3WNXB

Crystal structure of ergic-53/mcfd2, calcium/man3-bound form
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
57
Chain Sequence
QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 57
sequence length 70
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3wnxB00
2KYFA 3A8RA 1PVAA 3CR4X 4AOMA 1QVIZ 5IBWA 1TNQA 4NDBA 1A75A 2M97A 1CKKA 1EG3A 3OHMB 1CLLA 2BCAA 3BYAA 1J7OA 1SCMC 1M45A 4OCIA 4OV2A 1YR5A 3LLEA 4JPZB 1S6CA 2LM5A 1LXFC 1F4OA 5HKYA 3SIAA 2KGBC 1VRKA 2KBMA 4HSZA 1CTRA 1N65A 5TNCA 1QX5B 4QJ3B 2MHHA 4HRGA 4A4BA 1CFFA 4CPVA 3BUOB 2WNDA 4MBEA 1MXLC 2L5XB 2ZNDA 3HX4A 4NQGA 1EH2A 4Q04A 3QRXA 2LHLA 5D69A 2L0PA 3CTNA 2NZ0A 1AP4A 5I2OA 1B4CA 5JOLA 2LP3A 5HLVA 2CNPA 3JTDB 4HREE 1IJ5A 1MHOA 4P2YB 1AJ5A 3ZWHA 1SNLA 4FQOA 3EK7A 1HQVA 5AXIA 1NP8A 5I2LA 1DJHA 2H61A 1KWOC 1YTZC 2LLTA 2ZRTA 1G8IA 1DGUA 1QATA 1SR6C 2HQ8A 2E30A 1A29A 2LC5A 2PRUA 3TDIA 4PCWA 1UHHA 1OZSA 2BECA 2MA2A 1UWOA 4AQIA 2LVIA 2JULA 2F2PA 2KGRA 2G9BA 2HQWA 1XYDA 3VRPA 1NSHA 3WXAA 1BF5A 1CDPA 1IG5A 1NX0A 1ZMZA 2KBIA 2KQYA 4M2OA 3VRNA 5KTYA 3MSEB 1JF2A 1NCXA 4PHNA 1YVLA 2H61C 1NX3A 2K7DA 2F8PA 4PHJA 3EVVA 1A03A 2Q91A 1JSAA 3K21A 1WLZA 1CM1A 2KFHA 1IH0A 2AAOA 3I5HB 1HT9A 2ZKMX 3ICBA 3PN7C 2JTTA 1N2DA 4I5LB 3SG7A 1DJXA 1IJ6A 1DJWA 2BCBA 5HKWA 3FIAA 1WDCC 3NSKA 1W7IB 1YX8A 4GGNA 1QV0A 3CWGA 1GJYA 1XFVO 4MSPA 1K9KA 1SL9A 2COLB 5K89A 3LL8B 3SG3A 5FYXA 1DGVA 4YI9A 1NX2A 1ZUZA 3D0YA 2MJWB 3GOFA 2BE4A 4XJKA 2M3WA 2LNKA 4OR9B 2JNFA 1DJZA 1NUBA 2P6BB 1X02A 5F6TA 1PALA 2L4IA 2I2RE 2PVBA 4JQ0D 2LVKA 1Y0VH 4UPGA 4DIRA 1B7TY 2NCOA 4R1EA 4CFRA 1QASA 1KCYA 3I5IC 2LMVA 2VRGA 4GFTA 1AK8A 1OSAA 5DKQA 2LCPA 1NPQA 2KDHA 2I18A 2EGDA 2M7NA 2JWWA 2JXCA 4USLA 5CSFA 3TDZA 1K93D 1UHNA 1SCVA 3BQ3A 1PVBA 1CDNA 3PFVA 2LANA 4YRUA 4PE1A 3LCPC 1DJGA 1Y6WA 2LP2A 1ODBA 4I5JA 4TNCA 1BOCA 1RJVA 3BUNB 4GGFA 1S26D 3GK1A 3SG5A 1R6PA 3O78A 2K2FA 1LA3A 2PSRA 3PM8A 1F70A 2F2OA 1JBAA 3KHEA 4MZKA 3I5IB 2CXJA 2JOJA 1TNWA 3F45A 3H4SE 5JJGA 5KSZA 4GPLB 1UHKA 4GAOA 1GQMA 