3TS5C

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
b'KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 49
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5C02
3EVVA 4I5NB 3IQQA 3K21A 1MF8B 1NCZA 4I5LB 1DJWA 4CFRA 5K89A 1D1OA 2LHIA 2M9GA 1K8UA 1YRTB 3GK4X 4PALA 2BBNA 1AUIB 3BUOB 2JPTA 1NX2A 4GAOA 4MBEA 1DT7B 1RK9A 2F2OA 2KBIA 1TNPA 3IF7A 1L2OC 3O78A 3CS1A 2M1KB 5IBWA 1IKUA 1OMDA 1KQMC 3TUYB 1F54A 2L98A 5I8NA 3VRRA 1XFZO 5I2QA 1J55A 3EKHA 2JQ6A 2KHNA 1M63B 1QV0A 4OCIA 4C0KA 1Y6WA 2LMVA 1CFDA 1G8IA 1F55A 3A4UB 5PALA 5FYXA 2BE4A 1QX5B 1RWYA 3CTNA 3FWCA 4WQ2A 2KOTA 5CSIA 2F8PA 1SR6C 2LVVA 3RLZA 3I5GB 1YRUB 4GBAA 3VRNA 1CMGA 3KEVA 4GNKB 2LVJA 3BOWB 1SKTA 3KPXA 3OB2B 4N1GA 1TNQA 1S6IA 1AVSA 4PE4A 1DJYA 2VRGA 1NCYA 2CXJA 2K0JA 1MQ1A 5AFPA 5HLVA 4DRWA 1K93D 2HETA 2JT0A 1M39A 1PALA 1QX7A 2PVBA 2WNDA 4N5XA 1J7OA 2QACA 1IGVA 1K9UA 1OZOA 4MN0A 4PHNA 1SRAA 3LCPC 2Q4UA 4Q04A 3VRPA 3I5HC 1XYDA 1XFYO 1SMGA 1SBJA 2H2KA 2K7CA 2M97A 3AAKA 4ZCUA 2BKIB 3I5FC 3F45A 4GUKA 1CDPA 2LANA 1RFJA 2TN4A 3CR2A 4M2QA 1EL4A 4A4CA 1XA5A 2OTGB 3OX6A 1DJHA 2LVIA 4YI8A 2LHLA 3JTDC 1LINA 4PHMA 4MRYA 2LUCA 4NDCA 4ORAB 1JSAA 1LKJA 3OB1B 1EG3A 2NZ0A 3SG3A 5I2OA 2F33A 3MSEB 1QIVA 1PRWA 1B4CA 1AJ4A 1A29A 3BOWA 3CZTX 1MR8A 4MLWA 3PLFB 1QJTA 1TCOB 3KO0A 1QIWA 2ZN9A 5D7FA 2Y1NA 5HKZA 1FPWA 1GJYA 4OR9B 4CPVA 2E30A 4ZCVA 2L2EA 3M0WA 1DGUA 1JWDA 2LLSA 4FTGA 3SG4A 1Y1UA 4QJ5B 3DF0A 3FIAA 1NX0A 2F2PA 1MUXA 2NXQA 1PULA 3O4YA 2BL0C 2KSPA 5CSJA 1YTZC 2L0PA 1YVHA 3LK1A 2MLEC 1DMOA 1B9AA 2CNPA 1L2OB 2LP3A 1HQVA 1OSAA 3RM1A 1BF5A 3AAJA 2KFFA 1CKKA 1KQMB 2KI6D 1XK4C 2BE6A 2JULA 4FQOA 2LE9B 2LV7A 1LXFC 5ER4X 2JNXA 2KAVA 2EC6B 1CFPA 3CWGA 3PSRA 2OS8C 5KTYA 1FBVA 1YUTA 4OVNF 1KFUS 1CFFA 1CDLA 1B8RA 1WLMA 1NCXA 3PALA 1NX3A 1LVCD 2BBMA 1SR6B 1TIZA 2AUCA 1IQ3A 4A4BA 3PATA 1QS7A 1DJIA 4MZKA 1ZMZA 1KK8C 5AERA 1F8HA 1XFXO 1F4QA 2JU0A 4TNCA 2I18A 2MAZA 2WCBA 3TDZA 1S6CA 1BODA 1MHOA 2SASA 1Y0VH 1XFUO 5ER5A 1ZACA 5CPVA 4OKHA 1ZUZA 2NLNA 2JTZA 2ZN8A 1YVLA 4CIDA 2WC8A 3I5HB 1J1DA 1CB1A 3WXAA 2ZRTA 2LC5A 2WORA 1CLMA 2G9BA 2Y1MA 1IH0A 1R2UA 3I5FB 1K95A 3A8RA 2ZKMX 1CLBA 4OV2A 1DVIA 2JRFA 2GGZA 1CM4A 2F3ZA 2LP2A 3I5IC 2COLB 4WRIA 1SW8A 1YX7A 3EK7A 3JTDB 5TNCA 2LAPA 1BJFA 4N1FA 1KFXS 3FS7A 3VRQA 1BG1A 3AKAA 1YR5A 3DVMA 2A4JA 1ALWA 4YI9A 1A4PA 2M49B 1N2DA 3EK4A 2V53A 2R2IA 1DGVA 3D10A 3PM8A 2KFHA 3TS5C 4DCKA 1ALVA 1C7WA 3DF0B 4ETOA 1A75A 4AQJA 1XFWO 2JXCA 1K96A 4AOMA 5HKYA 3DVEA 3TDUA 1DF0A 3ZNIA 2BL0B 1FF1A 1DJXA 4YBHB 3EKJA 4PE7A 1EH2A 1W7JB 1TCFA 1G33A 1RJVA 4I5JA 1SYMA 1WRZA 2K8MB 1NX1A 1IQ5A 4UPGA 4JWQA 4GGNA 4ORBB 4PDZA 1OMRA 3EK8A 2LVKA 1J7QA 1OZSA 3CR4X 2KNEA 1J7PA 3TDIA 2LLTA 1LA3A 2PMYA 1M46A 1WRKA 1F70A 2OS8B 1BOCA 4GGFC 4M2OA 5CSNA 1QV1A 2FCEA 1PVBA 4BY5A 3HCMA 1U5IA 2MJWB 2EHBA 1UUSA 2K7OA 2O60A 1OMVA 1SL8A 3LL8B 2JTTA 1UHIA 1NIWA 2KDHA 2KAYA 1PVAA 2L4IA 3SIBA 1KK8B 2B1UA 1CM1A 2L4HA 1DJGA 3D0YB 2JWWA 3ICBA 2HQ8A 2EGDA 5AEQA 5DKRA 3O6BA 2I7AA 2LNKA 1X02A 4HRGA 4XYNA 1TOPA 1QX2A 1G4YR 2LM5A 3NXAA 4C0LA 3LK0A 1N0YA 2KQYA 2MHHA 5J3XA 1V1GA 2JZIA 4F0ZB 1IJ6A 4GFTA 4CFQA 4E68A 2KYFA 2F3YA 4I5KA 2NCOA 1XK4A 1OOJA 4XJKA 1DTLA 4YGCB 2M8UA 2FJUB 1S6JA 3EVRA 1AHRA 1WY9A 2HF5A 3I5IB 1SL9A 2QPTA 1K90D 3BUNB 5AANA 2K61A 1KCYA 2MLFC 4YGBB 2ZNEA 1F4OA 2OPOA 1ZFSA 2CT9A 3BUWB 3NSLA 2LMUA 2HPSA 1UHJA 3JVTC 1GGZA 1GGWA 1FI5A 1OQPA 1SNLA 4M2PA 5F6TA 1YURA 1QLSA 4IL1A 4BY4A 1J1EA 1Q80A 2BKHB 1YUUA 1A03A 5JOLA 1CMFA 3D0YA 2PRUA 1KWOC 3NSKA 1IWQA 3KF9A 4ICBA 3TS5B 2KAXA 1CFCA 1A75B 2Y5IA 3O2PA 1TRFA 3IQOA 2LCPA 1CDMA 2LUXA 3DD4A 4HREE 1BT6A 4CLNA 1DF0B 4D1EA 5HKWA 4YGDB 5D69A 1SPYA 2ZFDA 2MA2A 3NSIA 1UURA 2K7DA 3OX5A 1Y1XA 2MRDA 4MZLA 2WCFA 1UHKA 1NWDA 1DJZA 3QRXA 1JFKA 1GQMA 4PCWA 3BQ3A 1M45A 1YX8A 2JXLA 1TNWA 2LMTA 1QVIY 1WRLA 2MBXA 1IJ5A 1B1GA 2IS9A 2Y4QA 2SCPA 2L50A 1QLKA 1OE9B 1B8CA 3KHEA 1EG4A 2KQ6A 2M7NA 1BR4B 4U8DA 3SJSA 2NCPA 1AK8A 1MXEA 2E6WA 1U5IB 2BECA 1J7RA 3WHUB 4DS7A 2ZRSA 3PN7C 1BR1B 1WLZA 1QTXA 2KFGA 1LA0A 5G08A 1JF2A 2EC6C 1AP4A 1B7TY 5B8IB 1V1FA 4YRUA 1XO5A 1KQVA 2KGRA 5AXIA 4MVFA 4JQ0D 1SCMC 3OHMB 2L51A 3AKBA 4MEWA 3GK1A 5I2LA 5JJGA 1S5GY 1XFVO 2BCBA 3C1VA 1RROA 1WDCC 1VRKA 4DIRA 2JT8A 2PALA 2PSRA 1W7IB 5HLOA 1K2HA 2FCDA 2KI4C 4C0JA 4ORCB 1M31A 1MXLC 1PSRA 1RTP1 4XJKB 1B8LA 1R6PA 1CNPA 1L7ZA 2K7BA 1ODBA 2L5XB 2RGIA 4PHKA 4QJ3B 1JBAA 1CTRA 2KI6C 1Y1AA 1NYAA 2H61C 1KK7Z 4P5OE 2BCAA 4PE0A 2HQWA 1HT9A 2AAOA 3CGAA 3SG5A 3TZ1A 4R1EA 1PSBA 2H61A 1SY9A 5KU1A 1K9PA 2M0RA 1PK0D 1RECA 1NUBA 4NDDA 2JC2A 4GGFA 2WCEA 5KSZA 4MSPA 1E8AA 3TUYC 4QJ4B 2CBLA 4PE1A 2FOTA 3H4SE 3BYAA 1TTXA 3OP0A 2G2BA 2M1UA 2M3WA 3JVTB 1QXPA 1KFUL 3HX4A 1QASA 1BU3A 2K2FA 2K2AA 4YGAA 3SG6A 1C07A 1C7VA 1XVJA 4MZJA 1S26D 2D8NA 3SG7A 3CLNA 1UWOA 2GGMA 1K94A 2ISDA 2JOJA 1SL7A 2JNFA 5HYDA 1KWOB 2KYCA 1YUSA 3BUXB 3I5GC 2O5GA 4L9MA 2M29A 2P6BB 3E3RA 1NPQA 1B47A 1FW4A 3NSOA 2JT3A 1H8BA 4YGEB 2I94A 4MRXA 1NSHA 1H4BA 1SCVA 1KSMA 3WNXB 4JPZB 4AQIA 1BMOA 1QVIZ 1EXRA 4HRHA 2M7LA 4PHJA 3BXKA 2GV5A 1NP8A 5CSFA 1SK6D 2DOQA 2I2RE 2AMIA 2CTNA 3SG2A 4WQ3A 4USLA 3PFVA 3FWBA 4NQGA 5GQQC 3ZWHA 2CCMA 1IRJA 1B7TZ 2KGBC 1TN4A 4P2YB 5DKNA 1ZOTB 3EVUA 1A2XA 1KK7Y 1N65A 1UP5A 2OTGC 2ZNDA 3GK2A 3PN7B 1KFXL 1F71A 1S5GZ 2BCXA 3VGOA 1UHHA 5BPJA 3VROA 4NDBA 1BLQA 5DKQA 1JC2A 2WOSA 1IG5A 1CLLA 4GPLB 1QATA 3BUMB 3CR5X 3SIAA 1KSOA 1SCMB 3GOFA 1S1EA 3DVKA 2LLUA 4DUQA 1JFJA 2KBMA 4HSZA 1K9KA 1TNXA 3WHTB 1AJ5A 3LLEA 2Q91A 3DVJA 2PASA 1CDNA 1WDCB 1FI6A 1EJ3A 1S36A 1JUOA 2KI4B 1UHNA 1S3PA 1MWNA 1JF0A
