3WNXB

Crystal structure of ergic-53/mcfd2, calcium/man3-bound form
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
57
Chain Sequence
QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 22
structure length 57
sequence length 70
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3wnxB00
2GV5A 4DUQA 5G08A 2JT8A 4P2YB 2LNKA 2P6BB 3AAKA 1B4CA 4PHKA 1BODA 4GGFA 1DJGA 1D1OA 4PE4A 2PSRA 1SW8A 1CMGA 1CB1A 1IJ5A 2KYFA 1IH0A 2FJUB 4PDZA 4CFRA 1YX7A 1EG3A 1F4QA 1QX5B 1MXEA 2LAPA 3BOWB 4NDDA 1TIZA 1TNQA 4QJ3B 1L7ZA 1XFWO 1MHOA 1LXFC 1BG1A 4GGNA 1YX8A 5CSIA 1Y1AA 4GPLB 2K61A 3RM1A 1M45A 3O78A 1GGZA 1IJ6A 4C0KA 5HLOA 5GQQC 1S1EA 1DF0A 3VRPA 4DRWA 4WRIA 2CT9A 1QATA 2V53A 3M0WA 1CM4A 1RFJA 2WOSA 3CR2A 1RK9A 2ISDA 2L4HA 2ZNDA 1XO5A 4N5XA 3EKJA 3DVMA 2FOTA 4PHJA 3ZWHA 5HLVA 1SCMC 5HKWA 1TOPA 3DVJA 3FWCA 3IQQA 3OB2B 1XYDA 2JULA 2KQ6A 3I5IC 1UHNA 5JOLA 2BCXA 2EC6B 1F55A 2K0JA 2RGIA 1NCYA 2HPSA 2E6WA 2I2RE 1KCYA 1G4YR 4JWQA 1A2XA 1GGWA 1SMGA 2LMVA 2BL0C 1JBAA 4FTGA 1FI5A 2F33A 3C1VA 4AQJA 1MR8A 2Y4QA 2H61C 2JOJA 1H4BA 2WCBA 4NQGA 1B8LA 1K9KA 2L5XB 2F2OA 2BECA 1ODBA 2WNDA 1JFJA 1A75B 1ZOTB 3H4SE 1S26D 3NSIA 1TNPA 2WCEA 2KAXA 2KI4B 4ORBB 3TS5C 3EVUA 1PALA 3I5FC 5I8NA 1ALWA 1PSBA 1KFUL 2BE4A 1B8CA 1CLMA 1SK6D 3O2PA 2TN4A 4BY5A 1MXLC 2JQ6A 1KFXL 2R2IA 3BOWA 3EK8A 1SR6C 2KI4C 2ZFDA 3EVRA 1KFUS 1YRTB 1C7WA 1PULA 5CSJA 4NDCA 2VRGA 2K8MB 2OTGB 5I2QA 4N1FA 2JXCA 1AUIB 2MLFC 3DD4A 1X02A 2K7CA 2CCMA 2F2PA 2L51A 1DJZA 3CR4X 1TCOB 4WQ2A 1AVSA 3TDUA 1UURA 4FQOA 2OPOA 1TTXA 1KQVA 1SYMA 3OHMB 4OCIA 3AKAA 1CMFA 1KSOA 1QJTA 2LVIA 2ZRSA 2LP3A 1FF1A 1F4OA 2GGZA 1ZMZA 1RECA 2KNEA 1XK4A 4DIRA 4MBEA 2HQ8A 2CBLA 2JZIA 2M49B 3SIAA 1NUBA 1JC2A 3VGOA 1V1GA 1ZACA 2PMYA 3I5GC 1DGUA 1DJWA 1YRUB 5CPVA 4UPGA 1DMOA 5DKRA 3BUXB 1RTP1 1R6PA 1RJVA 1JFKA 4GUKA 1EXRA 3BUOB 2M7LA 1FBVA 2COLB 4D1EA 1WDCB 1F70A 1A29A 3GK2A 2B1UA 3DVKA 2JXLA 1A75A 3BXKA 2PALA 3MSEB 1AP4A 3SG3A 1KK7Y 2Q91A 3GK4X 4TNCA 1SL8A 5HYDA 1WDCC 3F45A 1MQ1A 1NCZA 5B8IB 1QTXA 2KI6C 5K89A 1QIWA 4DCKA 4GAOA 1G33A 1DTLA 3PLFB 2I18A 4XYNA 2KHNA 3HX4A 1SKTA 1UHIA 2JTZA 2ZN9A 1K95A 3KHEA 1NP8A 2LV7A 2MHHA 4XJKB 2ZN8A 4ICBA 5J3XA 2LMTA 1LKJA 1R2UA 1B7TZ 1CDMA 1SPYA 1NX3A 1QIVA 1WY9A 1WRZA 4OR9B 4MLWA 1F71A 3BUWB 1N65A 2BKIB 1JSAA 1CDNA 1QX7A 1YVLA 3WXAA 1SL9A 2LVKA 1WRLA 1OMVA 2G2BA 2KFGA 2H2KA 3GOFA 4YBHB 4MRYA 3TDIA 3ZNIA 1S6JA 3NSKA 3PALA 4GFTA 4ETOA 4MZKA 3CZTX 3HCMA 4PE1A 1SCMB 4AOMA 1CNPA 1KWOB 4AQIA 1CLBA 3I5IB 3D0YB 4MZJA 2SASA 3FS7A 3BYAA 1XFZO 3LK0A 1WLMA 4HSZA 1PK0D 3RLZA 1M31A 3WNXB 2M97A 4MVFA 3SG5A 1YURA 2NCOA 1BU3A 2PRUA 1KWOC 1IKUA 3PSRA 2LVJA 1S5GZ 2BL0B 2M3WA 1N0YA 2EHBA 2KGBC 4P5OE 4MRXA 1SL7A 2LC5A 1OMDA 2DOQA 1K94A 2O60A 2CTNA 2JWWA 4GNKB 1K9PA 1CFFA 4USLA 1SNLA 1F54A 1DJIA 1BF5A 1NYAA 4QJ4B 4WQ3A 1DJYA 4OV2A 1IGVA 2HETA 3TS5B 3I5FB 1KSMA 5AERA 1QV0A 1QV1A 1OSAA 4HRGA 4HREE 4PHNA 5AXIA 5TNCA 1SR6B 5ER4X 1FW4A 1OOJA 4XJKA 2GGMA 1XFYO 2MAZA 2K7OA 1J7PA 1DVIA 4U8DA 1KK8C 2OS8C 5D7FA 5FYXA 4I5KA 1AHRA 2Y1MA 5IBWA 2BE6A 2I7AA 2LHLA 2Q4UA 1B1GA 1CFCA 4CPVA 1QASA 2A4JA 5HKZA 1SY9A 2HF5A 1YTZC 1KFXS 1YUUA 1DJXA 1UWOA 3QRXA 1TNWA 2AUCA 5AANA 2KI6D 1DGVA 4YI9A 2KFHA 2MBXA 2LANA 2LHIA 3VROA 1GJYA 1UHKA 3AKBA 1SRAA 2CNPA 2LMUA 2M1KB 1V1FA 3PN7C 1W7JB 3TZ1A 2F3YA 1WRKA 1K2HA 1AK8A 2JC2A 3WHTB 1UUSA 3SJSA 1NX0A 1TRFA 4A4CA 5ER5A 3I5GB 3JTDC 3SG2A 1J7OA 1QVIZ 2JTTA 1BLQA 3BQ3A 3OX5A 5AFPA 3PM8A 1J1DA 2KSPA 1E8AA 1TNXA 2LE9B 1QLSA 1OQPA 1XA5A 2H61A 2L50A 3D10A 1Y1UA 1OMRA 4YGCB 1MUXA 1IQ5A 2JRFA 4GGFC 1NIWA 2K7BA 1K8UA 1NPQA 4YRUA 1M63B 3AAJA 3OP0A 3TDZA 1BT6A 4N1GA 1EG4A 4QJ5B 1K96A 5BPJA 2LUCA 2SCPA 1A03A 1WLZA 1PSRA 1CFDA 2QACA 4HRHA 1DF0B 4BY4A 4PALA 2QPTA 1DJHA 1S36A 5I2OA 1JF0A 3OX6A 2KDHA 4I5JA 2NLNA 3BUMB 2NXQA 2BBMA 4L9MA 1KQMB 1QS7A 1XVJA 2AMIA 1QXPA 2JNFA 5I2LA 5PALA 1C07A 2IS9A 1M46A 1CDPA 2K2AA 2FCDA 3CLNA 3VRRA 1G8IA 4YI8A 1Q80A 2LM5A 1UP5A 4OVNF 1NWDA 3I5HB 3IF7A 2KBMA 1EJ3A 1KQMC 1XFVO 2MA2A 4ZCUA 3KPXA 1EH2A 2MJWB 4GBAA 1Y0VH 2KFFA 4M2QA 4ORCB 2WCFA 1CTRA 1IRJA 3I5HC 1BJFA 2BKHB 1XFUO 4C0LA 2L98A 3CS1A 1SCVA 1QLKA 3E3RA 1K9UA 1J1EA 1YR5A 3O4YA 1FI6A 1B7TY 2LUXA 1BR4B 3LCPC 5KU1A 4CLNA 3GK1A 2M0RA 3K21A 1L2OB 1EL4A 1IWQA 1AJ4A 4M2OA 1RWYA 2EGDA 1RROA 2BBNA 4MEWA 1TN4A 2AAOA 1CKKA 2HQWA 1OZSA 1L2OC 4E68A 1S6IA 1MWNA 1Y1XA 2KYCA 1LA3A 3A4UB 2L0PA 4PE0A 2NCPA 2NZ0A 3SIBA 2I94A 1N2DA 1A4PA 1JF2A 5KSZA 4MSPA 4PE7A 2M29A 3LL8B 3EVVA 3OB1B 1LINA 1MF8B 4YGDB 1ZFSA 3VRQA 4PCWA 5JJGA 2L2EA 2JT0A 4ORAB 1TCFA 1S3PA 5D69A 3KF9A 4C0JA 2CXJA 4NDBA 4DS7A 1CFPA 3JVTB 1K90D 2M9GA 1S5GY 4YGEB 2MRDA 1PVBA 1GQMA 2JU0A 1OE9B 1KK8B 2OS8B 4Q04A 4M2PA 1NSHA 2M7NA 3A8RA 3PFVA 3WHUB 3JVTC 1HQVA 2LVVA 2WORA 5CSNA 1J55A 1NCXA 4IL1A 3ICBA 2EC6C 1XK4C 3NSLA 2LLSA 1ZUZA 1IG5A 3BUNB 3EK4A 3PN7B 1VRKA 3SG6A 1B47A 3CWGA 1CM1A 2BCBA 5CSFA 1PVAA 2M8UA 3VRNA 1B9AA 1YUSA 2PASA 1IQ3A 1YUTA 3DF0B 3JTDB 1ALVA 4A4BA 2JT3A 1FPWA 1S6CA 4F0ZB 2MLEC 3D0YA 1LVCD 1U5IB 2Y1NA 1JUOA 1JWDA 1SBJA 2PVBA 3LK1A 2LLTA 3CR5X 4YGAA 2L4IA 2JPTA 2K7DA 5F6TA 3SG4A 3TUYB 2BCAA 1J7QA 3CTNA 4CFQA 2D8NA 4OKHA 4JPZB 2ZRTA 1AJ5A 2KAYA 2WC8A 1F8HA 4I5LB 2ZKMX 3KO0A 4JQ0D 3TUYC 3FIAA 2O5GA 1BMOA 2JNXA 1C7VA 1W7IB 3NSOA 1OZOA 4MN0A 1K93D 1HT9A 2OTGC 1XFXO 2F3ZA 2K2FA 4CIDA 2KGRA 3EKHA 1QVIY 1LA0A 3IQOA 2M1UA 1NX2A 2Y5IA 5HKYA 3KEVA 2LLUA 3EK7A 1M39A 4R1EA 1Y6WA 4YGBB 2LCPA 5KTYA 2KQYA 1NX1A 1DT7B 1CLLA 1CDLA 1KK7Z 1J7RA 4PHMA 1PRWA 1YVHA 3CGAA 3FWBA 2LP2A 3O6BA 1B8RA 3DVEA 4MZLA 5AEQA 1BR1B 1BOCA 3SG7A 2KBIA 1UHHA 1QX2A 2FCEA 5DKNA 3LLEA 2KOTA 4I5NB 2G9BA 2KAVA 2F8PA 3DF0A 5DKQA 4ZCVA 1UHJA 3NXAA 2E30A 3PATA 2ZNEA 1H8BA 1U5IA
