK4C 3BUNB 4MSPA 2LVKA 3BJHA 1OOJA 2MJWB 1QXPA 1TUZA 1IRJA 1W9ZA 2OTGC 1IKUA 2LNKA 1F4QA 3FS7A 1QIVA 3B87A 4PALA 4FQTA 1UHKA 1KK7Y 3LL8B 3QMEA 4QJ4B 3GK1A 1BJFA 4YGDB 1RJVA 2COLB 2BECA 2ZNEA 2KOTA 3O4XA 3DVEA 2QACA 3D77A 3KF9A 2D8NA 1ZFSA 4I5KA 4OVNF 5FI6A 4F7FA 3UNWA 3D0YB 1Z2CB 1KFXS 1SR6B 1ZUZA 2H8VA 3D74A 5JJGA 3S0AA 1BT6A 1OQPA 1TCOB 2LHIA 2LUXA 1LINA 5PALA 1QX5B 2P70A 2WCKA 3SIBA 1PSRA 1KFXL 1LXFC 1YVHA 2JPTA 1JSAA 1RK9A 3SS3A 1NIWA 1HT9A 4INWA 1J7RA 1J7QA 5HYDA 1TIZA 1MR8A 1QTXA 2L5XB 3CZ0A 5CSJA 3UO9A 1WDCB 2BAPA 1V1FA 1QV0A 2K8MB 1JFKA 4ICBA 4DUQA 2KI6D 2KYFA 1YR5A 4U8DA 3DY9A 1FI5A 1S26D 1YX7A 2DOQA 2LHLA 2BNXA 3OP0A 1GQMA 1F70A 1QS7A 4GBAA 3PN7B 3DD4A 1AVSA 3S0GA 1B8RA 2SASA 3CTNA 3OGNA 2EC6C 3R1VA 4C0KA 1S6CA 2I94A 3LK1A 1CMGA 2KYCA 2VRGA 3ZNIA 2O5GA 2FCEA 1J1EA 1YUSA 1QVIY 3TDIA 4CPVA 2FJYA 2F8PA 3DF0A 1XFUO 1TNWA 4GAOA 1CM1A 2QEVA 1PVBA 2K7BA 4AOMA 1JWDA 1NCYA 1SNLA 2BKIB 4D1EA 1U5IB 1SCVA 1MF8B 3TDUA 3I5GB 2LCPA 3PATA 5I2OA 1TNPA 4FQOA 2BBMA 2GV5A 2K7DA 4WQ2A 5D3OA
chains in the Genus database with same CATH topology
3BUOB 2JT3A 1MUXA 4N5XA 4PHMA 4JWQA 1DJZA 5HKZA 1UP5A 1YUUA 1GGZA 2KI6C 1NX3A 1SCMB 1L7ZA 1UHHA 1S5GZ 5CSFA 1OE9B 1L2OB 3D0YA 1XYDA 2CT9A 3O4YA 2Y1MA 3OB2B 1ALWA 1KFUS 1M31A 2HQWA 3ICBA 4N1FA 1YRUB 1XVJA 1B7TZ 1XA5A 1A75B 4GGNA 1FI6A 4P5OE 1B8CA 3I5IC 2JT8A 1MWNA 1KFUL 2WCBA 2LMUA 5JOLA 3TDZA 5I8NA 2KBMA 4ORAB 2OPOA 4OR9B 2H61C 4OKHA 5HLVA 1J7PA 3TUYC 1DJYA 4A4CA 1CLMA 2ZNDA 3EK7A 3PLFB 1KK7Z 4DIRA 1SY9A 4AQJA 2ZRTA 1A2XA 1K9PA 2KGRA 3O2PA 1UHIA 1DJIA 2I7AA 4N1GA 1QX2A 1AJ5A 1EG4A 1QASA 4DCKA 1G4YR 2CNPA 3I5HB 2M97A 3JVTC 4ORCB 3SG5A 1NX1A 2KFHA 1G33A 1S36A 2O60A 4OCIA 4JQ0D 3M0WA 1HQVA 4I5JA 2JWWA 2K7CA 4PE1A 1XO5A 1CLLA 2KAVA 1CTRA 1N65A 1F8HA 1B9AA 2M3WA 1KWOB 1W7IB 1M45A 2PMYA 1JF2A 2AAOA 2LANA 1QLKA 2NLNA 1S3PA 1WLMA 3PM8A 2MBXA 3JTDB 1QIWA 4Q04A 1DMOA 1BODA 2BKHB 3AKBA 1NYAA 4PHKA 1R6PA 2CBLA 1CDNA 3OX6A 3BOWB 2PVBA 4ZCUA 2ZKMX 1CMFA 1XFWO 3BUMB 1GGWA 1RFJA 3BUWB 2F3YA 2HPSA 1N0YA 2GGMA 1QVIZ 4L9MA 2F2OA 2JNXA 2L4IA 1KQMB 2EHBA 2AUCA 2BCAA 2JTTA 2LAPA 3PALA 3NSKA 3VRPA 2KI4B 1A29A 2KNEA 3RLZA 1EJ3A 2M9GA 4HSZA 1XFVO 1AUIB 2WCFA 3SG6A 3FIAA 1CB1A 4CFRA 1AK8A 3OB1B 5F6TA 4ETOA 1K95A 2K61A 2M29A 5AANA 3VRRA 2H61A 1DJGA 3CLNA 1PRWA 1WDCC 2KSPA 4GGFA 4XJKA 2LVJA 2IS9A 1Y6WA 2K7OA 3O78A 1J55A 1CKKA 3SJSA 1IJ6A 1NCXA 4C0LA 1RECA 3PN7C 4FTGA 1H4BA 2RGIA 4WRIA 4QJ5B 2Y4QA 3TS5B 1KK8B 1TTXA 2ZRSA 4MZKA 2JTZA 2OTGB 5J3XA 1N2DA 1TOPA 2ZN8A 2MRDA 5AXIA 2M8UA 1W7JB 3LLEA 1FPWA 2L0PA 3BOWA 1C07A 3I5GC 1A4PA 4YGCB 1S1EA 1NCZA 4A4BA 1R2UA 2HQ8A 3EKHA 1H8BA 2LLUA 1BG1A 2BE6A 1NSHA 2BL0B 1ALVA 2KFGA 3H4SE 3I5FB 4DS7A 2KAXA 4TNCA 4CFQA 1SBJA 1SL7A 2MHHA 3GK4X 3GK2A 2M1KB 2B1UA 5FYXA 1QV1A 2ZN9A 1SCMC 4PHJA 1WY9A 2Q4UA 2KBIA 1TCFA 3CR4X 3LK0A 5KSZA 3RM1A 1L2OC 1TRFA 3KPXA 2OS8B 4BY4A 5DKQA 4CIDA 2GGZA 2L2EA 1XFXO 3KO0A 4AQIA 2CXJA 4MLWA 4CLNA 3NSIA 2CCMA 2LMTA 1IH0A 4ZCVA 1K9UA 1EH2A 2JQ6A 1XFYO 2M49B 2M7LA 4WQ3A 1CFDA 4PE4A 2M0RA 3CZTX 1QJTA 1CFCA 2JT0A 4PCWA 2ISDA 2KQ6A 1K2HA 3IF7A 1ODBA 2JXLA 2EC6B 2WC8A 2L50A 3SG4A 2CTNA 5CSIA 1EG3A 1OMVA 1CLBA 2JC2A 3K21A 4YGAA 1CFFA 3I5HC 1ZOTB 2QPTA 3A4UB 4GGFC 1KCYA 3AKAA 4MZJA 3BQ3A 1XFZO 4YRUA 1Y1XA 1SRAA 2HF5A 1FBVA 1SYMA 2BE4A 2NXQA 1M63B 1KSMA 2BCBA 1TNXA 2L51A 4YGEB 1AP4A 1CDPA 1JC2A 1JBAA 1IWQA 1Y1UA 1KWOC 2ZFDA 2F33A 2Q91A 3IQQA 3SG2A 1NUBA 4MBEA 3CR2A 1IG5A 1K93D 1TN4A 3JTDC 3NSOA 4M2QA 2KDHA 1TNQA 5I2LA 3PFVA 3SG3A 1IQ5A 1SMGA 1U5IA 2KQYA 1AJ4A 1C7VA 2LVVA 3I5IB 5CSNA 2P6BB 1BMOA 1BLQA 2SCPA 3KEVA 1B4CA 1S6JA 1DTLA 3GOFA 2PSRA 1Y1AA 1YTZC 1NPQA 2NCOA 1NWDA 5TNCA 2FCDA 2MLEC 1KQMC 1UHNA 2M7NA 5IBWA 1CNPA 2NZ0A 1RWYA 3EK8A 1V1GA 1YRTB 2KI4C 1BF5A 2WORA 1NX0A 1SL8A 1CM4A 2LMVA 1D1OA 1A75A 1IJ5A 2JNFA 1OZOA 2LC5A 1EL4A 1IQ3A 1UHJA 1SR6C 1B1GA 3DVJA 3VRNA 5G08A 4R1EA 1BR4B 2LUCA 2E30A 1OSAA 5D7FA 2A4JA 1GJYA 1CDMA 4PDZA 4JPZB 1B7TY 1DJXA 2LP2A 1PULA 3EVUA 4I5NB 1DJWA 5HKWA 1PK0D 2TN4A 