chains in the Genus database with same CATH superfamily
3EVVA 4I5NB 3IQQA 3K21A 1MF8B 1NCZA 4I5LB 1DJWA 4CFRA 5K89A 1D1OA 3L4AA 2LHIA 2M9GA 1K8UA 1YRTB 3B86A 3GK4X 4PALA 2BBNA 1AUIB 3BUOB 2JPTA 3S0DA 1NX2A 4GAOA 4MBEA 1DT7B 1RK9A 2F2OA 2KBIA 1TNPA 3IF7A 1L2OC 3O78A 3CS1A 2M1KB 5IBWA 1IKUA 1OMDA 1KQMC 3R1OA 3TUYB 1F54A 2L98A 5I8NA 3UNWA 3VRRA 1XFZO 5I2QA 1J55A 2QEHA 2JQ6A 3EKHA 2KHNA 1M63B 1QV0A 4OCIA 4C0KA 1LS8A 1Y6WA 2LMVA 1CFDA 1G8IA 1F55A 3A4UB 5PALA 5FYXA 2BE4A 1DEKA 2QDIA 1QX5B 1RWYA 3CTNA 3FWCA 4WQ2A 2KOTA 5CSIA 2F8PA 1SR6C 2LVVA 3RLZA 3I5GB 1YRUB 4GBAA 3VRNA 1CMGA 3N7HA 3KEVA 4GNKB 2LVJA 3BOWB 3S0BA 1SKTA 2YGUA 2JPOA 3KPXA 3OB2B 4N1GA 1TNQA 2WCKA 1S6IA 1AVSA 4PE4A 1DJYA 2VRGA 1NCYA 2CXJA 2K0JA 1MQ1A 5AFPA 5HLVA 4DRWA 1K93D 2HETA 2JT0A 1M39A 1PALA 1QX7A 2PVBA 2WNDA 4N5XA 3SS5A 1J7OA 3CZ2A 2QACA 1IGVA 1K9UA 1OZOA 4MN0A 4PHNA 1SRAA 5FI2A 3LCPC 2Q4UA 4Q04A 3VRPA 3I5HC 1XYDA 1W9ZA 1XFYO 1SMGA 1OOIX 3DY9A 1SBJA 2H2KA 2K7CA 2M97A 3AAKA 4ZCUA 2BKIB 3I5FC 3F45A 4GUKA 1CDPA 2LANA 1RFJA 2TN4A 3CR2A 4M2QA 1EL4A 4A4CA 1XA5A 2OTGB 3OX6A 1DQEA 1DJHA 2LVIA 4YI8A 2LHLA 3JTDC 1LINA 4PHMA 3CABA 4MRYA 2LUCA 4NDCA 4ORAB 1JSAA 1LKJA 3S0AA 3OB1B 1EG3A 2NZ0A 3SG3A 5I2OA 1ORGA 2F33A 1QIVA 3MSEB 1PRWA 1B4CA 1AJ4A 1A29A 3BOWA 3CZTX 1MR8A 3NHIA 4MLWA 3PLFB 1QJTA 1TCOB 3KO0A 1QIWA 2ZN9A 1C3YA 5D7FA 2Y1NA 5HKZA 1FPWA 5I94A 1GJYA 4OR9B 4CPVA 2E30A 4ZCVA 2L2EA 3M0WA 1DGUA 1JWDA 2LLSA 2WCJA 4FTGA 1Y1UA 5D3OA 3SG4A 3DF0A 4QJ5B 3FIAA 1NX0A 1XFRA 2F2PA 1MUXA 2NXQA 1PULA 3O4YA 2BL0C 2KSPA 3R72A 5CSJA 1YTZC 2L0PA 1YVHA 3LK1A 2MLEC 1DMOA 1B9AA 2CNPA 1L2OB 2LP3A 1HQVA 1OSAA 3RM1A 3CDNA 1BF5A 3AAJA 2KFFA 1CKKA 1KQMB 2KI6D 1XK4C 2BE6A 3D74A 2JULA 4FQOA 2LE9B 2LV7A 1LXFC 4JD9A 1OW4A 5ER4X 2JNXA 2KAVA 2EC6B 2GTEA 1CFPA 4KYNA 3CWGA 3PSRA 2OS8C 5KTYA 1FBVA 1YUTA 4OVNF 1KFUS 1CFFA 1T14A 1CDLA 1B8RA 1WLMA 1NCXA 3PALA 1NX3A 1LVCD 2BBMA 1SR6B 1TIZA 2PYQA 2AUCA 1IQ3A 4A4BA 3PATA 1QS7A 1DJIA 4MZKA 1ZMZA 1QWVA 1KK8C 5AERA 3NGVA 1F8HA 1XFXO 1F4QA 2JU0A 4TNCA 3OGNA 2I18A 2MAZA 2WCBA 3TDZA 1S6CA 1BODA 1MHOA 2SASA 3DYEA 2H8VA 1Y0VH 1XFUO 5ER5A 1ZACA 2P71A 4OKHA 5CPVA 1ZUZA 1Z2CB 2NLNA 3IVTA 2JTZA 2ZN8A 1YVLA 4CIDA 2WC8A 3I5HB 1J1DA 1CB1A 3D76A 3WXAA 2ZRTA 2LC5A 2WORA 1CLMA 2G9BA 2Y1MA 1IH0A 1R2UA 3I5FB 1K95A 3A8RA 2ZKMX 1CLBA 4OV2A 1DVIA 2WCLA 2JRFA 4JKTA 2GGZA 1CM4A 2F3ZA 2LP2A 2WCMA 3I5IC 2COLB 4WRIA 1SW8A 1YX7A 3EK7A 3JTDB 5TNCA 2LAPA 1BJFA 4N1FA 1KFXS 3FS7A 3VRQA 1BG1A 3AKAA 3PJIA 1YR5A 3DVMA 2A4JA 1ALWA 4YI9A 3BFBA 3S0EA 1A4PA 2M49B 1N2DA 3EK4A 2V53A 2R2IA 1DGVA 1P28A 3D10A 3PM8A 2KFHA 3TS5C 4DCKA 1ALVA 1C7WA 3DF0B 3B7AA 4ETOA 1A75A 3NHTA 4AQJA 2KLEA 1XFWO 2JXCA 1K96A 4AOMA 5HKYA 3DVEA 3TDUA 1DF0A 3ZNIA 2BL0B 1IIOA 1FF1A 1DJXA 4YBHB 3EKJA 4PE7A 1EH2A 1W7JB 1TCFA 2K60A 1G33A 1RJVA 4I5JA 5FI6A 1SYMA 1WRZA 2K8MB 1NX1A 1IQ5A 4UPGA 4JWQA 4GGNA 4ORBB 4PDZA 1OMRA 4OZDA 3EK8A 2LVKA 1J7QA 1OZSA 3CR4X 2KNEA 2FJYA 3TDIA 2LLTA 1J7PA 1LA3A 2PMYA 1M46A 1WRKA 1F70A 2OS8B 1BOCA 4GGFC 4M2OA 5CSNA 1QV1A 2FCEA 1PVBA 4BY5A 3HCMA 1U5IA 2MJWB 2EHBA 1UUSA 2K7OA 2O60A 1OMVA 1SL8A 3LL8B 2JTTA 1UHIA 1NIWA 2KDHA 2KAYA 1PVAA 2L4IA 3SIBA 1KK8B 2B1UA 1CM1A 2L4HA 3BFHA 1DJGA 2BAPA 2QEVA 3D0YB 3L47A 4PT1A 2JWWA 3ICBA 2HQ8A 2EGDA 5AEQA 5DKRA 3O6BA 2I7AA 2LNKA 3VB1A 1X02A 4HRGA 4XYNA 1TOPA 1QX2A 1G4YR 2LM5A 3NXAA 4C0LA 3LK0A 1N0YA 2KQYA 2MHHA 3R1VA 5J3XA 1V1GA 2JZIA 4F0ZB 1TWOA 1IJ6A 4GFTA 4CFQA 4E68A 2KYFA 2F3YA 4I5KA 2NCOA 1XK4A 1OOJA 4XJKA 3SS4A 1DTLA 1OOFA 4YGCB 2M8UA 2FJUB 1S6JA 3EVRA 2PQLA 1AHRA 1WY9A 2HF5A 3I5IB 1SL9A 2QPTA 1K90D 3BUNB 5AANA 2K61A 1KCYA 3D77A 2MLFC 4YGBB 2ZNEA 1F4OA 2OPOA 1ZFSA 2CT9A 3BUWB 3NSLA 2LMUA 2HPSA 1UHJA 3JVTC 1SSEB 1GGZA 1GGWA 1FI5A 1OQPA 1SNLA 1TUZA 4M2PA 2L2CA 5F6TA 1YURA 1QLSA 4IL1A 4BY4A 1J1EA 1Q80A 2BKHB 1YUUA 3UO9A 5JOLA 1A03A 2WCHA 1CMFA 3D0YA 2PRUA 1KWOC 3NSKA 1IWQA 3KF9A 4ICBA 3TS5B 2KAXA 3O4XA 1CFCA 1A75B 2L5YA 2Y5IA 1TRFA 3IQOA 3O2PA 3V2LA 2LCPA 2QEOA 1CDMA 2LUXA 3DD4A 4HREE 1BT6A 4CLNA 1DF0B 4D1EA 5HKWA 2WC6A 4YGDB 1SPYA 2ZFDA 5D69A 2MA2A 3NSIA 1UURA 2K7DA 4F7FA 3Q8IA 3OX5A 1Y1XA 2MRDA 4MZLA 2WCFA 1UHKA 1NWDA 1DJZA 5HL1A 3QRXA 1JFKA 1GQMA 4PCWA 3BQ3A 1DELA 2KPHA 3K1EA 1M45A 1YX8A 1C3ZA 1TNWA 2JXLA 1QVIY 1WRLA 2LMTA 1IJ5A 2MBXA 1B1GA 2IS9A 2Y4QA 2SCPA 2L50A 1QLKA 1OE9B 1B8CA 3KHEA 1EG4A 2KQ6A 2M7NA 1BR4B 4U8DA 3B6XA 3SJSA 2NCPA 1AK8A 3DZTA 1MXEA 2E6WA 1U5IB 2BECA 1J7RA 3WHUB 4DS7A 2ZRSA 3OBVA 3PN7C 1BR1B 1WLZA 1QTXA 2KFGA 1LA0A 5G08A 2WC5A 1JF2A 2EC6C 5EL2A 1AP4A 1B7TY 5B8IB 1V1FA 4YRUA 1XO5A 1KQVA 2KGRA 5AXIA 4MVFA 4JQ0D 1SCMC 3OHMB 2L51A 3AKBA 1GM0A 4MEWA 3GK1A 5I2LA 3SS3A 5JJGA 1S5GY 1XFVO 2BCBA 3C1VA 1RROA 3S0FA 1WDCC 1VRKA 4DIRA 2JT8A 2PALA 2PSRA 1W7IB 5HLOA 1K2HA 1OOHA 2FCDA 2KI4C 4C0JA 4ORCB 1M31A 1MXLC 2KLDA 1PSRA 1RTP1 4XJKB 1B8LA 1R6PA 1CNPA 3L4LA 1L7ZA 2K7BA 1ODBA 2L5XB 2RGIA 3CYZA 4FQTA 4PHKA 4QJ3B 1JBAA 1CTRA 2KI6C 1Y1AA 1NYAA 2H61C 1KK7Z 4P5OE 2BCAA 4PE0A 2HQWA 1HT9A 2AAOA 3B87A 3CGAA 4IJ7A 3SG5A 4R1EA 1PSBA 2H61A 1SY9A 3TZ1A 5KU1A 1K9PA 2M0RA 1PK0D 1RECA 1NUBA 4NDDA 2JC2A 3R1PA 2WCEA 4GGFA 5KSZA 4MSPA 1E8AA 3TUYC 4QJ4B 3PM2A 5DICA 2CBLA 4PE1A 