3TS5C

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
KLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 49
structure length 152
sequence length 152
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5C02
2K2FA 1BT6A 2KYFA 2V53A 4A4CA 4CLNA 5B8IB 1Y6WA 2VRGA 2LP3A 3FWCA 1NWDA 4QJ4B 2JTTA 1EG3A 1S26D 1QX2A 1BJFA 4GUKA 4PHMA 5KSZA 2AMIA 3DVKA 1PVAA 1G33A 1IH0A 1MR8A 1FBVA 4ZCVA 5HKWA 2KAYA 3TUYC 1QV1A 3DVEA 1AP4A 1UUSA 3AAKA 3CTNA 1B8LA 4U8DA 2PALA 3I5IC 1DT7B 2R2IA 1S1EA 5D7FA 1MXLC 1XO5A 1JF2A 1KK7Y 3IF7A 3E3RA 1CFDA 1K9PA 1S36A 1LXFC 1MWNA 1NIWA 1NX2A 2HETA 4FTGA 5CSFA 3I5GC 3OP0A 2LANA 3MSEB 3OB1B 3GK2A 1KQMB 4NDCA 3C1VA 2GGZA 1UURA 3OB2B 4I5JA 3CR2A 5DKQA 2K7BA 3ICBA 4AQJA 1UHJA 5AFPA 2BCBA 2ZRSA 1S5GY 1QVIZ 1YURA 2BE6A 4QJ3B 2BE4A 3KEVA 5BPJA 1S6CA 2HPSA 3D0YB 1J7RA 3PLFB 2WNDA 2JZIA 5JOLA 1F4OA 2E30A 4YGDB 5IBWA 3PSRA 1A2XA 2M1UA 2CXJA 1Y1XA 2G2BA 1SMGA 1F4QA 3TUYB 1L2OB 2GV5A 1TNQA 4MLWA 3NSKA 3WNXB 1Y1UA 1QS7A 3I5IB 2ZNEA 2NLNA 3EK4A 2M29A 1V1GA 1R2UA 3IQQA 3DF0A 3HCMA 3NSOA 1YVHA 1CFCA 1NPQA 2BL0B 1ALWA 1YVLA 1C07A 1NCZA 2KI6C 3O6BA 1BG1A 1YX7A 2LMUA 5TNCA 2WCEA 1DF0A 1SR6C 2SASA 3RM1A 4F0ZB 1ZOTB 2L5XB 2JXLA 3D0YA 3I5GB 5I8NA 3CWGA 1TIZA 1QV0A 1XFVO 2FCDA 3H4SE 1IJ6A 2KGRA 2PASA 1B47A 2MBXA 4D1EA 2TN4A 1IJ5A 2K0JA 1RFJA 4WRIA 1WRKA 3TDZA 3LCPC 3SJSA 3EVVA 2HQ8A 1KFUL 2Y5IA 2M97A 1TNXA 4OCIA 3CR4X 2KOTA 1BU3A 2MJWB 5D69A 1DVIA 3PFVA 4BY4A 5AEQA 5GQQC 1RWYA 2BKHB 3BUWB 1K8UA 2EC6C 4N1GA 2Q4UA 3SG5A 3NSIA 2JOJA 1B1GA 1CB1A 1BMOA 1XFUO 3SG2A 3QRXA 1TNPA 2B1UA 3F45A 4L9MA 4N1FA 1JF0A 2LC5A 1CFFA 1J7OA 1IGVA 4GBAA 2KI4B 2AUCA 4XJKA 3EVRA 1NX1A 4MSPA 2NXQA 1JFKA 3OX5A 3VROA 2KAVA 3EKJA 1A75A 2M7LA 1UHHA 3PALA 1SR6B 1CFPA 3WXAA 1S6JA 2BCXA 1SRAA 3OHMB 4M2OA 1V1FA 2KQYA 1AJ4A 4CPVA 1N2DA 1OMRA 1NSHA 2FCEA 2H61C 3EVUA 2LV7A 3DVJA 1H4BA 3VGOA 5HLVA 3IQOA 2WC8A 2EC6B 1EXRA 1AUIB 1YUSA 2F3YA 4ZCUA 2LVJA 2ZN8A 1SL9A 2K7OA 5AERA 1OMVA 1CNPA 3EKHA 1PSRA 1CLBA 2Y1MA 1S6IA 4I5LB 3BUXB 2KFHA 1KFUS 1CKKA 2LHIA 1TOPA 2OTGC 5ER4X 1B7TY 1KFXL 1TCFA 3KF9A 1UHIA 3SG7A 2LLUA 2BCAA 1CDNA 4MRYA 1J1DA 2NZ0A 4E68A 1IG5A 1U5IA 1K2HA 1Y0VH 4PCWA 1EG4A 1SL7A 1TNWA 5DKNA 3EK7A 2M8UA 1FPWA 2PVBA 4ORAB 4PHNA 4C0KA 2JT3A 1XYDA 2KBMA 1MXEA 3SG6A 3O2PA 2K7DA 1YR5A 4PHJA 1OZSA 1BF5A 1QJTA 3AKAA 2L0PA 2A4JA 3SIBA 1XFWO 2PMYA 1XK4C 2Y1NA 5AANA 4DS7A 2KQ6A 1TN4A 2H2KA 2JPTA 4I5KA 1Q80A 3NXAA 1CLLA 4AOMA 4PE4A 1B4CA 2LLTA 3BUMB 4BY5A 1JWDA 4ORBB 1KK8C 1S3PA 4GGFA 4GPLB 1H8BA 1QXPA 1KCYA 2BKIB 5PALA 2LCPA 3PATA 2MLEC 1X02A 1ALVA 1WLMA 2K2AA 2OTGB 2JT0A 2WOSA 1NX3A 4GGNA 3A4UB 2L98A 1QX7A 2MAZA 1J7QA 4CIDA 3FWBA 1W7JB 2M7NA 4OKHA 3TDIA 4M2PA 2I18A 1YUUA 1OSAA 1LA0A 2JWWA 2BBMA 4USLA 2PSRA 2BECA 2WCFA 3M0WA 3WHTB 4WQ2A 2LE9B 2SCPA 1DGUA 1N0YA 5J3XA 4MBEA 4WQ3A 3FS7A 3TDUA 1JBAA 2CTNA 2ISDA 4UPGA 1KSMA 1QIWA 1KFXS 1JC2A 2KSPA 3BUNB 2Y4QA 2LAPA 4MZLA 3NSLA 3PN7C 1M63B 1ZFSA 2LP2A 1ZMZA 4FQOA 2KYCA 3VRQA 1AJ5A 1NCXA 1ZACA 4CFRA 1CDPA 3PM8A 1XA5A 3LK0A 1KK8B 4MVFA 5I2LA 4Q04A 4OVNF 2P6BB 4XYNA 1PK0D 2WCBA 1NP8A 1FF1A 1DJIA 3A8RA 3HX4A 2FOTA 1XFXO 2LM5A 2LMTA 3BUOB 3I5FC 5ER5A 2JRFA 1EH2A 3I5HC 1NCYA 2JC2A 1SCVA 2O60A 1QVIY 4PHKA 1K95A 2M9GA 1SL8A 1Y1AA 3VRNA 1K90D 5FYXA 4ORCB 1DJXA 4OV2A 3WHUB 2KI6D 1UHNA 2NCOA 1B8CA 1QLKA 1SW8A 2BBNA 2EHBA 1F55A 1DJWA 3JTDC 1QLSA 2IS9A 4TNCA 1WY9A 1WLZA 2M49B 4YI9A 3VRRA 1J7PA 1SNLA 2JNXA 1W7IB 1XFZO 4R1EA 1K93D 2CNPA 1KK7Z 1BLQA 1CMGA 1M45A 2QACA 3SG3A 2FJUB 1KWOC 1YUTA 2OS8C 4NQGA 3PN7B 1KSOA 2COLB 4YGEB 1B8RA 4YI8A 1SYMA 4HREE 1QTXA 1TCOB 2JULA 1CM1A 3TZ1A 2F2OA 3CS1A 1BR4B 2GGMA 1RROA 3JVTC 1YRUB 5F6TA 1AHRA 3FIAA 2I94A 1OOJA 1S5GZ 3I5FB 1IQ5A 3KPXA 3BOWB 4IL1A 2MHHA 1LINA 3I5HB 4DCKA 4N5XA 1K9KA 2JU0A 1D1OA 1CLMA 3CGAA 4GNKB 2ZRTA 5HKYA 2DOQA 4NDDA 2LVKA 1IRJA 1L7ZA 4PE7A 2D8NA 3JTDB 2I2RE 1AK8A 5I2QA 1LA3A 1RK9A 3O78A 2KGBC 1PALA 3GK1A 1N65A 1QATA 1ZUZA 3VRPA 5HYDA 4M2QA 1SBJA 5DKRA 2OPOA 2CT9A 1JSAA 4ICBA 1C7WA 1YX8A 1UWOA 1KWOB 2OS8B 1NUBA 2KNEA 2KHNA 3BOWA 1CDMA 1FI6A 4JWQA 1SY9A 1YRTB 1HQVA 1BR1B 1K96A 1L2OC 2I7AA 2L2EA 3EK8A 5CSIA 1OQPA 2EGDA 1AVSA 2MA2A 2Q91A 1FI5A 1F70A 3JVTB 4MRXA 4YRUA 3GOFA 3TS5C 2F33A 1E8AA 1PSBA 2BL0C 2ZN9A 1PULA 4YGBB 1C7VA 5KTYA 2ZKMX 1HT9A 1QIVA 1MQ1A 2LMVA 2M3WA 2F3ZA 4JPZB 1DMOA 2HF5A 2JTZA 1G8IA 2KBIA 2LUXA 3RLZA 4C0LA 1IQ3A 2ZFDA 3D10A 5JJGA 2JQ6A 3LL8B 4HRGA 1EL4A 3DF0B 1JFJA 2H61A 3DD4A 1PVBA 4PE0A 1J1EA 2MRDA 1F71A 2PRUA 4HRHA 1R6PA 4DIRA 4JQ0D 1A29A 5G08A 1DF0B 5CSJA 4MZJA 1GJYA 2KFGA 1B9AA 1KQVA 1GGZA 3SG4A 3O4YA 2F8PA 1SKTA 2L50A 2LVVA 1WDCC 4QJ5B 1SPYA 3AAJA 2L4IA 1GQMA 4MN0A 2L4HA 2CBLA 4GAOA 3GK4X 4I5NB 4PE1A 4PDZA 2LHLA 4ETOA 2G9BA 4DRWA 3BXKA 2KI4C 2K7CA 1BODA 4DUQA 1LVCD 3TS5B 1MHOA 1NX0A 1TTXA 1RJVA 2RGIA 4P5OE 4CFQA 2L51A 4NDBA 3ZWHA 1DJHA 1QX5B 2M1KB 1M39A 1MUXA 1JUOA 2KAXA 2K8MB 1NYAA 3KO0A 1YTZC 2M0RA 3OX6A 1DTLA 5HLOA 1BOCA 4XJKB 3CZTX 5K89A 2HQWA 5AXIA 4MZKA 1DJGA 1OMDA 3K21A 4C0JA 2AAOA 2ZNDA 1UP5A 4MEWA 1UHKA 1TRFA 1A75B 1EJ3A 3ZNIA 1QASA 2JXCA 1MF8B 1WRLA 4GFTA 1SCMC 2WORA 1XK4A 2JNFA 1FW4A 1B7TZ 2O5GA 4OR9B 3KHEA 3AKBA 5CPVA 2CCMA 2MLFC 1M31A 4AQIA 4A4BA 2LLSA 1WDCB 1A03A 4YBHB 2KFFA 1WRZA 4YGAA 5CSNA 1CMFA 4YGCB 1IWQA 1RTP1 1OZOA 4PALA 1SK6D 3DVMA 3CLNA 1IKUA 3BQ3A 4HSZA 1F8HA 2K61A 1M46A 2LNKA 5KU1A 1PRWA 1A4PA 2LVIA 2NCPA 1GGWA 4GGFC 1VRKA 1OE9B 2QPTA 5I2OA 4P2YB 2KDHA 1DGVA 1DJZA 3LK1A 1K94A 1F54A 3LLEA 3SIAA 5HKZA 1K9UA 2E6WA 2LUCA 1CTRA 1XVJA 1J55A 1G4YR 1CM4A 1KQMC 2F2PA 1LKJA 1XFYO 3BYAA 1SCMB 1ODBA 3CR5X 1CDLA 1RECA 1U5IB 1DJYA 2JT8A