1KK8C 2G2BA 1YVLA 3SG7A 1DGVA 2V53A 4UPGA 1SL9A 2EGDA 1YUTA 1ZMZA 1YX8A 3KHEA 2JZIA 1VRKA 1MXEA 1Q80A 2LV7A 1WRKA 3CWGA 4GPLB 4QJ3B 1DGUA 3FWBA 3BYAA 2K0JA 3D10A 4BY5A 1RTP1 3SIAA 1PALA 1X02A 1KSOA 3FWCA 2KFFA 1K94A 3LCPC 1PVAA 3PSRA 3OX5A 1DF0B 1UURA 2BL0C 2WNDA 1SPYA 3I5FC 4XYNA 3AAJA 1NX2A 2I2RE 1MQ1A 1MXLC 3IQOA 1UUSA 1WLZA 3ZWHA 1CFPA 2JULA 4GUKA 3EVVA 1B8LA 3OHMB 2OS8C 2BBNA 2BCXA 1G8IA 1M46A 1PSBA 4F0ZB 5B8IB 2E6WA 2JOJA 1NP8A 5DKRA 4YBHB 1DVIA 2FJUB 3VGOA 1RROA 4YI8A 3MSEB 4IL1A 3QRXA 1KQVA 4P2YB 4YGBB 1C7WA 2AMIA 1F71A 1SK6D 4MVFA 1B47A 3BXKA 1F55A 5KTYA 1K8UA 3NSLA 4MEWA 1QX7A 1ZACA 2Y1NA 2MLFC 1F54A 1DJHA 3AAKA 1CDLA 2LLSA 1LA0A 5ER5A 3F45A 3A8RA 2G9BA 3VROA 1WRZA 4GFTA 5K89A 1M39A 3E3RA 3NXAA 1LKJA 3WNXB 4USLA 2JRFA 1K96A 2PASA 5DKNA 1IGVA 2R2IA 1LA3A 1LVCD 4NDBA 5KU1A 1QLSA 4M2PA 1BR1B 1XK4A 1YURA 2LLTA 4HREE 4MN0A 5I2QA 1DF0A 2F3ZA 2L98A 4MRYA 4HRGA 3WHTB 4DRWA 3CS1A 1OZSA 1DT7B 3C1VA 2JU0A 2KAYA 3CGAA 2K2FA 1WRLA 1MHOA 1OMDA 2HETA 2NCPA 4MRXA 4PHNA 4YI9A 4NDDA 4NDCA 5D69A 1Y0VH 3EVRA 3WHUB 5BPJA 3EK4A 5HLOA 1SKTA 1EXRA 1K9KA 1S6IA 5CPVA 1SW8A 2Y5IA 4C0JA 1F4OA 4M2OA 1JUOA 1OMRA 1A03A 2PALA 3TZ1A 2FOTA 5AFPA 2M1UA 4I5LB 1AHRA 4NQGA 4XJKB 3TUYB 2LP3A 3O6BA 2I18A 4OV2A 1QATA 4PE0A 5AERA 2LVIA 2MAZA 1JFJA 2LM5A 3JVTB 2JXCA 2LE9B 2KGBC 3DVMA 3CR5X 3HCMA 1FF1A 2K2AA 5GQQC 1J1DA 4HRHA 3VRQA 2KHNA 1S5GY 1JF0A 1E8AA 3DVKA 5AEQA 2H2KA 1UWOA 2WCEA 4MZLA 1FW4A 3WXAA 2PRUA 1K90D 4GNKB 4ORBB 2MA2A 1BOCA 3DF0B 3EKJA 5HKYA 1BU3A 3HX4A 3BUXB 4E68A 2L4HA 3TS5C 5ER4X 2WOSA 2F2PA 4PE7A 1XK4C 3BUNB 4MSPA 2LVKA 1OOJA 2MJWB 1QXPA 2OTGC 1IRJA 1IKUA 2LNKA 1F4QA 3FS7A 1QIVA 4PALA 1UHKA 1KK7Y 3LL8B 4QJ4B 3GK1A 1BJFA 4YGDB 1RJVA 2COLB 2BECA 2ZNEA 2KOTA 3DVEA 2QACA 3KF9A 2D8NA 1ZFSA 4I5KA 4OVNF 3D0YB 1KFXS 1SR6B 1ZUZA 5JJGA 1BT6A 1OQPA 1TCOB 2LHIA 2LUXA 1LINA 5PALA 1QX5B 3SIBA 1PSRA 1KFXL 1LXFC 1YVHA 2JPTA 1JSAA 1RK9A 1NIWA 1HT9A 1J7RA 1J7QA 5HYDA 1TIZA 1MR8A 1QTXA 2L5XB 5CSJA 1J7OA 1WDCB 1V1FA 1QV0A 2K8MB 1JFKA 4ICBA 4DUQA 2KI6D 2KYFA 1YR5A 4U8DA 1FI5A 1S26D 1YX7A 2DOQA 2LHLA 3OP0A 1GQMA 1F70A 1QS7A 4GBAA 3PN7B 3DD4A 1AVSA 1B8RA 2SASA 3CTNA 4C0KA 2EC6C 1S6CA 2I94A 3LK1A 1CMGA 2KYCA 2VRGA 3ZNIA 2O5GA 2FCEA 1J1EA 1YUSA 1QVIY 3TDIA 4CPVA 2F8PA 3DF0A 1XFUO 1TNWA 4GAOA 1CM1A 1JWDA 1PVBA 2K7BA 4AOMA 1NCYA 1SNLA 2BKIB 4D1EA 1U5IB 1SCVA 1MF8B 3TDUA 3I5GB 2LCPA 3PATA 5I2OA 1TNPA 4FQOA 2BBMA 2GV5A 2K7DA 4WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUO B;  2JT3 A;  1MUX A;  4N5X A;  4PHM A;  4JWQ A;  1DJZ A;  5HKZ A;  1UP5 A;  1YUU A;  1GGZ A;  2KI6 C;  1NX3 A;  1SCM B;  1L7Z A;  1UHH A;  1S5G Z;  5CSF A;  1OE9 B;  1L2O B;  3D0Y A;  1XYD A;  2CT9 A;  3O4Y A;  2Y1M A;  3OB2 B;  1ALW A;  1KFU S;  1M31 A;  2HQW A;  3ICB A;  4N1F A;  1YRU B;  1XVJ A;  1B7T Z;  1XA5 A;  1A75 B;  4GGN A;  1FI6 A;  4P5O E;  1B8C A;  3I5I C;  2JT8 A;  1MWN A;  1KFU L;  2WCB A;  2LMU A;  5JOL A;  3TDZ A;  5I8N A;  2KBM A;  4ORA B;  2OPO A;  4OR9 B;  2H61 C;  4OKH A;  5HLV A;  1J7P A;  3TUY C;  1DJY A;  4A4C A;  1CLM A;  2ZND A;  3EK7 A;  3PLF B;  1KK7 Z;  4DIR A;  1SY9 A;  4AQJ A;  2ZRT A;  1A2X A;  1K9P A;  2KGR A;  3O2P A;  1UHI A;  1DJI A;  2I7A A;  4N1G A;  1QX2 A;  1AJ5 A;  1EG4 A;  1QAS A;  4DCK A;  1G4Y R;  2CNP A;  3I5H B;  2M97 A;  3JVT C;  4ORC B;  3SG5 A;  1NX1 A;  2KFH A;  1G33 A;  1S36 A;  2O60 A;  4OCI A;  4JQ0 D;  3M0W A;  1HQV A;  4I5J A;  2JWW A;  2K7C A;  4PE1 A;  1XO5 A;  1CLL A;  2KAV A;  1CTR A;  1N65 A;  1F8H A;  1B9A A;  2M3W A;  1KWO B;  1W7I B;  1M45 A;  2PMY A;  1JF2 A;  2AAO A;  2LAN A;  1QLK A;  2NLN A;  1S3P A;  1WLM A;  3PM8 A;  2MBX A;  3JTD B;  1QIW A;  4Q04 A;  1DMO A;  1BOD A;  2BKH B;  3AKB A;  1NYA A;  4PHK A;  1R6P A;  2CBL A;  1CDN A;  3OX6 A;  3BOW B;  2PVB A;  4ZCU A;  2ZKM X;  1CMF A;  1XFW O;  3BUM B;  1GGW A;  1RFJ A;  3BUW B;  2F3Y A;  2HPS A;  1N0Y A;  2GGM A;  1QVI Z;  4L9M A;  2F2O A;  2JNX A;  2L4I A;  1KQM B;  2EHB A;  2AUC A;  2BCA