2FOTA 3H4SE 3BYAA 1TTXA 3OP0A 2G2BA 2M1UA 2M3WA 2P70A 3JVTB 3FE8A 1QXPA 1KFUL 3HX4A 1QASA 1BU3A 2K2FA 2K2AA 3BFAA 3DXLA 4YGAA 3SG6A 1C07A 1XVJA 4MZJA 1S26D 2D8NA 3SG7A 3CLNA 1UWOA 2GGMA 1K94A 2ISDA 2JOJA 1SL7A 2JNFA 5HYDA 1KWOB 2KYCA 1Z4HA 1YUSA 3BUXB 3I5GC 2O5GA 4L9MA 2M29A 2P6BB 3E3RA 1NPQA 4INWA 1B47A 1FW4A 3NSOA 3B88A 2JT3A 1C7VA 4YGEB 2I94A 4MRXA 1NSHA 1H4BA 1H8BA 1SCVA 1KSMA 3CZ1A 3WNXB 4JPZB 4AQIA 1BMOA 1QVIZ 3EG5B 1EXRA 4HRHA 2M7LA 4PHJA 3BXKA 2GV5A 1NP8A 3S0GA 3D78A 5CSFA 1SK6D 2DOQA 2I2RE 2AMIA 2CTNA 3SG2A 4WQ3A 4USLA 3CZ0A 3PFVA 1TUJA 3D73A 3FWBA 4NQGA 3FE9A 5GQQC 3ZWHA 2CCMA 1IRJA 1B7TZ 2KGBC 1TN4A 4P2YB 5DKNA 1ZOTB 3EVUA 1A2XA 1KK7Y 1N65A 1UP5A 2OTGC 2ZNDA 3GK2A 3PN7B 1KFXL 1F71A 1S5GZ 1DC1A 2BCXA 3BJHA 3VGOA 1UHHA 1OOGA 5BPJA 4INXA 3VROA 4NDBA 1BLQA 5DKQA 1JC2A 2WOSA 1IG5A 1CLLA 4GPLB 3RZSA 1QATA 3BUMB 3CR5X 5FI7A 3FE6A 3SIAA 1KSOA 1SCMB 3GOFA 2BNXA 1S1EA 3DVKA 2LLUA 4DUQA 1JFJA 2KBMA 4HSZA 1K9KA 1TNXA 3WHTB 1AJ5A 3LLEA 2Q91A 3DVJA 2PASA 1CDNA 1WDCB 2QEBA 2ERBA 1FI6A 1EJ3A 1S36A 1JUOA 2KI4B 1UHNA 3D75A 3QMEA 1S3PA 1MWNA 1JF0A
chains in the Genus database with same CATH topology
3EVVA 4I5NB 3IQQA 3K21A 1MF8B 1NCZA 4I5LB 1DJWA 4CFRA 5K89A 1D1OA 2LHIA 2M9GA 1K8UA 1YRTB 3GK4X 4PALA 2BBNA 1AUIB 3BUOB 2JPTA 1NX2A 4GAOA 4MBEA 1DT7B 1RK9A 2F2OA 2KBIA 1TNPA 3IF7A 1L2OC 3O78A 3CS1A 2M1KB 5IBWA 1IKUA 1OMDA 1KQMC 3TUYB 1F54A 2L98A 5I8NA 3VRRA 1XFZO 5I2QA 1J55A 3EKHA 2JQ6A 2KHNA 1M63B 1QV0A 4OCIA 4C0KA 1Y6WA 2LMVA 1CFDA 1G8IA 1F55A 3A4UB 5PALA 5FYXA 2BE4A 1QX5B 1RWYA 3CTNA 3FWCA 4WQ2A 2KOTA 5CSIA 2F8PA 1SR6C 2LVVA 3RLZA 3I5GB 1YRUB 4GBAA 3VRNA 1CMGA 3KEVA 4GNKB 2LVJA 3BOWB 1SKTA 3KPXA 3OB2B 4N1GA 1TNQA 1S6IA 1AVSA 4PE4A 1DJYA 2VRGA 1NCYA 2CXJA 2K0JA 1MQ1A 5AFPA 5HLVA 4DRWA 1K93D 2HETA 2JT0A 1M39A 1PALA 1QX7A 2PVBA 2WNDA 4N5XA 1J7OA 2QACA 1IGVA 1K9UA 1OZOA 4MN0A 4PHNA 1SRAA 3LCPC 2Q4UA 4Q04A 3VRPA 3I5HC 1XYDA 1XFYO 1SMGA 1SBJA 2H2KA 2K7CA 2M97A 3AAKA 4ZCUA 2BKIB 3I5FC 3F45A 4GUKA 1CDPA 2LANA 1RFJA 2TN4A 3CR2A 4M2QA 1EL4A 4A4CA 1XA5A 2OTGB 3OX6A 1DJHA 2LVIA 4YI8A 2LHLA 3JTDC 1LINA 4PHMA 4MRYA 2LUCA 4NDCA 4ORAB 1JSAA 1LKJA 3OB1B 1EG3A 2NZ0A 3SG3A 5I2OA 2F33A 3MSEB 1QIVA 1PRWA 1B4CA 1AJ4A 1A29A 3BOWA 3CZTX 1MR8A 4MLWA 3PLFB 1QJTA 1TCOB 3KO0A 1QIWA 2ZN9A 5D7FA 2Y1NA 5HKZA 1FPWA 1GJYA 4OR9B 4CPVA 2E30A 4ZCVA 2L2EA 3M0WA 1DGUA 1JWDA 2LLSA 4FTGA 3SG4A 1Y1UA 4QJ5B 3DF0A 3FIAA 1NX0A 2F2PA 1MUXA 2NXQA 1PULA 3O4YA 2BL0C 2KSPA 5CSJA 1YTZC 2L0PA 1YVHA 3LK1A 2MLEC 1DMOA 1B9AA 2CNPA 1L2OB 2LP3A 1HQVA 1OSAA 3RM1A 1BF5A 3AAJA 2KFFA 1CKKA 1KQMB 2KI6D 1XK4C 2BE6A 2JULA 4FQOA 2LE9B 2LV7A 1LXFC 5ER4X 2JNXA 2KAVA 2EC6B 1CFPA 3CWGA 3PSRA 2OS8C 5KTYA 1FBVA 1YUTA 4OVNF 1KFUS 1CFFA 1CDLA 1B8RA 1WLMA 1NCXA 3PALA 1NX3A 1LVCD 2BBMA 1SR6B 1TIZA 2AUCA 1IQ3A 4A4BA 3PATA 1QS7A 1DJIA 4MZKA 1ZMZA 1KK8C 5AERA 1F8HA 1XFXO 1F4QA 2JU0A 4TNCA 2I18A 2MAZA 2WCBA 3TDZA 1S6CA 1BODA 1MHOA 2SASA 1Y0VH 1XFUO 5ER5A 1ZACA 5CPVA 4OKHA 1ZUZA 2NLNA 2JTZA 2ZN8A 1YVLA 4CIDA 2WC8A 3I5HB 1J1DA 1CB1A 3WXAA 2ZRTA 2LC5A 2WORA 1CLMA 2G9BA 2Y1MA 1IH0A 1R2UA 3I5FB 1K95A 3A8RA 2ZKMX 1CLBA 4OV2A 1DVIA 2JRFA 2GGZA 1CM4A 2F3ZA 2LP2A 3I5IC 2COLB 4WRIA 1SW8A 1YX7A 3EK7A 3JTDB 5TNCA 2LAPA 1BJFA 4N1FA 1KFXS 3FS7A 3VRQA 1BG1A 3AKAA 1YR5A 3DVMA 2A4JA 1ALWA 4YI9A 1A4PA 2M49B 1N2DA 3EK4A 2V53A 2R2IA 1DGVA 3D10A 3PM8A 2KFHA 3TS5C 4DCKA 1ALVA 1C7WA 3DF0B 4ETOA 1A75A 4AQJA 1XFWO 2JXCA 1K96A 4AOMA 5HKYA 3DVEA 3TDUA 1DF0A 3ZNIA 2BL0B 1FF1A 1DJXA 4YBHB 3EKJA 4PE7A 1EH2A 1W7JB 1TCFA 1G33A 1RJVA 4I5JA 1SYMA 1WRZA 2K8MB 1NX1A 1IQ5A 4UPGA 4JWQA 4GGNA 4ORBB 4PDZA 1OMRA 3EK8A 2LVKA 1J7QA 1OZSA 3CR4X 2KNEA 1J7PA 3TDIA 2LLTA 1LA3A 2PMYA 1M46A 1WRKA 1F70A 2OS8B 1BOCA 4GGFC 4M2OA 5CSNA 1QV1A 2FCEA 1PVBA 4BY5A 3HCMA 1U5IA 2MJWB 2EHBA 1UUSA 2K7OA 2O60A 1OMVA 1SL8A 3LL8B 2JTTA 1UHIA 1NIWA 2KDHA 2KAYA 1PVAA 2L4IA 3SIBA 1KK8B 2B1UA 1CM1A 2L4HA 1DJGA 3D0YB 2JWWA 3ICBA 2HQ8A 2EGDA 5AEQA 5DKRA 3O6BA 2I7AA 2LNKA 1X02A 4HRGA 4XYNA 1TOPA 1QX2A 1G4YR 2LM5A 3NXAA 4C0LA 3LK0A 1N0YA 2KQYA 2MHHA 5J3XA 1V1GA 2JZIA 4F0ZB 1IJ6A 4GFTA 4CFQA 4E68A 2KYFA 2F3YA 4I5KA 2NCOA 1XK4A 1OOJA 4XJKA 1DTLA 4YGCB 2M8UA 2FJUB 1S6JA 3EVRA 1AHRA 1WY9A 2HF5A 3I5IB 1SL9A 2QPTA 1K90D 3BUNB 5AANA 2K61A 1KCYA 2MLFC 4YGBB 2ZNEA 1F4OA 2OPOA 1ZFSA 2CT9A 3BUWB 3NSLA 2LMUA 2HPSA 1UHJA 3JVTC 1GGZA 1GGWA 1FI5A 1OQPA 1SNLA 4M2PA 5F6TA 1YURA 1QLSA 4IL1A 4BY4A 1J1EA 1Q80A 2BKHB 1YUUA 1A03A 5JOLA 1CMFA 3D0YA 2PRUA 1KWOC 3NSKA 1IWQA 3KF9A 4ICBA 3TS5B 2KAXA 1CFCA 1A75B 2Y5IA 3O2PA 1TRFA 3IQOA 2LCPA 1CDMA 2LUXA 3DD4A 4HREE 1BT6A 4CLNA 1DF0B 4D1EA 5HKWA 4YGDB 5D69A 1SPYA 2ZFDA 2MA2A 3NSIA 1UURA 2K7DA 3OX5A 1Y1XA 2MRDA 4MZLA 2WCFA 1UHKA 1NWDA 1DJZA 3QRXA 1JFKA 1GQMA 4PCWA 3BQ3A 1M45A 1YX8A 2JXLA 1TNWA 2LMTA 1QVIY 1WRLA 2MBXA 1IJ5A 1B1GA 2IS9A 2Y4QA 2SCPA 2L50A 1QLKA 1OE9B 1B8CA 3KHEA 1EG4A 2KQ6A 2M7NA 1BR4B 4U8DA 3SJSA 2NCPA 1AK8A 1MXEA 2E6WA 1U5IB 2BECA 1J7RA 3WHUB 4DS7A 2ZRSA 3PN7C 1BR1B 1WLZA 1QTXA 2KFGA 1LA0A 5G08A 1JF2A 2EC6C 1AP4A 1B7TY 5B8IB 1V1FA 4YRUA 1XO5A 1KQVA 2KGRA 5AXIA 4MVFA 4JQ0D 1SCMC 3OHMB 2L51A 3AKBA 4MEWA 3GK1A 5I2LA 5JJGA 1S5GY 1XFVO 2BCBA 3C1VA 1RROA 1WDCC 1VRKA 4DIRA 2JT8A 2PALA 2PSRA 1W7IB 5HLOA 1K2HA 2FCDA 2KI4C 4C0JA 4ORCB 1M31A 1MXLC 1PSRA 1RTP1 4XJKB 1B8LA 1R6PA 1CNPA 1L7ZA 2K7BA 1ODBA 2L5XB 2RGIA 4PHKA 4QJ3B 1JBAA 