1S5GY 3DVMA 1C07A 1MF8B 1J7RA 2BBMA 1Q80A 1B1GA 3KO0A 2OPOA 2ZRSA 1TN4A 4JWQA 4MZLA 1S3PA 1QJTA 2WCBA 3JTDC 1M39A 3FWBA 4IL1A 3PLFB 4GGFC 2IS9A 4AQJA 1M31A 4PDZA 3DVJA 1EJ3A 1KK7Z 1YUSA 3EKHA 1PSBA 4MZJA 1OE9B 2ZNEA 4PHKA 2A4JA 1K8UA 4DUQA 3WHUB 3D10A 4DRWA 4F0ZB 1CDLA 1CM4A 1NIWA 2QPTA 2NLNA 3NSOA 2M49B 2F3YA 2OS8B 2EHBA 2LVVA 1F55A 4A4CA 1BLQA 4ZCVA 4HRHA 2AUCA 1B47A 1QLKA 2DOQA 2Y1MA 2KAVA 1K9PA 1G33A 2WCEA 4I5KA 4L9MA 3CGAA 1Y1UA 4NDCA 2Y1NA 3SG2A 1DTLA 1YURA 4ORCB 1M46A 1IQ5A 1SY9A 3VRQA 1AHRA 1K96A 1XK4A 1SRAA 1YRTB 1ALWA 3I5HC 2BCXA 1AVSA 2CTNA 1N0YA 5CSJA 1AUIB 4ICBA 4N1FA 3M0WA 1YUUA 2F33A 1ZFSA 1E8AA 1MQ1A 1S36A 2KNEA 1BODA 1LA0A 1QTXA 2M9GA 4MLWA 1RFJA 4D1EA 2FCDA 3AAKA 3WNXB 2EC6B 1S6IA 2LMUA 5HLOA 1XFWO 1J7PA 1KFUL 1SK6D 1XK4C 5J3XA 1DJYA 2SCPA 1CFDA 1SMGA 4MRXA 1DVIA 3VRRA 3CS1A 1NCZA 1QS7A 3NSIA 2JNXA 1XA5A 2MLEC 1IQ3A 3DVKA 2LVJA 1C7VA 2KQ6A 3CLNA 3TUYB 2L2EA 2I7AA 3EK4A 4GUKA 3EVRA 4CFQA 3NSLA 4WQ3A 2G2BA 1LINA 1QX7A 2BL0B 2LUXA 5PALA 1V1GA 5CSIA 1FBVA 1PSRA 2JZIA 1SBJA 2BBNA 2B1UA 2FOTA 3DF0B 1LKJA 5DKRA 4E68A 2LMTA 5BPJA 2QACA 1XFUO 1PULA 2MBXA 3FWCA 2H2KA 2LHIA 2MLFC 4GNKB 1BR1B 2M1KB 1GGZA 1ZOTB 4YI8A 1KFXL 1W7JB 2CBLA 4I5NB 4DCKA 2WOSA 2KSPA 1K2HA 1B8LA 1PK0D 3BUWB 3KF9A 3KEVA 4WQ2A 1EXRA 2OTGB 1IGVA 3I5FB 3PSRA 1ALVA 1JFKA 4BY5A 2FJUB 4M2PA 1CFCA 1WLMA 1YVHA 2HPSA 5AFPA 1CFPA 1L7ZA 2LV7A 4ORAB 4N5XA 4PE4A 4YGBB 2K61A 1KSMA 1OMVA 4OVNF 3I5GC 2LLUA 3TDUA 1OQPA 1UP5A 2JRFA 1KQVA 1TCFA 2K7BA 2KAXA 3EVUA 1IRJA 1U5IA 1BG1A 4C0KA 1R2UA 4DS7A 1F8HA 4ORBB 3BUXB 1RECA 2M7LA 2MAZA 2MRDA 2BKIB 4NDDA 2NCPA 2Q4UA 1UURA 2OS8C 3OX5A 5AERA 2PALA 3NXAA 4MEWA 1RTP1 3IQQA 5KU1A 1CDMA 3DD4A 1UHJA 1BT6A 1CLMA 1QLSA 1A4PA 2HF5A 1WY9A 1F54A 3SG4A 1B9AA 4M2QA 3GK4X 4YGDB 3VGOA 3I5GB 1SW8A 2CT9A 4ETOA 2WORA 4CLNA 4PE7A 1JFJA 1KQMC 3AKBA 2K2AA 1GGWA 2WC8A 1CLBA 2D8NA 1YRUB 3TS5C 3JVTC 3BXKA 4OKHA 1M63B 1RK9A 2GV5A 3CR5X 2M8UA 2JQ6A 1JWDA 1MR8A 2KI4C 2M1UA 1QIWA 3VROA 2KHNA 5AANA 2WCFA 3A4UB 2EC6C 