A;  2JTT A;  2LAP A;  3PAL A;  3NSK A;  3VRP A;  2KI4 B;  1A29 A;  2KNE A;  3RLZ A;  1EJ3 A;  2M9G A;  4HSZ A;  1XFV O;  1AUI B;  2WCF A;  3SG6 A;  3FIA A;  1CB1 A;  4CFR A;  1AK8 A;  3OB1 B;  5F6T A;  4ETO A;  1K95 A;  2K61 A;  2M29 A;  5AAN A;  3VRR A;  2H61 A;  1DJG A;  3CLN A;  1PRW A;  1WDC C;  2KSP A;  4GGF A;  4XJK A;  2LVJ A;  2IS9 A;  1Y6W A;  2K7O A;  3O78 A;  1J55 A;  1CKK A;  3SJS A;  1IJ6 A;  1NCX A;  4C0L A;  1REC A;  3PN7 C;  4FTG A;  1H4B A;  2RGI A;  4WRI A;  4QJ5 B;  2Y4Q A;  3TS5 B;  1KK8 B;  1TTX A;  2ZRS A;  4MZK A;  2JTZ A;  2OTG B;  5J3X A;  1N2D A;  1TOP A;  2ZN8 A;  2MRD A;  5AXI A;  2M8U A;  1W7J B;  3LLE A;  1FPW A;  2L0P A;  3BOW A;  1C07 A;  3I5G C;  1A4P A;  4YGC B;  1S1E A;  1NCZ A;  4A4B A;  1R2U A;  2HQ8 A;  3EKH A;  1H8B A;  2LLU A;  1BG1 A;  2BE6 A;  1NSH A;  2BL0 B;  1ALV A;  2KFG A;  3H4S E;  3I5F B;  4DS7 A;  2KAX A;  4TNC A;  4CFQ A;  1SBJ A;  1SL7 A;  2MHH A;  3GK4 X;  3GK2 A;  2M1K B;  2B1U A;  5FYX A;  1QV1 A;  2ZN9 A;  1SCM C;  4PHJ A;  1WY9 A;  2Q4U A;  2KBI A;  1TCF A;  3CR4 X;  3LK0 A;  5KSZ A;  3RM1 A;  1L2O C;  1TRF A;  3KPX A;  2OS8 B;  4BY4 A;  5DKQ A;  4CID A;  2GGZ A;  2L2E A;  1XFX O;  3KO0 A;  4AQI A;  2CXJ A;  4MLW A;  4CLN A;  3NSI A;  2CCM A;  2LMT A;  1IH0 A;  4ZCV A;  1K9U A;  1EH2 A;  2JQ6 A;  1XFY O;  2M49 B;  2M7L A;  4WQ3 A;  1CFD A;  4PE4 A;  2M0R A;  3CZT X;  1QJT A;  1CFC A;  2JT0 A;  4PCW A;  2ISD A;  2KQ6 A;  1K2H A;  3IF7 A;  1ODB A;  2JXL A;  2EC6 B;  2WC8 A;  2L50 A;  3SG4 A;  2CTN A;  5CSI A;  1EG3 A;  1OMV A;  1CLB A;  2JC2 A;  3K21 A;  4YGA A;  1CFF A;  3I5H C;  1ZOT B;  2QPT A;  3A4U B;  4GGF C;  1KCY A;  3AKA A;  4MZJ A;  3BQ3 A;  1XFZ O;  4YRU A;  1Y1X A;  1SRA A;  2HF5 A;  1FBV A;  1SYM A;  2BE4 A;  2NXQ A;  1M63 B;  1KSM A;  2BCB A;  1TNX A;  2L51 A;  4YGE B;  1AP4 A;  1CDP A;  1JC2 A;  1JBA A;  1IWQ A;  1Y1U A;  1KWO C;  2ZFD A;  2F33 A;  2Q91 A;  3IQQ A;  3SG2 A;  1NUB A;  4MBE A;  3CR2 A;  1IG5 A;  1K93 D;  1TN4 A;  3JTD C;  3NSO A;  4M2Q A;  2KDH A;  1TNQ A;  5I2L A;  3PFV A;  3SG3 A;  1IQ5 A;  1SMG A;  1U5I A;  2KQY A;  1AJ4 A;  1C7V A;  2LVV A;  3I5I B;  5CSN A;  2P6B B;  1BMO A;  1BLQ A;  2SCP A;  3KEV A;  1B4C A;  1S6J A;  1DTL A;  3GOF A;  2PSR A;  1Y1A A;  1YTZ C;  1NPQ A;  2NCO A;  1NWD A;  5TNC A;  2FCD A;  2MLE C;  1KQM C;  1UHN A;  2M7N A;  5IBW A;  1CNP A;  2NZ0 A;  1RWY A;  3EK8 A;  1V1G A;  1YRT B;  2KI4 C;  1BF5 A;  2WOR A;  1NX0 A;  1SL8 A;  1CM4 A;  2LMV A;  1D1O A;  1A75 A;  1IJ5 A;  2JNF A;  1OZO A;  2LC5 A;  1EL4 A;  1IQ3 A;  1UHJ A;  1SR6 C;  1B1G A;  3DVJ A;  3VRN A;  5G08 A;  4R1E A;  1BR4 B;  2LUC A;  2E30 A;  1OSA A;  5D7F A;  2A4J A;  1GJY A;  1CDM A;  4PDZ A;  4JPZ B;  1B7T Y;  1DJX A;  2LP2 A;  1PUL A;  3EVU A;  4I5N B;  1DJW A;  5HKW A;  1PK0 D;  2TN4 A;  1KK8 C;  2G2B A;  1YVL A;  3SG7 A;  1DGV A;  2V53 A;  4UPG A;  1SL9 A;  2EGD A;  1YUT A;  1ZMZ A;  1YX8 A;  3KHE A;  2JZI A;  1VRK A;  1MXE A;  1Q80 A;  2LV7 A;  1WRK A;  3CWG A;  4GPL B;  4QJ3 B;  1DGU A;  3FWB A;  3BYA A;  2K0J A;  3D10 A;  4BY5 A;  1RTP 1;  3SIA A;  1PAL A;  1X02 A;  1KSO A;  3FWC A;  2KFF A;  1K94 A;  3LCP C;  1PVA A;  3PSR A;  3OX5 A;  1DF0 B;  1UUR A;  2BL0 C;  2WND A;  1SPY A;  3I5F C;  4XYN A;  3AAJ A;  1NX2 A;  2I2R E;  1MQ1 A;  1MXL C;  3IQO A;  1UUS A;  1WLZ A;  3ZWH A;  1CFP A;  2JUL A;  4GUK A;  3EVV A;  1B8L A;  3OHM B;  2OS8 C;  2BBN A;  2BCX A;  1G8I A;  1M46 A;  1PSB A;  4F0Z B;  5B8I B;  2E6W A;  2JOJ A;  1NP8 A;  5DKR A;  4YBH B;  1DVI A;  2FJU B;  3VGO A;  1RRO A;  4YI8 A;  3MSE B;  4IL1 A;  3QRX A;  1KQV A;  4P2Y B;  4YGB B;  1C7W A;  2AMI A;  1F71 A;  1SK6 D;  4MVF A;  1B47 A;  3BXK A;  1F55 A;  5KTY A;  1K8U A;  3NSL A;  4MEW A;  1QX7 A;  1ZAC A;  2Y1N A;  2MLF C;  1F54 A;  1DJH A;  3AAK A;  1CDL A;  2LLS A;  1LA0 A;  5ER5 A;  3F45 A;  3A8R A;  2G9B A;  3VRO A;  1WRZ A;  4GFT A;  5K89 A;  1M39 A;  3E3R A;  3NXA A;  1LKJ A;  3WNX B;  4USL A;  2JRF