1CTRA 2KI6C 1Y1AA 1NYAA 2H61C 1KK7Z 4P5OE 2BCAA 4PE0A 2HQWA 1HT9A 2AAOA 3CGAA 3SG5A 3TZ1A 4R1EA 1PSBA 2H61A 1SY9A 5KU1A 1K9PA 2M0RA 1PK0D 1RECA 1NUBA 4NDDA 2JC2A 4GGFA 2WCEA 5KSZA 4MSPA 1E8AA 3TUYC 4QJ4B 2CBLA 4PE1A 2FOTA 3H4SE 3BYAA 1TTXA 3OP0A 2G2BA 2M1UA 2M3WA 3JVTB 1QXPA 1KFUL 3HX4A 1QASA 1BU3A 2K2FA 2K2AA 4YGAA 3SG6A 1C07A 1C7VA 1XVJA 4MZJA 1S26D 2D8NA 3SG7A 3CLNA 1UWOA 2GGMA 1K94A 2ISDA 2JOJA 1SL7A 2JNFA 5HYDA 1KWOB 2KYCA 1YUSA 3BUXB 3I5GC 2O5GA 4L9MA 2M29A 2P6BB 3E3RA 1NPQA 1B47A 1FW4A 3NSOA 2JT3A 1H8BA 4YGEB 2I94A 4MRXA 1NSHA 1H4BA 1SCVA 1KSMA 3WNXB 4JPZB 4AQIA 1BMOA 1QVIZ 1EXRA 4HRHA 2M7LA 4PHJA 3BXKA 2GV5A 1NP8A 5CSFA 1SK6D 2DOQA 2I2RE 2AMIA 2CTNA 3SG2A 4WQ3A 4USLA 3PFVA 3FWBA 4NQGA 5GQQC 3ZWHA 2CCMA 1IRJA 1B7TZ 2KGBC 1TN4A 4P2YB 5DKNA 1ZOTB 3EVUA 1A2XA 1KK7Y 1N65A 1UP5A 2OTGC 2ZNDA 3GK2A 3PN7B 1KFXL 1F71A 1S5GZ 2BCXA 3VGOA 1UHHA 5BPJA 3VROA 4NDBA 1BLQA 5DKQA 1JC2A 2WOSA 1IG5A 1CLLA 4GPLB 1QATA 3BUMB 3CR5X 3SIAA 1KSOA 1SCMB 3GOFA 1S1EA 3DVKA 2LLUA 4DUQA 1JFJA 2KBMA 4HSZA 1K9KA 1TNXA 3WHTB 1AJ5A 3LLEA 2Q91A 3DVJA 2PASA 1CDNA 1WDCB 1FI6A 1EJ3A 1S36A 1JUOA 2KI4B 1UHNA 1S3PA 1MWNA 1JF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  4I5N B;  3IQQ A;  3K21 A;  1MF8 B;  1NCZ A;  4I5L B;  1DJW A;  4CFR A;  5K89 A;  1D1O A;  2LHI A;  2M9G A;  1K8U A;  1YRT B;  3GK4 X;  4PAL A;  2BBN A;  1AUI B;  3BUO B;  2JPT A;  1NX2 A;  4GAO A;  4MBE A;  1DT7 B;  1RK9 A;  2F2O A;  2KBI A;  1TNP A;  3IF7 A;  1L2O C;  3O78 A;  3CS1 A;  2M1K B;  5IBW A;  1IKU A;  1OMD A;  1KQM C;  3TUY B;  1F54 A;  2L98 A;  5I8N A;  3VRR A;  1XFZ O;  5I2Q A;  1J55 A;  3EKH A;  2JQ6 A;  2KHN A;  1M63 B;  1QV0 A;  4OCI A;  4C0K A;  1Y6W A;  2LMV A;  1CFD A;  1G8I A;  1F55 A;  3A4U B;  5PAL A;  5FYX A;  2BE4 A;  1QX5 B;  1RWY A;  3CTN A;  3FWC A;  4WQ2 A;  2KOT A;  5CSI A;  2F8P A;  1SR6 C;  2LVV A;  3RLZ A;  3I5G B;  1YRU B;  4GBA A;  3VRN A;  1CMG A;  3KEV A;  4GNK B;  2LVJ A;  3BOW B;  1SKT A;  3KPX A;  3OB2 B;  4N1G A;  1TNQ A;  1S6I A;  1AVS A;  4PE4 A;  1DJY A;  2VRG A;  1NCY A;  2CXJ A;  2K0J A;  1MQ1 A;  5AFP A;  5HLV A;  4DRW A;  1K93 D;  2HET A;  2JT0 A;  1M39 A;  1PAL A;  1QX7 A;  2PVB A;  2WND A;  4N5X A;  1J7O A;  2QAC A;  1IGV A;  1K9U A;  1OZO A;  4MN0 A;  4PHN A;  1SRA A;  3LCP C;  2Q4U A;  4Q04 A;  3VRP A;  3I5H C;  1XYD A;  1XFY O;  1SMG A;  1SBJ A;  2H2K A;  2K7C A;  2M97 A;  3AAK A;  4ZCU A;  2BKI B;  3I5F C;  3F45 A;  4GUK A;  1CDP A;  2LAN A;  1RFJ A;  2TN4 A;  3CR2 A;  4M2Q A;  1EL4 A;  4A4C A;  1XA5 A;  2OTG B;  3OX6 A;  1DJH A;  2LVI A;  4YI8 A;  2LHL A;  3JTD C;  1LIN A;  4PHM A;  4MRY A;  2LUC A;  4NDC A;  4ORA B;  1JSA A;  1LKJ A;  3OB1 B;  1EG3 A;  2NZ0 A;  3SG3 A;  5I2O A;  2F33 A;  3MSE B;  1QIV A;  1PRW A;  1B4C A;  1AJ4 A;  1A29 A;  3BOW A;  3CZT X;  1MR8 A;  4MLW A;  3PLF B;  1QJT A;  1TCO B;  3KO0 A;  1QIW A;  2ZN9 A;  5D7F A;  2Y1N A;  5HKZ A;  1FPW A;  1GJY A;  4OR9 B;  4CPV A;  2E30 A;  4ZCV A;  2L2E A;  3M0W A;  1DGU A;  1JWD A;  2LLS A;  4FTG A;  3SG4 A;  1Y1U A;  4QJ5 B;  3DF0 A;  3FIA A;  1NX0 A;  2F2P A;  1MUX A;  2NXQ A;  1PUL A;  3O4Y A;  2BL0 C;  2KSP A;  5CSJ A;  1YTZ C;  2L0P A;  1YVH A;  3LK1 A;  2MLE C;  1DMO A;  1B9A A;  2CNP A;  1L2O B;  2LP3 A;  1HQV A;  1OSA A;  3RM1 A;  1BF5 A;  3AAJ A;  2KFF A;  1CKK A;  1KQM B;  2KI6 D;  1XK4 C;  2BE6 A;  2JUL A;  4FQO A;  2LE9 B;  2LV7 A;  1LXF C;  5ER4 X;  2JNX A;  2KAV A;  2EC6 B;  1CFP A;  3CWG A;  3PSR A;  2OS8 C;  5KTY A;  1FBV A;  1YUT A;  4OVN F;  1KFU S;  1CFF A;  1CDL A;  1B8R A;  1WLM A;  1NCX A;  3PAL A;  1NX3 A;  1LVC D;  2BBM A;  1SR6 B;  1TIZ A;  2AUC A;  1IQ3 A;  4A4B A;  3PAT A;  1QS7 A;  1DJI A;  4MZK A;  1ZMZ A;  1KK8 C;  5AER A;  1F8H A;  1XFX O;  1F4Q A;  2JU0 A;  4TNC A;  2I18 A;  2MAZ A;  2WCB A;  3TDZ A;  1S6C A;  1BOD A;  1MHO A;  2SAS A;  1Y0V H;  1XFU O;  5ER5 A;  1ZAC A;  5CPV A;  4OKH A;  1ZUZ A;  2NLN A;  2JTZ A;  2ZN8 A;  1YVL A;  4CID A;  2WC8 A;  3I5H B;  1J1D A;  1CB1 A;  3WXA A;  2ZRT A;  2LC5 A;  2WOR A;  1CLM A;  2G9B A;  2Y1M A;  1IH0 A;  1R2U A;  3I5F B;  1K95 A;  3A8R A;  2ZKM X;  1CLB A;  4OV2 A;  1DVI A;  2JRF A;  2GGZ A;  1CM4 A;  2F3Z A;  2LP2 A;  3I5I C;  2COL B;  4WRI A;  1SW8 A;  1YX7 A;  3EK7 A;  3JTD B;  5TNC A;  2LAP A;  1BJF A;  4N1F A;  1KFX S;  3FS7 A;  3VRQ A;  1BG1 A;  3AKA A;  1YR5 A;  3DVM A;  2A4J A;  1ALW A;  4YI9 A;  1A4P A;  2M49 B;  1N2D A;  3EK4 A;  2V53 A;  2R2I A;  1DGV A;  3D10 A;  3PM8 A;  2KFH A;  3TS5 C;  4DCK A;  1ALV A;  1C7W A;  3DF0 B;  4ETO A;  1A75 A;  4AQJ A;  1XFW O;  2JXC A;  1K96 A;  4AOM A;  5HKY A;  3DVE A;  3TDU A;  1DF0 A;  3ZNI A;  2BL0 B;  1FF1 A;  1DJX A;  4YBH B;  3EKJ A;  4PE7 A;  1EH2 A;  1W7J B;  1TCF A;  1G33 A;  1RJV A;  4I5J A;  1SYM A;  1WRZ A;  2K8M B;  1NX1 A;  1IQ5 A;  4UPG A;  4JWQ A;  4GGN A;  4ORB B;  4PDZ A;  1OMR A;  3EK8 A;  2LVK A;  1J7Q A;  1OZS A;  3CR4 X;  2KNE A;  1J7P A;  3TDI A;  2LLT A;  1LA3 A;  2PMY A;  1M46 A;  1WRK A;  1F70 A;  2OS8 B;  1BOC A;  4GGF C;  4M2O A;  5CSN A;  1QV1 A;  2FCE A;  1PVB A;  4BY5 A;  3HCM A;  1U5I A;  2MJW B;  2EHB A;  1UUS A;  2K7O A;  2O60 A;  1OMV A;  1SL8 A;  3LL8 B;  2JTT A;  1UHI A;  1NIW A;  2KDH A;  2KAY A;  1PVA A;  2L4I A;  3SIB A;  1KK8 B;  2B1U A;  1CM1 A;  2L4H A;  1DJG A;  3D0Y B;  2JWW A;  