chains in the Genus database with same CATH superfamily
1Z2CB 2GV5A 3B87A 5HL1A 4DUQA 5G08A 2JT8A 4P2YB 2LNKA 2P6BB 3AAKA 1B4CA 4PHKA 1BODA 4GGFA 1DJGA 3VB1A 4PE4A 2PSRA 1SW8A 4INXA 1CMGA 1D1OA 1CB1A 1IJ5A 2KYFA 1IH0A 2FJUB 4PDZA 4CFRA 4JD9A 1YX7A 1EG3A 1F4QA 1QX5B 1MXEA 3BJHA 2LAPA 3S0BA 3BOWB 3R1OA 1TIZA 4NDDA 1TNQA 4QJ3B 1L7ZA 1XFWO 1MHOA 3CZ1A 1LXFC 2P71A 4FQTA 1YX8A 4GGNA 5CSIA 1Y1AA 4GPLB 3V2LA 1BG1A 3PJIA 2K61A 3RM1A 1M45A 3O78A 1GGZA 1IJ6A 4C0KA 5HLOA 5GQQC 1S1EA 1DF0A 3VRPA 4DRWA 4WRIA 2CT9A 1QATA 2V53A 3M0WA 1CM4A 1RFJA 2WOSA 3CR2A 1RK9A 2ISDA 2L4HA 4OZDA 2KLDA 2ZNDA 1XO5A 4N5XA 3EKJA 3DVMA 2FOTA 3NHIA 4PHJA 3SS5A 3ZWHA 3D74A 5HLVA 1SCMC 5HKWA 1TOPA 3DVJA 3FWCA 3IQQA 3OB2B 1XYDA 2JULA 2KQ6A 2ERBA 1UHNA 2WCKA 2BCXA 2EC6B 3I5IC 5JOLA 1F55A 2K0JA 1SSEB 2RGIA 1NCYA 2HPSA 2E6WA 2I2RE 1KCYA 2QEVA 1G4YR 4JWQA 1A2XA 1GGWA 3S0FA 1SMGA 2LMVA 2BL0C 1JBAA 4FTGA 1FI5A 2F33A 3C1VA 4AQJA 1MR8A 2Y4QA 2H61C 2JOJA 1H4BA 3FE9A 2WCBA 4NQGA 1B8LA 1K9KA 2L5XB 2F2OA 1ODBA 2BECA 2WNDA 1JFJA 1A75B 1ZOTB 3H4SE 1S26D 3NSIA 1TNPA 2WCEA 2KAXA 2KI4B 4ORBB 3TS5C 3EVUA 1PALA 3I5FC 5I8NA 3PM2A 1ALWA 1PSBA 1KFUL 2BE4A 1B8CA 1CLMA 1SK6D 3O2PA 2TN4A 4BY5A 1MXLC 2JQ6A 1KFXL 2R2IA 2BNXA 3BOWA 3EK8A 1SR6C 2KI4C 2ZFDA 3EVRA 3UO9A 1KFUS 1YRTB 1C7WA 1PULA 5CSJA 4NDCA 2VRGA 2K8MB 2OTGB 5I2QA 4N1FA 2JXCA 1AUIB 2MLFC 3DD4A 1X02A 2K7CA 2CCMA 2F2PA 2L51A 1DJZA 3CR4X 1TCOB 4INWA 4WQ2A 2WCHA 1AVSA 3TDUA 1UURA 4FQOA 1OW4A 2OPOA 1TTXA 1KQVA 1SYMA 3OHMB 4OCIA 3AKAA 1CMFA 1KSOA 1QJTA 2LVIA 2ZRSA 3SS4A 1OOFA 2LP3A 1FF1A 1F4OA 2GGZA 1ZMZA 1RECA 3FE8A 3D78A 2KNEA 1XK4A 4DIRA 4MBEA 2HQ8A 2CBLA 2JZIA 2M49B 3SIAA 1NUBA 1JC2A 3VGOA 1V1GA 1ZACA 2PMYA 3I5GC 1DGUA 1DJWA 1YRUB 5CPVA 4UPGA 1DMOA 5DKRA 1LS8A 1RTP1 3BUXB 1R6PA 1RJVA 1JFKA 2QEBA 1OOHA 4GUKA 1EXRA 3BUOB 5FI2A 2M7LA 1FBVA 2COLB 4D1EA 3TZ1A 1WDCB 1F70A 1A29A 3GK2A 2B1UA 1P28A 2JXLA 3DVKA 1A75A 3BXKA 2PALA 3DY9A 3MSEB 1AP4A 3SG3A 3S0EA 1KK7Y 2Q91A 3GK4X 4TNCA 1SL8A 5HYDA 1WDCC 3F45A 1MQ1A 1NCZA 5B8IB 1QTXA 2KI6C 5K89A 1QIWA 4DCKA 4GAOA 1G33A 1DTLA 3PLFB 2I18A 4XYNA 2KHNA 3HX4A 1SKTA 1UHIA 2JPOA 2JTZA 2ZN9A 1K95A 3KHEA 3D73A 1NP8A 2LV7A 2MHHA 4XJKB 3NHTA 2ZN8A 4ICBA 5J3XA 2LMTA 1LKJA 1R2UA 1B7TZ 4KYNA 3D77A 1CDMA 1SPYA 1NX3A 1QIVA 1WY9A 1WRZA 4OR9B 2WCJA 3B86A 4MLWA 1F71A 3BUWB 1N65A 2BKIB 1JSAA 1CDNA 1QX7A 3UNWA 1YVLA 3WXAA 1GM0A 1SL9A 2LVKA 1WRLA 3CZ0A 1OMVA 2G2BA 2KFGA 2H2KA 3SS3A 3GOFA 4YBHB 4MRYA 3TDIA 3ZNIA 3S0AA 1S6JA 3NSKA 3PALA 4GFTA 4ETOA 4MZKA 3CZTX 3HCMA 4PE1A 1SCMB 4AOMA 1CNPA 3DXLA 1KWOB 4AQIA 1CLBA 3I5IB 3D0YB 4MZJA 2SASA 3FS7A 3BYAA 1XFZO 3LK0A 1WLMA 4HSZA 1PK0D 1TUJA 1M31A 3RLZA 2M97A 3WNXB 4MVFA 3SG5A 2GTEA 1YURA 2BAPA 3OGNA 1DEKA 2NCOA 1BU3A 2PRUA 1KWOC 1IKUA 3PSRA 2LVJA 1S5GZ 2BL0B 2M3WA 1N0YA 2EHBA 2KGBC 2PYQA 4P5OE 3B7AA 1SL7A 4MRXA 2WCLA 2LC5A 1OMDA 2DOQA 1K94A 2O60A 2CTNA 2JWWA 4GNKB 1K9PA 4F7FA 1CFFA 4USLA 1SNLA 1F54A 1DJIA 1BF5A 1NYAA 4QJ4B 4WQ3A 3S0DA 1DJYA 2PQLA 1IGVA 2HETA 4OV2A 3TS5B 3I5FB 1KSMA 5AERA 1QV0A 1QV1A 3DZTA 2QEHA 1OSAA 4HRGA 4HREE 4PHNA 5AXIA 5TNCA 1SR6B 3BFHA 1FW4A 1OOJA 4XJKA 5ER4X 1XFRA 2GGMA 1XFYO 2MAZA 2K7OA 1J7PA 3Q8IA 1DVIA 4U8DA 1KK8C 2OS8C 5D7FA 5FYXA 4I5KA 1AHRA 2Y1MA 5IBWA 2BE6A 2I7AA 2LHLA 2Q4UA 1B1GA 1CFCA 4CPVA 1QASA 2A4JA 2L5YA 1SY9A 5HKZA 2HF5A 1YTZC 1KFXS 1YUUA 1DJXA 1UWOA 3QRXA 1TNWA 2AUCA 5AANA 2KI6D 1DGVA 4YI9A 2KFHA 2MBXA 2LANA 2LHIA 3VROA 1GJYA 1UHKA 2YGUA 1SRAA 2CNPA 2LMUA 2M1KB 1V1FA 3AKBA 1W7JB 3PN7C 2F3YA 3CDNA 1WRKA 3D75A 1K2HA 1AK8A 2JC2A 3BFAA 3N7HA 3WHTB 1UUSA 3SJSA 1NX0A 1TRFA 4A4CA 5ER5A 3I5GB 3JTDC 3SG2A 1J7OA 1QVIZ 2JTTA 1BLQA 3BQ3A 3OX5A 4PT1A 5AFPA 1ORGA 1J1DA 2KSPA 3PM8A 1E8AA 1TNXA 4JKTA 2LE9B 1QLSA 1OQPA 1XA5A 2H61A 2L50A 3D10A 1Y1UA 1OMRA 4YGCB 1MUXA 1IQ5A 2JRFA 3K1EA 4GGFC 1NIWA 2K7BA 1K8UA 3CZ2A 3R72A 1NPQA 4YRUA 1M63B 3AAJA 3OP0A 3TDZA 1BT6A 4N1GA 1EG4A 4QJ5B 1K96A 5BPJA 2LUCA 2SCPA 1A03A 1WLZA 3OBVA 1PSRA 1CFDA 2QACA 4HRHA 1DF0B 4IJ7A 4BY4A 2WC6A 4PALA 2H8VA 1DJHA 2QPTA 3IVTA 1S36A 5I2OA 3EG5B 1JF0A 3OX6A 2KDHA 3D76A 4I5JA 3L4LA 2NLNA 3BUMB 2NXQA 2BBMA 4L9MA 1KQMB 1QS7A 3L4AA 5EL2A 1XVJA 2AMIA 1QXPA 2JNFA 5I2LA 5PALA 1C07A 2IS9A 1M46A 1CDPA 2K2AA 2FCDA 3CLNA 3VRRA 1G8IA 4YI8A 1Q80A 2LM5A 1UP5A 4OVNF 1NWDA 3I5HB 3IF7A 2KBMA 1EJ3A 1KQMC 1C3ZA 1XFVO 2MA2A 4ZCUA 3KPXA 1EH2A 3FE6A 2MJWB 4GBAA 1Y0VH 2KFFA 4M2QA 2L2CA 4ORCB 2WCFA 1CTRA 1IRJA 3I5HC 1BJFA 2BKHB 1XFUO 4C0LA 2L98A 3CS1A 1SCVA 1QLKA 3CYZA 1K9UA 2WC5A 1J1EA 3E3RA 1W9ZA 1YR5A 3O4YA 1FI6A 1B7TY 2LUXA 1BR4B 3LCPC 5KU1A 4CLNA 3GK1A 2M0RA 3K21A 1L2OB 1EL4A 1IWQA 1AJ4A 4M2OA 1RWYA 2EGDA 1RROA 2BBNA 3R1PA 3B88A 4MEWA 1TN4A 2AAOA 1CKKA 2HQWA 1OZSA 1L2OC 4E68A 1S6IA 1MWNA 1Y1XA 2KYCA 1LA3A 3A4UB 2L0PA 4PE0A 2NCPA 2NZ0A 5D3OA 2I94A 1N2DA 3SIBA 1A4PA 1JF2A 5KSZA 2KPHA 3BFBA 4MSPA 4PE7A 2M29A 3LL8B 3EVVA 3OB1B 1LINA 1MF8B 3QMEA 1ZFSA 4YGDB 4PCWA 3VRQA 5JJGA 1IIOA 2L2EA 2JT0A 4ORAB 1TCFA 1S3PA 5D69A 3KF9A 4C0JA 2CXJA 4NDBA 4DS7A 1CFPA 3JVTB 1K90D 2M9GA 1S5GY 4YGEB 2MRDA 1PVBA 2KLEA 1GQMA 2JU0A 3O4XA 1OE9B 