A;  1K96 A;  2PAS A;  5DKN A;  1IGV A;  2R2I A;  1LA3 A;  1LVC D;  4NDB A;  5KU1 A;  1QLS A;  4M2P A;  1BR1 B;  1XK4 A;  1YUR A;  2LLT A;  4HRE E;  4MN0 A;  5I2Q A;  1DF0 A;  2F3Z A;  2L98 A;  4MRY A;  4HRG A;  3WHT B;  4DRW A;  3CS1 A;  1OZS A;  1DT7 B;  3C1V A;  2JU0 A;  2KAY A;  3CGA A;  2K2F A;  1WRL A;  1MHO A;  1OMD A;  2HET A;  2NCP A;  4MRX A;  4PHN A;  4YI9 A;  4NDD A;  4NDC A;  5D69 A;  1Y0V H;  3EVR A;  3WHU B;  5BPJ A;  3EK4 A;  5HLO A;  1SKT A;  1EXR A;  1K9K A;  1S6I A;  5CPV A;  1SW8 A;  2Y5I A;  4C0J A;  1F4O A;  4M2O A;  1JUO A;  1OMR A;  1A03 A;  2PAL A;  3TZ1 A;  2FOT A;  5AFP A;  2M1U A;  4I5L B;  1AHR A;  4NQG A;  4XJK B;  3TUY B;  2LP3 A;  3O6B A;  2I18 A;  4OV2 A;  1QAT A;  4PE0 A;  5AER A;  2LVI A;  2MAZ A;  1JFJ A;  2LM5 A;  3JVT B;  2JXC A;  2LE9 B;  2KGB C;  3DVM A;  3CR5 X;  3HCM A;  1FF1 A;  2K2A A;  5GQQ C;  1J1D A;  4HRH A;  3VRQ A;  2KHN A;  1S5G Y;  1JF0 A;  1E8A A;  3DVK A;  5AEQ A;  2H2K A;  1UWO A;  2WCE A;  4MZL A;  1FW4 A;  3WXA A;  2PRU A;  1K90 D;  4GNK B;  4ORB B;  2MA2 A;  1BOC A;  3DF0 B;  3EKJ A;  5HKY A;  1BU3 A;  3HX4 A;  3BUX B;  4E68 A;  2L4H A;  3TS5 C;  5ER4 X;  2WOS A;  2F2P A;  4PE7 A;  1XK4 C;  3BUN B;  4MSP A;  2LVK A;  1OOJ A;  2MJW B;  1QXP A;  2OTG C;  1IRJ A;  1IKU A;  2LNK A;  1F4Q A;  3FS7 A;  1QIV A;  4PAL A;  1UHK A;  1KK7 Y;  3LL8 B;  4QJ4 B;  3GK1 A;  1BJF A;  4YGD B;  1RJV A;  2COL B;  2BEC A;  2ZNE A;  2KOT A;  3DVE A;  2QAC A;  3KF9 A;  2D8N A;  1ZFS A;  4I5K A;  4OVN F;  3D0Y B;  1KFX S;  1SR6 B;  1ZUZ A;  5JJG A;  1BT6 A;  1OQP A;  1TCO B;  2LHI A;  2LUX A;  1LIN A;  5PAL A;  1QX5 B;  3SIB A;  1PSR A;  1KFX L;  1LXF C;  1YVH A;  2JPT A;  1JSA A;  1RK9 A;  1NIW A;  1HT9 A;  1J7R A;  1J7Q A;  5HYD A;  1TIZ A;  1MR8 A;  1QTX A;  2L5X B;  5CSJ A;  1J7O A;  1WDC B;  1V1F A;  1QV0 A;  2K8M B;  1JFK A;  4ICB A;  4DUQ A;  2KI6 D;  2KYF A;  1YR5 A;  4U8D A;  1FI5 A;  1S26 D;  1YX7 A;  2DOQ A;  2LHL A;  3OP0 A;  1GQM A;  1F70 A;  1QS7 A;  4GBA A;  3PN7 B;  3DD4 A;  1AVS A;  1B8R A;  2SAS A;  3CTN A;  4C0K A;  2EC6 C;  1S6C A;  2I94 A;  3LK1 A;  1CMG A;  2KYC A;  2VRG A;  3ZNI A;  2O5G A;  2FCE A;  1J1E A;  1YUS A;  1QVI Y;  3TDI A;  4CPV A;  2F8P A;  3DF0 A;  1XFU O;  1TNW A;  4GAO A;  1CM1 A;  1JWD A;  1PVB A;  2K7B A;  4AOM A;  1NCY A;  1SNL A;  2BKI B;  4D1E A;  1U5I B;  1SCV A;  1MF8 B;  3TDU A;  3I5G B;  2LCP A;  3PAT A;  5I2O A;  1TNP A;  4FQO A;  2BBM A;  2GV5 A;  2K7D A;  4WQ2 A; 
#chains in the Genus database with same CATH topology
 3BUO B;  2JT3 A;  1MUX A;  4N5X A;  4PHM A;  4JWQ A;  1DJZ A;  3S0E A;  5HKZ A;  1UP5 A;  1YUU A;  1GGZ A;  2WCH A;  2KI6 C;  1NX3 A;  1SCM B;  1L7Z A;  1UHH A;  1S5G Z;  5CSF A;  1OE9 B;  1L2O B;  3D0Y A;  1XYD A;  2CT9 A;  3N7H A;  2Y1M A;  3O4Y A;  1ALW A;  3OB2 B;  1KFU S;  1M31 A;  2HQW A;  3ICB A;  4N1F A;  1YRU B;  1XVJ A;  5HL1 A;  1B7T Z;  1XA5 A;  4JKT A;  1A75 B;  4GGN A;  1FI6 A;  4P5O E;  1B8C A;  3I5I C;  2JT8 A;  1MWN A;  3FE6 A;  1KFU L;  2WCB A;  2LMU A;  5JOL A;  3TDZ A;  5I8N A;  2KBM A;  4ORA B;  4PT1 A;  2OPO A;  4OR9 B;  2H61 C;  4OKH A;  5HLV A;  1J7P A;  3TUY C;  1DJY A;  4A4C A;  1CLM A;  2ZND A;  3EK7 A;  3PLF B;  1KK7 Z;  2PQL A;  1SY9 A;  4AQJ A;  2ZRT A;  4DIR A;  1A2X A;  1K9P A;  2KGR A;  3O2P A;  1UHI A;  1DJI A;  2I7A A;  4N1G A;  1QX2 A;  1AJ5 A;  3D75 A;  1EG4 A;  1QAS A;  2QEB A;  4DCK A;  1G4Y R;  2CNP A;  3I5H B;  2M97 A;  3JVT C;  4ORC B;  3SG5 A;  4E68 A;  1NX1 A;  2KFH A;  1G33 A;  1S36 A;  2O60 A;  4OCI A;  4JQ0 D;  3M0W A;  3DXL A;  1HQV A;  4I5J A;  2JWW A;  2K7C A;  4PE1 A;  1XO5 A;  1CLL A;  2KAV A;  1CTR A;  1N65 A;  3NHT A;  1B9A A;  1F8H A;  2M3W A;  1KWO B;  1W7I B;  1M45 A;  2PMY A;  1JF2 A;  2AAO A;  2LAN A;  1QLK A;  2GTE A;  2NLN A;  1S3P A;  1WLM A;  3PM8 A;  2MBX A;  3JTD B;  1QIW A;  2WCL A;  4Q04 A;  1SSE B;  1DMO A;  1J7O A;  1BOD A;  2BKH B;  3AKB A;  1NYA A;  4PHK A;  1R6P A;  2CBL A;  