chains in the Genus database with same CATH superfamily
2WC5A 2K2FA 1BT6A 2KPHA 2KYFA 2V53A 4A4CA 4CLNA 2GTEA 3K1EA 5B8IB 1Y6WA 2VRGA 3B6XA 2LP3A 3FWCA 1NWDA 4QJ4B 2JTTA 1EG3A 1S26D 1QX2A 1BJFA 4GUKA 4PHMA 5KSZA 2AMIA 3DVKA 1PVAA 3D78A 1G33A 1IH0A 1MR8A 1FBVA 4ZCVA 5HKWA 2KAYA 3TUYC 1QV1A 3DVEA 1AP4A 1UUSA 3AAKA 3CTNA 1B8LA 3R1VA 2PALA 3I5IC 4U8DA 3SIBA 1DT7B 3D73A 2R2IA 1S1EA 2QEHA 5D7FA 1MXLC 1XO5A 5FI2A 1JF2A 1KK7Y 3IF7A 3E3RA 1CFDA 1K9PA 1TWOA 1S36A 1LXFC 1MWNA 1NIWA 1NX2A 2WCHA 2HETA 4FTGA 5CSFA 3I5GC 3OP0A 2LANA 3S0FA 3MSEB 3OB1B 3GK2A 1KQMB 4NDCA 3C1VA 2GGZA 1UURA 3OB2B 4I5JA 1DEKA 3PM2A 3CR2A 5DKQA 2K7BA 3ICBA 4AQJA 1UHJA 2PQLA 2BCBA 2ZRSA 1S5GY 5AFPA 1QVIZ 1YURA 2BE6A 4QJ3B 2BE4A 3KEVA 5BPJA 1S6CA 2HPSA 3D0YB 1J7RA 3PLFB 2WNDA 2JZIA 5JOLA 1F4OA 3VB1A 2E30A 4YGDB 5IBWA 3PSRA 1A2XA 2M1UA 2KLEA 2CXJA 1Y1XA 2G2BA 1SMGA 1F4QA 3TUYB 1L2OB 2GV5A 1TNQA 4MLWA 2QEOA 3NSKA 3WNXB 1Y1UA 2KLDA 1QS7A 1T14A 3I5IB 2ZNEA 2NLNA 3EK4A 2M29A 1V1GA 1R2UA 3DY9A 3DF0A 3HCMA 3IQQA 1YVHA 3NSOA 1CFCA 1NPQA 2BL0B 1ALWA 1YVLA 1C07A 1NCZA 2KI6C 3O6BA 1BG1A 1YX7A 2LMUA 3QMEA 5TNCA 2WCEA 1DF0A 1SR6C 2QDIA 2SASA 3RM1A 1ZOTB 2L5XB 2JXLA 3D0YA 1DELA 2FJYA 3I5GB 1Z4HA 3CWGA 1TIZA 1QV0A 1XFVO 2FCDA 3H4SE 1IJ6A 2KGRA 2PASA 1B47A 2MBXA 4D1EA 2TN4A 1IJ5A 1OOGA 1RFJA 2K0JA 4WRIA 1WRKA 3TDZA 3LCPC 3SJSA 1C3YA 3EVVA 2HQ8A 1KFUL 2Y5IA 2M97A 1TNXA 3PJIA 4OCIA 3CR4X 2QEVA 2KOTA 1BU3A 2MJWB 5D69A 1DVIA 3PFVA 4BY4A 5AEQA 5GQQC 1RWYA 2BKHB 3BUWB 1K8UA 3DYEA 2EC6C 4N1GA 2Q4UA 3SG5A 3NSIA 2JOJA 1B1GA 1CB1A 1BMOA 1XFUO 3L4AA 3SG2A 3R1PA 3QRXA 1TNPA 2B1UA 3F45A 4L9MA 4N1FA 1JF0A 2LC5A 1CFFA 3B86A 1IIOA 5HL1A 1IGVA 1J7OA 4GBAA 2KI4B 2AUCA 4XJKA 3BFBA 3EVRA 1NX1A 4MSPA 2NXQA 1JFKA 3OX5A 3VROA 2KAVA 3D74A 3EKJA 1A75A 3N7HA 2M7LA 1UHHA 3PALA 1SR6B 3OGNA 1CFPA 3WXAA 3B7AA 1S6JA 2BCXA 1SRAA 3OHMB 4M2OA 1V1FA 2P70A 2KQYA 3CABA 1AJ4A 4CPVA 1N2DA 1OMRA 1NSHA 2FCEA 2H61C 3EVUA 2LV7A 3DVJA 1H4BA 2WCJA 5I8NA 3VGOA 1ORGA 5HLVA 3IQOA 3IVTA 3R1OA 2WC8A 3UO9A 2EC6B 1EXRA 1AUIB 1YUSA 2F3YA 4ZCUA 1SSEB 2LVJA 2ZN8A 1SL9A 2K7OA 5AERA 1OMVA 1CNPA 3EKHA 3NHIA 1PSRA 1CLBA 2Y1MA 1S6IA 4I5LB 3BUXB 2KFHA 1KFUS 1CKKA 2LHIA 1TOPA 2OTGC 5ER4X 2H8VA 1B7TY 1KFXL 1TCFA 3KF9A 1UHIA 3SG7A 2LLUA 2BCAA 1CDNA 1GM0A 4MRYA 1J1DA 2NZ0A 4E68A 1IG5A 1U5IA 1K2HA 1Y0VH 4PCWA 1EG4A 1SL7A 1TNWA 3L47A 5DKNA 5FI7A 3EK7A 2M8UA 1FPWA 2PVBA 4ORAB 3OBVA 4PHNA 4C0KA 2JT3A 1XYDA 2KBMA 1MXEA 3SG6A 3O2PA 2K7DA 1YR5A 4PHJA 1OZSA 4KYNA 1BF5A 1QJTA 3AKAA 2L0PA 2A4JA 3O4XA 1XFWO 2PMYA 2PYQA 1XK4C 2P71A 2Y1NA 3Q8IA 5AANA 4DS7A 2KQ6A 3D76A 1TN4A 2H2KA 2JPTA 4I5KA 1Q80A 3L4LA 3NXAA 3V2LA 1QWVA 1CLLA 4AOMA 4PE4A 1B4CA 2LLTA 2WCKA 3BUMB 4BY5A 1OOFA 1JWDA 4ORBB 1KK8C 1S3PA 4GGFA 4GPLB 1H8BA 1QXPA 1KCYA 2BKIB 5PALA 2LCPA 3D77A 2MLEC 3PATA 1X02A 3UNWA 1ALVA 1WLMA 2K2AA 2OTGB 2JT0A 2WOSA 1NX3A 4GGNA 3A4UB 3S0BA 2L98A 1QX7A 2MAZA 2YGUA 1J7QA 4CIDA 3FWBA 1OW4A 1W7JB 2M7NA 3D75A 4OKHA 3TDIA 4M2PA 1DC1A 2I18A 1YUUA 1OSAA 1LA0A 2JWWA 2BBMA 4USLA 2PSRA 2BECA 1Z2CB 2QEBA 2WCFA 3M0WA 3WHTB 4WQ2A 2LE9B 2SCPA 1DGUA 1N0YA 1XFRA 5J3XA 4MBEA 4WQ3A 3CDNA 3FS7A 3TDUA 1OOHA 1JBAA 2CTNA 2ISDA 4UPGA 1KSMA 1QIWA 1KFXS 1JC2A 2KSPA 3BUNB 2Y4QA 2LAPA 4OZDA 4MZLA 3NSLA 3PN7C 3S0GA 2JPOA 1M63B 1ZFSA 2LP2A 1ZMZA 4FQOA 2KYCA 3B88A 3FE6A 3VRQA 1AJ5A 1NCXA 1ZACA 2BAPA 4CFRA 1CDPA 3PM8A 1XA5A 3LK0A 1KK8B 4MVFA 5I2LA 4Q04A 4OVNF 2P6BB 4XYNA 1PK0D 2WCBA 1NP8A 1FF1A 1DJIA 3A8RA 3HX4A 2FOTA 1XFXO 2LM5A 2LMTA 3BUOB 3I5FC 5ER5A 2JRFA 1EH2A 3I5HC 1NCYA 2JC2A 1SCVA 2O60A 1QVIY 4PHKA 1K95A 2M9GA 1SL8A 1Y1AA 4INXA 3VRNA 1K90D 5FYXA 4ORCB 1DJXA 4OV2A 3WHUB 2KI6D 1UHNA 2NCOA 1B8CA 1QLKA 1SW8A 2BBNA 2EHBA 1F55A 1DJWA 3JTDC 1QLSA 2IS9A 4TNCA 1WY9A 1WLZA 2M49B 4YI9A 3VRRA 1J7PA 1SNLA 2JNXA 2WCMA 1W7IB 1XFZO 4R1EA 1K93D 1KK7Z 2CNPA 1BLQA 1CMGA 1M45A 2QACA 3SG3A 2FJUB 2BNXA 1KWOC 1YUTA 2OS8C 3NGVA 4NQGA 2WCLA 3PN7B 1KSOA 2COLB 4YGEB 1B8RA 4YI8A 1SYMA 4HREE 1QTXA 1TCOB 2JULA 1CM1A 3TZ1A 2F2OA 3CS1A 1BR4B 2GGMA 1RROA 3JVTC 1YRUB 5F6TA 1AHRA 3FIAA 2I94A 1OOJA 1S5GZ 3I5FB 1IQ5A 3KPXA 3BOWB 4IL1A 2MHHA 1LINA 3I5HB 1DQEA 4DCKA 4N5XA 1K9KA 2JU0A 1D1OA 1CLMA 3CGAA 3EG5B 4GNKB 2ZRTA 5HKYA 2DOQA 4NDDA 2LVKA 1IRJA 4JKTA 1L7ZA 4PE7A 2D8NA 3JTDB 2I2RE 1AK8A 5I2QA 1LA3A 1RK9A 3S0DA 3O78A 2KGBC 1PALA 3GK1A 1N65A 1QATA 1ZUZA 3VRPA 5HYDA 4M2QA 1SBJA 5DKRA 2OPOA 2CT9A 1JSAA 4ICBA 1C7WA 1YX8A 1UWOA 1KWOB 2OS8B 1NUBA 2KNEA 2KHNA 3BOWA 1CDMA 3B87A 4JWQA 1FI6A 1SY9A 1YRTB 1HQVA 1BR1B 1K96A 1L2OC 2I7AA 2L2EA 3EK8A 3CZ2A 1OQPA 5CSIA 2EGDA 1AVSA 2MA2A 2Q91A 1FI5A 4FQTA 3JVTB 4MRXA 4YRUA 1F70A 1LS8A 3GOFA 3TS5C 2F33A 1E8AA 1PSBA 2BL0C 2ZN9A 1PULA 4YGBB 4F0ZB 1C7VA 5KTYA 2ZKMX 1HT9A 1QIVA 1MQ1A 2LMVA 2M3WA 2F3ZA 4JPZB 1DMOA 2HF5A 2JTZA 1G8IA 2KBIA 2LUXA 3RLZA 4C0LA 1IQ3A 2ZFDA 3D10A 5JJGA 2JQ6A 3LL8B 4HRGA 1EL4A 3DF0B 5FI6A 1JFJA 2H61A 3DD4A 1PVBA 4PE0A 1J1EA 2MRDA 1F71A 2PRUA 4HRHA 1R6PA 4DIRA 4JQ0D 1A29A 5G08A 1DF0B 5CSJA 4MZJA 1GJYA 2KFGA 1B9AA 1KQVA 4F7FA 1GGZA 3SG4A 3O4YA 2F8PA 4IJ7A 2ERBA 1SKTA 3BFHA 2L50A 2LVVA 1WDCC 4QJ5B 1SPYA 1P28A 2L4IA 1GQMA 3AAJA 3BJHA 2L4HA 4MN0A 