1KK8B 2OS8B 4Q04A 4M2PA 1NSHA 2M7NA 1TWOA 3A8RA 3PFVA 3WHUB 3JVTC 1HQVA 2LVVA 2P70A 2WORA 5CSNA 1OOGA 2FJYA 1J55A 1NCXA 4IL1A 3ICBA 5DICA 1DQEA 2EC6C 5I94A 1XK4C 3NSLA 2LLSA 1ZUZA 1IG5A 3BUNB 3EK4A 3PN7B 1VRKA 3SG6A 1B47A 3CWGA 1CM1A 2BCBA 1Z4HA 5CSFA 1PVAA 2M8UA 3NGVA 3VRNA 1B9AA 1YUSA 2PASA 1IQ3A 5FI7A 1YUTA 3DF0B 3JTDB 1ALVA 4A4BA 2JT3A 1FPWA 1S6CA 4F0ZB 2MLEC 3D0YA 1LVCD 1U5IB 2Y1NA 1JUOA 2QDIA 1JWDA 1SBJA 2PVBA 3LK1A 2LLTA 3CR5X 3DYEA 1TUZA 4YGAA 2L4IA 2JPTA 2K7DA 3B6XA 5F6TA 3SG4A 3TUYB 1QWVA 2BCAA 1J7QA 3CTNA 4CFQA 2D8NA 4OKHA 4JPZB 2ZRTA 1AJ5A 2KAYA 2WC8A 1F8HA 4I5LB 2ZKMX 3KO0A 4JQ0D 3TUYC 1OOIX 3FIAA 2O5GA 1BMOA 2JNXA 1C7VA 1W7IB 3NSOA 1OZOA 4MN0A 3CABA 1K93D 1HT9A 2OTGC 1XFXO 2F3ZA 2K2FA 4CIDA 2KGRA 3EKHA 1QVIY 1LA0A 3IQOA 2M1UA 1NX2A 2Y5IA 5HKYA 3KEVA 2LLUA 3R1VA 3RZSA 3EK7A 1M39A 4R1EA 1Y6WA 4YGBB 2LCPA 2WCMA 5KTYA 1T14A 2KQYA 1NX1A 1DT7B 1CLLA 1CDLA 3L47A 2QEOA 1KK7Z 3S0GA 1J7RA 4PHMA 1C3YA 1PRWA 1YVHA 1DELA 3CGAA 3FWBA 2LP2A 3O6BA 1B8RA 3DVEA 4MZLA 5AEQA 1BR1B 1BOCA 3SG7A 2KBIA 1UHHA 2K60A 1QX2A 2FCEA 5DKNA 3LLEA 2KOTA 4I5NB 2G9BA 2KAVA 2F8PA 3DF0A 5DKQA 4ZCVA 1DC1A 1UHJA 3NXAA 2E30A 3PATA 2ZNEA 5FI6A 1H8BA 1U5IA
chains in the Genus database with same CATH topology
2GV5A 4DUQA 5G08A 2JT8A 4P2YB 2LNKA 2P6BB 3AAKA 1B4CA 4PHKA 1BODA 4GGFA 1DJGA 1D1OA 4PE4A 2PSRA 1SW8A 1CMGA 1CB1A 1IJ5A 2KYFA 1IH0A 2FJUB 4PDZA 4CFRA 1YX7A 1EG3A 1F4QA 1QX5B 1MXEA 2LAPA 3BOWB 4NDDA 1TIZA 1TNQA 4QJ3B 1L7ZA 1XFWO 1MHOA 1LXFC 1BG1A 4GGNA 1YX8A 5CSIA 1Y1AA 4GPLB 2K61A 3RM1A 1M45A 3O78A 1GGZA 1IJ6A 4C0KA 5HLOA 5GQQC 1S1EA 1DF0A 3VRPA 4DRWA 4WRIA 2CT9A 1QATA 2V53A 3M0WA 1CM4A 1RFJA 2WOSA 3CR2A 1RK9A 2ISDA 2L4HA 2ZNDA 1XO5A 4N5XA 3EKJA 3DVMA 2FOTA 4PHJA 3ZWHA 5HLVA 1SCMC 5HKWA 1TOPA 3DVJA 3FWCA 3IQQA 3OB2B 1XYDA 2JULA 2KQ6A 3I5IC 1UHNA 5JOLA 2BCXA 2EC6B 1F55A 2K0JA 2RGIA 1NCYA 2HPSA 2E6WA 2I2RE 1KCYA 1G4YR 4JWQA 1A2XA 1GGWA 1SMGA 2LMVA 2BL0C 1JBAA 4FTGA 1FI5A 2F33A 3C1VA 4AQJA 1MR8A 2Y4QA 2H61C 2JOJA 1H4BA 2WCBA 4NQGA 1B8LA 1K9KA 2L5XB 2F2OA 2BECA 1ODBA 2WNDA 1JFJA 1A75B 1ZOTB 3H4SE 1S26D 3NSIA 1TNPA 2WCEA 2KAXA 2KI4B 4ORBB 3TS5C 3EVUA 1PALA 3I5FC 5I8NA 1ALWA 1PSBA 1KFUL 2BE4A 1B8CA 1CLMA 1SK6D 3O2PA 2TN4A 4BY5A 1MXLC 2JQ6A 1KFXL 2R2IA 3BOWA 3EK8A 1SR6C 2KI4C 2ZFDA 3EVRA 1KFUS 1YRTB 1C7WA 1PULA 5CSJA 4NDCA 2VRGA 2K8MB 2OTGB 5I2QA 4N1FA 2JXCA 1AUIB 2MLFC 3DD4A 1X02A 2K7CA 2CCMA 2F2PA 2L51A 1DJZA 3CR4X 1TCOB 4WQ2A 1AVSA 3TDUA 1UURA 4FQOA 2OPOA 1TTXA 1KQVA 1SYMA 3OHMB 4OCIA 3AKAA 1CMFA 1KSOA 1QJTA 2LVIA 2ZRSA 2LP3A 1FF1A 1F4OA 2GGZA 1ZMZA 1RECA 2KNEA 1XK4A 4DIRA 4MBEA 2HQ8A 2CBLA 2JZIA 2M49B 3SIAA 1NUBA 1JC2A 3VGOA 1V1GA 1ZACA 2PMYA 3I5GC 1DGUA 1DJWA 1YRUB 5CPVA 4UPGA 1DMOA 5DKRA 3BUXB 1RTP1 1R6PA 1RJVA 1JFKA 4GUKA 1EXRA 3BUOB 2M7LA 1FBVA 2COLB 4D1EA 1WDCB 1F70A 1A29A 3GK2A 2B1UA 3DVKA 2JXLA 1A75A 3BXKA 2PALA 3MSEB 1AP4A 3SG3A 1KK7Y 2Q91A 3GK4X 4TNCA 1SL8A 5HYDA 1WDCC 3F45A 1MQ1A 1NCZA 5B8IB 1QTXA 2KI6C 5K89A 1QIWA 4DCKA 4GAOA 1G33A 1DTLA 3PLFB 2I18A 4XYNA 2KHNA 3HX4A 1SKTA 1UHIA 2JTZA 2ZN9A 1K95A 3KHEA 1NP8A 2LV7A 2MHHA 4XJKB 2ZN8A 4ICBA 5J3XA 2LMTA 1LKJA 1R2UA 1B7TZ 1CDMA 1SPYA 1NX3A 1QIVA 1WY9A 1WRZA 4OR9B 4MLWA 1F71A 3BUWB 1N65A 2BKIB 1JSAA 1CDNA 1QX7A 1YVLA 3WXAA 1SL9A 2LVKA 1WRLA 1OMVA 2G2BA 2KFGA 2H2KA 3GOFA 4YBHB 4MRYA 3TDIA 3ZNIA 1S6JA 3NSKA 3PALA 4GFTA 4ETOA 4MZKA 3CZTX 3HCMA 4PE1A 1SCMB 4AOMA 1CNPA 1KWOB 4AQIA 1CLBA 3I5IB 3D0YB 4MZJA 2SASA 3FS7A 3BYAA 1XFZO 3LK0A 1WLMA 4HSZA 1PK0D 3RLZA 1M31A 3WNXB 2M97A 4MVFA 3SG5A 1YURA 2NCOA 1BU3A 2PRUA 1KWOC 1IKUA 3PSRA 2LVJA 1S5GZ 2BL0B 2M3WA 1N0YA 2EHBA 2KGBC 4P5OE 4MRXA 1SL7A 2LC5A 1OMDA 2DOQA 1K94A 2O60A 2CTNA 2JWWA 4GNKB 1K9PA 1CFFA 4USLA 1SNLA 1F54A 1DJIA 1BF5A 1NYAA 4QJ4B 4WQ3A 1DJYA 4OV2A 1IGVA 2HETA 3TS5B 3I5FB 1KSMA 5AERA 1QV0A 1QV1A 1OSAA 4HRGA 4HREE 4PHNA 5AXIA 5TNCA 1SR6B 5ER4X 1FW4A 1OOJA 4XJKA 2GGMA 1XFYO 2MAZA 2K7OA 1J7PA 1DVIA 4U8DA 1KK8C 2OS8C 5D7FA 5FYXA 4I5KA 1AHRA 2Y1MA 5IBWA 2BE6A 2I7AA 2LHLA 2Q4UA 1B1GA 1CFCA 4CPVA 1QASA 2A4JA 5HKZA 1SY9A 2HF5A 1YTZC 1KFXS 1YUUA 1DJXA 1UWOA 3QRXA 1TNWA 2AUCA 5AANA 2KI6D 1DGVA 4YI9A 2KFHA 2MBXA 2LANA 2LHIA 3VROA 1GJYA 1UHKA 3AKBA 1SRAA 2CNPA 2LMUA 2M1KB 1V1FA 3PN7C 1W7JB 3TZ1A 2F3YA 1WRKA 1K2HA 1AK8A 2JC2A 3WHTB 1UUSA 3SJSA 1NX0A 1TRFA 4A4CA 5ER5A 3I5GB 3JTDC 3SG2A 1J7OA 1QVIZ 2JTTA 1BLQA 3BQ3A 3OX5A 5AFPA 3PM8A 1J1DA 2KSPA 1E8AA 1TNXA 2LE9B 1QLSA 1OQPA 1XA5A 2H61A 2L50A 3D10A 1Y1UA 1OMRA 4YGCB 1MUXA 1IQ5A 2JRFA 4GGFC 1NIWA 2K7BA 1K8UA 1NPQA 4YRUA 1M63B 3AAJA 3OP0A 3TDZA 1BT6A 4N1GA 1EG4A 4QJ5B 1K96A 5BPJA 2LUCA 2SCPA 1A03A 1WLZA 1PSRA 1CFDA 2QACA 4HRHA 1DF0B 4BY4A 4PALA 2QPTA 1DJHA 1S36A 5I2OA 1JF0A 3OX6A 2KDHA 4I5JA 2NLNA 3BUMB 2NXQA 2BBMA 4L9MA 1KQMB 1QS7A 1XVJA 2AMIA 1QXPA 2JNFA 5I2LA 5PALA 1C07A 2IS9A 1M46A 1CDPA 2K2AA 2FCDA 3CLNA 3VRRA 1G8IA 4YI8A 1Q80A 2LM5A 1UP5A 4OVNF 1NWDA 3I5HB 3IF7A 2KBMA 1EJ3A 1KQMC 1XFVO 2MA2A 4ZCUA 3KPXA 1EH2A 2MJWB 4GBAA 1Y0VH 2KFFA 4M2QA 4ORCB 2WCFA 1CTRA 1IRJA 3I5HC 1BJFA 2BKHB 1XFUO 4C0LA 2L98A 3CS1A 1SCVA 1QLKA 3E3RA 1K9UA 1J1EA 1YR5A 3O4YA 1FI6A 1B7TY 2LUXA 1BR4B 3LCPC 5KU1A 4CLNA 3GK1A 2M0RA 3K21A 1L2OB 1EL4A 1IWQA 1AJ4A 4M2OA 1RWYA 2EGDA 1RROA 2BBNA 4MEWA 1TN4A 2AAOA 1CKKA 2HQWA 1OZSA 1L2OC 4E68A 1S6IA 1MWNA 1Y1XA 2KYCA 1LA3A 3A4UB 2L0PA 4PE0A 2NCPA 2NZ0A 3SIBA 2I94A 1N2DA 1A4PA 1JF2A 5KSZA 