1RROA 1UUSA 4ZCUA 1DF0B 4WRIA 4YGAA 4N1GA 1U5IB 1CMGA 1IWQA 3BOWB 1BU3A 1DJIA 3WHTB 2JPTA 3DF0A 2L51A 5B8IB 2L4HA 4MVFA 3GK2A 1Y1AA 3AAJA 5ER4X 1KK8B 1TRFA 1XVJA 1KQMB 3AKAA 4MN0A 4C0JA 1J7QA 1CB1A 1QVIY 4U8DA 1LVCD 3TZ1A 3OB1B 2RGIA 1BMOA 1SYMA 1FI5A 3TS5B 3JVTB 1BJFA 3OB2B 3TUYC 1NCYA 1FI6A 1KK7Y 2KI4B 2BL0C 2O5GA 1SPYA 5I8NA 1QX2A 1TNXA 1S6JA 1SCMB 1DMOA 3CZTX 4GBAA 1D1OA 1J1EA 1OOJA 4CIDA 1JC2A 1K90D 1F4QA 1KFUS 1QV1A 2K8MB 2KI6C 2KYCA 5I2QA 4YGCB 2FCEA 2ZFDA 2JC2A 2Y4QA 2O60A 2CCMA 3E3RA 1AJ4A 3OX6A 4FTGA 2JTZA 3SIBA 1TTXA 3PALA 1V1FA 1J1DA 1A75B 2OTGC 3I5FC 1B7TZ 2K0JA 4C0LA 2JU0A 2BE6A 2KAYA 2TN4A 1JUOA 5CSNA 1XFZO 1XO5A 2L50A 3RLZA 3IQOA 2JXLA 1SL7A 1MUXA 1SKTA 2ISDA 1PRWA 2LAPA 3CR2A 3KPXA 3SJSA 1KWOB 2KFFA 5ER5A 2ZN9A 2KI6D 1J55A 1SR6B 5D7FA 1F71A 2E6WA 1NX1A 1KSOA 4MRYA 4PE0A 2LE9B 1K9UA 1L2OC 1KFXS 2I94A 4PALA 5AEQA 3RM1A 2ZN8A 2V53A 2SASA 2KOTA 1TCOB 1FPWA 2KFGA 1UHIA 1JF0A 2PMYA 3LK0A 4P5OE 3FS7A 3ZNIA 1QIVA 2K7CA 1MWNA 1FF1A 3LK1A 2GGMA 3C1VA 1NYAA 2GGZA 2M29A 1S5GZ 2HETA 4XYNA 2JT3A 2K7OA 1DF0A 1NWDA 1CNPA 1YUTA 2LUCA 2R2IA 1RWYA 1BR4B 1TOPA 1WRLA 1DT7B 4BY4A 1OZOA 3PN7B 4QJ5B 3BOWA 1SL8A 5CPVA 1Y1XA 2AMIA 3IF7A 3EK8A 1WDCB 1C7WA 1OMRA 1L2OB 2M0RA 1K95A 3O4YA 1WRZA 4YBHB 1CMFA 4QJ4B 3SG6A 1EL4A 2BKHB 3PATA 4YGEB 1IKUA 1OMDA 1A2XA 1B8RA 2JT0A 1MXEA 4PHMA 3OP0A 5HKZA 1ZACA 3BUMB 3O6BA 1B8CA 3HCMA 1H8BA 5G08A 1TNPA 2LLSA 1FW4A 1TIZA 2L98A 5HYDA 2F3ZA 3O2PA 2PASA 5DKNA 1KK8C 1QXPA 1XFXO 1WRKA 2JT8A 1H4BA 2Y5IA 1G4YR 1EG4A 1K94A 3EKJA 5GQQC 3DVEA 1XFYO 2NXQA 3D0YB 1YX7A 1S1EA 4XJKB
chains in the Genus database with same CATH superfamily
2KYFA 3A8RA 1PVAA 3CR4X 4AOMA 1QVIZ 5IBWA 1DEKA 1TNQA 4NDBA 1A75A 2M97A 3UO9A 1EG3A 3OHMB 1CLLA 2BCAA 3BYAA 1CKKA 1J7OA 1TUZA 1SCMC 1M45A 4OCIA 4OV2A 1YR5A 3LLEA 4JPZB 1S6CA 2LM5A 1LXFC 2JPOA 1F4OA 5HKYA 3SIAA 2KGBC 1VRKA 2KBMA 4HSZA 1CTRA 1N65A 5TNCA 1QX5B 4QJ3B 2MHHA 2P70A 4HRGA 4A4BA 1CFFA 4CPVA 3BUOB 4YBHB 2WNDA 4MBEA 1MXLC 2L5XB 3N7HA 2ZNDA 3HX4A 