3ICB A;  2HQ8 A;  2EGD A;  5AEQ A;  5DKR A;  3O6B A;  2I7A A;  2LNK A;  1X02 A;  4HRG A;  4XYN A;  1TOP A;  1QX2 A;  1G4Y R;  2LM5 A;  3NXA A;  4C0L A;  3LK0 A;  1N0Y A;  2KQY A;  2MHH A;  5J3X A;  1V1G A;  2JZI A;  4F0Z B;  1IJ6 A;  4GFT A;  4CFQ A;  4E68 A;  2KYF A;  2F3Y A;  4I5K A;  2NCO A;  1XK4 A;  1OOJ A;  4XJK A;  1DTL A;  4YGC B;  2M8U A;  2FJU B;  1S6J A;  3EVR A;  1AHR A;  1WY9 A;  2HF5 A;  3I5I B;  1SL9 A;  2QPT A;  1K90 D;  3BUN B;  5AAN A;  2K61 A;  1KCY A;  2MLF C;  4YGB B;  2ZNE A;  1F4O A;  2OPO A;  1ZFS A;  2CT9 A;  3BUW B;  3NSL A;  2LMU A;  2HPS A;  1UHJ A;  3JVT C;  1GGZ A;  1GGW A;  1FI5 A;  1OQP A;  1SNL A;  4M2P A;  5F6T A;  1YUR A;  1QLS A;  4IL1 A;  4BY4 A;  1J1E A;  1Q80 A;  2BKH B;  1YUU A;  1A03 A;  5JOL A;  1CMF A;  3D0Y A;  2PRU A;  1KWO C;  3NSK A;  1IWQ A;  3KF9 A;  4ICB A;  3TS5 B;  2KAX A;  1CFC A;  1A75 B;  2Y5I A;  3O2P A;  1TRF A;  3IQO A;  2LCP A;  1CDM A;  2LUX A;  3DD4 A;  4HRE E;  1BT6 A;  4CLN A;  1DF0 B;  4D1E A;  5HKW A;  4YGD B;  5D69 A;  1SPY A;  2ZFD A;  2MA2 A;  3NSI A;  1UUR A;  2K7D A;  3OX5 A;  1Y1X A;  2MRD A;  4MZL A;  2WCF A;  1UHK A;  1NWD A;  1DJZ A;  3QRX A;  1JFK A;  1GQM A;  4PCW A;  3BQ3 A;  1M45 A;  1YX8 A;  2JXL A;  1TNW A;  2LMT A;  1QVI Y;  1WRL A;  2MBX A;  1IJ5 A;  1B1G A;  2IS9 A;  2Y4Q A;  2SCP A;  2L50 A;  1QLK A;  1OE9 B;  1B8C A;  3KHE A;  1EG4 A;  2KQ6 A;  2M7N A;  1BR4 B;  4U8D A;  3SJS A;  2NCP A;  1AK8 A;  1MXE A;  2E6W A;  1U5I B;  2BEC A;  1J7R A;  3WHU B;  4DS7 A;  2ZRS A;  3PN7 C;  1BR1 B;  1WLZ A;  1QTX A;  2KFG A;  1LA0 A;  5G08 A;  1JF2 A;  2EC6 C;  1AP4 A;  1B7T Y;  5B8I B;  1V1F A;  4YRU A;  1XO5 A;  1KQV A;  2KGR A;  5AXI A;  4MVF A;  4JQ0 D;  1SCM C;  3OHM B;  2L51 A;  3AKB A;  4MEW A;  3GK1 A;  5I2L A;  5JJG A;  1S5G Y;  1XFV O;  2BCB A;  3C1V A;  1RRO A;  1WDC C;  1VRK A;  4DIR A;  2JT8 A;  2PAL A;  2PSR A;  1W7I B;  5HLO A;  1K2H A;  2FCD A;  2KI4 C;  4C0J A;  4ORC B;  1M31 A;  1MXL C;  1PSR A;  1RTP 1;  4XJK B;  1B8L A;  1R6P A;  1CNP A;  1L7Z A;  2K7B A;  1ODB A;  2L5X B;  2RGI A;  4PHK A;  4QJ3 B;  1JBA A;  1CTR A;  2KI6 C;  1Y1A A;  1NYA A;  2H61 C;  1KK7 Z;  4P5O E;  2BCA A;  4PE0 A;  2HQW A;  1HT9 A;  2AAO A;  3CGA A;  3SG5 A;  3TZ1 A;  4R1E A;  1PSB A;  2H61 A;  1SY9 A;  5KU1 A;  1K9P A;  2M0R A;  1PK0 D;  1REC A;  1NUB A;  4NDD A;  2JC2 A;  4GGF A;  2WCE A;  5KSZ A;  4MSP A;  1E8A A;  3TUY C;  4QJ4 B;  2CBL A;  4PE1 A;  2FOT A;  3H4S E;  3BYA A;  1TTX A;  3OP0 A;  2G2B A;  2M1U A;  2M3W A;  3JVT B;  1QXP A;  1KFU L;  3HX4 A;  1QAS A;  1BU3 A;  2K2F A;  2K2A A;  4YGA A;  3SG6 A;  1C07 A;  1C7V A;  1XVJ A;  4MZJ A;  1S26 D;  2D8N A;  3SG7 A;  3CLN A;  1UWO A;  2GGM A;  1K94 A;  2ISD A;  2JOJ A;  1SL7 A;  2JNF A;  5HYD A;  1KWO B;  2KYC A;  1YUS A;  3BUX B;  3I5G C;  2O5G A;  4L9M A;  2M29 A;  2P6B B;  3E3R A;  1NPQ A;  1B47 A;  1FW4 A;  3NSO A;  2JT3 A;  1H8B A;  4YGE B;  2I94 A;  4MRX A;  1NSH A;  1H4B A;  1SCV A;  1KSM A;  3WNX B;  4JPZ B;  4AQI A;  1BMO A;  1QVI Z;  1EXR A;  4HRH A;  2M7L A;  4PHJ A;  3BXK A;  2GV5 A;  1NP8 A;  5CSF A;  1SK6 D;  2DOQ A;  2I2R E;  2AMI A;  2CTN A;  3SG2 A;  4WQ3 A;  4USL A;  3PFV A;  3FWB A;  4NQG A;  5GQQ C;  3ZWH A;  2CCM A;  1IRJ A;  1B7T Z;  2KGB C;  1TN4 A;  4P2Y B;  5DKN A;  1ZOT B;  3EVU A;  1A2X A;  1KK7 Y;  1N65 A;  1UP5 A;  2OTG C;  2ZND A;  3GK2 A;  3PN7 B;  1KFX L;  1F71 A;  1S5G Z;  2BCX A;  3VGO A;  1UHH A;  5BPJ A;  3VRO A;  4NDB A;  1BLQ A;  5DKQ A;  1JC2 A;  2WOS A;  1IG5 A;  1CLL A;  4GPL B;  1QAT A;  3BUM B;  3CR5 X;  3SIA A;  1KSO A;  1SCM B;  3GOF A;  1S1E A;  3DVK A;  2LLU A;  4DUQ A;  1JFJ A;  2KBM A;  4HSZ A;  1K9K A;  1TNX A;  3WHT B;  1AJ5 A;  3LLE A;  2Q91 A;  3DVJ A;  2PAS A;  1CDN A;  1WDC B;  1FI6 A;  1EJ3 A;  1S36 A;  1JUO A;  2KI4 B;  1UHN A;  1S3P A;  1MWN A;  1JF0 A; 
#chains in the Genus database with same CATH topology
 3EVV A;  4I5N B;  3IQQ A;  3K21 A;  1MF8 B;  1NCZ A;  4I5L B;  1DJW A;  4CFR A;  5K89 A;  1D1O A;  3L4A A;  2LHI A;  2M9G A;  1K8U A;  1YRT B;  3B86 A;  3GK4 X;  4PAL A;  2BBN A;  1AUI B;  3BUO B;  2JPT A;  3S0D A;  1NX2 A;  4GAO A;  4MBE A;  1DT7 B;  1RK9 A;  2F2O A;  2KBI A;  1TNP A;  3IF7 A;  1L2O C;  3O78 A;  3CS1 A;  2M1K B;  5IBW A;  1IKU A;  1OMD A;  1KQM C;  3R1O A;  3TUY B;  1F54 A;  2L98 A;  5I8N A;  3UNW A;  3VRR A;  1XFZ O;  5I2Q A;  1J55 A;  2QEH A;  2JQ6 A;  3EKH A;  2KHN A;  1M63 B;  1QV0 A;  4OCI A;  4C0K A;  1LS8 A;  1Y6W A;  2LMV A;  1CFD A;  1G8I A;  1F55 A;  3A4U B;  5PAL A;  5FYX A;  2BE4 A;  1DEK A;  2QDI A;  1QX5 B;  1RWY A;  3CTN A;  3FWC A;  4WQ2 A;  2KOT A;  5CSI A;  2F8P A;  1SR6 C;  2LVV A;  3RLZ A;  3I5G B;  1YRU B;  4GBA A;  3VRN A;  1CMG A;  3N7H A;  3KEV A;  4GNK B;  2LVJ A;  3BOW B;  3S0B A;  1SKT A;  2YGU A;  2JPO A;  3KPX A;  3OB2 B;  4N1G A;  1TNQ A;  2WCK A;  1S6I A;  1AVS A;  4PE4 A;  1DJY A;  2VRG A;  1NCY A;  2CXJ A;  2K0J A;  1MQ1 A;  5AFP A;  5HLV A;  4DRW A;  1K93 D;  2HET A;  2JT0 A;  1M39 A;  1PAL A;  1QX7 A;  2PVB A;  2WND A;  4N5X A;  3SS5 A;  1J7O A;  3CZ2 A;  2QAC A;  1IGV A;  1K9U A;  1OZO A;  4MN0 A;  4PHN A;  1SRA A;  5FI2 A;  3LCP C;  2Q4U A;  4Q04 A;  3VRP A;  3I5H C;  1XYD A;  1W9Z A;  1XFY O;  1SMG A;  1OOI X;  3DY9 A;  1SBJ A;  2H2K A;  2K7C A;  2M97 A;  3AAK