4MSPA 4PE7A 2M29A 3LL8B 3EVVA 3OB1B 1LINA 1MF8B 4YGDB 1ZFSA 3VRQA 4PCWA 5JJGA 2L2EA 2JT0A 4ORAB 1TCFA 1S3PA 5D69A 3KF9A 4C0JA 2CXJA 4NDBA 4DS7A 1CFPA 3JVTB 1K90D 2M9GA 1S5GY 4YGEB 2MRDA 1PVBA 1GQMA 2JU0A 1OE9B 1KK8B 2OS8B 4Q04A 4M2PA 1NSHA 2M7NA 3A8RA 3PFVA 3WHUB 3JVTC 1HQVA 2LVVA 2WORA 5CSNA 1J55A 1NCXA 4IL1A 3ICBA 2EC6C 1XK4C 3NSLA 2LLSA 1ZUZA 1IG5A 3BUNB 3EK4A 3PN7B 1VRKA 3SG6A 1B47A 3CWGA 1CM1A 2BCBA 5CSFA 1PVAA 2M8UA 3VRNA 1B9AA 1YUSA 2PASA 1IQ3A 1YUTA 3DF0B 3JTDB 1ALVA 4A4BA 2JT3A 1FPWA 1S6CA 4F0ZB 2MLEC 3D0YA 1LVCD 1U5IB 2Y1NA 1JUOA 1JWDA 1SBJA 2PVBA 3LK1A 2LLTA 3CR5X 4YGAA 2L4IA 2JPTA 2K7DA 5F6TA 3SG4A 3TUYB 2BCAA 1J7QA 3CTNA 4CFQA 2D8NA 4OKHA 4JPZB 2ZRTA 1AJ5A 2KAYA 2WC8A 1F8HA 4I5LB 2ZKMX 3KO0A 4JQ0D 3TUYC 3FIAA 2O5GA 1BMOA 2JNXA 1C7VA 1W7IB 3NSOA 1OZOA 4MN0A 1K93D 1HT9A 2OTGC 1XFXO 2F3ZA 2K2FA 4CIDA 2KGRA 3EKHA 1QVIY 1LA0A 3IQOA 2M1UA 1NX2A 2Y5IA 5HKYA 3KEVA 2LLUA 3EK7A 1M39A 4R1EA 1Y6WA 4YGBB 2LCPA 5KTYA 2KQYA 1NX1A 1DT7B 1CLLA 1CDLA 1KK7Z 1J7RA 4PHMA 1PRWA 1YVHA 3CGAA 3FWBA 2LP2A 3O6BA 1B8RA 3DVEA 4MZLA 5AEQA 1BR1B 1BOCA 3SG7A 2KBIA 1UHHA 1QX2A 2FCEA 5DKNA 3LLEA 2KOTA 4I5NB 2G9BA 2KAVA 2F8PA 3DF0A 5DKQA 4ZCVA 1UHJA 3NXAA 2E30A 3PATA 2ZNEA 1H8BA 1U5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GV5 A;  4DUQ A;  5G08 A;  2JT8 A;  4P2Y B;  2LNK A;  2P6B B;  3AAK A;  1B4C A;  4PHK A;  1BOD A;  4GGF A;  1DJG A;  1D1O A;  4PE4 A;  2PSR A;  1SW8 A;  1CMG A;  1CB1 A;  1IJ5 A;  2KYF A;  1IH0 A;  2FJU B;  4PDZ A;  4CFR A;  1YX7 A;  1EG3 A;  1F4Q A;  1QX5 B;  1MXE A;  2LAP A;  3BOW B;  4NDD A;  1TIZ A;  1TNQ A;  4QJ3 B;  1L7Z A;  1XFW O;  1MHO A;  1LXF C;  1BG1 A;  4GGN A;  1YX8 A;  5CSI A;  1Y1A A;  4GPL B;  2K61 A;  3RM1 A;  1M45 A;  3O78 A;  1GGZ A;  1IJ6 A;  4C0K A;  5HLO A;  5GQQ C;  1S1E A;  1DF0 A;  3VRP A;  4DRW A;  4WRI A;  2CT9 A;  1QAT A;  2V53 A;  3M0W A;  1CM4 A;  1RFJ A;  2WOS A;  3CR2 A;  1RK9 A;  2ISD A;  2L4H A;  2ZND A;  1XO5 A;  4N5X A;  3EKJ A;  3DVM A;  2FOT A;  4PHJ A;  3ZWH A;  5HLV A;  1SCM C;  5HKW A;  1TOP A;  3DVJ A;  3FWC A;  3IQQ A;  3OB2 B;  1XYD A;  2JUL A;  2KQ6 A;  3I5I C;  1UHN A;  5JOL A;  2BCX A;  2EC6 B;  1F55 A;  2K0J A;  2RGI A;  1NCY A;  2HPS A;  2E6W A;  2I2R E;  1KCY A;  1G4Y R;  4JWQ A;  1A2X A;  1GGW A;  1SMG A;  2LMV A;  2BL0 C;  1JBA A;  4FTG A;  1FI5 A;  2F33 A;  3C1V A;  4AQJ A;  1MR8 A;  2Y4Q A;  2H61 C;  2JOJ A;  1H4B A;  2WCB A;  4NQG A;  1B8L A;  1K9K A;  2L5X B;  2F2O A;  2BEC A;  1ODB A;  2WND A;  1JFJ A;  1A75 B;  1ZOT B;  3H4S E;  1S26 D;  3NSI A;  1TNP A;  2WCE A;  2KAX A;  2KI4 B;  4ORB B;  3TS5 C;  3EVU A;  1PAL A;  3I5F C;  5I8N A;  1ALW A;  1PSB A;  1KFU L;  2BE4 A;  1B8C A;  1CLM A;  1SK6 D;  3O2P A;  2TN4 A;  4BY5 A;  1MXL C;  2JQ6 A;  1KFX L;  2R2I A;  3BOW A;  3EK8 A;  1SR6 C;  2KI4 C;  2ZFD A;  3EVR A;  1KFU S;  1YRT B;  1C7W A;  1PUL A;  5CSJ A;  4NDC A;  2VRG A;  2K8M B;  2OTG B;  5I2Q A;  4N1F A;  2JXC A;  1AUI B;  2MLF C;  3DD4 A;  1X02 A;  2K7C A;  2CCM A;  2F2P A;  2L51 A;  1DJZ A;  3CR4 X;  1TCO B;  4WQ2 A;  1AVS A;  3TDU A;  1UUR A;  4FQO A;  2OPO A;  1TTX A;  1KQV A;  1SYM A;  3OHM B;  4OCI A;  3AKA A;  1CMF A;  1KSO A;  1QJT A;  2LVI A;  2ZRS A;  2LP3 A;  1FF1 A;  1F4O A;  2GGZ A;  1ZMZ A;  1REC A;  2KNE A;  1XK4 A;  4DIR A;  4MBE A;  2HQ8 A;  2CBL A;  2JZI A;  2M49 B;  3SIA A;  1NUB A;  1JC2 A;  3VGO A;  1V1G A;  1ZAC A;  2PMY A;  3I5G C;  1DGU A;  1DJW A;  1YRU B;  5CPV A;  4UPG A;  1DMO A;  5DKR A;  3BUX B;  1RTP 1;  1R6P A;  1RJV A;  1JFK A;  4GUK A;  1EXR A;  3BUO B;  2M7L A;  1FBV A;  2COL B;  4D1E A;  1WDC B;  1F70 A;  1A29 A;  3GK2 A;  2B1U A;  3DVK A;  2JXL A;  1A75 A;  3BXK A;  2PAL A;  3MSE B;  1AP4 A;  3SG3 A;  1KK7 Y;  2Q91 A;  3GK4 X;  4TNC A;  1SL8 A;  5HYD A;  1WDC C;  3F45 A;  1MQ1 A;  1NCZ A;  5B8I B;  1QTX A;  2KI6 C;  5K89 A;  1QIW A;  4DCK A;  4GAO A;  1G33 A;  1DTL A;  3PLF B;  2I18 A;  4XYN A;  2KHN A;  3HX4 A;  1SKT A;  1UHI A;  2JTZ A;  2ZN9 A;  1K95 A;  3KHE A;  1NP8 A;  2LV7 A;  2MHH A;  4XJK B;  2ZN8 A;  4ICB A;  5J3X A;  2LMT A;  1LKJ A;  1R2U A;  1B7T Z;  1CDM A;  1SPY A;  1NX3 A;  1QIV A;  1WY9 A;  1WRZ A;  4OR9 B;  4MLW A;  1F71 A;  3BUW B;  1N65 A;  2BKI B;  1JSA A;  1CDN A;  1QX7 A;  1YVL A;  3WXA A;  1SL9 A;  2LVK A;  1WRL A;  1OMV A;  2G2B A;  2KFG A;  2H2K A;  3GOF A;  4YBH B;  4MRY A;  3TDI A;  3ZNI A;  1S6J A;  3NSK A;  3PAL A;  4GFT A;  4ETO A;  4MZK A;  3CZT X;  3HCM A;  4PE1 A;  1SCM B;  4AOM A;  1CNP A;  1KWO B;  4AQI A;  1CLB A;  3I5I B;  3D0Y B;  4MZJ A;  2SAS A;  3FS7 A;  3BYA A;  1XFZ O;  3LK0 A;  1WLM A;  4HSZ A;  1PK0 D;  3RLZ A;  1M31 A;  3WNX B;  2M97 A;  4MVF A;  3SG5 A;  1YUR A;  2NCO A;  1BU3 A;  2PRU A;  1KWO C;  1IKU A;  3PSR A;  2LVJ A;  1S5G Z;  2BL0 B;  2M3W A;  1N0Y A;  2EHB A;  2KGB C;  4P5O E;  4MRX A;  1SL7 A;  2LC5 A;  1OMD A;  2DOQ A;  1K94 A;  2O60 A;  2CTN A;  2JWW A;  4GNK B;  1K9P A;  1CFF A;  4USL A;  1SNL A;  1F54 A;  1DJI A;  1BF5 A;  1NYA A;  4QJ4 B;  4WQ3 A;  1DJY A;  4OV2 A;  1IGV A;  2HET A;  3TS5 B;  3I5F B;  1KSM A;  5AER A;  1QV0 A;  1QV1 A;  1OSA A;  4HRG A;  4HRE E;  4PHN A;  5AXI A;  5TNC A;  1SR6 B;  5ER4 X;  1FW4 A;  1OOJ A;  4XJK A;  2GGM A;  1XFY O;  2MAZ A;  2K7O A;  1J7P A;  1DVI A;  4U8D A;  1KK8 C;  2OS8 C;  5D7F A;  5FYX A;  4I5K A;  1AHR A;  