1CDN A;  3OX6 A;  3BOW B;  2PVB A;  4ZCU A;  2JPO A;  2ZKM X;  1CMF A;  1XFW O;  3BUM B;  1OOI X;  1GGW A;  1RFJ A;  3BUW B;  2F3Y A;  2HPS A;  1N0Y A;  3CYZ A;  3PM2 A;  2GGM A;  1QVI Z;  4L9M A;  2F2O A;  2JNX A;  2L4I A;  2L2C A;  1KQM B;  2EHB A;  2AUC A;  2BCA A;  2JTT A;  3R1P A;  2LAP A;  3BFB A;  3NSK A;  3PAL A;  3R1O A;  2KI4 B;  3VRP A;  1A29 A;  2KNE A;  3RLZ A;  1EJ3 A;  2M9G A;  4HSZ A;  1XFV O;  1AUI B;  2WCF A;  3SG6 A;  3FIA A;  1CB1 A;  4CFR A;  2QEO A;  1AK8 A;  3OB1 B;  5F6T A;  4ETO A;  1K95 A;  2K61 A;  2M29 A;  5AAN A;  3VRR A;  2H61 A;  1DJG A;  3CLN A;  1PRW A;  1WDC C;  2KSP A;  4GGF A;  4XJK A;  2LVJ A;  2IS9 A;  3D73 A;  1Y6W A;  2K7O A;  3O78 A;  1J55 A;  1CKK A;  3SJS A;  1IJ6 A;  1NCX A;  3SS5 A;  4C0L A;  1REC A;  3EG5 B;  3PN7 C;  4FTG A;  1H4B A;  2RGI A;  4WRI A;  4QJ5 B;  2Y4Q A;  3TS5 B;  1KK8 B;  1TTX A;  2ZRS A;  4MZK A;  2JTZ A;  2OTG B;  5J3X A;  1N2D A;  1TOP A;  2ZN8 A;  2MRD A;  5AXI A;  2M8U A;  1W7J B;  3LLE A;  1FPW A;  2L0P A;  1QWV A;  3BOW A;  1C07 A;  3I5G C;  1A4P A;  4YGC B;  1S1E A;  1NCZ A;  4A4B A;  1R2U A;  2HQ8 A;  3EKH A;  1H8B A;  2LLU A;  1BG1 A;  2BE6 A;  1NSH A;  2BL0 B;  1ALV A;  2KFG A;  3H4S E;  3I5F B;  4DS7 A;  2KAX A;  4TNC A;  4CFQ A;  1SBJ A;  1SL7 A;  2MHH A;  3GK4 X;  3GK2 A;  2M1K B;  2B1U A;  5FYX A;  1QV1 A;  2ZN9 A;  1SCM C;  3Q8I A;  4PHJ A;  1WY9 A;  2Q4U A;  2KBI A;  1TCF A;  3CR4 X;  3LK0 A;  5KSZ A;  3RM1 A;  1L2O C;  1TRF A;  3KPX A;  2OS8 B;  4BY4 A;  5DKQ A;  4CID A;  2GGZ A;  2L2E A;  1XFX O;  3KO0 A;  4AQI A;  2CXJ A;  4MLW A;  4CLN A;  3NSI A;  2CCM A;  2LMT A;  1IH0 A;  4ZCV A;  1K9U A;  1EH2 A;  2JQ6 A;  1XFY O;  1DQE A;  2M49 B;  2M7L A;  1OOG A;  1CFD A;  4WQ3 A;  4PE4 A;  2M0R A;  3CZT X;  1QJT A;  1CFC A;  2JT0 A;  3FE8 A;  4PCW A;  2KQ6 A;  2ISD A;  1K2H A;  3IF7 A;  1ODB A;  2JXL A;  2EC6 B;  3VB1 A;  2WC8 A;  2L50 A;  2QDI A;  3SG4 A;  2CTN A;  5CSI A;  1EG3 A;  1OMV A;  1CLB A;  2JC2 A;  3K21 A;  1P28 A;  4YGA A;  1CFF A;  3I5H C;  1ZOT B;  2QPT A;  3A4U B;  4GGF C;  3S0B A;  3AKA A;  4MZJ A;  1KCY A;  3BQ3 A;  1XFZ O;  4YRU A;  1Y1X A;  1SRA A;  2HF5 A;  1FBV A;  1SYM A;  2BE4 A;  2NXQ A;  1M63 B;  2PYQ A;  1KSM A;  2BCB A;  1TNX A;  2L51 A;  4YGE B;  1AP4 A;  1CDP A;  1JC2 A;  1JBA A;  1IWQ A;  1Y1U A;  3L47 A;  1KWO C;  2ZFD A;  2F33 A;  1DEL A;  2Q91 A;  3IQQ A;  3SG2 A;  1NUB A;  4MBE A;  3CR2 A;  3BFH A;  1IG5 A;  1K93 D;  1TN4 A;  3JTD C;  3NSO A;  4M2Q A;  1ORG A;  2KDH A;  3V2L A;  1TNQ A;  5I2L A;  3PFV A;  3SG3 A;  1IQ5 A;  1SMG A;  1U5I A;  2KQY A;  1AJ4 A;  1C7V A;  2P71 A;  2LVV A;  3CZ1 A;  3I5I B;  5CSN A;  2P6B B;  1BMO A;  1BLQ A;  1XFR A;  2SCP A;  3KEV A;  1B4C A;  1S6J A;  1DTL A;  3GOF A;  2PSR A;  1C3Z A;  1Y1A A;  1YTZ C;  1NPQ A;  2NCO A;  2K60 A;  1NWD A;  5TNC A;  2FCD A;  2MLE C;  1KQM C;  1UHN A;  2M7N A;  3PJI A;  5IBW A;  1CNP A;  2WCM A;  2NZ0 A;  1RWY A;  3EK8 A;  1V1G A;  1YRT B;  2KI4 C;  1BF5 A;  2WOR A;  1NX0 A;  1SL8 A;  1CM4 A;  2LMV A;  1D1O A;  1A75 A;  1IJ5 A;  3D78 A;  2JNF A;  1OZO A;  2LC5 A;  1EL4 A;  1IIO A;  1IQ3 A;  1UHJ A;  3L4A A;  5FI7 A;  1SR6 C;  1B1G A;  3DVJ A;  3VRN A;  5G08 A;  4R1E A;  1BR4 B;  2LUC A;  2E30 A;  1OSA A;  5D7F A;  2A4J A;  3B86 A;  1GJY A;  1CDM A;  4PDZ A;  4JPZ B;  3IVT A;  1B7T Y;  1DJX A;  2LP2 A;  1PUL A;  3EVU A;  4I5N B;  1DJW A;  3CZ2 A;  5HKW A;  2YGU A;  2QEH A;  1PK0 D;  2TN4 A;  1KK8 C;  2G2B A;  1YVL A;  3SG7 A;  1DGV A;  2V53 A;  4UPG A;  1SL9 A;  2EGD A;  1YUT A;  1ZMZ A;  1YX8 A;  3KHE A;  2JZI A;  1VRK A;  1MXE A;  1Q80 A;  2LV7 A;  1WRK A;  3CWG A;  4GPL B;  4QJ3 B;  1DGU A;  3FWB A;  3B88 A;  3BYA A;  1DEK A;  2K0J A;  3D10 A;  1RTP 1;  3SIA A;  1PAL A;  1X02 A;  1KSO A;  4BY5 A;  3FWC A;  2KFF A;  1K94 A;  3LCP C;  1PVA A;  3PSR A;  1OOH A;  3OX5 A;  1DF0 B;  1UUR A;  2BL0 C;  2WND A;  1SPY A;  3I5F C;  3OBV A;  4XYN A;  3AAJ A;  1NX2 A;  2I2R E;  3BFA