4NQGA 1EH2A 4Q04A 1C3ZA 3QRXA 2LHLA 5D69A 2L0PA 3CTNA 2NZ0A 1AP4A 5I2OA 3NHIA 2FJYA 1B4CA 5JOLA 2LP3A 5HLVA 3CZ1A 2BAPA 2CNPA 3L4AA 3JTDB 4HREE 1IJ5A 1MHOA 3BJHA 4P2YB 1AJ5A 3ZWHA 3CABA 1SNLA 4FQOA 3EK7A 1HQVA 4JD9A 5AXIA 1NP8A 5I2LA 1DJHA 1OW4A 2H61A 1KWOC 1YTZC 2LLTA 2ZRTA 1G8IA 2WC6A 1DGUA 1QATA 1SR6C 2HQ8A 2E30A 1A29A 2LC5A 2PRUA 3TDIA 4PCWA 1UHHA 1OZSA 2BECA 2MA2A 1UWOA 4AQIA 2LVIA 2JULA 2F2PA 2KGRA 2G9BA 2HQWA 3BFBA 1XYDA 4INWA 3VRPA 1NSHA 3WXAA 1BF5A 1CDPA 1IG5A 1NX0A 1ZMZA 2KBIA 2KQYA 4M2OA 3VRNA 4OZDA 5KTYA 3MSEB 1JF2A 1NCXA 3CYZA 4PHNA 1YVLA 2H61C 1NX3A 2K7DA 2F8PA 4PHJA 3EVVA 1A03A 2Q91A 1JSAA 2QEBA 3K21A 1WLZA 1CM1A 2KFHA 1IH0A 2AAOA 3I5HB 1HT9A 2ZKMX 3ICBA 3PN7C 2JTTA 1N2DA 4I5LB 3SG7A 1DJXA 1IJ6A 1DJWA 2BCBA 5HKWA 3FIAA 1WDCC 3NSKA 1W7IB 1YX8A 4GGNA 1QV0A 1Z2CB 3CWGA 1GJYA 1XFVO 2WCHA 3CZ0A 1K9KA 4MSPA 1SL9A 2COLB 5K89A 3LL8B 2KPHA 3EG5B 1DQEA 5FYXA 3SG3A 1DGVA 4YI9A 1LS8A 1NX2A 1ORGA 1ZUZA 2MJWB 3D0YA 2BE4A 3GOFA 4PT1A 4XJKA 2M3WA 2LNKA 4OR9B 2JNFA 1DJZA 1NUBA 2P6BB 1X02A 5F6TA 1PALA 2L4IA 2I2RE 2PVBA 4JQ0D 2LVKA 1Y0VH 4UPGA 4DIRA 1B7TY 3R1OA 2NCOA 4R1EA 4CFRA 1QASA 1KCYA 3I5IC 2LMVA 2VRGA 4GFTA 1AK8A 1OSAA 4KYNA 5DKQA 2LCPA 1NPQA 5FI7A 2KDHA 2I18A 3B88A 3NHTA 2EGDA 3SS5A 1OOGA 2M7NA 2JWWA 2JXCA 4USLA 5CSFA 5FI2A 3TDZA 1K93D 1UHNA 1SCVA 3BQ3A 1PVBA 1CDNA 3FE6A 3PFVA 2LANA 4YRUA 4PE1A 3LCPC 1DJGA 1Y6WA 2LP2A 1ODBA 4I5JA 4TNCA 1BOCA 1RJVA 3BUNB 4GGFA 1S26D 3GK1A 3SG5A 1R6PA 3O78A 2K2FA 1LA3A 2PSRA 3PM8A 2QEOA 1F70A 3S0BA 2F2OA 1JBAA 3KHEA 4MZKA 3I5IB 3V2LA 3CZ2A 3R1VA 2CXJA 2JOJA 1TNWA 2KLDA 2QEVA 3F45A 1DELA 2H8VA 3H4SE 5JJGA 5KSZA 4GPLB 1UHKA 4GAOA 1GQMA 1S5GY 3DVMA 3B86A 1W9ZA 3L47A 1C07A 1MF8B 1J7RA 3SS3A 4JKTA 3DXLA 2BBMA 1Q80A 1B1GA 3KO0A 2OPOA 2ZRSA 1TN4A 4JWQA 4MZLA 5EL2A 1S3PA 1QJTA 2WCBA 3JTDC 3DY9A 1M39A 3FWBA 3PM2A 3PLFB 4IL1A 4GGFC 2IS9A 4AQJA 1M31A 4PDZA 3DVJA 1EJ3A 2PQLA 1KK7Z 1YUSA 1OOHA 3EKHA 1PSBA 4MZJA 1OE9B 2ZNEA 4PHKA 2A4JA 3D78A 1K8UA 4DUQA 1TUJA 3D10A 3WHUB 