2Y1M A;  5IBW A;  2BE6 A;  2I7A A;  2LHL A;  2Q4U A;  1B1G A;  1CFC A;  4CPV A;  1QAS A;  2A4J A;  5HKZ A;  1SY9 A;  2HF5 A;  1YTZ C;  1KFX S;  1YUU A;  1DJX A;  1UWO A;  3QRX A;  1TNW A;  2AUC A;  5AAN A;  2KI6 D;  1DGV A;  4YI9 A;  2KFH A;  2MBX A;  2LAN A;  2LHI A;  3VRO A;  1GJY A;  1UHK A;  3AKB A;  1SRA A;  2CNP A;  2LMU A;  2M1K B;  1V1F A;  3PN7 C;  1W7J B;  3TZ1 A;  2F3Y A;  1WRK A;  1K2H A;  1AK8 A;  2JC2 A;  3WHT B;  1UUS A;  3SJS A;  1NX0 A;  1TRF A;  4A4C A;  5ER5 A;  3I5G B;  3JTD C;  3SG2 A;  1J7O A;  1QVI Z;  2JTT A;  1BLQ A;  3BQ3 A;  3OX5 A;  5AFP A;  3PM8 A;  1J1D A;  2KSP A;  1E8A A;  1TNX A;  2LE9 B;  1QLS A;  1OQP A;  1XA5 A;  2H61 A;  2L50 A;  3D10 A;  1Y1U A;  1OMR A;  4YGC B;  1MUX A;  1IQ5 A;  2JRF A;  4GGF C;  1NIW A;  2K7B A;  1K8U A;  1NPQ A;  4YRU A;  1M63 B;  3AAJ A;  3OP0 A;  3TDZ A;  1BT6 A;  4N1G A;  1EG4 A;  4QJ5 B;  1K96 A;  5BPJ A;  2LUC A;  2SCP A;  1A03 A;  1WLZ A;  1PSR A;  1CFD A;  2QAC A;  4HRH A;  1DF0 B;  4BY4 A;  4PAL A;  2QPT A;  1DJH A;  1S36 A;  5I2O A;  1JF0 A;  3OX6 A;  2KDH A;  4I5J A;  2NLN A;  3BUM B;  2NXQ A;  2BBM A;  4L9M A;  1KQM B;  1QS7 A;  1XVJ A;  2AMI A;  1QXP A;  2JNF A;  5I2L A;  5PAL A;  1C07 A;  2IS9 A;  1M46 A;  1CDP A;  2K2A A;  2FCD A;  3CLN A;  3VRR A;  1G8I A;  4YI8 A;  1Q80 A;  2LM5 A;  1UP5 A;  4OVN F;  1NWD A;  3I5H B;  3IF7 A;  2KBM A;  1EJ3 A;  1KQM C;  1XFV O;  2MA2 A;  4ZCU A;  3KPX A;  1EH2 A;  2MJW B;  4GBA A;  1Y0V H;  2KFF A;  4M2Q A;  4ORC B;  2WCF A;  1CTR A;  1IRJ A;  3I5H C;  1BJF A;  2BKH B;  1XFU O;  4C0L A;  2L98 A;  3CS1 A;  1SCV A;  1QLK A;  3E3R A;  1K9U A;  1J1E A;  1YR5 A;  3O4Y A;  1FI6 A;  1B7T Y;  2LUX A;  1BR4 B;  3LCP C;  5KU1 A;  4CLN A;  3GK1 A;  2M0R A;  3K21 A;  1L2O B;  1EL4 A;  1IWQ A;  1AJ4 A;  4M2O A;  1RWY A;  2EGD A;  1RRO A;  2BBN A;  4MEW A;  1TN4 A;  2AAO A;  1CKK A;  2HQW A;  1OZS A;  1L2O C;  4E68 A;  1S6I A;  1MWN A;  1Y1X A;  2KYC A;  1LA3 A;  3A4U B;  2L0P A;  4PE0 A;  2NCP A;  2NZ0 A;  3SIB A;  2I94 A;  1N2D A;  1A4P A;  1JF2 A;  5KSZ A;  4MSP A;  4PE7 A;  2M29 A;  3LL8 B;  3EVV A;  3OB1 B;  1LIN A;  1MF8 B;  4YGD B;  1ZFS A;  3VRQ A;  4PCW A;  5JJG A;  2L2E A;  2JT0 A;  4ORA B;  1TCF A;  1S3P A;  5D69 A;  3KF9 A;  4C0J A;  2CXJ A;  4NDB A;  4DS7 A;  1CFP A;  3JVT B;  1K90 D;  2M9G A;  1S5G Y;  4YGE B;  2MRD A;  1PVB A;  1GQM A;  2JU0 A;  1OE9 B;  1KK8 B;  2OS8 B;  4Q04 A;  4M2P A;  1NSH A;  2M7N A;  3A8R A;  3PFV A;  3WHU B;  3JVT C;  1HQV A;  2LVV A;  2WOR A;  5CSN A;  1J55 A;  1NCX A;  4IL1 A;  3ICB A;  2EC6 C;  1XK4 C;  3NSL A;  2LLS A;  1ZUZ A;  1IG5 A;  3BUN B;  3EK4 A;  3PN7 B;  1VRK A;  3SG6 A;  1B47 A;  3CWG A;  1CM1 A;  2BCB A;  5CSF A;  1PVA A;  2M8U A;  3VRN A;  1B9A A;  1YUS A;  2PAS A;  1IQ3 A;  1YUT A;  3DF0 B;  3JTD B;  1ALV A;  4A4B A;  2JT3 A;  1FPW A;  1S6C A;  4F0Z B;  2MLE C;  3D0Y A;  1LVC D;  1U5I B;  2Y1N A;  1JUO A;  1JWD A;  1SBJ A;  2PVB A;  3LK1 A;  2LLT A;  3CR5 X;  4YGA A;  2L4I A;  2JPT A;  2K7D A;  5F6T A;  3SG4 A;  3TUY B;  2BCA A;  1J7Q A;  3CTN A;  4CFQ A;  2D8N A;  4OKH A;  4JPZ B;  2ZRT A;  1AJ5 A;  2KAY A;  2WC8 A;  1F8H A;  4I5L B;  2ZKM X;  3KO0 A;  4JQ0 D;  3TUY C;  3FIA A;  2O5G A;  1BMO A;  2JNX A;  1C7V A;  1W7I B;  3NSO A;  1OZO A;  4MN0 A;  1K93 D;  1HT9 A;  2OTG C;  1XFX O;  2F3Z A;  2K2F A;  4CID A;  2KGR A;  3EKH A;  1QVI Y;  1LA0 A;  3IQO A;  2M1U A;  1NX2 A;  2Y5I A;  5HKY A;  3KEV A;  2LLU A;  3EK7 A;  1M39 A;  4R1E A;  1Y6W A;  4YGB B;  2LCP A;  5KTY A;  2KQY A;  1NX1 A;  1DT7 B;  1CLL A;  1CDL A;  1KK7 Z;  1J7R A;  4PHM A;  1PRW A;  1YVH A;  3CGA A;  3FWB A;  2LP2 A;  3O6B A;  1B8R A;  3DVE A;  4MZL A;  5AEQ A;  1BR1 B;  1BOC A;  3SG7 A;  2KBI A;  1UHH A;  1QX2 A;  2FCE A;  5DKN A;  3LLE A;  2KOT A;  4I5N B;  2G9B A;  2KAV A;  2F8P A;  3DF0 A;  5DKQ A;  4ZCV A;  1UHJ A;  3NXA A;  2E30 A;  3PAT A;  2ZNE A;  1H8B A;  1U5I A; 
#chains in the Genus database with same CATH topology
 1Z2C B;  2GV5 A;  3B87 A;  5HL1 A;  4DUQ A;  5G08 A;  2JT8 A;  4P2Y B;  2LNK A;  2P6B B;  3AAK A;  1B4C A;  4PHK A;  1BOD A;  4GGF A;  1DJG A;  3VB1 A;  4PE4 A;  2PSR A;  1SW8 A;  4INX A;  1CMG A;  1D1O A;  1CB1 A;  1IJ5 A;  2KYF A;  1IH0 A;  2FJU B;  4PDZ A;  4CFR A;  4JD9 A;  1YX7 A;  1EG3 A;  1F4Q A;  1QX5 B;  1MXE A;  3BJH A;  2LAP A;  3S0B A;  3BOW B;  3R1O A;  1TIZ A;  4NDD A;  1TNQ A;  4QJ3 B;  1L7Z A;  1XFW O;  1MHO A;  3CZ1 A;  1LXF C;  2P71 A;  4FQT A;  1YX8 A;  4GGN A;  5CSI A;  1Y1A A;  4GPL B;  3V2L A;  1BG1 A;  3PJI A;  2K61 A;  3RM1 A;  1M45 A;  3O78 A;  1GGZ A;  1IJ6 A;  4C0K A;  5HLO A;  5GQQ C;  1S1E A;  1DF0 A;  3VRP A;  4DRW A;  4WRI A;  2CT9 A;  1QAT A;  2V53 A;  3M0W A;  1CM4 A;  1RFJ A;  2WOS A;  3CR2 A;  1RK9 A;  2ISD A;  2L4H A;  4OZD A;  2KLD A;  2ZND A;  1XO5 A;  4N5X A;  3EKJ A;  3DVM A;  2FOT A;  3NHI A;  4PHJ A;  3SS5 A;  3ZWH A;  3D74 A;  5HLV A;  1SCM C;  5HKW A;  1TOP A;  3DVJ A;  3FWC A;  3IQQ A;  3OB2 B;  1XYD A;  2JUL A;  2KQ6 A;  2ERB A;  1UHN A;  2WCK A;  2BCX A;  2EC6 B;  3I5I C;  5JOL A;  1F55 A;  2K0J A;  1SSE B;  2RGI A;  1NCY A;  2HPS A;  2E6W A;  2I2R E;  1KCY A;  2QEV A;  1G4Y R;  4JWQ A;  1A2X A;  1GGW A;  3S0F A;  1SMG A;  2LMV A;  2BL0 C;  1JBA A;  4FTG A;  1FI5 A;  2F33 A;  3C1V A;  4AQJ A;  1MR8 A;  2Y4Q A;  2H61 C;  2JOJ A;  1H4B A;  3FE9 A;  2WCB A;  4NQG A;  1B8L A;  1K9K A;  2L5X B;  2F2O A;  1ODB A;  2BEC A;  2WND A;  1JFJ A;  1A75 B;  1ZOT B;  3H4S E;  1S26 D;  3NSI A;  1TNP A;  2WCE A;  2KAX A;  2KI4 B;  4ORB B;  3TS5 C;  3EVU A;  1PAL A;  3I5F C;  5I8N A;  3PM2 A;  1ALW A;  1PSB A;  1KFU L;  2BE4 A;  1B8C A;  1CLM A;  1SK6 D;  3O2P A;  2TN4 A;  4BY5 A;  1MXL C;  2JQ6 A;  1KFX L;  2R2I A;  2BNX A;  3BOW A;  3EK8 A;  1SR6 C;  2KI4 C;  2ZFD A;  3EVR A;  3UO9 A;  1KFU S;  1YRT B;  1C7W A;  1PUL A;  5CSJ A;  4NDC A;  2VRG A;  2K8M B;  2OTG B;  5I2Q A;  4N1F A;  2JXC A;  1AUI B;  2MLF C;  3DD4 A;  1X02 A;  2K7C A;  2CCM A;  2F2P A;  2L51 A;  1DJZ A;  3CR4 X;  1TCO B;  4INW A;  4WQ2 A;  2WCH A;  1AVS A;  3TDU A;  1UUR A;  4FQO A;  1OW4 A;  2OPO A;  1TTX A;  1KQV A;  1SYM A;  3OHM B;  4OCI A;  3AKA A;  1CMF A;  1KSO A;  1QJT A;  2LVI A;  2ZRS A;  3SS4 A;  1OOF A;  2LP3 A;  1FF1 A;  1F4O A;  2GGZ A;  1ZMZ A;  1REC A;  3FE8 A;  3D78 A;  2KNE A;  1XK4 A;  4DIR A;  4MBE A;  2HQ8 A;  2CBL A;  2JZI A;  2M49 B;  3SIA A;  1NUB A;  1JC2 A;  3VGO A;  1V1G A;  1ZAC A;  2PMY A;  3I5G C;  1DGU A;  1DJW A;  1YRU B;  5CPV A;  4UPG A;  1DMO A;  5DKR A;  1LS8 A;  1RTP 1;  3BUX B;  1R6P A;  1RJV A;  1JFK A;  2QEB A;  1OOH A;  4GUK A;  1EXR A;  3BUO B;  5FI2 A;  2M7L A;  1FBV A;  2COL B;  4D1E A;  3TZ1 A;  1WDC B;  1F70 A;  1A29 A;  3GK2 A;  2B1U A;  1P28 A;  2JXL A;  3DVK A;  1A75 A;  3BXK A;  2PAL A;  3DY9 A;  3MSE B;  1AP4 A;  3SG3 A;  3S0E A;  1KK7 Y;  2Q91 A;  3GK4 X;  4TNC A;  1SL8 A;  5HYD A;  1WDC C;  3F45 A;  1MQ1 A;  1NCZ A;  5B8I B;  1QTX A;  2KI6 C;  5K89 A;  1QIW A;  4DCK A;  4GAO A;  1G33 A;  1DTL A;  3PLF B;  2I18 A;  4XYN A;  2KHN A;  3HX4 A;  1SKT A;  1UHI A;  2JPO A;  2JTZ A;  2ZN9 A;  1K95 A;  3KHE A;  3D73 A;  1NP8 A;  2LV7 A;  2MHH A;  4XJK B;  3NHT A;  2ZN8 A;  4ICB A;  5J3X A;  2LMT A;  1LKJ A;  1R2U A;  1B7T Z;  4KYN A;  3D77 A;  1CDM A;  1SPY A;  1NX3 A;  1QIV A;  1WY9 A;  1WRZ A;  4OR9 B;  2WCJ A;  3B86 A;  4MLW A;  1F71 A;  3BUW B;  1N65 A;  2BKI B;  1JSA A;  1CDN A;  1QX7 A;  3UNW A;  1YVL A;  3WXA A;  1GM0 A;  1SL9 A;  2LVK A;  1WRL A;  3CZ0 A;  1OMV A;  2G2B A;  2KFG A;  2H2K A;  3SS3 A;  3GOF A;  4YBH B;  4MRY A;  3TDI A;  3ZNI A;  3S0A A;  1S6J A;  3NSK A;  3PAL A;  4GFT A;  4ETO A;  4MZK A;  3CZT X;  3HCM A;  4PE1 A;  1SCM B;  4AOM A;  1CNP A;  3DXL A;  1KWO B;  4AQI A;  1CLB A;  3I5I B;  3D0Y B;  4MZJ A;  2SAS A;  3FS7 A;  3BYA A;  1XFZ O;  3LK0 A;  1WLM A;  4HSZ A;  1PK0 D;  1TUJ A;  1M31 A;  3RLZ A;  2M97 A;  3WNX B;  4MVF A;  3SG5 A;  2GTE A;  1YUR A;  2BAP A;  3OGN A;  1DEK A;  2NCO A;  1BU3 A;  2PRU A;  1KWO C;  1IKU A;  3PSR A;  2LVJ A;  1S5G Z;  2BL0 B;  2M3W A;  1N0Y A;  2EHB A;  2KGB C;  2PYQ A;  4P5O E;  3B7A A;  1SL7 A;  4MRX A;  2WCL A;  2LC5 A;  1OMD A;  2DOQ A;  1K94 A;  2O60 A;  2CTN A;  2JWW A;  4GNK B;  1K9P A;  4F7F A;  1CFF A;  4USL A;  1SNL A;  1F54 A;  1DJI A;  1BF5 A;  1NYA A;  4QJ4 B;  4WQ3 A;  3S0D A;  1DJY A;  2PQL A;  1IGV A;  2HET A;  4OV2 A;  3TS5 B;  3I5F B;  1KSM A;  5AER A;  1QV0 A;  1QV1 A;  3DZT A;  2QEH A;  1OSA A;  4HRG A;  4HRE E;  4PHN A;  5AXI A;  5TNC A;  1SR6 B;  3BFH A;  1FW4 A;  1OOJ A;  4XJK A;  5ER4 X;  1XFR A;  2GGM A;  1XFY O;  2MAZ A;  2K7O A;  1J7P A;  3Q8I A;  1DVI A;  4U8D A;  1KK8 C;  2OS8 C;  5D7F A;  5FYX A;  4I5K A;  1AHR A;  2Y1M A;  5IBW A;  2BE6 A;  2I7A A;  2LHL A;  2Q4U A;  1B1G A;  1CFC A;  4CPV A;  1QAS A;  2A4J A;  2L5Y A;  1SY9 A;  5HKZ A;  2HF5 A;  1YTZ C;  1KFX S;  1YUU A;  1DJX A;  1UWO A;  3QRX A;  1TNW A;  2AUC A;  5AAN A;  2KI6 D;  1DGV A;  4YI9 A;  2KFH A;  2MBX A;  2LAN A;  2LHI A;  3VRO A;  1GJY A;  1UHK A;  2YGU A;  1SRA A;  2CNP A;  2LMU A;  2M1K B;  1V1F A;  3AKB A;  1W7J B;  3PN7 C;  2F3Y A;  3CDN A;  1WRK A;  3D75 A;  1K2H A;  1AK8 A;  2JC2 A;  3BFA A;  3N7H A;  3WHT B;  1UUS A;  3SJS A;  1NX0 A;  1TRF A;  4A4C A;  5ER5 A;  3I5G B;  3JTD C;  3SG2 A;  1J7O A;  1QVI Z;  2JTT A;  1BLQ A;  3BQ3 A;  3OX5 A;  4PT1 A;  5AFP A;  1ORG A;  1J1D A;  2KSP A;  3PM8 A;  1E8A A;  1TNX A;  4JKT A;  2LE9 B;  1QLS A;  1OQP A;  1XA5 A;  2H61 A;  2L50 A;  3D10 A;  1Y1U A;  1OMR A;  4YGC B;  1MUX A;  1IQ5 A;  2JRF A;  3K1E A;  4GGF C;  1NIW A;  2K7B A;  1K8U A;  3CZ2 A;  3R72 A;  1NPQ A;  4YRU A;  1M63 B;  3AAJ A;  3OP0 A;  3TDZ A;  1BT6 A;  4N1G A;  1EG4 A;  4QJ5 B;  1K96 A;  5BPJ A;  2LUC A;  2SCP A;  1A03 A;  1WLZ A;  3OBV A;  1PSR A;  1CFD A;  2QAC A;  4HRH A;  1DF0 B;  4IJ7 A;  4BY4 A;  2WC6 A;  4PAL A;  2H8V A;  1DJH A;  2QPT A;  3IVT A;  1S36 A;  5I2O A;  3EG5 B;  1JF0 A;  3OX6 A;  2KDH A;  3D76 A;  4I5J A;  3L4L A;  2NLN A;  3BUM B;  2NXQ A;  2BBM A;  4L9M A;  1KQM B;  1QS7 A;  3L4A A;  5EL2 A;  1XVJ A;  2AMI A;  1QXP A;  2JNF A;  5I2L A;  5PAL A;  1C07 A;  2IS9 A;  1M46 A;  1CDP A;  2K2A A;  2FCD A;  3CLN A;  3VRR A;  1G8I A;  4YI8 A;  1Q80 A;  2LM5 A;  1UP5 A;  4OVN F;  1NWD A;  3I5H B;  3IF7 A;  2KBM A;  1EJ3 A;  1KQM C;  1C3Z A;  1XFV O;  2MA2 A;  4ZCU A;  3KPX A;  1EH2 A;  3FE6 A;  2MJW B;  4GBA A;  1Y0V H;  2KFF A;  4M2Q A;  2L2C A;  4ORC B;  2WCF A;  1CTR A;  1IRJ A;  3I5H C;  1BJF A;  2BKH B;  1XFU O;  4C0L A;  2L98 A;  3CS1 A;  1SCV A;  1QLK A;  3CYZ A;  1K9U A;  2WC5 A;  1J1E A;  3E3R A;  1W9Z A;  1YR5 A;  3O4Y A;  1FI6 A;  1B7T Y;  2LUX A;  