A;  1MQ1 A;  1MXL C;  3IQO A;  1UUS A;  1WLZ A;  3ZWH A;  1CFP A;  2JUL A;  4GUK A;  3EVV A;  1B8L A;  3OHM B;  2OS8 C;  2BBN A;  2BCX A;  1G8I A;  1M46 A;  1PSB A;  4F0Z B;  5B8I B;  2E6W A;  2JOJ A;  1NP8 A;  5DKR A;  4YBH B;  1DVI A;  2FJU B;  3VGO A;  1RRO A;  3K1E A;  4YI8 A;  5DIC A;  3MSE B;  4IL1 A;  3QRX A;  1KQV A;  4P2Y B;  4YGB B;  1C7W A;  2AMI A;  1F71 A;  1SK6 D;  2ERB A;  4MVF A;  5I94 A;  1B47 A;  3BXK A;  1F55 A;  3D76 A;  5KTY A;  1K8U A;  3NSL A;  4JD9 A;  4MEW A;  1QX7 A;  1ZAC A;  1OW4 A;  2Y1N A;  3CAB A;  2MLF C;  2WC5 A;  1F54 A;  1DJH A;  3AAK A;  1CDL A;  2LLS A;  1LA0 A;  5ER5 A;  3F45 A;  3A8R A;  2G9B A;  3SS4 A;  3VRO A;  1WRZ A;  3S0D A;  4GFT A;  5K89 A;  1M39 A;  3E3R A;  3NXA A;  1LKJ A;  2WCJ A;  3R72 A;  4USL A;  3WNX B;  2JRF A;  5HKY A;  1K96 A;  2PAS A;  5DKN A;  3S0F A;  1IGV A;  2R2I A;  3B6X A;  1LA3 A;  1LVC D;  4NDB A;  5KU1 A;  1GM0 A;  1QLS A;  4M2P A;  1BR1 B;  1XK4 A;  1YUR A;  2LLT A;  1LS8 A;  4HRE E;  4MN0 A;  5I2Q A;  1DF0 A;  2F3Z A;  2L98 A;  4MRY A;  4HRG A;  5FI2 A;  3WHT B;  4DRW A;  3DYE A;  3CS1 A;  1OZS A;  1DT7 B;  3C1V A;  2JU0 A;  4IJ7 A;  2KAY A;  3CGA A;  2K2F A;  1WRL A;  1MHO A;  1OMD A;  2HET A;  2NCP A;  4MRX A;  4PHN A;  4YI9 A;  4NDD A;  4NDC A;  5D69 A;  1Y0V H;  3EVR A;  3WHU B;  5BPJ A;  3EK4 A;  5HLO A;  3NGV A;  1SKT A;  1EXR A;  1K9K A;  1S6I A;  5CPV A;  1SW8 A;  2Y5I A;  4C0J A;  1F4O A;  4M2O A;  4INX A;  1JUO A;  1OMR A;  1A03 A;  2PAL A;  3TZ1 A;  2FOT A;  4KYN A;  2M1U A;  5AFP A;  4I5L B;  1AHR A;  1TWO A;  1DC1 A;  4NQG A;  4XJK B;  3TUY B;  2LP3 A;  3O6B A;  2I18 A;  4OV2 A;  1QAT A;  4PE0 A;  5AER A;  2KLE A;  2LVI A;  2MAZ A;  1JFJ A;  2LM5 A;  3JVT B;  2JXC A;  2LE9 B;  2KGB C;  3DVM A;  3CR5 X;  3NHI A;  3HCM A;  3B7A A;  1FF1 A;  1Z4H A;  2K2A A;  5GQQ C;  1J1D A;  4HRH A;  3VRQ A;  1T14 A;  2KHN A;  3RZS A;  1S5G Y;  1JF0 A;  2L5Y A;  1E8A A;  3DVK A;  5AEQ A;  1TUJ A;  1UWO A;  2H2K A;  2WCE A;  4MZL A;  1FW4 A;  3WXA A;  2PRU A;  1K90 D;  1C3Y A;  4GNK B;  4ORB B;  2KPH A;  2MA2 A;  3FE9 A;  1BOC A;  3CDN A;  3DF0 B;  1OOF A;  5EL2 A;  3DZT A;  3EKJ A;  1BU3 A;  2WC6 A;  3BUX B;  3HX4 A;  2L4H A;  3L4L A;  4OZD A;  5ER4 X;  3TS5 C;  2WOS A;  2F2P A;  2KLD A;  4PE7 A;  1XK4 C;  3BUN B;  4MSP A;  2LVK A;  3BJH A;  1OOJ A;  2MJW B;  1QXP A;  1TUZ A;  1IRJ A;  1W9Z A;  2OTG C;  1IKU A;  2LNK A;  1F4Q A;  3FS7 A;  1QIV A;  3B87 A;  4PAL A;  4FQT A;  1UHK A;  1KK7 Y;  3LL8 B;  3QME A;  4QJ4 B;  3GK1 A;  1BJF A;  4YGD B;  1RJV A;  2COL B;  2BEC A;  2ZNE A;  2KOT A;  3O4X A;  3DVE A;  2QAC A;  3D77 A;  3KF9 A;  2D8N A;  1ZFS A;  4I5K A;  4OVN F;  5FI6 A;  4F7F A;  3UNW A;  3D0Y B;  1Z2C B;  1KFX S;  1SR6 B;  1ZUZ A;  2H8V A;  3D74 A;  5JJG A;  3S0A A;  1BT6 A;  1OQP A;  1TCO B;  2LHI A;  2LUX A;  1LIN A;  5PAL A;  1QX5 B;  2P70 A;  2WCK A;  3SIB A;  1PSR A;  1KFX L;  1LXF C;  1YVH A;  2JPT A;  1JSA A;  1RK9 A;  3SS3 A;  1NIW A;  1HT9 A;  4INW A;  1J7R A;  1J7Q A;  5HYD A;  1TIZ A;  1MR8 A;  1QTX A;  2L5X B;  3CZ0 A;  5CSJ A;  3UO9 A;  1WDC B;  2BAP A;  1V1F A;  1QV0 A;  2K8M B;  1JFK A;  4ICB A;  4DUQ A;  2KI6 D;  2KYF A;  1YR5 A;  4U8D A;  3DY9 A;  1FI5 A;  1S26 D;  1YX7 A;  2DOQ A;  2LHL A;  2BNX A;  3OP0 A;  1GQM A;  1F70 A;  1QS7 A;  4GBA A;  3PN7 B;  3DD4 A;  1AVS A;  3S0G A;  1B8R A;  2SAS A;  3CTN A;  3OGN A;  2EC6 C;  3R1V A;  4C0K A;  1S6C A;  2I94 A;  3LK1 A;  1CMG A;  2KYC A;  2VRG A;  3ZNI A;  2O5G A;  2FCE A;  1J1E A;  1YUS A;  1QVI Y;  3TDI A;  4CPV A;  2FJY A;  2F8P A;  3DF0 A;  1XFU O;  1TNW A;  4GAO A;  1CM1 A;  2QEV A;  1PVB A;  2K7B A;  4AOM A;  1JWD A;  1NCY A;  1SNL A;  2BKI B;  4D1E A;  1U5I B;  1SCV A;  1MF8 B;  3TDU A;  3I5G B;  2LCP A;  3PAT A;  5I2O A;  1TNP A;  4FQO A;  2BBM A;  2GV5 A;  2K7D A;  4WQ2 A;  5D3O A; 
#chains in the Genus database with same CATH homology