A;  4ZCU A;  2BKI B;  3I5F C;  3F45 A;  4GUK A;  1CDP A;  2LAN A;  1RFJ A;  2TN4 A;  3CR2 A;  4M2Q A;  1EL4 A;  4A4C A;  1XA5 A;  2OTG B;  3OX6 A;  1DQE A;  1DJH A;  2LVI A;  4YI8 A;  2LHL A;  3JTD C;  1LIN A;  4PHM A;  3CAB A;  4MRY A;  2LUC A;  4NDC A;  4ORA B;  1JSA A;  1LKJ A;  3S0A A;  3OB1 B;  1EG3 A;  2NZ0 A;  3SG3 A;  5I2O A;  1ORG A;  2F33 A;  1QIV A;  3MSE B;  1PRW A;  1B4C A;  1AJ4 A;  1A29 A;  3BOW A;  3CZT X;  1MR8 A;  3NHI A;  4MLW A;  3PLF B;  1QJT A;  1TCO B;  3KO0 A;  1QIW A;  2ZN9 A;  1C3Y A;  5D7F A;  2Y1N A;  5HKZ A;  1FPW A;  5I94 A;  1GJY A;  4OR9 B;  4CPV A;  2E30 A;  4ZCV A;  2L2E A;  3M0W A;  1DGU A;  1JWD A;  2LLS A;  2WCJ A;  4FTG A;  1Y1U A;  5D3O A;  3SG4 A;  3DF0 A;  4QJ5 B;  3FIA A;  1NX0 A;  1XFR A;  2F2P A;  1MUX A;  2NXQ A;  1PUL A;  3O4Y A;  2BL0 C;  2KSP A;  3R72 A;  5CSJ A;  1YTZ C;  2L0P A;  1YVH A;  3LK1 A;  2MLE C;  1DMO A;  1B9A A;  2CNP A;  1L2O B;  2LP3 A;  1HQV A;  1OSA A;  3RM1 A;  3CDN A;  1BF5 A;  3AAJ A;  2KFF A;  1CKK A;  1KQM B;  2KI6 D;  1XK4 C;  2BE6 A;  3D74 A;  2JUL A;  4FQO A;  2LE9 B;  2LV7 A;  1LXF C;  4JD9 A;  1OW4 A;  5ER4 X;  2JNX A;  2KAV A;  2EC6 B;  2GTE A;  1CFP A;  4KYN A;  3CWG A;  3PSR A;  2OS8 C;  5KTY A;  1FBV A;  1YUT A;  4OVN F;  1KFU S;  1CFF A;  1T14 A;  1CDL A;  1B8R A;  1WLM A;  1NCX A;  3PAL A;  1NX3 A;  1LVC D;  2BBM A;  1SR6 B;  1TIZ A;  2PYQ A;  2AUC A;  1IQ3 A;  4A4B A;  3PAT A;  1QS7 A;  1DJI A;  4MZK A;  1ZMZ A;  1QWV A;  1KK8 C;  5AER A;  3NGV A;  1F8H A;  1XFX O;  1F4Q A;  2JU0 A;  4TNC A;  3OGN A;  2I18 A;  2MAZ A;  2WCB A;  3TDZ A;  1S6C A;  1BOD A;  1MHO A;  2SAS A;  3DYE A;  2H8V A;  1Y0V H;  1XFU O;  5ER5 A;  1ZAC A;  2P71 A;  4OKH A;  5CPV A;  1ZUZ A;  1Z2C B;  2NLN A;  3IVT A;  2JTZ A;  2ZN8 A;  1YVL A;  4CID A;  2WC8 A;  3I5H B;  1J1D A;  1CB1 A;  3D76 A;  3WXA A;  2ZRT A;  2LC5 A;  2WOR A;  1CLM A;  2G9B A;  2Y1M A;  1IH0 A;  1R2U A;  3I5F B;  1K95 A;  3A8R A;  2ZKM X;  1CLB A;  4OV2 A;  1DVI A;  2WCL A;  2JRF A;  4JKT A;  2GGZ A;  1CM4 A;  2F3Z A;  2LP2 A;  2WCM A;  3I5I C;  2COL B;  4WRI A;  1SW8 A;  1YX7 A;  3EK7 A;  3JTD B;  5TNC A;  2LAP A;  1BJF A;  4N1F A;  1KFX S;  3FS7 A;  3VRQ A;  1BG1 A;  3AKA A;  3PJI A;  1YR5 A;  3DVM A;  2A4J A;  1ALW A;  4YI9 A;  3BFB A;  3S0E A;  1A4P A;  2M49 B;  1N2D A;  3EK4 A;  2V53 A;  2R2I A;  1DGV A;  1P28 A;  3D10 A;  3PM8 A;  2KFH A;  3TS5 C;  4DCK A;  1ALV A;  1C7W A;  3DF0 B;  3B7A A;  4ETO A;  1A75 A;  3NHT A;  4AQJ A;  2KLE A;  1XFW O;  2JXC A;  1K96 A;  4AOM A;  5HKY A;  3DVE A;  3TDU A;  1DF0 A;  3ZNI A;  2BL0 B;  1IIO A;  1FF1 A;  1DJX A;  4YBH B;  3EKJ A;  4PE7 A;  1EH2 A;  1W7J B;  1TCF A;  2K60 A;  1G33 A;  1RJV A;  4I5J A;  5FI6 A;  1SYM A;  1WRZ A;  2K8M B;  1NX1 A;  1IQ5 A;  4UPG A;  4JWQ A;  4GGN A;  4ORB B;  4PDZ A;  1OMR A;  4OZD A;  3EK8 A;  2LVK A;  1J7Q A;  1OZS A;  3CR4 X;  2KNE A;  2FJY A;  3TDI A;  2LLT A;  1J7P A;  1LA3 A;  2PMY A;  1M46 A;  1WRK A;  1F70 A;  2OS8 B;  1BOC A;  4GGF C;  4M2O A;  5CSN A;  1QV1 A;  2FCE A;  1PVB A;  4BY5 A;  3HCM A;  1U5I A;  2MJW B;  2EHB A;  1UUS A;  2K7O A;  2O60 A;  1OMV A;  1SL8 A;  3LL8 B;  2JTT A;  1UHI A;  1NIW A;  2KDH A;  2KAY A;  1PVA A;  2L4I A;  3SIB A;  1KK8 B;  2B1U A;  1CM1 A;  2L4H A;  3BFH A;  1DJG A;  2BAP A;  2QEV A;  3D0Y B;  3L47 A;  4PT1 A;  2JWW A;  3ICB A;  2HQ8 A;  2EGD A;  5AEQ A;  5DKR A;  3O6B A;  2I7A A;  2LNK A;  3VB1 A;  1X02 A;  4HRG A;  4XYN A;  1TOP A;  1QX2 A;  1G4Y R;  2LM5 A;  3NXA A;  4C0L A;  3LK0 A;  1N0Y A;  2KQY A;  2MHH A;  3R1V A;  5J3X A;  1V1G A;  2JZI A;  4F0Z B;  1TWO A;  1IJ6 A;  4GFT A;  4CFQ A;  4E68 A;  2KYF A;  2F3Y A;  4I5K A;  2NCO A;  1XK4 A;  1OOJ A;  4XJK A;  3SS4 A;  1DTL A;  1OOF A;  4YGC B;  2M8U A;  2FJU B;  1S6J A;  3EVR A;  2PQL A;  1AHR A;  1WY9 A;  2HF5 A;  3I5I B;  1SL9 A;  2QPT A;  1K90 D;  3BUN B;  5AAN A;  2K61 A;  1KCY A;  3D77 A;  2MLF C;  4YGB B;  2ZNE A;  1F4O A;  2OPO A;  1ZFS A;  2CT9 A;  3BUW B;  3NSL A;  2LMU A;  2HPS A;  1UHJ A;  3JVT C;  1SSE B;  1GGZ A;  1GGW A;  1FI5 A;  1OQP A;  1SNL A;  1TUZ A;  4M2P A;  2L2C A;  5F6T A;  1YUR A;  1QLS A;  4IL1 A;  4BY4 A;  1J1E A;  1Q80 A;  2BKH B;  1YUU A;  3UO9 A;  5JOL A;  1A03 A;  2WCH A;  1CMF A;  3D0Y A;  2PRU A;  1KWO C;  3NSK A;  1IWQ A;  3KF9 A;  4ICB A;  3TS5 B;  2KAX A;  3O4X A;  1CFC A;  1A75 B;  2L5Y A;  2Y5I A;  1TRF A;  3IQO A;  3O2P A;  3V2L A;  2LCP A;  2QEO A;  1CDM A;  2LUX A;  3DD4 A;  4HRE E;  1BT6 A;  4CLN A;  1DF0 B;  4D1E A;  5HKW A;  2WC6 A;  4YGD B;  1SPY A;  2ZFD A;  5D69 A;  2MA2 A;  3NSI A;  1UUR A;  2K7D A;  4F7F A;  3Q8I A;  3OX5 A;  1Y1X A;  2MRD A;  4MZL A;  2WCF A;  1UHK A;  1NWD A;  1DJZ A;  5HL1 A;  3QRX A;  1JFK A;  1GQM A;  4PCW A;  3BQ3 A;  1DEL A;  2KPH A;  3K1E A;  1M45 A;  1YX8 A;  1C3Z A;  1TNW A;  2JXL A;  1QVI Y;  1WRL A;  2LMT A;  1IJ5 A;  2MBX A;  1B1G A;  2IS9 A;  2Y4Q A;  2SCP A;  2L50 A;  1QLK A;  1OE9 B;  1B8C A;  3KHE A;  1EG4 A;  2KQ6 A;  2M7N A;  1BR4 B;  4U8D A;  3B6X A;  3SJS A;  2NCP A;  1AK8 A;  3DZT A;  1MXE A;  2E6W A;  1U5I B;  2BEC A;  1J7R A;  3WHU B;  4DS7 A;  2ZRS A;  3OBV A;  3PN7 C;  1BR1 B;  1WLZ A;  1QTX A;  2KFG A;  1LA0 A;  5G08 A;  2WC5 A;  1JF2 A;  2EC6 C;  5EL2 A;  1AP4 A;  1B7T Y;  5B8I B;  1V1F A;  4YRU A;  1XO5 A;  1KQV