4DRWA 4F0ZB 1CDLA 1CM4A 1NIWA 3S0EA 2QPTA 2NLNA 3DZTA 3NSOA 4IJ7A 2M49B 2F3YA 2OS8B 2EHBA 2LVVA 1F55A 1GM0A 4A4CA 1BLQA 4ZCVA 4HRHA 2AUCA 3CDNA 1B47A 1QLKA 2DOQA 2Y1MA 2KAVA 1K9PA 1G33A 3OGNA 2WCEA 4I5KA 4L9MA 3CGAA 1Y1UA 4NDCA 2Y1NA 3SG2A 1DTLA 1YURA 4ORCB 1M46A 1IQ5A 1SY9A 3VRQA 2BNXA 1AHRA 1K96A 1XK4A 1SRAA 1YRTB 1ALWA 3I5HC 2BCXA 1AVSA 2CTNA 1N0YA 5CSJA 1AUIB 4ICBA 4N1FA 3M0WA 1YUUA 2F33A 4INXA 1ZFSA 1E8AA 1MQ1A 1S36A 2KNEA 1BODA 1LA0A 1QTXA 2M9GA 4MLWA 1RFJA 4D1EA 3O4XA 2FCDA 3AAKA 3WNXB 2EC6B 1S6IA 2LMUA 5I94A 5HLOA 1XFWO 2WCLA 1J7PA 1KFUL 1SK6D 1XK4C 5J3XA 1DJYA 2SCPA 1CFDA 1SMGA 4MRXA 2QEHA 1DVIA 3VRRA 3CS1A 1NCZA 1QS7A 3NSIA 2JNXA 1XA5A 2MLEC 1IQ3A 3DVKA 1P28A 2LVJA 3R1PA 1C7VA 1TWOA 2KQ6A 3CLNA 3TUYB 1C3YA 2L2EA 2I7AA 3EK4A 4GUKA 3EVRA 2WCKA 4CFQA 3NSLA 4WQ3A 2G2BA 1LINA 1QX7A 2BL0B 2LUXA 5PALA 1V1GA 5CSIA 1FBVA 3B87A 1PSRA 2JZIA 1SBJA 2BBNA 2B1UA 2FOTA 3DF0B 1LKJA 5DKRA 4E68A 2LMTA 5BPJA 2QACA 1XFUO 1PULA 2MBXA 3FWCA 2ERBA 2H2KA 2LHIA 2MLFC 4GNKB 1BR1B 2M1KB 1GGZA 1ZOTB 4YI8A 1KFXL 1W7JB 2CBLA 4I5NB 4DCKA 1QWVA 2WOSA 4FQTA 2KSPA 1K2HA 1B8LA 1PK0D 3BUWB 3KF9A 3KEVA 4WQ2A 1EXRA 2OTGB 1IGVA 3I5FB 3PSRA 1ALVA 1JFKA 3SS4A 4BY5A 2FJUB 3NGVA 2WCMA 1WLMA 1YVHA 2HPSA 4M2PA 5AFPA 1CFCA 3K1EA 1CFPA 1L7ZA 2LV7A 4ORAB 4N5XA 4PE4A 4YGBB 2K61A 3D75A 1KSMA 1OMVA 3D73A 4OVNF 3I5GC 2LLUA 3TDUA 1OQPA 1UP5A 2JRFA 1KQVA 1IIOA 1TCFA 2K7BA 2KAXA 3EVUA 1IRJA 1U5IA 1BG1A 4C0KA 1R2UA 4DS7A 1F8HA 4ORBB 3BUXB 1RECA 2M7LA 1OOFA 2MAZA 2MRDA 2BKIB 4NDDA 2NCPA 2Q4UA 5FI6A 1UURA 2L5YA 2OS8C 3OX5A 5AERA 2PALA 3NXAA 4MEWA 1RTP1 3IQQA 5KU1A 1CDMA 3DD4A 3BFAA 1UHJA 1BT6A 1CLMA 1QLSA 1A4PA 2HF5A 1WY9A 3B7AA 1F54A 3SG4A 1B9AA 5D3OA 4M2QA 3GK4X 4YGDB 3VGOA 3I5GB 1SW8A 2CT9A 4ETOA 2WORA 4CLNA 3S0FA 4PE7A 1JFJA 1KQMC 3AKBA 1OOIX 2K2AA 1GGWA 2WC8A 3S0GA 3RZSA 2D8NA 1CLBA 1YRUB 3TS5C 3JVTC 3BXKA 4OKHA 1M63B 1RK9A 2GV5A 3CR5X 2M8UA 2JQ6A 4F7FA 1JWDA 1MR8A 2KI4C 2M1UA 1QIWA 3VROA 2KHNA 5AANA 2WCFA 3A4UB 2EC6C 3D74A 1RROA 1UUSA 4ZCUA 