 3BUO B;  2JT3 A;  1MUX A;  4N5X A;  4PHM A;  4JWQ A;  1DJZ A;  5HKZ A;  1UP5 A;  1YUU A;  1GGZ A;  2KI6 C;  1NX3 A;  1SCM B;  1L7Z A;  1UHH A;  1S5G Z;  5CSF A;  1OE9 B;  1L2O B;  3D0Y A;  1XYD A;  2CT9 A;  3O4Y A;  2Y1M A;  3OB2 B;  1ALW A;  1KFU S;  1M31 A;  2HQW A;  3ICB A;  4N1F A;  1YRU B;  1XVJ A;  1B7T Z;  1XA5 A;  1A75 B;  4GGN A;  1FI6 A;  4P5O E;  1B8C A;  3I5I C;  2JT8 A;  1MWN A;  1KFU L;  2WCB A;  2LMU A;  5JOL A;  3TDZ A;  5I8N A;  2KBM A;  4ORA B;  2OPO A;  4OR9 B;  2H61 C;  4OKH A;  5HLV A;  1J7P A;  3TUY C;  1DJY A;  4A4C A;  1CLM A;  2ZND A;  3EK7 A;  3PLF B;  1KK7 Z;  4DIR A;  1SY9 A;  4AQJ A;  2ZRT A;  1A2X A;  1K9P A;  2KGR A;  3O2P A;  1UHI A;  1DJI A;  2I7A A;  4N1G A;  1QX2 A;  1AJ5 A;  1EG4 A;  1QAS A;  4DCK A;  1G4Y R;  2CNP A;  3I5H B;  2M97 A;  3JVT C;  4ORC B;  3SG5 A;  1NX1 A;  2KFH A;  1G33 A;  1S36 A;  2O60 A;  4OCI A;  4JQ0 D;  3M0W A;  1HQV A;  4I5J A;  2JWW A;  2K7C A;  4PE1 A;  1XO5 A;  1CLL A;  2KAV A;  1CTR A;  1N65 A;  1F8H A;  1B9A A;  2M3W A;  1KWO B;  1W7I B;  1M45 A;  2PMY A;  1JF2 A;  2AAO A;  2LAN A;  1QLK A;  2NLN A;  1S3P A;  1WLM A;  3PM8 A;  2MBX A;  3JTD B;  1QIW A;  4Q04 A;  1DMO A;  1BOD A;  2BKH B;  3AKB A;  1NYA A;  4PHK A;  1R6P A;  2CBL A;  1CDN A;  3OX6 A;  3BOW B;  2PVB A;  4ZCU A;  2ZKM X;  1CMF A;  1XFW O;  3BUM B;  1GGW A;  1RFJ A;  3BUW B;  2F3Y A;  2HPS A;  1N0Y A;  2GGM A;  1QVI Z;  4L9M A;  2F2O A;  2JNX A;  2L4I A;  1KQM B;  2EHB A;  2AUC A;  2BCA A;  2JTT A;  2LAP A;  3PAL A;  3NSK A;  3VRP A;  2KI4 B;  1A29 A;  2KNE A;  3RLZ A;  1EJ3 A;  2M9G A;  4HSZ A;  1XFV O;  1AUI B;  2WCF A;  3SG6 A;  3FIA A;  1CB1 A;  4CFR A;  1AK8 A;  3OB1 B;  5F6T A;  4ETO A;  1K95 A;  2K61 A;  2M29 A;  5AAN A;  3VRR A;  2H61 A;  1DJG A;  3CLN A;  1PRW A;  1WDC C;  2KSP A;  4GGF A;  4XJK A;  2LVJ A;  2IS9 A;  1Y6W A;  2K7O A;  3O78 A;  1J55 A;  1CKK A;  3SJS A;  1IJ6 A;  1NCX A;  4C0L A;  1REC A;  3PN7 C;  4FTG A;  1H4B A;  2RGI A;  4WRI A;  4QJ5 B;  2Y4Q A;  3TS5 B;  1KK8 B;  1TTX A;  2ZRS A;  4MZK A;  2JTZ A;  2OTG B;  5J3X A;  1N2D A;  1TOP A;  2ZN8 A;  2MRD A;  5AXI A;  2M8U A;  1W7J B;  3LLE A;  1FPW A;  2L0P A;  3BOW A;  1C07 A;  3I5G C;  1A4P A;  4YGC B;  1S1E A;  1NCZ A;  4A4B A;  1R2U A;  2HQ8 A;  3EKH A;  1H8B A;  2LLU A;  1BG1 A;  2BE6 A;  1NSH A;  2BL0 B;  1ALV A;  2KFG A;  3H4S E;  3I5F B;  4DS7 A;  2KAX A;  4TNC A;  4CFQ A;  1SBJ A;  1SL7 A;  2MHH A;  3GK4 X;  3GK2 A;  2M1K B;  2B1U A;  5FYX A;  1QV1 A;  2ZN9 A;  1SCM C;  4PHJ A;  1WY9 A;  2Q4U A;  2KBI A;  1TCF A;  3CR4 X;  3LK0 A;  5KSZ A;  3RM1 A;  1L2O C;  1TRF A;  3KPX A;  2OS8 B;  4BY4 A;  5DKQ A;  4CID A;  2GGZ A;  2L2E A;  1XFX O;  3KO0 A;  4AQI A;  2CXJ A;  4MLW A;  4CLN A;  3NSI A;  2CCM A;  2LMT A;  1IH0 A;  4ZCV A;  1K9U A;  1EH2 A;  2JQ6 A;  1XFY O;  2M49 B;  2M7L A;  4WQ3 A;  1CFD A;  4PE4 A;  2M0R A;  3CZT X;  1QJT A;  1CFC A;  2JT0 A;  4PCW A;  2ISD A;  2KQ6 A;  1K2H A;  3IF7 A;  1ODB A;  2JXL A;  2EC6 B;  2WC8 A;  2L50 A;  3SG4 A;  2CTN A;  5CSI A;  1EG3 A;  1OMV A;  1CLB A;  2JC2 A;  3K21 A;  4YGA A;  1CFF A;  3I5H C;  1ZOT B;  2QPT A;  3A4U B;  4GGF C;  1KCY A;  3AKA A;  4MZJ A;  3BQ3 A;  1XFZ O;  4YRU A;  1Y1X A;  1SRA A;  2HF5 A;  1FBV A;  1SYM A;  2BE4 A;  2NXQ A;  1M63 B;  1KSM A;  2BCB A;  1TNX A;  2L51 A;  4YGE B;  1AP4 A;  1CDP A;  1JC2 A;  1JBA A;  1IWQ A;  1Y1U A;  1KWO C;  2ZFD A;  2F33 A;  2Q91 A;  3IQQ A;  3SG2 A;  1NUB A;  4MBE A;  3CR2 A;  1IG5 A;  1K93 D;  1TN4 A;  3JTD C;  3NSO A;  4M2Q A;  2KDH A;  1TNQ A;  5I2L A;  3PFV A;  3SG3 A;  1IQ5 A;  1SMG A;  1U5I A;  2KQY A;  1AJ4 A;  1C7V A;  2LVV A;  3I5I B;  5CSN A;  2P6B B;  1BMO A;  1BLQ A;  2SCP A;  3KEV A;  1B4C A;  1S6J A;  1DTL A;  3GOF A;  2PSR A;  1Y1A A;  1YTZ C;  1NPQ A;  2NCO A;  1NWD A;  5TNC A;  2FCD A;  2MLE C;  1KQM C;  1UHN A;  2M7N A;  5IBW A;  1CNP A;  2NZ0 A;  1RWY A;  3EK8 A;  1V1G A;  1YRT B;  2KI4 C;  1BF5 A;  2WOR A;  1NX0 A;  1SL8 A;  1CM4 A;  2LMV A;  1D1O A;  1A75 A;  1IJ5 A;  2JNF A;  1OZO A;  