A;  2KGR A;  5AXI A;  4MVF A;  4JQ0 D;  1SCM C;  3OHM B;  2L51 A;  3AKB A;  1GM0 A;  4MEW A;  3GK1 A;  5I2L A;  3SS3 A;  5JJG A;  1S5G Y;  1XFV O;  2BCB A;  3C1V A;  1RRO A;  3S0F A;  1WDC C;  1VRK A;  4DIR A;  2JT8 A;  2PAL A;  2PSR A;  1W7I B;  5HLO A;  1K2H A;  1OOH A;  2FCD A;  2KI4 C;  4C0J A;  4ORC B;  1M31 A;  1MXL C;  2KLD A;  1PSR A;  1RTP 1;  4XJK B;  1B8L A;  1R6P A;  1CNP A;  3L4L A;  1L7Z A;  2K7B A;  1ODB A;  2L5X B;  2RGI A;  3CYZ A;  4FQT A;  4PHK A;  4QJ3 B;  1JBA A;  1CTR A;  2KI6 C;  1Y1A A;  1NYA A;  2H61 C;  1KK7 Z;  4P5O E;  2BCA A;  4PE0 A;  2HQW A;  1HT9 A;  2AAO A;  3B87 A;  3CGA A;  4IJ7 A;  3SG5 A;  4R1E A;  1PSB A;  2H61 A;  1SY9 A;  3TZ1 A;  5KU1 A;  1K9P A;  2M0R A;  1PK0 D;  1REC A;  1NUB A;  4NDD A;  2JC2 A;  3R1P A;  2WCE A;  4GGF A;  5KSZ A;  4MSP A;  1E8A A;  3TUY C;  4QJ4 B;  3PM2 A;  5DIC A;  2CBL A;  4PE1 A;  2FOT A;  3H4S E;  3BYA A;  1TTX A;  3OP0 A;  2G2B A;  2M1U A;  2M3W A;  2P70 A;  3JVT B;  3FE8 A;  1QXP A;  1KFU L;  3HX4 A;  1QAS A;  1BU3 A;  2K2F A;  2K2A A;  3BFA A;  3DXL A;  4YGA A;  3SG6 A;  1C07 A;  1XVJ A;  4MZJ A;  1S26 D;  2D8N A;  3SG7 A;  3CLN A;  1UWO A;  2GGM A;  1K94 A;  2ISD A;  2JOJ A;  1SL7 A;  2JNF A;  5HYD A;  1KWO B;  2KYC A;  1Z4H A;  1YUS A;  3BUX B;  3I5G C;  2O5G A;  4L9M A;  2M29 A;  2P6B B;  3E3R A;  1NPQ A;  4INW A;  1B47 A;  1FW4 A;  3NSO A;  3B88 A;  2JT3 A;  1C7V A;  4YGE B;  2I94 A;  4MRX A;  1NSH A;  1H4B A;  1H8B A;  1SCV A;  1KSM A;  3CZ1 A;  3WNX B;  4JPZ B;  4AQI A;  1BMO A;  1QVI Z;  3EG5 B;  1EXR A;  4HRH A;  2M7L A;  4PHJ A;  3BXK A;  2GV5 A;  1NP8 A;  3S0G A;  3D78 A;  5CSF A;  1SK6 D;  2DOQ A;  2I2R E;  2AMI A;  2CTN A;  3SG2 A;  4WQ3 A;  4USL A;  3CZ0 A;  3PFV A;  1TUJ A;  3D73 A;  3FWB A;  4NQG A;  3FE9 A;  5GQQ C;  3ZWH A;  2CCM A;  1IRJ A;  1B7T Z;  2KGB C;  1TN4 A;  4P2Y B;  5DKN A;  1ZOT B;  3EVU A;  1A2X A;  1KK7 Y;  1N65 A;  1UP5 A;  2OTG C;  2ZND A;  3GK2 A;  3PN7 B;  1KFX L;  1F71 A;  1S5G Z;  1DC1 A;  2BCX A;  3BJH A;  3VGO A;  1UHH A;  1OOG A;  5BPJ A;  4INX A;  3VRO A;  4NDB A;  1BLQ A;  5DKQ A;  1JC2 A;  2WOS A;  1IG5 A;  1CLL A;  4GPL B;  3RZS A;  1QAT A;  3BUM B;  3CR5 X;  5FI7 A;  3FE6 A;  3SIA A;  1KSO A;  1SCM B;  3GOF A;  2BNX A;  1S1E A;  3DVK A;  2LLU A;  4DUQ A;  1JFJ A;  2KBM A;  4HSZ A;  1K9K A;  1TNX A;  3WHT B;  1AJ5 A;  3LLE A;  2Q91 A;  3DVJ A;  2PAS A;  1CDN A;  1WDC B;  2QEB A;  2ERB A;  1FI6 A;  1EJ3 A;  1S36 A;  1JUO A;  2KI4 B;  1UHN A;  3D75 A;  3QME A;  1S3P A;  1MWN A;  1JF0 A; 
#chains in the Genus database with same CATH homology
 3EVV A;  4I5N B;  3IQQ A;  3K21 A;  1MF8 B;  1NCZ A;  4I5L B;  1DJW A;  4CFR A;  5K89 A;  1D1O A;  2LHI A;  2M9G A;  1K8U A;  1YRT B;  3GK4 X;  4PAL A;  2BBN A;  1AUI B;  3BUO B;  2JPT A;  1NX2 A;  4GAO A;  4MBE A;  1DT7 B;  1RK9 A;  2F2O A;  2KBI A;  1TNP A;  3IF7 A;  1L2O C;  3O78 A;  3CS1 A;  2M1K B;  5IBW A;  1IKU A;  1OMD A;  1KQM C;  3TUY B;  1F54 A;  2L98 A;  5I8N A;  3VRR A;  1XFZ O;  5I2Q A;  1J55 A;  3EKH A;  2JQ6 A;  2KHN A;  1M63 B;  1QV0 A;  4OCI A;  4C0K A;  1Y6W A;  2LMV A;  1CFD A;  1G8I A;  1F55 A;  3A4U B;  5PAL A;  5FYX A;  2BE4 A;  1QX5 B;  1RWY A;  3CTN A;  3FWC A;  4WQ2 A;  2KOT A;  5CSI A;  2F8P A;  1SR6 C;  2LVV A;  3RLZ A;  3I5G B;  1YRU B;  4GBA A;  3VRN A;  1CMG A;  3KEV A;  4GNK B;  2LVJ A;  3BOW B;  1SKT A;  3KPX A;  3OB2 B;  4N1G A;  1TNQ A;  1S6I A;  1AVS A;  4PE4 A;  1DJY A;  2VRG A;  1NCY A;  2CXJ A;  2K0J A;  1MQ1 A;  5AFP A;  5HLV A;  4DRW A;  1K93 D;  2HET A;  2JT0 A;  1M39 A;  1PAL A;  1QX7 A;  2PVB A;  2WND A;  4N5X A;  1J7O A;  2QAC A;  1IGV A;  1K9U A;  1OZO A;  4MN0 A;  4PHN A;  1SRA A;  3LCP C;  2Q4U A;  4Q04 A;  3VRP A;  3I5H C;  1XYD A;  1XFY O;  1SMG A;  1SBJ A;  2H2K A;  2K7C A;  2M97 A;  3AAK A;  4ZCU A;  2BKI B;  3I5F C;  3F45 A;  4GUK A;  1CDP A;  2LAN A;  1RFJ A;  2TN4 A;  3CR2 A;  4M2Q A;  1EL4 A;  4A4C A;  1XA5 A;  2OTG B;  3OX6 A;  1DJH A;  2LVI A;  4YI8 A;  2LHL A;  3JTD C;  1LIN A;  4PHM A;  4MRY A;  2LUC A;  4NDC A;  4ORA B;  1JSA A;  1LKJ A;  3OB1 B;  1EG3 A;  2NZ0 A;  3SG3 A;  5I2O A;  2F33 A;  3MSE B;  1QIV A;  1PRW A;  1B4C A;  1AJ4 A;  1A29 A;  3BOW A;  3CZT X;  1MR8 A;  4MLW A;  3PLF B;  1QJT A;  1TCO B;  3KO0 A;  1QIW A;  2ZN9 A;  5D7F A;  2Y1N A;  5HKZ A;  1FPW A;  1GJY A;  4OR9 B;  4CPV A;  2E30 A;  4ZCV A;  2L2E A;  3M0W A;  1DGU A;  1JWD A;  2LLS A;  4FTG A;  3SG4 A;  1Y1U A;  4QJ5 B;  3DF0 A;  3FIA A;  1NX0 A;  2F2P A;  1MUX A;  2NXQ A;  1PUL A;  3O4Y A;  2BL0 C;  2KSP A;  5CSJ A;  1YTZ C;  2L0P A;  1YVH A;  3LK1 A;  2MLE C;  1DMO A;  1B9A A;  2CNP A;  1L2O B;  2LP3 A;  1HQV A;  1OSA A;  3RM1 A;  1BF5 A;  3AAJ A;  2KFF A;  1CKK A;  1KQM B;  2KI6 D;  1XK4 C;  2BE6 A;  2JUL A;  4FQO A;  2LE9 B;  2LV7 A;  1LXF C;  5ER4 X;  2JNX A;  2KAV A;  2EC6 B;  1CFP A;  3CWG A;  3PSR A;  2OS8 C;  5KTY A;  1FBV A;  1YUT A;  4OVN F;  1KFU S;  1CFF A;  1CDL A;  1B8R A;  1WLM A;  1NCX A;  3PAL A;  1NX3 A;  1LVC D;  2BBM A;  1SR6 B;  1TIZ A;  2AUC A;  1IQ3 A;  4A4B A;  3PAT A;  1QS7 A;  1DJI A;  4MZK A;  1ZMZ A;  1KK8 C;  5AER A;  1F8H A;  1XFX O;  1F4Q A;  2JU0 A;  4TNC A;  2I18 A;  2MAZ A;  2WCB A;  3TDZ A;  1S6C A;  1BOD A;  1MHO A;  2SAS A;  1Y0V H;  1XFU O;  5ER5 A;  1ZAC A;  5CPV A;  4OKH A;  1ZUZ A;  2NLN A;  2JTZ A;  2ZN8 A;  1YVL A;  4CID A;  2WC8 A;  3I5H B;  1J1D A;  1CB1 A;  3WXA A;  2ZRT A;  2LC5 A;  2WOR A;  1CLM A;  2G9B A;  2Y1M A;  1IH0 A;  1R2U A;  3I5F B;  1K95 A;  3A8R A;  2ZKM X;  1CLB A;  4OV2 A;  1DVI A;  2JRF A;  2GGZ A;  1CM4 A;  2F3Z A;  2LP2 A;  3I5I C;  2COL B;  4WRI A;  1SW8 A;  1YX7 A;  3EK7 A;  3JTD B;  5TNC A;  2LAP A;  1BJF A;  4N1F A;  1KFX S;  3FS7 A;  3VRQ A;  1BG1 A;  3AKA A;  1YR5 A;  3DVM A;  2A4J A;  1ALW A;  4YI9 A;  1A4P A;  2M49 B;  1N2D A;  3EK4 A;  2V53 A;  2R2I A;  1DGV A;  3D10 A;  3PM8 A;  2KFH A;  3TS5 C;  4DCK A;  1ALV A;  1C7W A;  3DF0 B;  4ETO A;  1A75 A;  4AQJ A;  1XFW O;  2JXC A;  1K96 A;  4AOM A;  5HKY A;  3DVE A;  3TDU A;  1DF0 A;  3ZNI A;  2BL0 B;  1FF1 A;  1DJX A;  4YBH B;  3EKJ A;  4PE7 A;  1EH2 A;  1W7J B;  1TCF A;  1G33 A;  1RJV A;  4I5J A;  1SYM A;  1WRZ A;  2K8M B;  1NX1 A;  1IQ5 A;  4UPG A;  4JWQ A;  4GGN A;  4ORB B;  4PDZ A;  1OMR A;  3EK8 A;  2LVK A;  1J7Q A;  1OZS A;  3CR4 X;  2KNE A;  1J7P A;  3TDI A;  2LLT A;  1LA3 A;  2PMY A;  1M46 A;  1WRK A;  1F70 A;  2OS8 B;  1BOC A;  4GGF C;  4M2O A;  5CSN A;  1QV1 A;  2FCE A;  1PVB A;  4BY5 A;  3HCM A;  1U5I A;  2MJW B;  2EHB A;  1UUS A;  2K7O A;  2O60 A;  1OMV A;  1SL8 A;  3LL8 B;  2JTT A;  1UHI A;  1NIW A;  2KDH A;  2KAY A;  1PVA A;  2L4I A;  3SIB A;  1KK8 B;  2B1U A;  1CM1 A;  2L4H A;  1DJG A;  3D0Y B;  2JWW A;  3ICB A;  2HQ8 A;  2EGD A;  5AEQ A;  5DKR A;  3O6B A;  2I7A A;  2LNK A;  1X02 A;  4HRG A;  4XYN A;  1TOP A;  1QX2 A;  1G4Y R;  2LM5 A;  3NXA A;  4C0L A;  3LK0 A;  1N0Y A;  2KQY A;  2MHH A;  5J3X A;  1V1G A;  2JZI A;  4F0Z B;  1IJ6 A;  4GFT A;  4CFQ A;  4E68 A;  2KYF A;  2F3Y A;  4I5K A;  2NCO A;  1XK4 A;  1OOJ A;  4XJK A;  1DTL A;  4YGC B;  2M8U A;  2FJU B;  1S6J A;  3EVR A;  1AHR A;  1WY9 A;  2HF5 A;  3I5I B;  1SL9 A;  2QPT A;  1K90 D;  3BUN B;  5AAN A;  2K61 A;  1KCY A;  2MLF C;  4YGB B;  2ZNE A;  1F4O A;  2OPO A;  1ZFS A;  2CT9 A;  3BUW B;  3NSL A;  2LMU A;  2HPS A;  1UHJ A;  3JVT C;  1GGZ A;  1GGW A;  1FI5 A;  1OQP A;  1SNL A;  4M2P A;  5F6T A;  1YUR A;  1QLS A;  4IL1 A;  4BY4 A;  1J1E A;  1Q80 A;  2BKH B;  1YUU A;  1A03 A;  5JOL A;  1CMF A;  3D0Y A;  2PRU A;  1KWO C;  3NSK A;  1IWQ A;  3KF9 A;  4ICB A;  3TS5 B;  2KAX A;  1CFC A;  1A75 B;  2Y5I A;  3O2P A;  1TRF A;  3IQO A;  2LCP A;  1CDM A;  2LUX A;  3DD4 A;  4HRE E;  1BT6 A;  4CLN A;  1DF0 B;  4D1E A;  5HKW A;  4YGD B;  5D69 A;  1SPY A;  2ZFD A;  2MA2 A;  3NSI A;  1UUR A;  2K7D A;  3OX5 A;  1Y1X A;  2MRD A;  4MZL A;  2WCF A;  1UHK A;  1NWD A;  1DJZ A;  3QRX A;  1JFK A;  1GQM A;  4PCW A;  3BQ3 A;  1M45 A;  1YX8 A;  2JXL A;  1TNW A;  2LMT A;  1QVI Y;  1WRL A;  2MBX A;  1IJ5 A;  1B1G A;  2IS9 A;  2Y4Q A;  2SCP A;  2L50 A;  1QLK A;  1OE9 B;  1B8C A;  3KHE A;  1EG4 A;  2KQ6 A;  2M7N A;  1BR4 B;  4U8D A;  3SJS A;  2NCP A;  1AK8 A;  1MXE A;  2E6W A;  1U5I B;  2BEC A;  1J7R A;  3WHU B;  4DS7 A;  2ZRS A;  3PN7 C;  1BR1 B;  1WLZ A;  1QTX A;  2KFG A;  1LA0 A;  5G08 A;  1JF2 A;  2EC6 C;  1AP4 A;  1B7T Y;  5B8I B;  1V1F A;  4YRU A;  1XO5 A;  1KQV A;  2KGR A;  5AXI A;  4MVF A;  4JQ0 D;  1SCM C;  3OHM B;  2L51 A;  3AKB A;  4MEW A;  3GK1 A;  5I2L A;  5JJG A;  1S5G Y;  1XFV O;  2BCB A;  3C1V A;  1RRO A;  1WDC C;  1VRK A;  4DIR A;  2JT8 A;  2PAL A;  2PSR A;  1W7I B;  5HLO A;  1K2H A;  2FCD A;  2KI4 C;  4C0J A;  4ORC B;  1M31 A;  1MXL C;  1PSR A;  1RTP 1;  4XJK B;  1B8L A;  1R6P A;  1CNP A;  1L7Z A;  2K7B A;  1ODB A;  2L5X B;  2RGI A;  4PHK A;  4QJ3 B;  1JBA A;  1CTR A;  2KI6 C;  1Y1A A;  1NYA A;  2H61 C;  1KK7 Z;  4P5O E;  2BCA A;  4PE0 A;  2HQW A;  1HT9 A;  2AAO A;  3CGA A;  3SG5 A;  3TZ1 A;  4R1E A;  1PSB A;  2H61 A;  1SY9 A;  5KU1 A;  1K9P A;  2M0R A;  1PK0 D;  1REC A;  1NUB A;  4NDD A;  2JC2 A;  4GGF A;  2WCE A;  5KSZ A;  4MSP A;  1E8A A;  3TUY C;  4QJ4 B;  2CBL A;  4PE1 A;  2FOT A;  3H4S E;  3BYA A;  1TTX A;  3OP0 A;  2G2B A;  2M1U A;  2M3W A;  3JVT B;  1QXP A;  1KFU L;  3HX4 A;  1QAS A;  1BU3 A;  2K2F A;  2K2A A;  4YGA A;  3SG6 A;  1C07 A;  1C7V A;  1XVJ A;  4MZJ A;  1S26 D;  2D8N A;  3SG7 A;  3CLN A;  1UWO A;  2GGM A;  1K94 A;  2ISD A;  2JOJ A;  1SL7 A;  2JNF A;  5HYD A;  1KWO B;  2KYC A;  1YUS A;  3BUX B;  3I5G C;  2O5G A;  4L9M A;  2M29 A;  2P6B B;  3E3R A;  1NPQ A;  1B47 A;  1FW4 A;  3NSO A;  2JT3 A;  1H8B A;  4YGE B;  2I94 A;  4MRX A;  1NSH A;  1H4B A;  1SCV A;  1KSM A;  3WNX B;  4JPZ B;  4AQI A;  1BMO A;  1QVI Z;  1EXR A;  4HRH A;  2M7L A;  4PHJ A;  3BXK A;  2GV5 A;  1NP8 A;  5CSF A;  1SK6 D;  2DOQ A;  2I2R E;  2AMI A;  2CTN A;  3SG2 A;  4WQ3 A;  4USL A;  3PFV A;  3FWB A;  4NQG A;  5GQQ C;  3ZWH A;  2CCM A;  1IRJ A;  1B7T Z;  2KGB C;  1TN4 A;  4P2Y B;  5DKN A;  1ZOT B;  3EVU A;  1A2X A;  1KK7 Y;  1N65 A;  1UP5 A;  2OTG C;  2ZND A;  3GK2 A;  3PN7 B;  1KFX L;  1F71 A;  1S5G Z;  2BCX A;  3VGO A;  1UHH A;  5BPJ A;  3VRO A;  4NDB A;  1BLQ A;  5DKQ A;  1JC2 A;  2WOS A;  1IG5 A;  1CLL A;  4GPL B;  1QAT A;  3BUM B;  3CR5 X;  3SIA A;  1KSO A;  1SCM B;  3GOF A;  1S1E A;  3DVK A;  2LLU A;  4DUQ A;  1JFJ A;  2KBM A;  4HSZ A;  1K9K A;  1TNX A;  3WHT B;  1AJ5 A;  3LLE A;  2Q91 A;  3DVJ A;  2PAS A;  1CDN A;  1WDC B;  1FI6 A;  1EJ3 A;  1S36 A;  1JUO A;  2KI4 B;  1UHN A;  1S3P A;  1MWN A;  1JF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...