1DF0B 4WRIA 4YGAA 4N1GA 5HL1A 3UNWA 1U5IB 1CMGA 1IWQA 3BOWB 1BU3A 1DJIA 3WHTB 2JPTA 3DF0A 2L51A 5B8IB 2L4HA 4MVFA 3GK2A 2KLEA 1Y1AA 3AAJA 5ER4X 1KK8B 1TRFA 1XVJA 1KQMB 3AKAA 4MN0A 4C0JA 1J7QA 1CB1A 1QVIY 2L2CA 4U8DA 1LVCD 3TZ1A 3OB1B 2RGIA 1BMOA 1SYMA 1FI5A 2P71A 3DYEA 3TS5B 3JVTB 1BJFA 3OB2B 3TUYC 3VB1A 1NCYA 1FI6A 1KK7Y 2KI4B 2BL0C 2O5GA 1SPYA 5I8NA 3FE9A 1QX2A 1T14A 1TNXA 1S6JA 1SCMB 1DMOA 3CZTX 4GBAA 1D1OA 1J1EA 1OOJA 4CIDA 1JC2A 1K90D 1F4QA 1KFUS 1QV1A 2K8MB 3OBVA 3QMEA 2KI6C 2KYCA 5I2QA 3PJIA 4YGCB 2FCEA 2ZFDA 2JC2A 2Y4QA 2O60A 2CCMA 3E3RA 1AJ4A 3OX6A 4FTGA 2JTZA 3SIBA 1TTXA 3PALA 1V1FA 1J1DA 1A75B 2OTGC 3I5FC 1B7TZ 2K0JA 4C0LA 2JU0A 2BE6A 2KAYA 3Q8IA 2TN4A 1JUOA 5CSNA 1XFZO 2K60A 1XO5A 2L50A 3RLZA 3IQOA 3B6XA 2JXLA 1SL7A 1MUXA 1SKTA 2ISDA 1PRWA 2LAPA 3CR2A 3KPXA 3SJSA 1KWOB 2KFFA 5ER5A 2ZN9A 2KI6D 1J55A 1SR6B 5D7FA 1F71A 2E6WA 1NX1A 1KSOA 4MRYA 4PE0A 2LE9B 1K9UA 1L2OC 1KFXS 2I94A 4PALA 5AEQA 3D76A 3L4LA 3RM1A 2ZN8A 2V53A 2SASA 2KOTA 1TCOB 3S0DA 1FPWA 2KFGA 1UHIA 1JF0A 2PMYA 3LK0A 4P5OE 3FS7A 3ZNIA 1QIVA 2K7CA 1MWNA 1FF1A 3LK1A 2GGMA 3C1VA 1NYAA 2GGZA 2WC5A 2M29A 1S5GZ 2GTEA 2HETA 2JT3A 2K7OA 4XYNA 3IVTA 1XFRA 1DF0A 1NWDA 2PYQA 1CNPA 2QDIA 1YUTA 2LUCA 2R2IA 1RWYA 1BR4B 1TOPA 1WRLA 1DT7B 4BY4A 1OZOA 3PN7B 4QJ5B 3BOWA 1SL8A 5CPVA 1Y1XA 2AMIA 3IF7A 3EK8A 1WDCB 1C7WA 1OMRA 1L2OB 2M0RA 1K95A 1Z4HA 1WRZA 3O4YA 1CMFA 4QJ4B 3SG6A 1EL4A 2BKHB 3PATA 3D77A 4YGEB 1IKUA 1OMDA 3BFHA 1A2XA 3S0AA 1B8RA 2JT0A 1MXEA 4PHMA 3OP0A 5HKZA 1ZACA 3BUMB 3O6BA 3FE8A 1B8CA 1DC1A 3HCMA 1H8BA 5G08A 1TNPA 3R72A 2LLSA 1FW4A 1TIZA 2L98A 5HYDA 2YGUA 2F3ZA 3O2PA 5DICA 2PASA 5DKNA 1KK8C 1QXPA 1XFXO 2WCJA 1WRKA 2JT8A 1H4BA 2Y5IA 1G4YR 1EG4A 1K94A 3EKJA 5GQQC 3DVEA 1XFYO 1SSEB 2NXQA 3D0YB 1YX7A 1S1EA 4XJKB
chains in the Genus database with same CATH topology