2LC5 A;  1EL4 A;  1IQ3 A;  1UHJ A;  1SR6 C;  1B1G A;  3DVJ A;  3VRN A;  5G08 A;  4R1E A;  1BR4 B;  2LUC A;  2E30 A;  1OSA A;  5D7F A;  2A4J A;  1GJY A;  1CDM A;  4PDZ A;  4JPZ B;  1B7T Y;  1DJX A;  2LP2 A;  1PUL A;  3EVU A;  4I5N B;  1DJW A;  5HKW A;  1PK0 D;  2TN4 A;  1KK8 C;  2G2B A;  1YVL A;  3SG7 A;  1DGV A;  2V53 A;  4UPG A;  1SL9 A;  2EGD A;  1YUT A;  1ZMZ A;  1YX8 A;  3KHE A;  2JZI A;  1VRK A;  1MXE A;  1Q80 A;  2LV7 A;  1WRK A;  3CWG A;  4GPL B;  4QJ3 B;  1DGU A;  3FWB A;  3BYA A;  2K0J A;  3D10 A;  4BY5 A;  1RTP 1;  3SIA A;  1PAL A;  1X02 A;  1KSO A;  3FWC A;  2KFF A;  1K94 A;  3LCP C;  1PVA A;  3PSR A;  3OX5 A;  1DF0 B;  1UUR A;  2BL0 C;  2WND A;  1SPY A;  3I5F C;  4XYN A;  3AAJ A;  1NX2 A;  2I2R E;  1MQ1 A;  1MXL C;  3IQO A;  1UUS A;  1WLZ A;  3ZWH A;  1CFP A;  2JUL A;  4GUK A;  3EVV A;  1B8L A;  3OHM B;  2OS8 C;  2BBN A;  2BCX A;  1G8I A;  1M46 A;  1PSB A;  4F0Z B;  5B8I B;  2E6W A;  2JOJ A;  1NP8 A;  5DKR A;  4YBH B;  1DVI A;  2FJU B;  3VGO A;  1RRO A;  4YI8 A;  3MSE B;  4IL1 A;  3QRX A;  1KQV A;  4P2Y B;  4YGB B;  1C7W A;  2AMI A;  1F71 A;  1SK6 D;  4MVF A;  1B47 A;  3BXK A;  1F55 A;  5KTY A;  1K8U A;  3NSL A;  4MEW A;  1QX7 A;  1ZAC A;  2Y1N A;  2MLF C;  1F54 A;  1DJH A;  3AAK A;  1CDL A;  2LLS A;  1LA0 A;  5ER5 A;  3F45 A;  3A8R A;  2G9B A;  3VRO A;  1WRZ A;  4GFT A;  5K89 A;  1M39 A;  3E3R A;  3NXA A;  1LKJ A;  3WNX B;  4USL A;  2JRF A;  1K96 A;  2PAS A;  5DKN A;  1IGV A;  2R2I A;  1LA3 A;  1LVC D;  4NDB A;  5KU1 A;  1QLS A;  4M2P A;  1BR1 B;  1XK4 A;  1YUR A;  2LLT A;  4HRE E;  4MN0 A;  5I2Q A;  1DF0 A;  2F3Z A;  2L98 A;  4MRY A;  4HRG A;  3WHT B;  4DRW A;  3CS1 A;  1OZS A;  1DT7 B;  3C1V A;  2JU0 A;  2KAY A;  3CGA A;  2K2F A;  1WRL A;  1MHO A;  1OMD A;  2HET A;  2NCP A;  4MRX A;  4PHN A;  4YI9 A;  4NDD A;  4NDC A;  5D69 A;  1Y0V H;  3EVR A;  3WHU B;  5BPJ A;  3EK4 A;  5HLO A;  1SKT A;  1EXR A;  1K9K A;  1S6I A;  5CPV A;  1SW8 A;  2Y5I A;  4C0J A;  1F4O A;  4M2O A;  1JUO A;  1OMR A;  1A03 A;  2PAL A;  3TZ1 A;  2FOT A;  5AFP A;  2M1U A;  4I5L B;  1AHR A;  4NQG A;  4XJK B;  3TUY B;  2LP3 A;  3O6B A;  2I18 A;  4OV2 A;  1QAT A;  4PE0 A;  5AER A;  2LVI A;  2MAZ A;  1JFJ A;  2LM5 A;  3JVT B;  2JXC A;  2LE9 B;  2KGB C;  3DVM A;  3CR5 X;  3HCM A;  1FF1 A;  2K2A A;  5GQQ C;  1J1D A;  4HRH A;  3VRQ A;  2KHN A;  1S5G Y;  1JF0 A;  1E8A A;  3DVK A;  5AEQ A;  2H2K A;  1UWO A;  2WCE A;  4MZL A;  1FW4 A;  3WXA A;  2PRU A;  1K90 D;  4GNK B;  4ORB B;  2MA2 A;  1BOC A;  3DF0 B;  3EKJ A;  5HKY A;  1BU3 A;  3HX4 A;  3BUX B;  4E68 A;  2L4H A;  3TS5 C;  5ER4 X;  2WOS A;  2F2P A;  4PE7 A;  1XK4 C;  3BUN B;  4MSP A;  2LVK A;  1OOJ A;  2MJW B;  1QXP A;  2OTG C;  1IRJ A;  1IKU A;  2LNK A;  1F4Q A;  3FS7 A;  1QIV A;  4PAL A;  1UHK A;  1KK7 Y;  3LL8 B;  4QJ4 B;  3GK1 A;  1BJF A;  4YGD B;  1RJV A;  2COL B;  2BEC A;  2ZNE A;  2KOT A;  3DVE A;  2QAC A;  3KF9 A;  2D8N A;  1ZFS A;  4I5K A;  4OVN F;  3D0Y B;  1KFX S;  1SR6 B;  1ZUZ A;  5JJG A;  1BT6 A;  1OQP A;  1TCO B;  2LHI A;  2LUX A;  1LIN A;  5PAL A;  1QX5 B;  3SIB A;  1PSR A;  1KFX L;  1LXF C;  1YVH A;  2JPT A;  1JSA A;  1RK9 A;  1NIW A;  1HT9 A;  1J7R A;  1J7Q A;  5HYD A;  1TIZ A;  1MR8 A;  1QTX A;  2L5X B;  5CSJ A;  1J7O A;  1WDC B;  1V1F A;  1QV0 A;  2K8M B;  1JFK A;  4ICB A;  4DUQ A;  2KI6 D;  2KYF A;  1YR5 A;  4U8D A;  1FI5 A;  1S26 D;  1YX7 A;  2DOQ A;  2LHL A;  3OP0 A;  1GQM A;  1F70 A;  1QS7 A;  4GBA A;  3PN7 B;  3DD4 A;  1AVS A;  1B8R A;  2SAS A;  3CTN A;  4C0K A;  2EC6 C;  1S6C A;  2I94 A;  3LK1 A;  1CMG A;  2KYC A;  2VRG A;  3ZNI A;  2O5G A;  2FCE A;  1J1E A;  1YUS A;  1QVI Y;  3TDI A;  4CPV A;  2F8P A;  3DF0 A;  1XFU O;  1TNW A;  4GAO A;  1CM1 A;  1JWD A;  1PVB A;  2K7B A;  4AOM A;  1NCY A;  1SNL A;  2BKI B;  4D1E A;  1U5I B;  1SCV A;  1MF8 B;  3TDU A;  3I5G B;  2LCP A;  3PAT A;  5I2O A;  1TNP A;  4FQO A;  2BBM A;  2GV5 A;  2K7D A;  4WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...