2CBLA 4GAOA 3GK4X 4I5NB 4PE1A 4PDZA 2LHLA 4ETOA 2G9BA 4DRWA 3BXKA 2KI4C 2K7CA 3CYZA 1W9ZA 1BODA 4DUQA 1LVCD 3NHTA 3TS5B 1MHOA 1NX0A 1TTXA 1TUJA 1RJVA 2RGIA 4P5OE 4CFQA 2L51A 4NDBA 3ZWHA 2L2CA 3DXLA 1DJHA 1QX5B 2M1KB 1M39A 1MUXA 1JUOA 3S0AA 2KAXA 2K8MB 1NYAA 3KO0A 1YTZC 2M0RA 3OX6A 1DTLA 5HLOA 1BOCA 4XJKB 3CZTX 5K89A 2HQWA 5AXIA 4MZKA 1DJGA 1OMDA 3K21A 4C0JA 1C3ZA 2AAOA 2ZNDA 1UP5A 4MEWA 1UHKA 3FE8A 1TRFA 1A75B 1EJ3A 5DICA 1QASA 2JXCA 1MF8B 1WRLA 4GFTA 3ZNIA 1SCMC 2WORA 1XK4A 2JNFA 3CZ0A 1FW4A 1B7TZ 2O5GA 4OR9B 5EL2A 1OOIX 3SS4A 3KHEA 3AKBA 5CPVA 3S0EA 2CCMA 3BFAA 3RZSA 2MLFC 1M31A 4AQIA 4A4BA 2LLSA 1WDCB 4JD9A 5D3OA 1A03A 3DZTA 4YBHB 2KFFA 1WRZA 4YGAA 5CSNA 1CMFA 4PT1A 4YGCB 1IWQA 1RTP1 1OZOA 4PALA 1SK6D 3DVMA 3CLNA 1IKUA 3BQ3A 2K60A 4HSZA 1F8HA 2K61A 1M46A 3CZ1A 2LNKA 5KU1A 1PRWA 1A4PA 5I94A 3SS5A 2LVIA 2NCPA 1GGWA 3SS3A 4GGFC 1VRKA 1OE9B 2WC6A 2L5YA 2QPTA 5I2OA 4P2YB 2KDHA 1DGVA 1DJZA 3LK1A 1K94A 3FE9A 3LLEA 1F54A 3SIAA 5HKZA 1K9UA 2E6WA 4INWA 2LUCA 1CTRA 1XVJA 1J55A 1G4YR 1CM4A 1KQMC 2F2PA 1LKJA 1XFYO 3BYAA 1TUZA 1SCMB 1ODBA 3CR5X 1CDLA 1RECA 1U5IB 1DJYA 3R72A 2JT8A
chains in the Genus database with same CATH topology
2K2FA 1BT6A 2KYFA 2V53A 4A4CA 4CLNA 5B8IB 1Y6WA 2VRGA 2LP3A 3FWCA 1NWDA 4QJ4B 2JTTA 1EG3A 1S26D 1QX2A 1BJFA 4GUKA 4PHMA 5KSZA 2AMIA 3DVKA 1PVAA 1G33A 1IH0A 1MR8A 1FBVA 4ZCVA 5HKWA 2KAYA 3TUYC 1QV1A 3DVEA 1AP4A 1UUSA 3AAKA 3CTNA 1B8LA 4U8DA 2PALA 3I5IC 1DT7B 2R2IA 1S1EA 5D7FA 1MXLC 1XO5A 1JF2A 1KK7Y 3IF7A 3E3RA 1CFDA 1K9PA 1S36A 1LXFC 1MWNA 1NIWA 1NX2A 2HETA 4FTGA 5CSFA 3I5GC 3OP0A 2LANA 3MSEB 3OB1B 3GK2A 1KQMB 4NDCA 3C1VA 2GGZA 1UURA 3OB2B 4I5JA 3CR2A 5DKQA 2K7BA 3ICBA 4AQJA 1UHJA 5AFPA 2BCBA 2ZRSA 1S5GY 1QVIZ 1YURA 2BE6A 4QJ3B 2BE4A 3KEVA 5BPJA 1S6CA 2HPSA 3D0YB 1J7RA 3PLFB 2WNDA 2JZIA 5JOLA 1F4OA 2E30A 4YGDB 5IBWA 3PSRA 1A2XA 2M1UA 2CXJA 1Y1XA 2G2BA 1SMGA 1F4QA 3TUYB 1L2OB 2GV5A 1TNQA 4MLWA 3NSKA 3WNXB 1Y1UA 1QS7A 3I5IB 2ZNEA 2NLNA 3EK4A 2M29A 1V1GA 1R2UA 3IQQA 3DF0A 3HCMA 3NSOA 1YVHA 1CFCA 1NPQA 2BL0B 1ALWA 1YVLA 1C07A 1NCZA 2KI6C 3O6BA 1BG1A 1YX7A 2LMUA 5TNCA 2WCEA 1DF0A 1SR6C 2SASA 3RM1A 4F0ZB 1ZOTB 2L5XB 2JXLA 3D0YA 3I5GB 5I8NA 3CWGA 1TIZA 1QV0A 1XFVO 2FCDA 3H4SE 1IJ6A 2KGRA 2PASA 1B47A 2MBXA 4D1EA 2TN4A 1IJ5A 2K0JA 1RFJA 4WRIA 1WRKA 3TDZA 3LCPC 3SJSA 3EVVA 2HQ8A 1KFUL 2Y5IA 2M97A 1TNXA 4OCIA 3CR4X 2KOTA 1BU3A 2MJWB 5D69A 1DVIA 3PFVA 4BY4A 5AEQA 5GQQC 1RWYA 2BKHB 3BUWB 1K8UA 2EC6C 4N1GA 2Q4UA 3SG5A 3NSIA 2JOJA 1B1GA 1CB1A 1BMOA 1XFUO 3SG2A 3QRXA 1TNPA 2B1UA 3F45A 4L9MA 4N1FA 1JF0A 2LC5A 1CFFA 1J7OA 1IGVA 4GBAA 2KI4B 2AUCA 4XJKA 3EVRA 1NX1A 4MSPA 2NXQA 1JFKA 3OX5A 3VROA 2KAVA 3EKJA 1A75A 2M7LA 1UHHA 3PALA 1SR6B 1CFPA 3WXAA 1S6JA 2BCXA 1SRAA 3OHMB 4M2OA 1V1FA 2KQYA 1AJ4A 4CPVA 1N2DA 1OMRA 1NSHA 2FCEA 2H61C 3EVUA 2LV7A 3DVJA 1H4BA 3VGOA 5HLVA 3IQOA 2WC8A 2EC6B 1EXRA 1AUIB 1YUSA 2F3YA 4ZCUA 2LVJA 2ZN8A 1SL9A 2K7OA 5AERA 1OMVA 1CNPA 3EKHA 1PSRA 1CLBA 2Y1MA 1S6IA 4I5LB 3BUXB 2KFHA 1KFUS 1CKKA 2LHIA 1TOPA 2OTGC 5ER4X 1B7TY 1KFXL 1TCFA 3KF9A 1UHIA 3SG7A 2LLUA 2BCAA 1CDNA 4MRYA 1J1DA 2NZ0A 4E68A 1IG5A 1U5IA 1K2HA 1Y0VH 4PCWA 1EG4A 1SL7A 1TNWA 5DKNA 3EK7A 2M8UA 1FPWA 2PVBA 4ORAB 4PHNA 4C0KA 2JT3A 1XYDA 2KBMA 1MXEA 3SG6A 3O2PA 2K7DA 1YR5A 4PHJA 1OZSA 1BF5A 1QJTA 3AKAA 2L0PA 2A4JA 3SIBA 1XFWO 2PMYA 1XK4C 2Y1NA 5AANA 4DS7A 2KQ6A 1TN4A 2H2KA 2JPTA 4I5KA 1Q80A 3NXAA 1CLLA 4AOMA 4PE4A 1B4CA 2LLTA 3BUMB 4BY5A 1JWDA 4ORBB 1KK8C 1S3PA 4GGFA 4GPLB 1H8BA 1QXPA 1KCYA 2BKIB 5PALA 2LCPA 3PATA 2MLEC 1X02A 1ALVA 1WLMA 2K2AA 2OTGB 2JT0A 2WOSA 1NX3A 4GGNA 3A4UB 2L98A 1QX7A 2MAZA 1J7QA 4CIDA 3FWBA 1W7JB 2M7NA 4OKHA 3TDIA 4M2PA 2I18A 1YUUA 1OSAA 1LA0A 2JWWA 2BBMA 4USLA 2PSRA 2BECA 2WCFA 3M0WA 3WHTB 4WQ2A 2LE9B 2SCPA 1DGUA 1N0YA 5J3XA 4MBEA 4WQ3A 3FS7A 3TDUA 1JBAA 2CTNA 2ISDA 4UPGA 1KSMA 1QIWA 1KFXS 1JC2A 2KSPA 3BUNB 2Y4QA 2LAPA 4MZLA 3NSLA 3PN7C 1M63B 1ZFSA 2LP2A 1ZMZA 4FQOA 2KYCA 3VRQA 1AJ5A 1NCXA 1ZACA 4CFRA 1CDPA 3PM8A 1XA5A 3LK0A 1KK8B 4MVFA 5I2LA 4Q04A 4OVNF 2P6BB 4XYNA 1PK0D 2WCBA 1NP8A 1FF1A 1DJIA 3A8RA 3HX4A 2FOTA 1XFXO 2LM5A 2LMTA 3BUOB 3I5FC 5ER5A 2JRFA 1EH2A 3I5HC 1NCYA 2JC2A 1SCVA 2O60A 1QVIY 4PHKA 1K95A 2M9GA 1SL8A 1Y1AA 3VRNA 1K90D 5FYXA 4ORCB 1DJXA 4OV2A 3WHUB 2KI6D 1UHNA 2NCOA 1B8CA 1QLKA 1SW8A 2BBNA 2EHBA 1F55A 1DJWA 3JTDC 1QLSA 2IS9A 4TNCA 1WY9A 1WLZA 2M49B 4YI9A 3VRRA 1J7PA 1SNLA 2JNXA 1W7IB 1XFZO 4R1EA 1K93D 2CNPA 1KK7Z 1BLQA 1CMGA 1M45A 2QACA 3SG3A 2FJUB 1KWOC 1YUTA 2OS8C 4NQGA 3PN7B 1KSOA 2COLB 4YGEB 1B8RA 4YI8A 1SYMA 4HREE 1QTXA 1TCOB 2JULA 1CM1A 3TZ1A 2F2OA 3CS1A 1BR4B 2GGMA 1RROA 3JVTC 1YRUB 5F6TA 1AHRA 3FIAA 2I94A 1OOJA 1S5GZ 3I5FB 1IQ5A 3KPXA 3BOWB 4IL1A 2MHHA 1LINA 3I5HB 4DCKA 4N5XA 1K9KA 2JU0A 1D1OA 1CLMA 3CGAA 4GNKB 2ZRTA 5HKYA 2DOQA 4NDDA 2LVKA 1IRJA 1L7ZA 4PE7A 2D8NA 3JTDB 2I2RE 1AK8A 5I2QA 1LA3A 1RK9A 3O78A 2KGBC 1PALA 3GK1A 1N65A 1QATA 1ZUZA 3VRPA 5HYDA 4M2QA 1SBJA 5DKRA 2OPOA 2CT9A 1JSAA 4ICBA 1C7WA 1YX8A 1UWOA 1KWOB 2OS8B 1NUBA 2KNEA 2KHNA 3BOWA 1CDMA 1FI6A 4JWQA 1SY9A 1YRTB 1HQVA 1BR1B 1K96A 1L2OC 2I7AA 2L2EA 3EK8A 5CSIA 1OQPA 2EGDA 1AVSA 2MA2A 2Q91A 1FI5A 1F70A 3JVTB 4MRXA 4YRUA 3GOFA 3TS5C 2F33A 1E8AA 1PSBA 2BL0C 2ZN9A 1PULA 4YGBB 1C7VA 5KTYA 2ZKMX 1HT9A 1QIVA 1MQ1A 2LMVA 2M3WA 2F3ZA 4JPZB 1DMOA 2HF5A 2JTZA 1G8IA 2KBIA 2LUXA 3RLZA 4C0LA 1IQ3A 2ZFDA 3D10A 5JJGA 2JQ6A 3LL8B 