1BR4 B;  3LCP C;  5KU1 A;  4CLN A;  3GK1 A;  2M0R A;  3K21 A;  1L2O B;  1EL4 A;  1IWQ A;  1AJ4 A;  4M2O A;  1RWY A;  2EGD A;  1RRO A;  2BBN A;  3R1P A;  3B88 A;  4MEW A;  1TN4 A;  2AAO A;  1CKK A;  2HQW A;  1OZS A;  1L2O C;  4E68 A;  1S6I A;  1MWN A;  1Y1X A;  2KYC A;  1LA3 A;  3A4U B;  2L0P A;  4PE0 A;  2NCP A;  2NZ0 A;  5D3O A;  2I94 A;  1N2D A;  3SIB A;  1A4P A;  1JF2 A;  5KSZ A;  2KPH A;  3BFB A;  4MSP A;  4PE7 A;  2M29 A;  3LL8 B;  3EVV A;  3OB1 B;  1LIN A;  1MF8 B;  3QME A;  1ZFS A;  4YGD B;  4PCW A;  3VRQ A;  5JJG A;  1IIO A;  2L2E A;  2JT0 A;  4ORA B;  1TCF A;  1S3P A;  5D69 A;  3KF9 A;  4C0J A;  2CXJ A;  4NDB A;  4DS7 A;  1CFP A;  3JVT B;  1K90 D;  2M9G A;  1S5G Y;  4YGE B;  2MRD A;  1PVB A;  2KLE A;  1GQM A;  2JU0 A;  3O4X A;  1OE9 B;  1KK8 B;  2OS8 B;  4Q04 A;  4M2P A;  1NSH A;  2M7N A;  1TWO A;  3A8R A;  3PFV A;  3WHU B;  3JVT C;  1HQV A;  2LVV A;  2P70 A;  2WOR A;  5CSN A;  1OOG A;  2FJY A;  1J55 A;  1NCX A;  4IL1 A;  3ICB A;  5DIC A;  1DQE A;  2EC6 C;  5I94 A;  1XK4 C;  3NSL A;  2LLS A;  1ZUZ A;  1IG5 A;  3BUN B;  3EK4 A;  3PN7 B;  1VRK A;  3SG6 A;  1B47 A;  3CWG A;  1CM1 A;  2BCB A;  1Z4H A;  5CSF A;  1PVA A;  2M8U A;  3NGV A;  3VRN A;  1B9A A;  1YUS A;  2PAS A;  1IQ3 A;  5FI7 A;  1YUT A;  3DF0 B;  3JTD B;  1ALV A;  4A4B A;  2JT3 A;  1FPW A;  1S6C A;  4F0Z B;  2MLE C;  3D0Y A;  1LVC D;  1U5I B;  2Y1N A;  1JUO A;  2QDI A;  1JWD A;  1SBJ A;  2PVB A;  3LK1 A;  2LLT A;  3CR5 X;  3DYE A;  1TUZ A;  4YGA A;  2L4I A;  2JPT A;  2K7D A;  3B6X A;  5F6T A;  3SG4 A;  3TUY B;  1QWV A;  2BCA A;  1J7Q A;  3CTN A;  4CFQ A;  2D8N A;  4OKH A;  4JPZ B;  2ZRT A;  1AJ5 A;  2KAY A;  2WC8 A;  1F8H A;  4I5L B;  2ZKM X;  3KO0 A;  4JQ0 D;  3TUY C;  1OOI X;  3FIA A;  2O5G A;  1BMO A;  2JNX A;  1C7V A;  1W7I B;  3NSO A;  1OZO A;  4MN0 A;  3CAB A;  1K93 D;  1HT9 A;  2OTG C;  1XFX O;  2F3Z A;  2K2F A;  4CID A;  2KGR A;  3EKH A;  1QVI Y;  1LA0 A;  3IQO A;  2M1U A;  1NX2 A;  2Y5I A;  5HKY A;  3KEV A;  2LLU A;  3R1V A;  3RZS A;  3EK7 A;  1M39 A;  4R1E A;  1Y6W A;  4YGB B;  2LCP A;  2WCM A;  5KTY A;  1T14 A;  2KQY A;  1NX1 A;  1DT7 B;  1CLL A;  1CDL A;  3L47 A;  2QEO A;  1KK7 Z;  3S0G A;  1J7R A;  4PHM A;  1C3Y A;  1PRW A;  1YVH A;  1DEL A;  3CGA A;  3FWB A;  2LP2 A;  3O6B A;  1B8R A;  3DVE A;  4MZL A;  5AEQ A;  1BR1 B;  1BOC A;  3SG7 A;  2KBI A;  1UHH A;  2K60 A;  1QX2 A;  2FCE A;  5DKN A;  3LLE A;  2KOT A;  4I5N B;  2G9B A;  2KAV A;  2F8P A;  3DF0 A;  5DKQ A;  4ZCV A;  1DC1 A;  1UHJ A;  3NXA A;  2E30 A;  3PAT A;  2ZNE A;  5FI6 A;  1H8B A;  1U5I A; 
#chains in the Genus database with same CATH homology
 2GV5 A;  4DUQ A;  5G08 A;  2JT8 A;  4P2Y B;  2LNK A;  2P6B B;  3AAK A;  1B4C A;  4PHK A;  1BOD A;  4GGF A;  1DJG A;  1D1O A;  4PE4 A;  2PSR A;  1SW8 A;  1CMG A;  1CB1 A;  1IJ5 A;  2KYF A;  1IH0 A;  2FJU B;  4PDZ A;  4CFR A;  1YX7 A;  1EG3 A;  1F4Q A;  1QX5 B;  1MXE A;  2LAP A;  3BOW B;  4NDD A;  1TIZ A;  1TNQ A;  4QJ3 B;  1L7Z A;  1XFW O;  1MHO A;  1LXF C;  1BG1 A;  4GGN A;  1YX8 A;  5CSI A;  1Y1A A;  4GPL B;  2K61 A;  3RM1 A;  1M45 A;  3O78 A;  1GGZ A;  1IJ6 A;  4C0K A;  5HLO A;  5GQQ C;  1S1E A;  1DF0 A;  3VRP A;  4DRW A;  4WRI A;  2CT9 A;  1QAT A;  2V53 A;  3M0W A;  1CM4 A;  1RFJ A;  2WOS A;  3CR2 A;  1RK9 A;  2ISD A;  2L4H A;  2ZND A;  1XO5 A;  4N5X A;  3EKJ A;  3DVM A;  2FOT A;  4PHJ A;  3ZWH A;  5HLV A;  1SCM C;  5HKW A;  1TOP A;  3DVJ A;  3FWC A;  3IQQ A;  3OB2 B;  1XYD A;  2JUL A;  2KQ6 A;  3I5I C;  1UHN A;  5JOL A;  2BCX A;  2EC6 B;  1F55 A;  2K0J A;  2RGI A;  1NCY A;  2HPS A;  2E6W A;  2I2R E;  1KCY A;  1G4Y R;  4JWQ A;  1A2X A;  1GGW A;  1SMG A;  2LMV A;  2BL0 C;  1JBA A;  4FTG A;  1FI5 A;  2F33 A;  3C1V A;  4AQJ A;  1MR8 A;  2Y4Q A;  2H61 C;  2JOJ A;  1H4B A;  2WCB A;  4NQG A;  1B8L A;  1K9K A;  2L5X B;  2F2O A;  2BEC A;  1ODB A;  2WND A;  1JFJ A;  1A75 B;  1ZOT B;  3H4S E;  1S26 D;  3NSI A;  1TNP A;  2WCE A;  2KAX A;  2KI4 B;  4ORB B;  3TS5 C;  3EVU A;  1PAL A;  3I5F C;  5I8N A;  1ALW A;  1PSB A;  1KFU L;  2BE4 A;  1B8C A;  1CLM A;  1SK6 D;  3O2P A;  2TN4 A;  4BY5 A;  1MXL C;  2JQ6 A;  1KFX L;  2R2I A;  3BOW A;  3EK8 A;  1SR6 C;  2KI4 C;  2ZFD A;  3EVR A;  1KFU S;  1YRT B;  1C7W A;  1PUL A;  5CSJ A;  4NDC A;  2VRG A;  2K8M B;  2OTG B;  5I2Q A;  4N1F A;  2JXC A;  1AUI B;  2MLF C;  3DD4 A;  1X02 A;  2K7C A;  2CCM A;  2F2P A;  2L51 A;  1DJZ A;  3CR4 X;  1TCO B;  4WQ2 A;  1AVS A;  3TDU A;  1UUR A;  4FQO A;  2OPO A;  1TTX A;  1KQV A;  1SYM A;  3OHM B;  4OCI A;  3AKA A;  1CMF A;  1KSO A;  1QJT A;  2LVI A;  2ZRS A;  2LP3 A;  1FF1 A;  1F4O A;  2GGZ A;  1ZMZ A;  1REC A;  2KNE A;  1XK4 A;  4DIR A;  4MBE A;  2HQ8 A;  2CBL A;  2JZI A;  2M49 B;  3SIA A;  1NUB A;  1JC2 A;  3VGO A;  1V1G A;  1ZAC A;  2PMY A;  3I5G C;  1DGU A;  1DJW A;  1YRU B;  5CPV A;  4UPG A;  1DMO A;  5DKR A;  3BUX B;  1RTP 1;  1R6P A;  1RJV A;  1JFK A;  4GUK A;  1EXR A;  3BUO B;  2M7L A;  1FBV A;  2COL B;  4D1E A;  1WDC B;  1F70 A;  1A29 A;  3GK2 A;  2B1U A;  3DVK A;  2JXL A;  1A75 A;  3BXK A;  2PAL A;  3MSE B;  1AP4 A;  3SG3 A;  1KK7 Y;  2Q91 A;  3GK4 X;  4TNC A;  1SL8 A;  5HYD A;  1WDC C;  3F45 A;  1MQ1 A;  1NCZ A;  5B8I B;  1QTX A;  2KI6 C;  5K89 A;  1QIW A;  4DCK A;  4GAO A;  1G33 A;  1DTL A;  3PLF B;  2I18 A;  4XYN A;  2KHN A;  3HX4 A;  1SKT A;  1UHI A;  2JTZ A;  