2KYFA 3A8RA 1PVAA 3CR4X 4AOMA 1QVIZ 5IBWA 1TNQA 4NDBA 1A75A 2M97A 1CKKA 1EG3A 3OHMB 1CLLA 2BCAA 3BYAA 1J7OA 1SCMC 1M45A 4OCIA 4OV2A 1YR5A 3LLEA 4JPZB 1S6CA 2LM5A 1LXFC 1F4OA 5HKYA 3SIAA 2KGBC 1VRKA 2KBMA 4HSZA 1CTRA 1N65A 5TNCA 1QX5B 4QJ3B 2MHHA 4HRGA 4A4BA 1CFFA 4CPVA 3BUOB 2WNDA 4MBEA 1MXLC 2L5XB 2ZNDA 3HX4A 4NQGA 1EH2A 4Q04A 3QRXA 2LHLA 5D69A 2L0PA 3CTNA 2NZ0A 1AP4A 5I2OA 1B4CA 5JOLA 2LP3A 5HLVA 2CNPA 3JTDB 4HREE 1IJ5A 1MHOA 4P2YB 1AJ5A 3ZWHA 1SNLA 4FQOA 3EK7A 1HQVA 5AXIA 1NP8A 5I2LA 1DJHA 2H61A 1KWOC 1YTZC 2LLTA 2ZRTA 1G8IA 1DGUA 1QATA 1SR6C 2HQ8A 2E30A 1A29A 2LC5A 2PRUA 3TDIA 4PCWA 1UHHA 1OZSA 2BECA 2MA2A 1UWOA 4AQIA 2LVIA 2JULA 2F2PA 2KGRA 2G9BA 2HQWA 1XYDA 3VRPA 1NSHA 3WXAA 1BF5A 1CDPA 1IG5A 1NX0A 1ZMZA 2KBIA 2KQYA 4M2OA 3VRNA 5KTYA 3MSEB 1JF2A 1NCXA 4PHNA 1YVLA 2H61C 1NX3A 2K7DA 2F8PA 4PHJA 3EVVA 1A03A 2Q91A 1JSAA 3K21A 1WLZA 1CM1A 2KFHA 1IH0A 2AAOA 3I5HB 1HT9A 2ZKMX 3ICBA 3PN7C 2JTTA 1N2DA 4I5LB 3SG7A 1DJXA 1IJ6A 1DJWA 2BCBA 5HKWA 3FIAA 1WDCC 3NSKA 1W7IB 1YX8A 4GGNA 1QV0A 3CWGA 1GJYA 1XFVO 4MSPA 1K9KA 1SL9A 2COLB 5K89A 3LL8B 3SG3A 5FYXA 1DGVA 4YI9A 1NX2A 1ZUZA 3D0YA 2MJWB 3GOFA 2BE4A 4XJKA 2M3WA 2LNKA 4OR9B 2JNFA 1DJZA 1NUBA 2P6BB 1X02A 5F6TA 1PALA 2L4IA 2I2RE 2PVBA 4JQ0D 2LVKA 1Y0VH 4UPGA 4DIRA 1B7TY 2NCOA 4R1EA 4CFRA 1QASA 1KCYA 3I5IC 2LMVA 2VRGA 4GFTA 1AK8A 1OSAA 5DKQA 2LCPA 1NPQA 2KDHA 2I18A 2EGDA 2M7NA 2JWWA 2JXCA 4USLA 5CSFA 3TDZA 1K93D 1UHNA 1SCVA 3BQ3A 1PVBA 1CDNA 3PFVA 2LANA 4YRUA 4PE1A 3LCPC 1DJGA 1Y6WA 2LP2A 1ODBA 4I5JA 4TNCA 1BOCA 1RJVA 3BUNB 4GGFA 1S26D 3GK1A 3SG5A 1R6PA 3O78A 2K2FA 1LA3A 2PSRA 3PM8A 1F70A 2F2OA 1JBAA 3KHEA 4MZKA 3I5IB 2CXJA 2JOJA 1TNWA 3F45A 3H4SE 5JJGA 5KSZA 4GPLB 1UHKA 4GAOA 1GQMA 1S5GY 3DVMA 1C07A 1MF8B 1J7RA 2BBMA 1Q80A 1B1GA 3KO0A 2OPOA 2ZRSA 1TN4A 4JWQA 4MZLA 1S3PA 1QJTA 2WCBA 3JTDC 1M39A 3FWBA 4IL1A 3PLFB 4GGFC 2IS9A 4AQJA 1M31A 4PDZA 3DVJA 1EJ3A 1KK7Z 1YUSA 3EKHA 1PSBA 4MZJA 1OE9B 2ZNEA 4PHKA 2A4JA 1K8UA 4DUQA 3WHUB 3D10A 4DRWA 4F0ZB 1CDLA 1CM4A 1NIWA 2QPTA 2NLNA 3NSOA 2M49B 2F3YA 2OS8B 2EHBA 2LVVA 1F55A 4A4CA 1BLQA 4ZCVA 4HRHA 2AUCA 1B47A 1QLKA 2DOQA 2Y1MA 2KAVA 1K9PA 1G33A 2WCEA 4I5KA 4L9MA 3CGAA 1Y1UA 4NDCA 