4HRGA 1EL4A 3DF0B 1JFJA 2H61A 3DD4A 1PVBA 4PE0A 1J1EA 2MRDA 1F71A 2PRUA 4HRHA 1R6PA 4DIRA 4JQ0D 1A29A 5G08A 1DF0B 5CSJA 4MZJA 1GJYA 2KFGA 1B9AA 1KQVA 1GGZA 3SG4A 3O4YA 2F8PA 1SKTA 2L50A 2LVVA 1WDCC 4QJ5B 1SPYA 3AAJA 2L4IA 1GQMA 4MN0A 2L4HA 2CBLA 4GAOA 3GK4X 4I5NB 4PE1A 4PDZA 2LHLA 4ETOA 2G9BA 4DRWA 3BXKA 2KI4C 2K7CA 1BODA 4DUQA 1LVCD 3TS5B 1MHOA 1NX0A 1TTXA 1RJVA 2RGIA 4P5OE 4CFQA 2L51A 4NDBA 3ZWHA 1DJHA 1QX5B 2M1KB 1M39A 1MUXA 1JUOA 2KAXA 2K8MB 1NYAA 3KO0A 1YTZC 2M0RA 3OX6A 1DTLA 5HLOA 1BOCA 4XJKB 3CZTX 5K89A 2HQWA 5AXIA 4MZKA 1DJGA 1OMDA 3K21A 4C0JA 2AAOA 2ZNDA 1UP5A 4MEWA 1UHKA 1TRFA 1A75B 1EJ3A 3ZNIA 1QASA 2JXCA 1MF8B 1WRLA 4GFTA 1SCMC 2WORA 1XK4A 2JNFA 1FW4A 1B7TZ 2O5GA 4OR9B 3KHEA 3AKBA 5CPVA 2CCMA 2MLFC 1M31A 4AQIA 4A4BA 2LLSA 1WDCB 1A03A 4YBHB 2KFFA 1WRZA 4YGAA 5CSNA 1CMFA 4YGCB 1IWQA 1RTP1 1OZOA 4PALA 1SK6D 3DVMA 3CLNA 1IKUA 3BQ3A 4HSZA 1F8HA 2K61A 1M46A 2LNKA 5KU1A 1PRWA 1A4PA 2LVIA 2NCPA 1GGWA 4GGFC 1VRKA 1OE9B 2QPTA 5I2OA 4P2YB 2KDHA 1DGVA 1DJZA 3LK1A 1K94A 1F54A 3LLEA 3SIAA 5HKZA 1K9UA 2E6WA 2LUCA 1CTRA 1XVJA 1J55A 1G4YR 1CM4A 1KQMC 2F2PA 1LKJA 1XFYO 3BYAA 1SCMB 1ODBA 3CR5X 1CDLA 1RECA 1U5IB 1DJYA 2JT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2F A;  1BT6 A;  2KYF A;  2V53 A;  4A4C A;  4CLN A;  5B8I B;  1Y6W A;  2VRG A;  2LP3 A;  3FWC A;  1NWD A;  4QJ4 B;  2JTT A;  1EG3 A;  1S26 D;  1QX2 A;  1BJF A;  4GUK A;  4PHM A;  5KSZ A;  2AMI A;  3DVK A;  1PVA A;  1G33 A;  1IH0 A;  1MR8 A;  1FBV A;  4ZCV A;  5HKW A;  2KAY A;  3TUY C;  1QV1 A;  3DVE A;  1AP4 A;  1UUS A;  3AAK A;  3CTN A;  1B8L A;  4U8D A;  2PAL A;  3I5I C;  1DT7 B;  2R2I A;  1S1E A;  5D7F A;  1MXL C;  1XO5 A;  1JF2 A;  1KK7 Y;  3IF7 A;  3E3R A;  1CFD A;  1K9P A;  1S36 A;  1LXF C;  1MWN A;  1NIW A;  1NX2 A;  2HET A;  4FTG A;  5CSF A;  3I5G C;  3OP0 A;  2LAN A;  3MSE B;  3OB1 B;  3GK2 A;  1KQM B;  4NDC A;  3C1V A;  2GGZ A;  1UUR A;  3OB2 B;  4I5J A;  3CR2 A;  5DKQ A;  2K7B A;  3ICB A;  4AQJ A;  1UHJ A;  5AFP A;  2BCB A;  2ZRS A;  1S5G Y;  1QVI Z;  1YUR A;  2BE6 A;  4QJ3 B;  2BE4 A;  3KEV A;  5BPJ A;  1S6C A;  2HPS A;  3D0Y B;  1J7R A;  3PLF B;  2WND A;  2JZI A;  5JOL A;  1F4O A;  2E30 A;  4YGD B;  5IBW A;  3PSR A;  1A2X A;  2M1U A;  2CXJ A;  1Y1X A;  2G2B A;  1SMG A;  1F4Q A;  3TUY B;  1L2O B;  2GV5 A;  1TNQ A;  4MLW A;  3NSK A;  3WNX B;  1Y1U A;  1QS7 A;  3I5I B;  2ZNE A;  2NLN A;  3EK4 A;  2M29 A;  1V1G A;  1R2U A;  3IQQ A;  3DF0 A;  3HCM A;  3NSO A;  1YVH A;  1CFC A;  1NPQ A;  2BL0 B;  1ALW A;  1YVL A;  1C07 A;  1NCZ A;  2KI6 C;  3O6B A;  1BG1 A;  1YX7 A;  2LMU A;  5TNC A;  2WCE A;  1DF0 A;  1SR6 C;  2SAS A;  3RM1 A;  4F0Z B;  1ZOT B;  2L5X B;  2JXL A;  3D0Y A;  3I5G B;  5I8N A;  3CWG A;  1TIZ A;  1QV0 A;  1XFV O;  2FCD A;  3H4S E;  1IJ6 A;  2KGR A;  2PAS A;  1B47 A;  2MBX A;  4D1E A;  2TN4 A;  1IJ5 A;  2K0J A;  1RFJ A;  4WRI A;  1WRK A;  3TDZ A;  3LCP C;  3SJS A;  3EVV A;  2HQ8 A;  1KFU L;  2Y5I A;  2M97 A;  1TNX A;  4OCI A;  3CR4 X;  2KOT A;  1BU3 A;  2MJW B;  5D69 A;  1DVI A;  3PFV A;  4BY4 A;  5AEQ A;  5GQQ C;  1RWY A;  2BKH B;  3BUW B;  1K8U A;  2EC6 C;  4N1G A;  2Q4U A;  3SG5 A;  3NSI A;  2JOJ A;  1B1G A;  1CB1 A;  1BMO A;  1XFU O;  3SG2 A;  3QRX A;  1TNP A;  2B1U A;  3F45 A;  4L9M A;  4N1F A;  1JF0 A;  2LC5 A;  1CFF A;  1J7O A;  1IGV A;  4GBA A;  2KI4 B;  2AUC A;  4XJK A;  3EVR A;  1NX1 A;  4MSP A;  2NXQ A;  1JFK A;  3OX5 A;  3VRO A;  2KAV A;  3EKJ A;  1A75 A;  2M7L A;  1UHH A;  3PAL A;  1SR6 B;  1CFP A;  3WXA A;  1S6J A;  2BCX A;  1SRA A;  3OHM B;  4M2O A;  1V1F A;  2KQY A;  1AJ4 A;  4CPV A;  1N2D A;  1OMR A;  1NSH A;  2FCE A;  2H61 C;  3EVU A;  2LV7 A;  3DVJ A;  1H4B A;  3VGO A;  5HLV A;  3IQO A;  2WC8 A;  2EC6 B;  1EXR A;  1AUI B;  1YUS A;  2F3Y A;  4ZCU A;  2LVJ A;  2ZN8 A;  1SL9 A;  2K7O A;  5AER A;  1OMV A;  1CNP A;  3EKH A;  1PSR A;  1CLB A;  2Y1M A;  1S6I A;  4I5L B;  3BUX B;  2KFH A;  1KFU S;  1CKK A;  2LHI A;  1TOP A;  2OTG C;  5ER4 X;  1B7T Y;  1KFX L;  1TCF A;  3KF9 A;  1UHI A;  3SG7 A;  2LLU A;  2BCA A;  1CDN A;  4MRY A;  1J1D A;  2NZ0 A;  4E68 A;  1IG5 A;  1U5I A;  1K2H A;  1Y0V H;  4PCW A;  1EG4 A;  1SL7 A;  1TNW A;  5DKN A;  3EK7 A;  2M8U A;  1FPW A;  2PVB A;  4ORA B;  4PHN A;  4C0K A;  2JT3 A;  1XYD A;  2KBM A;  1MXE A;  3SG6 A;  3O2P A;  2K7D A;  1YR5 A;  4PHJ A;  1OZS A;  1BF5 A;  1QJT A;  3AKA A;  2L0P A;  2A4J A;  3SIB A;  1XFW O;  2PMY A;  1XK4 C;  2Y1N A;  5AAN A;  4DS7 A;  2KQ6 A;  1TN4 A;  2H2K A;  2JPT A;  4I5K A;  1Q80 A;  3NXA A;  1CLL A;  4AOM A;  4PE4 A;  1B4C A;  2LLT A;  3BUM B;  4BY5 A;  1JWD A;  4ORB B;  1KK8 C;  1S3P A;  4GGF A;  4GPL B;  1H8B A;  1QXP A;  1KCY A;  2BKI B;  5PAL A;  2LCP A;  3PAT A;  2MLE C;  1X02 A;  1ALV A;  1WLM A;  2K2A A;  2OTG B;  2JT0 A;  2WOS A;  1NX3 A;  4GGN A;  3A4U B;  2L98 A;  1QX7 A;  2MAZ A;  1J7Q A;  4CID A;  3FWB A;  1W7J B;  2M7N A;  4OKH A;  3TDI A;  4M2P A;  2I18 A;  1YUU A;  1OSA A;  1LA0 A;  2JWW A;  2BBM A;  4USL A;  2PSR A;  2BEC A;  2WCF A;  3M0W A;  3WHT B;  4WQ2 A;  2LE9 B;  2SCP A;  1DGU A;  1N0Y A;  5J3X A;  4MBE A;  4WQ3 A;  3FS7 A;  3TDU A;  1JBA A;  2CTN A;  2ISD A;  4UPG A;  1KSM A;  1QIW A;  1KFX S;  1JC2 A;  2KSP A;  3BUN B;  2Y4Q A;  2LAP A;  4MZL A;  3NSL A;  3PN7 C;  1M63 B;  1ZFS A;  2LP2 A;  1ZMZ A;  4FQO A;  2KYC A;  3VRQ A;  1AJ5 A;  1NCX A;  1ZAC A;  4CFR A;  1CDP A;  3PM8 A;  1XA5 A;  3LK0 A;  1KK8 B;  4MVF A;  5I2L A;  4Q04 A;  4OVN F;  2P6B B;  4XYN A;  1PK0 D;  2WCB A;  1NP8 A;  1FF1 A;  1DJI A;  3A8R A;  3HX4 A;  2FOT A;  1XFX O;  2LM5 A;  2LMT A;  3BUO B;  3I5F C;  5ER5 A;  2JRF A;  1EH2 A;  3I5H C;  1NCY A;  2JC2 A;  1SCV A;  2O60 A;  1QVI Y;  4PHK A;  1K95 A;  2M9G A;  1SL8 A;  1Y1A A;  3VRN A;  1K90 D;  5FYX A;  4ORC B;  1DJX A;  4OV2 A;  3WHU B;  2KI6 D;  1UHN A;  2NCO A;  1B8C A;  1QLK A;  1SW8 A;  2BBN A;  2EHB A;  1F55 A;  1DJW A;  3JTD C;  1QLS A;  2IS9 A;  4TNC A;  1WY9 A;  1WLZ A;  2M49 B;  4YI9 A;  3VRR A;  1J7P A;  1SNL A;  2JNX A;  1W7I B;  1XFZ O;  4R1E A;  1K93 D;  2CNP A;  1KK7 Z;  1BLQ A;  1CMG A;  1M45 A;  2QAC A;  3SG3 A;  2FJU B;  1KWO C;  1YUT A;  2OS8 C;  4NQG A;  3PN7 B;  1KSO A;  2COL B;  4YGE B;  1B8R A;  4YI8 A;  1SYM A;  4HRE E;  1QTX A;  1TCO B;  2JUL A;  1CM1 A;  3TZ1 A;  2F2O A;  3CS1 A;  1BR4 B;  2GGM A;  1RRO A;  3JVT C;  1YRU B;  5F6T A;  1AHR A;  3FIA A;  2I94 A;  1OOJ A;  1S5G Z;  3I5F B;  1IQ5 A;  3KPX A;  3BOW B;  4IL1 A;  2MHH A;  1LIN A;  3I5H B;  4DCK A;  4N5X A;  1K9K A;  2JU0 A;  1D1O A;  1CLM A;  3CGA A;  4GNK B;  2ZRT A;  5HKY A;  2DOQ A;  4NDD A;  2LVK A;  1IRJ A;  1L7Z A;  4PE7 A;  2D8N A;  3JTD B;  2I2R E;  1AK8 A;  5I2Q A;  1LA3 A;  1RK9 A;  3O78 A;  2KGB C;  1PAL A;  3GK1 A;  1N65 A;  1QAT A;  1ZUZ A;  3VRP A;  5HYD A;  4M2Q A;  1SBJ A;  5DKR A;  2OPO A;  2CT9 A;  1JSA A;  4ICB A;  1C7W A;  1YX8 A;  1UWO A;  1KWO B;  2OS8 B;  1NUB A;  2KNE A;  2KHN A;  3BOW A;  1CDM A;  1FI6 A;  4JWQ A;  1SY9 A;  1YRT B;  1HQV A;  1BR1 B;  1K96 A;  1L2O C;  2I7A A;  2L2E A;  3EK8 A;  5CSI A;  1OQP A;  2EGD A;  1AVS A;  2MA2 A;  2Q91 A;  1FI5 A;  1F70 A;  3JVT B;  4MRX A;  4YRU A;  3GOF A;  3TS5 C;  2F33 A;  1E8A A;  1PSB A;  2BL0 C;  2ZN9 A;  1PUL A;  4YGB B;  1C7V A;  5KTY A;  2ZKM X;  1HT9 A;  1QIV A;  1MQ1 A;  2LMV A;  2M3W A;  2F3Z A;  4JPZ B;  1DMO A;  2HF5 A;  2JTZ A;  1G8I A;  2KBI A;  2LUX A;  3RLZ A;  4C0L A;  1IQ3 A;  2ZFD A;  3D10 A;  5JJG A;  2JQ6 A;  3LL8 B;  4HRG A;  1EL4 A;  3DF0 B;  1JFJ A;  2H61 A;  3DD4 A;  1PVB A;  4PE0 A;  1J1E A;  2MRD A;  1F71 A;  2PRU A;  4HRH A;  1R6P A;  4DIR A;  4JQ0 D;  1A29 A;  5G08 A;  1DF0 B;  5CSJ A;  4MZJ A;  1GJY A;  2KFG A;  1B9A A;  1KQV A;  1GGZ A;  3SG4 A;  3O4Y A;  2F8P A;  1SKT A;  2L50 A;  2LVV A;  1WDC C;  4QJ5 B;  1SPY A;  3AAJ A;  2L4I A;  1GQM A;  4MN0 A;  2L4H A;  2CBL A;  4GAO A;  3GK4 X;  4I5N B;  4PE1 A;  4PDZ A;  2LHL A;  4ETO A;  2G9B A;  4DRW A;  3BXK A;  2KI4 C;  2K7C A;  1BOD A;  4DUQ A;  1LVC D;  3TS5 B;  1MHO A;  1NX0 A;  1TTX A;  1RJV A;  2RGI A;  4P5O E;  4CFQ A;  2L51 A;  4NDB A;  3ZWH A;  1DJH A;  1QX5 B;  2M1K B;  1M39 A;  1MUX A;  1JUO A;  2KAX A;  2K8M B;  1NYA A;  3KO0 A;  1YTZ C;  2M0R A;  3OX6 A;  1DTL A;  5HLO A;  1BOC A;  4XJK B;  3CZT X;  5K89 A;  2HQW A;  5AXI A;  4MZK A;  1DJG A;  1OMD A;  3K21 A;  4C0J A;  2AAO A;  2ZND A;  1UP5 A;  4MEW A;  1UHK A;  1TRF A;  1A75 B;  1EJ3 A;  3ZNI A;  1QAS A;  2JXC A;  1MF8 B;  1WRL A;  4GFT A;  1SCM C;  2WOR A;  1XK4 A;  2JNF A;  1FW4 A;  1B7T Z;  2O5G A;  4OR9 B;  3KHE A;  3AKB A;  5CPV A;  2CCM A;  2MLF C;  1M31 A;  4AQI A;  4A4B A;  2LLS A;  1WDC B;  1A03 A;  4YBH B;  2KFF A;  1WRZ A;  4YGA A;  5CSN A;  1CMF A;  4YGC B;  1IWQ A;  1RTP 1;  1OZO A;  4PAL A;  1SK6 D;  3DVM A;  3CLN A;  1IKU A;  3BQ3 A;  4HSZ A;  1F8H A;  2K61 A;  1M46 A;  2LNK A;  5KU1 A;  1PRW A;  1A4P A;  2LVI A;  2NCP A;  1GGW A;  4GGF C;  1VRK A;  1OE9 B;  2QPT A;  5I2O A;  4P2Y B;  2KDH A;  1DGV A;  1DJZ A;  3LK1 A;  1K94 A;  1F54 A;  3LLE A;  3SIA A;  5HKZ A;  1K9U A;  2E6W A;  2LUC A;  1CTR A;  1XVJ A;  1J55 A;  1G4Y R;  1CM4 A;  1KQM C;  2F2P A;  1LKJ A;  1XFY O;  3BYA A;  1SCM B;  1ODB A;  3CR5 X;  1CDL A;  1REC A;  1U5I B;  1DJY A;  2JT8 A; 
#chains in the Genus database with same CATH topology
 2WC5 A;  2K2F A;  1BT6 A;  2KPH A;  2KYF A;  2V53 A;  4A4C A;  4CLN A;  2GTE A;  3K1E A;  5B8I B;  1Y6W A;  2VRG A;  3B6X A;  2LP3 A;  3FWC A;  1NWD A;  4QJ4 B;  2JTT A;  1EG3 A;  1S26 D;  1QX2 A;  1BJF A;  4GUK A;  4PHM A;  5KSZ A;  2AMI A;  3DVK A;  1PVA A;  3D78 A;  1G33 A;  1IH0 A;  1MR8 A;  1FBV A;  4ZCV A;  5HKW A;  2KAY A;  3TUY C;  1QV1 A;  3DVE A;  1AP4 A;  1UUS A;  3AAK A;  3CTN A;  1B8L A;  3R1V A;  2PAL A;  3I5I C;  4U8D A;  3SIB A;  1DT7 B;  3D73 A;  2R2I A;  1S1E A;  2QEH A;  5D7F A;  1MXL C;  1XO5 A;  5FI2 A;  1JF2 A;  1KK7 Y;  3IF7 A;  3E3R A;  1CFD A;  1K9P A;  1TWO A;  1S36 A;  1LXF C;  1MWN A;  1NIW A;  1NX2 A;  2WCH A;  2HET A;  4FTG A;  5CSF A;  3I5G C;  3OP0 A;  2LAN A;  3S0F A;  3MSE B;  3OB1 B;  3GK2 A;  1KQM B;  4NDC A;  3C1V A;  2GGZ A;  1UUR A;  3OB2 B;  4I5J A;  1DEK A;  3PM2 A;  3CR2 A;  5DKQ A;  2K7B A;  3ICB A;  4AQJ A;  1UHJ A;  2PQL A;  2BCB A;  2ZRS A;  1S5G Y;  5AFP A;  1QVI Z;  1YUR A;  2BE6 A;  4QJ3 B;  2BE4 A;  3KEV A;  5BPJ A;  1S6C A;  2HPS A;  3D0Y B;  1J7R A;  3PLF B;  2WND A;  2JZI A;  5JOL A;  1F4O A;  3VB1 A;  2E30 A;  4YGD B;  5IBW A;  3PSR A;  1A2X A;  2M1U A;  2KLE A;  2CXJ A;  1Y1X A;  2G2B A;  1SMG A;  1F4Q A;  3TUY B;  1L2O B;  2GV5 A;  1TNQ A;  4MLW A;  2QEO A;  3NSK A;  3WNX B;  1Y1U A;  2KLD A;  1QS7 A;  1T14 A;  3I5I B;  2ZNE A;  2NLN A;  3EK4 A;  2M29 A;  1V1G A;  1R2U A;  3DY9 A;  3DF0 A;  3HCM A;  3IQQ A;  1YVH A;  3NSO A;  1CFC A;  1NPQ A;  2BL0 B;  1ALW A;  1YVL A;  1C07 A;  1NCZ A;  2KI6 C;  3O6B A;  1BG1 A;  1YX7 A;  2LMU A;  3QME A;  5TNC A;  2WCE A;  1DF0 A;  1SR6 C;  2QDI A;  2SAS A;  3RM1 A;  1ZOT B;  2L5X B;  2JXL A;  3D0Y A;  1DEL A;  2FJY A;  3I5G B;  1Z4H A;  3CWG A;  1TIZ A;  1QV0 A;  1XFV O;  2FCD A;  3H4S E;  1IJ6 A;  2KGR A;  2PAS A;  1B47 A;  2MBX A;  4D1E A;  2TN4 A;  1IJ5 A;  1OOG A;  1RFJ A;  2K0J A;  4WRI A;  1WRK A;  3TDZ A;  3LCP C;  3SJS A;  1C3Y A;  3EVV A;  2HQ8 A;  1KFU L;  2Y5I A;  2M97 A;  1TNX A;  3PJI A;  4OCI A;  3CR4 X;  2QEV A;  2KOT A;  1BU3 A;  2MJW B;  5D69 A;  1DVI A;  3PFV A;  4BY4 A;  5AEQ A;  5GQQ C;  1RWY A;  2BKH B;  3BUW B;  1K8U A;  3DYE A;  2EC6 C;  4N1G A;  2Q4U A;  3SG5 A;  3NSI A;  2JOJ A;  1B1G A;  1CB1 A;  1BMO A;  1XFU O;  3L4A A;  3SG2 A;  3R1P A;  3QRX A;  1TNP A;  2B1U A;  3F45 A;  4L9M A;  4N1F A;  1JF0 A;  2LC5 A;  1CFF A;  3B86 A;  1IIO A;  5HL1 A;  1IGV A;  1J7O A;  4GBA A;  2KI4 B;  2AUC A;  4XJK A;  3BFB A;  3EVR A;  1NX1 A;  4MSP A;  2NXQ A;  1JFK A;  3OX5 A;  3VRO A;  2KAV A;  3D74 A;  3EKJ A;  1A75 A;  3N7H A;  2M7L A;  1UHH A;  3PAL A;  1SR6 B;  3OGN A;  1CFP A;  3WXA A;  3B7A A;  1S6J A;  2BCX A;  1SRA A;  3OHM B;  4M2O A;  1V1F A;  2P70 A;  2KQY A;  3CAB A;  1AJ4 A;  4CPV A;  1N2D A;  1OMR A;  1NSH A;  2FCE A;  2H61 C;  3EVU A;  2LV7 A;  3DVJ A;  1H4B A;  2WCJ A;  5I8N A;  3VGO A;  1ORG A;  5HLV A;  3IQO A;  3IVT A;  3R1O A;  2WC8 A;  3UO9 A;  2EC6 B;  1EXR A;  1AUI B;  1YUS A;  2F3Y A;  4ZCU A;  1SSE B;  2LVJ A;  2ZN8 A;  1SL9 A;  2K7O A;  5AER A;  1OMV A;  1CNP A;  3EKH A;  3NHI A;  1PSR A;  1CLB A;  2Y1M A;  1S6I A;  4I5L B;  3BUX B;  2KFH A;  1KFU S;  1CKK A;  2LHI A;  1TOP A;  2OTG C;  5ER4 X;  2H8V A;  1B7T Y;  1KFX L;  1TCF A;  3KF9 A;  1UHI A;  3SG7 A;  2LLU A;  2BCA A;  1CDN A;  1GM0 A;  4MRY A;  1J1D A;  2NZ0 A;  4E68 A;  1IG5 A;  1U5I A;  1K2H A;  1Y0V H;  4PCW A;  1EG4 A;  1SL7 A;  1TNW A;  3L47 A;  5DKN A;  5FI7 A;  3EK7 A;  2M8U A;  1FPW A;  2PVB A;  4ORA B;  3OBV A;  4PHN A;  4C0K A;  2JT3 A;  1XYD A;  2KBM A;  1MXE A;  3SG6 A;  3O2P A;  2K7D A;  1YR5 A;  4PHJ A;  1OZS A;  4KYN A;  1BF5 A;  1QJT A;  3AKA A;  2L0P A;  2A4J A;  3O4X A;  1XFW O;  2PMY A;  2PYQ A;  1XK4 C;  2P71 A;  2Y1N A;  3Q8I A;  5AAN A;  4DS7 A;  2KQ6 A;  3D76 A;  1TN4 A;  2H2K A;  2JPT A;  4I5K A;  1Q80 A;  3L4L A;  3NXA A;  3V2L A;  1QWV A;  1CLL A;  4AOM A;  4PE4 A;  1B4C A;  2LLT A;  2WCK A;  3BUM B;  4BY5 A;  1OOF A;  1JWD A;  4ORB B;  1KK8 C;  1S3P A;  4GGF A;  4GPL B;  1H8B A;  1QXP A;  1KCY A;  2BKI B;  5PAL A;  2LCP A;  3D77 A;  2MLE C;  3PAT A;  1X02 A;  3UNW A;  1ALV A;  1WLM A;  2K2A A;  2OTG B;  2JT0 A;  2WOS A;  1NX3 A;  4GGN A;  3A4U B;  3S0B A;  2L98 A;  1QX7 A;  2MAZ A;  2YGU A;  1J7Q A;  4CID A;  3FWB A;  1OW4 A;  1W7J B;  2M7N A;  3D75 A;  4OKH A;  3TDI A;  4M2P A;  1DC1 A;  2I18 A;  1YUU A;  1OSA A;  1LA0 A;  2JWW A;  2BBM A;  4USL A;  2PSR A;  2BEC A;  1Z2C B;  2QEB A;  2WCF A;  3M0W A;  3WHT B;  4WQ2 A;  2LE9 B;  2SCP A;  1DGU A;  1N0Y A;  1XFR A;  5J3X A;  4MBE A;  4WQ3 A;  3CDN A;  3FS7 A;  3TDU A;  1OOH A;  1JBA A;  2CTN A;  2ISD A;  4UPG A;  1KSM A;  1QIW A;  1KFX S;  1JC2 A;  2KSP A;  3BUN B;  2Y4Q A;  2LAP A;  4OZD A;  4MZL A;  3NSL A;  3PN7 C;  3S0G A;  2JPO A;  1M63 B;  1ZFS A;  2LP2 A;  1ZMZ A;  4FQO A;  2KYC A;  3B88 A;  3FE6 A;  3VRQ A;  1AJ5 A;  1NCX A;  1ZAC A;  2BAP A;  4CFR A;  1CDP A;  3PM8 A;  1XA5 A;  3LK0 A;  1KK8 B;  4MVF A;  5I2L A;  4Q04 A;  4OVN F;  2P6B B;  4XYN A;  1PK0 D;  2WCB A;  1NP8 A;  1FF1 A;  1DJI A;  3A8R A;  3HX4 A;  2FOT A;  1XFX O;  2LM5 A;  2LMT A;  3BUO B;  3I5F C;  5ER5 A;  2JRF A;  1EH2 A;  3I5H C;  1NCY A;  2JC2 A;  1SCV A;  2O60 A;  1QVI Y;  4PHK A;  1K95 A;  2M9G A;  1SL8 A;  1Y1A A;  4INX A;  3VRN A;  1K90 D;  5FYX A;  4ORC B;  1DJX A;  4OV2 A;  3WHU B;  2KI6 D;  1UHN A;  2NCO A;  1B8C A;  1QLK A;  1SW8 A;  2BBN A;  2EHB A;  1F55 A;  1DJW A;  3JTD C;  1QLS A;  2IS9 A;  4TNC A;  1WY9 A;  1WLZ A;  2M49 B;  4YI9 A;  3VRR A;  1J7P A;  1SNL A;  2JNX A;  2WCM A;  1W7I B;  1XFZ O;  4R1E A;  1K93 D;  1KK7 Z;  2CNP A;  1BLQ A;  1CMG A;  1M45 A;  2QAC A;  3SG3 A;  2FJU B;  2BNX A;  1KWO C;  1YUT A;  2OS8 C;  3NGV A;  4NQG A;  2WCL A;  3PN7 B;  1KSO A;  2COL B;  4YGE B;  1B8R A;  4YI8 A;  1SYM A;  4HRE E;  1QTX A;  1TCO B;  2JUL A;  1CM1 A;  3TZ1 A;  2F2O A;  3CS1 A;  1BR4 B;  2GGM A;  1RRO A;  3JVT C;  1YRU B;  5F6T A;  1AHR A;  3FIA A;  2I94 A;  1OOJ A;  1S5G Z;  3I5F B;  1IQ5 A;  3KPX A;  3BOW B;  4IL1 A;  2MHH A;  1LIN A;  3I5H B;  1DQE A;  4DCK A;  4N5X A;  1K9K A;  2JU0 A;  1D1O A;  1CLM A;  3CGA A;  3EG5 B;  4GNK B;  2ZRT A;  5HKY A;  2DOQ A;  4NDD A;  2LVK A;  1IRJ A;  4JKT A;  1L7Z A;  4PE7 A;  2D8N A;  3JTD B;  2I2R E;  1AK8 A;  5I2Q A;  1LA3 A;  1RK9 A;  3S0D A;  3O78 A;  2KGB C;  1PAL A;  3GK1 A;  1N65 A;  1QAT A;  1ZUZ A;  3VRP A;  5HYD A;  4M2Q A;  1SBJ A;  5DKR A;  2OPO A;  2CT9 A;  1JSA A;  4ICB A;  1C7W A;  1YX8 A;  1UWO A;  1KWO B;  2OS8 B;  1NUB A;  2KNE A;  2KHN A;  3BOW A;  1CDM A;  3B87 A;  4JWQ A;  1FI6 A;  1SY9 A;  1YRT B;  1HQV A;  1BR1 B;  1K96 A;  1L2O C;  2I7A A;  2L2E A;  3EK8 A;  3CZ2 A;  1OQP A;  5CSI A;  2EGD