2ZN9 A;  1K95 A;  3KHE A;  1NP8 A;  2LV7 A;  2MHH A;  4XJK B;  2ZN8 A;  4ICB A;  5J3X A;  2LMT A;  1LKJ A;  1R2U A;  1B7T Z;  1CDM A;  1SPY A;  1NX3 A;  1QIV A;  1WY9 A;  1WRZ A;  4OR9 B;  4MLW A;  1F71 A;  3BUW B;  1N65 A;  2BKI B;  1JSA A;  1CDN A;  1QX7 A;  1YVL A;  3WXA A;  1SL9 A;  2LVK A;  1WRL A;  1OMV A;  2G2B A;  2KFG A;  2H2K A;  3GOF A;  4YBH B;  4MRY A;  3TDI A;  3ZNI A;  1S6J A;  3NSK A;  3PAL A;  4GFT A;  4ETO A;  4MZK A;  3CZT X;  3HCM A;  4PE1 A;  1SCM B;  4AOM A;  1CNP A;  1KWO B;  4AQI A;  1CLB A;  3I5I B;  3D0Y B;  4MZJ A;  2SAS A;  3FS7 A;  3BYA A;  1XFZ O;  3LK0 A;  1WLM A;  4HSZ A;  1PK0 D;  3RLZ A;  1M31 A;  3WNX B;  2M97 A;  4MVF A;  3SG5 A;  1YUR A;  2NCO A;  1BU3 A;  2PRU A;  1KWO C;  1IKU A;  3PSR A;  2LVJ A;  1S5G Z;  2BL0 B;  2M3W A;  1N0Y A;  2EHB A;  2KGB C;  4P5O E;  4MRX A;  1SL7 A;  2LC5 A;  1OMD A;  2DOQ A;  1K94 A;  2O60 A;  2CTN A;  2JWW A;  4GNK B;  1K9P A;  1CFF A;  4USL A;  1SNL A;  1F54 A;  1DJI A;  1BF5 A;  1NYA A;  4QJ4 B;  4WQ3 A;  1DJY A;  4OV2 A;  1IGV A;  2HET A;  3TS5 B;  3I5F B;  1KSM A;  5AER A;  1QV0 A;  1QV1 A;  1OSA A;  4HRG A;  4HRE E;  4PHN A;  5AXI A;  5TNC A;  1SR6 B;  5ER4 X;  1FW4 A;  1OOJ A;  4XJK A;  2GGM A;  1XFY O;  2MAZ A;  2K7O A;  1J7P A;  1DVI A;  4U8D A;  1KK8 C;  2OS8 C;  5D7F A;  5FYX A;  4I5K A;  1AHR A;  2Y1M A;  5IBW A;  2BE6 A;  2I7A A;  2LHL A;  2Q4U A;  1B1G A;  1CFC A;  4CPV A;  1QAS A;  2A4J A;  5HKZ A;  1SY9 A;  2HF5 A;  1YTZ C;  1KFX S;  1YUU A;  1DJX A;  1UWO A;  3QRX A;  1TNW A;  2AUC A;  5AAN A;  2KI6 D;  1DGV A;  4YI9 A;  2KFH A;  2MBX A;  2LAN A;  2LHI A;  3VRO A;  1GJY A;  1UHK A;  3AKB A;  1SRA A;  2CNP A;  2LMU A;  2M1K B;  1V1F A;  3PN7 C;  1W7J B;  3TZ1 A;  2F3Y A;  1WRK A;  1K2H A;  1AK8 A;  2JC2 A;  3WHT B;  1UUS A;  3SJS A;  1NX0 A;  1TRF A;  4A4C A;  5ER5 A;  3I5G B;  3JTD C;  3SG2 A;  1J7O A;  1QVI Z;  2JTT A;  1BLQ A;  3BQ3 A;  3OX5 A;  5AFP A;  3PM8 A;  1J1D A;  2KSP A;  1E8A A;  1TNX A;  2LE9 B;  1QLS A;  1OQP A;  1XA5 A;  2H61 A;  2L50 A;  3D10 A;  1Y1U A;  1OMR A;  4YGC B;  1MUX A;  1IQ5 A;  2JRF A;  4GGF C;  1NIW A;  2K7B A;  1K8U A;  1NPQ A;  4YRU A;  1M63 B;  3AAJ A;  3OP0 A;  3TDZ A;  1BT6 A;  4N1G A;  1EG4 A;  4QJ5 B;  1K96 A;  5BPJ A;  2LUC A;  2SCP A;  1A03 A;  1WLZ A;  1PSR A;  1CFD A;  2QAC A;  4HRH A;  1DF0 B;  4BY4 A;  4PAL A;  2QPT A;  1DJH A;  1S36 A;  5I2O A;  1JF0 A;  3OX6 A;  2KDH A;  4I5J A;  2NLN A;  3BUM B;  2NXQ A;  2BBM A;  4L9M A;  1KQM B;  1QS7 A;  1XVJ A;  2AMI A;  1QXP A;  2JNF A;  5I2L A;  5PAL A;  1C07 A;  2IS9 A;  1M46 A;  1CDP A;  2K2A A;  2FCD A;  3CLN A;  3VRR A;  1G8I A;  4YI8 A;  1Q80 A;  2LM5 A;  1UP5 A;  4OVN F;  1NWD A;  3I5H B;  3IF7 A;  2KBM A;  1EJ3 A;  1KQM C;  1XFV O;  2MA2 A;  4ZCU A;  3KPX A;  1EH2 A;  2MJW B;  4GBA A;  1Y0V H;  2KFF A;  4M2Q A;  4ORC B;  2WCF A;  1CTR A;  1IRJ A;  3I5H C;  1BJF A;  2BKH B;  1XFU O;  4C0L A;  2L98 A;  3CS1 A;  1SCV A;  1QLK A;  3E3R A;  1K9U A;  1J1E A;  1YR5 A;  3O4Y A;  1FI6 A;  1B7T Y;  2LUX A;  1BR4 B;  3LCP C;  5KU1 A;  4CLN A;  3GK1 A;  2M0R A;  3K21 A;  1L2O B;  1EL4 A;  1IWQ A;  1AJ4 A;  4M2O A;  1RWY A;  2EGD A;  1RRO A;  2BBN A;  4MEW A;  1TN4 A;  2AAO A;  1CKK A;  2HQW A;  1OZS A;  1L2O C;  4E68 A;  1S6I A;  1MWN A;  1Y1X A;  2KYC A;  1LA3 A;  3A4U B;  2L0P A;  4PE0 A;  2NCP A;  2NZ0 A;  3SIB A;  2I94 A;  1N2D A;  1A4P A;  1JF2 A;  5KSZ A;  4MSP A;  4PE7 A;  2M29 A;  3LL8 B;  3EVV A;  3OB1 B;  1LIN A;  1MF8 B;  4YGD B;  1ZFS A;  3VRQ A;  4PCW A;  5JJG A;  2L2E A;  2JT0 A;  4ORA B;  1TCF A;  1S3P A;  5D69 A;  3KF9 A;  4C0J A;  2CXJ A;  4NDB A;  4DS7 A;  1CFP A;  3JVT B;  1K90 D;  2M9G A;  1S5G Y;  4YGE B;  2MRD A;  1PVB A;  1GQM A;  2JU0 A;  1OE9 B;  1KK8 B;  2OS8 B;  4Q04 A;  4M2P A;  1NSH A;  2M7N A;  3A8R A;  3PFV A;  3WHU B;  3JVT C;  1HQV A;  2LVV A;  2WOR A;  5CSN A;  1J55 A;  1NCX A;  4IL1 A;  3ICB A;  2EC6 C;  1XK4 C;  3NSL A;  2LLS A;  1ZUZ A;  1IG5 A;  3BUN B;  3EK4 A;  3PN7 B;  1VRK A;  3SG6 A;  1B47 A;  3CWG A;  1CM1 A;  2BCB A;  5CSF A;  1PVA A;  2M8U A;  3VRN A;  1B9A A;  1YUS A;  2PAS A;  1IQ3 A;  1YUT A;  3DF0 B;  3JTD B;  1ALV A;  4A4B A;  2JT3 A;  1FPW A;  1S6C A;  4F0Z B;  2MLE C;  3D0Y A;  1LVC D;  1U5I B;  2Y1N A;  1JUO A;  1JWD A;  1SBJ A;  2PVB A;  3LK1 A;  2LLT A;  3CR5 X;  4YGA A;  2L4I A;  2JPT A;  2K7D A;  5F6T A;  3SG4 A;  3TUY B;  2BCA A;  1J7Q A;  3CTN A;  4CFQ A;  2D8N A;  4OKH A;  4JPZ B;  2ZRT A;  1AJ5 A;  2KAY A;  2WC8 A;  1F8H A;  4I5L B;  2ZKM X;  3KO0 A;  4JQ0 D;  3TUY C;  3FIA A;  2O5G A;  1BMO A;  2JNX A;  1C7V A;  1W7I B;  3NSO A;  1OZO A;  4MN0 A;  1K93 D;  1HT9 A;  2OTG C;  1XFX O;  2F3Z A;  2K2F A;  4CID A;  2KGR A;  3EKH A;  1QVI Y;  1LA0 A;  3IQO A;  2M1U A;  1NX2 A;  2Y5I A;  5HKY A;  3KEV A;  2LLU A;  3EK7 A;  1M39 A;  4R1E A;  1Y6W A;  4YGB B;  2LCP A;  5KTY A;  2KQY A;  1NX1 A;  1DT7 B;  1CLL A;  1CDL A;  1KK7 Z;  1J7R A;  4PHM A;  1PRW A;  1YVH A;  3CGA A;  3FWB A;  2LP2 A;  3O6B A;  1B8R A;  3DVE A;  4MZL A;  5AEQ A;  1BR1 B;  1BOC A;  3SG7 A;  2KBI A;  1UHH A;  1QX2 A;  2FCE A;  5DKN A;  3LLE A;  2KOT A;  4I5N B;  2G9B A;  2KAV A;  2F8P A;  3DF0 A;  5DKQ A;  4ZCV A;  1UHJ A;  3NXA A;  2E30 A;  3PAT A;  2ZNE A;  1H8B A;  1U5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...