A;  1AVS A;  2MA2 A;  2Q91 A;  1FI5 A;  4FQT A;  3JVT B;  4MRX A;  4YRU A;  1F70 A;  1LS8 A;  3GOF A;  3TS5 C;  2F33 A;  1E8A A;  1PSB A;  2BL0 C;  2ZN9 A;  1PUL A;  4YGB B;  4F0Z B;  1C7V A;  5KTY A;  2ZKM X;  1HT9 A;  1QIV A;  1MQ1 A;  2LMV A;  2M3W A;  2F3Z A;  4JPZ B;  1DMO A;  2HF5 A;  2JTZ A;  1G8I A;  2KBI A;  2LUX A;  3RLZ A;  4C0L A;  1IQ3 A;  2ZFD A;  3D10 A;  5JJG A;  2JQ6 A;  3LL8 B;  4HRG A;  1EL4 A;  3DF0 B;  5FI6 A;  1JFJ A;  2H61 A;  3DD4 A;  1PVB A;  4PE0 A;  1J1E A;  2MRD A;  1F71 A;  2PRU A;  4HRH A;  1R6P A;  4DIR A;  4JQ0 D;  1A29 A;  5G08 A;  1DF0 B;  5CSJ A;  4MZJ A;  1GJY A;  2KFG A;  1B9A A;  1KQV A;  4F7F A;  1GGZ A;  3SG4 A;  3O4Y A;  2F8P A;  4IJ7 A;  2ERB A;  1SKT A;  3BFH A;  2L50 A;  2LVV A;  1WDC C;  4QJ5 B;  1SPY A;  1P28 A;  2L4I A;  1GQM A;  3AAJ A;  3BJH A;  2L4H A;  4MN0 A;  2CBL A;  4GAO A;  3GK4 X;  4I5N B;  4PE1 A;  4PDZ A;  2LHL A;  4ETO A;  2G9B A;  4DRW A;  3BXK A;  2KI4 C;  2K7C A;  3CYZ A;  1W9Z A;  1BOD A;  4DUQ A;  1LVC D;  3NHT A;  3TS5 B;  1MHO A;  1NX0 A;  1TTX A;  1TUJ A;  1RJV A;  2RGI A;  4P5O E;  4CFQ A;  2L51 A;  4NDB A;  3ZWH A;  2L2C A;  3DXL A;  1DJH A;  1QX5 B;  2M1K B;  1M39 A;  1MUX A;  1JUO A;  3S0A A;  2KAX A;  2K8M B;  1NYA A;  3KO0 A;  1YTZ C;  2M0R A;  3OX6 A;  1DTL A;  5HLO A;  1BOC A;  4XJK B;  3CZT X;  5K89 A;  2HQW A;  5AXI A;  4MZK A;  1DJG A;  1OMD A;  3K21 A;  4C0J A;  1C3Z A;  2AAO A;  2ZND A;  1UP5 A;  4MEW A;  1UHK A;  3FE8 A;  1TRF A;  1A75 B;  1EJ3 A;  5DIC A;  1QAS A;  2JXC A;  1MF8 B;  1WRL A;  4GFT A;  3ZNI A;  1SCM C;  2WOR A;  1XK4 A;  2JNF A;  3CZ0 A;  1FW4 A;  1B7T Z;  2O5G A;  4OR9 B;  5EL2 A;  1OOI X;  3SS4 A;  3KHE A;  3AKB A;  5CPV A;  3S0E A;  2CCM A;  3BFA A;  3RZS A;  2MLF C;  1M31 A;  4AQI A;  4A4B A;  2LLS A;  1WDC B;  4JD9 A;  5D3O A;  1A03 A;  3DZT A;  4YBH B;  2KFF A;  1WRZ A;  4YGA A;  5CSN A;  1CMF A;  4PT1 A;  4YGC B;  1IWQ A;  1RTP 1;  1OZO A;  4PAL A;  1SK6 D;  3DVM A;  3CLN A;  1IKU A;  3BQ3 A;  2K60 A;  4HSZ A;  1F8H A;  2K61 A;  1M46 A;  3CZ1 A;  2LNK A;  5KU1 A;  1PRW A;  1A4P A;  5I94 A;  3SS5 A;  2LVI A;  2NCP A;  1GGW A;  3SS3 A;  4GGF C;  1VRK A;  1OE9 B;  2WC6 A;  2L5Y A;  2QPT A;  5I2O A;  4P2Y B;  2KDH A;  1DGV A;  1DJZ A;  3LK1 A;  1K94 A;  3FE9 A;  3LLE A;  1F54 A;  3SIA A;  5HKZ A;  1K9U A;  2E6W A;  4INW A;  2LUC A;  1CTR A;  1XVJ A;  1J55 A;  1G4Y R;  1CM4 A;  1KQM C;  2F2P A;  1LKJ A;  1XFY O;  3BYA A;  1TUZ A;  1SCM B;  1ODB A;  3CR5 X;  1CDL A;  1REC A;  1U5I B;  1DJY A;  3R72 A;  2JT8 A; 
#chains in the Genus database with same CATH homology
 2K2F A;  1BT6 A;  2KYF A;  2V53 A;  4A4C A;  4CLN A;  5B8I B;  1Y6W A;  2VRG A;  2LP3 A;  3FWC A;  1NWD A;  4QJ4 B;  2JTT A;  1EG3 A;  1S26 D;  1QX2 A;  1BJF A;  4GUK A;  4PHM A;  5KSZ A;  2AMI A;  3DVK A;  1PVA A;  1G33 A;  1IH0 A;  1MR8 A;  1FBV A;  4ZCV A;  5HKW A;  2KAY A;  3TUY C;  1QV1 A;  3DVE A;  1AP4 A;  1UUS A;  3AAK A;  3CTN A;  1B8L A;  4U8D A;  2PAL A;  3I5I C;  1DT7 B;  2R2I A;  1S1E A;  5D7F A;  1MXL C;  1XO5 A;  1JF2 A;  1KK7 Y;  3IF7 A;  3E3R A;  1CFD A;  1K9P A;  1S36 A;  1LXF C;  1MWN A;  1NIW A;  1NX2 A;  2HET A;  4FTG A;  5CSF A;  3I5G C;  3OP0 A;  2LAN A;  3MSE B;  3OB1 B;  3GK2 A;  1KQM B;  4NDC A;  3C1V A;  2GGZ A;  1UUR A;  3OB2 B;  4I5J A;  3CR2 A;  5DKQ A;  2K7B A;  3ICB A;  4AQJ A;  1UHJ A;  5AFP A;  2BCB A;  2ZRS A;  1S5G Y;  1QVI Z;  1YUR A;  2BE6 A;  4QJ3 B;  2BE4 A;  3KEV A;  5BPJ A;  1S6C A;  2HPS A;  3D0Y B;  1J7R A;  3PLF B;  2WND A;  2JZI A;  5JOL A;  1F4O A;  2E30 A;  4YGD B;  5IBW A;  3PSR A;  1A2X A;  2M1U A;  2CXJ A;  1Y1X A;  2G2B A;  1SMG A;  1F4Q A;  3TUY B;  1L2O B;  2GV5 A;  1TNQ A;  4MLW A;  3NSK A;  3WNX B;  1Y1U A;  1QS7 A;  3I5I B;  2ZNE A;  2NLN A;  3EK4 A;  2M29 A;  1V1G A;  1R2U A;  3IQQ A;  3DF0 A;  3HCM A;  3NSO A;  1YVH A;  1CFC A;  1NPQ A;  2BL0 B;  1ALW A;  1YVL A;  1C07 A;  1NCZ A;  2KI6 C;  3O6B A;  1BG1 A;  1YX7 A;  2LMU A;  5TNC A;  2WCE A;  1DF0 A;  1SR6 C;  2SAS A;  3RM1 A;  4F0Z B;  1ZOT B;  2L5X B;  2JXL A;  3D0Y A;  3I5G B;  5I8N A;  3CWG A;  1TIZ A;  1QV0 A;  1XFV O;  2FCD A;  3H4S E;  1IJ6 A;  2KGR A;  2PAS A;  1B47 A;  2MBX A;  4D1E A;  2TN4 A;  1IJ5 A;  2K0J A;  1RFJ A;  4WRI A;  1WRK A;  3TDZ A;  3LCP C;  3SJS A;  3EVV A;  2HQ8 A;  1KFU L;  2Y5I A;  2M97 A;  1TNX A;  4OCI A;  3CR4 X;  2KOT A;  1BU3 A;  2MJW B;  5D69 A;  1DVI A;  3PFV A;  4BY4 A;  5AEQ A;  5GQQ C;  1RWY A;  2BKH B;  3BUW B;  1K8U A;  2EC6 C;  4N1G A;  2Q4U A;  3SG5 A;  3NSI A;  2JOJ A;  1B1G A;  1CB1 A;  1BMO A;  1XFU O;  3SG2 A;  3QRX A;  1TNP A;  2B1U A;  3F45 A;  4L9M A;  4N1F A;  1JF0 A;  2LC5 A;  1CFF A;  1J7O A;  1IGV A;  4GBA A;  2KI4 B;  2AUC A;  4XJK A;  3EVR A;  1NX1 A;  4MSP A;  2NXQ A;  1JFK A;  3OX5 A;  3VRO A;  2KAV A;  3EKJ A;  1A75 A;  2M7L A;  1UHH A;  3PAL A;  1SR6 B;  1CFP A;  3WXA A;  1S6J A;  2BCX A;  1SRA A;  3OHM B;  4M2O A;  1V1F A;  2KQY A;  1AJ4 A;  4CPV A;  1N2D A;  1OMR A;  1NSH A;  2FCE A;  2H61 C;  3EVU A;  2LV7 A;  3DVJ A;  1H4B A;  3VGO A;  5HLV A;  3IQO A;  2WC8 A;  2EC6 B;  1EXR A;  1AUI B;  1YUS A;  2F3Y A;  4ZCU A;  2LVJ A;  2ZN8 A;  1SL9 A;  2K7O A;  5AER A;  1OMV A;  1CNP A;  3EKH A;  1PSR A;  1CLB A;  2Y1M A;  1S6I A;  4I5L B;  3BUX B;  2KFH A;  1KFU S;  1CKK A;  2LHI A;  1TOP A;  2OTG C;  5ER4 X;  1B7T Y;  1KFX L;  1TCF A;  3KF9 A;  1UHI A;  3SG7 A;  2LLU A;  2BCA A;  1CDN A;  4MRY A;  1J1D A;  2NZ0 A;  4E68 A;  1IG5 A;  1U5I A;  1K2H A;  1Y0V H;  4PCW A;  1EG4 A;  1SL7 A;  1TNW A;  5DKN A;  3EK7 A;  2M8U A;  1FPW A;  2PVB A;  4ORA B;  4PHN A;  4C0K A;  2JT3 A;  1XYD A;  2KBM A;  1MXE A;  3SG6 A;  3O2P A;  2K7D A;  1YR5 A;  4PHJ A;  1OZS A;  1BF5 A;  1QJT A;  3AKA A;  2L0P A;  2A4J A;  3SIB A;  1XFW O;  2PMY A;  1XK4 C;  2Y1N A;  5AAN A;  4DS7 A;  2KQ6 A;  1TN4 A;  2H2K A;  2JPT A;  4I5K A;  1Q80 A;  3NXA A;  1CLL A;  4AOM A;  4PE4 A;  1B4C A;  2LLT A;  3BUM B;  4BY5 A;  1JWD A;  4ORB B;  1KK8 C;  1S3P A;  4GGF A;  4GPL B;  1H8B A;  1QXP A;  1KCY A;  2BKI B;  5PAL A;  2LCP A;  3PAT A;  2MLE C;  1X02 A;  1ALV A;  1WLM A;  2K2A A;  2OTG B;  2JT0 A;  2WOS A;  1NX3 A;  4GGN A;  3A4U B;  2L98 A;  1QX7 A;  2MAZ A;  1J7Q A;  4CID A;  3FWB A;  1W7J B;  2M7N A;  4OKH A;  3TDI A;  4M2P A;  2I18 A;  1YUU A;  1OSA A;  1LA0 A;  2JWW A;  2BBM A;  4USL A;  2PSR A;  2BEC A;  2WCF A;  3M0W A;  3WHT B;  4WQ2 A;  2LE9 B;  2SCP A;  1DGU A;  1N0Y A;  5J3X A;  4MBE A;  4WQ3 A;  3FS7 A;  3TDU A;  1JBA A;  2CTN A;  2ISD A;  4UPG A;  1KSM A;  1QIW A;  1KFX S;  1JC2 A;  2KSP A;  3BUN B;  2Y4Q A;  2LAP A;  4MZL A;  3NSL A;  3PN7 C;  1M63 B;  1ZFS A;  2LP2 A;  1ZMZ A;  4FQO A;  2KYC A;  3VRQ A;  1AJ5 A;  1NCX A;  1ZAC A;  4CFR A;  1CDP A;  3PM8 A;  1XA5 A;  3LK0 A;  1KK8 B;  4MVF A;  5I2L A;  4Q04 A;  4OVN F;  2P6B B;  4XYN A;  1PK0 D;  2WCB A;  1NP8 A;  1FF1 A;  1DJI A;  3A8R A;  3HX4 A;  2FOT A;  1XFX O;  2LM5 A;  2LMT A;  3BUO B;  3I5F C;  5ER5 A;  2JRF A;  1EH2 A;  3I5H C;  1NCY A;  2JC2 A;  1SCV A;  2O60 A;  1QVI Y;  4PHK A;  1K95 A;  2M9G A;  1SL8 A;  1Y1A A;  3VRN A;  1K90 D;  5FYX A;  4ORC B;  1DJX A;  4OV2 A;  3WHU B;  2KI6 D;  1UHN A;  2NCO A;  1B8C A;  1QLK A;  1SW8 A;  2BBN A;  2EHB A;  1F55 A;  1DJW A;  3JTD C;  1QLS A;  2IS9 A;  4TNC A;  1WY9 A;  1WLZ A;  2M49 B;  4YI9 A;  3VRR A;  1J7P A;  1SNL A;  2JNX A;  1W7I B;  1XFZ O;  4R1E A;  1K93 D;  2CNP A;  1KK7 Z;  1BLQ A;  1CMG A;  1M45 A;  2QAC A;  3SG3 A;  2FJU B;  1KWO C;  1YUT A;  2OS8 C;  4NQG A;  3PN7 B;  1KSO A;  2COL B;  4YGE B;  1B8R A;  4YI8 A;  1SYM A;  4HRE E;  1QTX A;  1TCO B;  2JUL A;  1CM1 A;  3TZ1 A;  2F2O A;  3CS1 A;  1BR4 B;  2GGM A;  1RRO A;  3JVT C;  1YRU B;  5F6T A;  1AHR A;  3FIA A;  2I94 A;  1OOJ A;  1S5G Z;  3I5F B;  1IQ5 A;  3KPX A;  3BOW B;  4IL1 A;  2MHH A;  1LIN A;  3I5H B;  4DCK A;  4N5X A;  1K9K A;  2JU0 A;  1D1O A;  1CLM A;  3CGA A;  4GNK B;  2ZRT A;  5HKY A;  2DOQ A;  4NDD A;  2LVK A;  1IRJ A;  1L7Z A;  4PE7 A;  2D8N A;  3JTD B;  2I2R E;  1AK8 A;  5I2Q A;  1LA3 A;  1RK9 A;  3O78 A;  2KGB C;  1PAL A;  3GK1 A;  1N65 A;  1QAT A;  1ZUZ A;  3VRP A;  5HYD A;  4M2Q A;  1SBJ A;  5DKR A;  2OPO A;  2CT9 A;  1JSA A;  4ICB A;  1C7W A;  1YX8 A;  1UWO A;  1KWO B;  2OS8 B;  1NUB A;  2KNE A;  2KHN A;  3BOW A;  1CDM A;  1FI6 A;  4JWQ A;  1SY9 A;  1YRT B;  1HQV A;  1BR1 B;  1K96 A;  1L2O C;  2I7A A;  2L2E A;  3EK8 A;  5CSI A;  1OQP A;  2EGD A;  1AVS A;  2MA2 A;  2Q91 A;  1FI5 A;  1F70 A;  3JVT B;  4MRX A;  4YRU A;  3GOF A;  3TS5 C;  2F33 A;  1E8A A;  1PSB A;  2BL0 C;  2ZN9 A;  1PUL A;  4YGB B;  1C7V A;  5KTY A;  2ZKM X;  1HT9 A;  1QIV A;  1MQ1 A;  2LMV A;  2M3W A;  2F3Z A;  4JPZ B;  1DMO A;  2HF5 A;  2JTZ A;  1G8I A;  2KBI A;  2LUX A;  3RLZ A;  4C0L A;  1IQ3 A;  2ZFD A;  3D10 A;  5JJG A;  2JQ6 A;  3LL8 B;  4HRG A;  1EL4 A;  3DF0 B;  1JFJ A;  2H61 A;  3DD4 A;  1PVB A;  4PE0 A;  1J1E A;  2MRD A;  1F71 A;  2PRU A;  4HRH A;  1R6P A;  4DIR A;  4JQ0 D;  1A29 A;  5G08 A;  1DF0 B;  5CSJ A;  4MZJ A;  1GJY A;  2KFG A;  1B9A A;  1KQV A;  1GGZ A;  3SG4 A;  3O4Y A;  2F8P A;  1SKT A;  2L50 A;  2LVV A;  1WDC C;  4QJ5 B;  1SPY A;  3AAJ A;  2L4I A;  1GQM A;  4MN0 A;  2L4H A;  2CBL A;  4GAO A;  3GK4 X;  4I5N B;  4PE1 A;  4PDZ A;  2LHL A;  4ETO A;  2G9B A;  4DRW A;  3BXK A;  2KI4 C;  2K7C A;  1BOD A;  4DUQ A;  1LVC D;  3TS5 B;  1MHO A;  1NX0 A;  1TTX A;  1RJV A;  2RGI A;  4P5O E;  4CFQ A;  2L51 A;  4NDB A;  3ZWH A;  1DJH A;  1QX5 B;  2M1K B;  1M39 A;  1MUX A;  1JUO A;  2KAX A;  2K8M B;  1NYA A;  3KO0 A;  1YTZ C;  2M0R A;  3OX6 A;  1DTL A;  5HLO A;  1BOC A;  4XJK B;  3CZT X;  5K89 A;  2HQW A;  5AXI A;  4MZK A;  1DJG A;  1OMD A;  3K21 A;  4C0J A;  2AAO A;  2ZND A;  1UP5 A;  4MEW A;  1UHK A;  1TRF A;  1A75 B;  1EJ3 A;  3ZNI A;  1QAS A;  2JXC A;  1MF8 B;  1WRL A;  4GFT A;  1SCM C;  2WOR A;  1XK4 A;  2JNF A;  1FW4 A;  1B7T Z;  2O5G A;  4OR9 B;  3KHE A;  3AKB A;  5CPV A;  2CCM A;  2MLF C;  1M31 A;  4AQI A;  4A4B A;  2LLS A;  1WDC B;  1A03 A;  4YBH B;  2KFF A;  1WRZ A;  4YGA A;  5CSN A;  1CMF A;  4YGC B;  1IWQ A;  1RTP 1;  1OZO A;  4PAL A;  1SK6 D;  3DVM A;  3CLN A;  1IKU A;  3BQ3 A;  4HSZ A;  1F8H A;  2K61 A;  1M46 A;  2LNK A;  5KU1 A;  1PRW A;  1A4P A;  2LVI A;  2NCP A;  1GGW A;  4GGF C;  1VRK A;  1OE9 B;  2QPT A;  5I2O A;  4P2Y B;  2KDH A;  1DGV A;  1DJZ A;  3LK1 A;  1K94 A;  1F54 A;  3LLE A;  3SIA A;  5HKZ A;  1K9U A;  2E6W A;  2LUC A;  1CTR A;  1XVJ A;  1J55 A;  1G4Y R;  1CM4 A;  1KQM C;  2F2P A;  1LKJ A;  1XFY O;  3BYA A;  1SCM B;  1ODB A;  3CR5 X;  1CDL A;  1REC A;  1U5I B;  1DJY A;  2JT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...