2Y1NA 3SG2A 1DTLA 1YURA 4ORCB 1M46A 1IQ5A 1SY9A 3VRQA 1AHRA 1K96A 1XK4A 1SRAA 1YRTB 1ALWA 3I5HC 2BCXA 1AVSA 2CTNA 1N0YA 5CSJA 1AUIB 4ICBA 4N1FA 3M0WA 1YUUA 2F33A 1ZFSA 1E8AA 1MQ1A 1S36A 2KNEA 1BODA 1LA0A 1QTXA 2M9GA 4MLWA 1RFJA 4D1EA 2FCDA 3AAKA 3WNXB 2EC6B 1S6IA 2LMUA 5HLOA 1XFWO 1J7PA 1KFUL 1SK6D 1XK4C 5J3XA 1DJYA 2SCPA 1CFDA 1SMGA 4MRXA 1DVIA 3VRRA 3CS1A 1NCZA 1QS7A 3NSIA 2JNXA 1XA5A 2MLEC 1IQ3A 3DVKA 2LVJA 1C7VA 2KQ6A 3CLNA 3TUYB 2L2EA 2I7AA 3EK4A 4GUKA 3EVRA 4CFQA 3NSLA 4WQ3A 2G2BA 1LINA 1QX7A 2BL0B 2LUXA 5PALA 1V1GA 5CSIA 1FBVA 1PSRA 2JZIA 1SBJA 2BBNA 2B1UA 2FOTA 3DF0B 1LKJA 5DKRA 4E68A 2LMTA 5BPJA 2QACA 1XFUO 1PULA 2MBXA 3FWCA 2H2KA 2LHIA 2MLFC 4GNKB 1BR1B 2M1KB 1GGZA 1ZOTB 4YI8A 1KFXL 1W7JB 2CBLA 4I5NB 4DCKA 2WOSA 2KSPA 1K2HA 1B8LA 1PK0D 3BUWB 3KF9A 3KEVA 4WQ2A 1EXRA 2OTGB 1IGVA 3I5FB 3PSRA 1ALVA 1JFKA 4BY5A 2FJUB 4M2PA 1CFCA 1WLMA 1YVHA 2HPSA 5AFPA 1CFPA 1L7ZA 2LV7A 4ORAB 4N5XA 4PE4A 4YGBB 2K61A 1KSMA 1OMVA 4OVNF 3I5GC 2LLUA 3TDUA 1OQPA 1UP5A 2JRFA 1KQVA 1TCFA 2K7BA 2KAXA 3EVUA 1IRJA 1U5IA 1BG1A 4C0KA 1R2UA 4DS7A 1F8HA 4ORBB 3BUXB 1RECA 2M7LA 2MAZA 2MRDA 2BKIB 4NDDA 2NCPA 2Q4UA 1UURA 2OS8C 3OX5A 5AERA 2PALA 3NXAA 4MEWA 1RTP1 3IQQA 5KU1A 1CDMA 3DD4A 1UHJA 1BT6A 1CLMA 1QLSA 1A4PA 2HF5A 1WY9A 1F54A 3SG4A 1B9AA 4M2QA 3GK4X 4YGDB 3VGOA 3I5GB 1SW8A 2CT9A 4ETOA 2WORA 4CLNA 4PE7A 1JFJA 1KQMC 3AKBA 2K2AA 1GGWA 2WC8A 1CLBA 2D8NA 1YRUB 3TS5C 3JVTC 3BXKA 4OKHA 1M63B 1RK9A 2GV5A 3CR5X 2M8UA 2JQ6A 1JWDA 1MR8A 2KI4C 2M1UA 1QIWA 3VROA 2KHNA 5AANA 2WCFA 3A4UB 2EC6C 1RROA 1UUSA 4ZCUA 1DF0B 4WRIA 4YGAA 4N1GA 1U5IB 1CMGA 1IWQA 3BOWB 1BU3A 1DJIA 3WHTB 2JPTA 3DF0A 2L51A 5B8IB 2L4HA 4MVFA 3GK2A 1Y1AA 3AAJA 5ER4X 1KK8B 1TRFA 1XVJA 1KQMB 3AKAA 4MN0A 4C0JA 1J7QA 1CB1A 1QVIY 4U8DA 1LVCD 3TZ1A 3OB1B 2RGIA 1BMOA 1SYMA 1FI5A 3TS5B 3JVTB 1BJFA 3OB2B 3TUYC 1NCYA 1FI6A 1KK7Y 2KI4B 2BL0C 2O5GA 1SPYA 5I8NA 1QX2A 1TNXA 1S6JA 1SCMB 1DMOA 3CZTX 4GBAA 1D1OA 1J1EA 1OOJA 4CIDA 1JC2A 1K90D 1F4QA 1KFUS 1QV1A 2K8MB 2KI6C 2KYCA 5I2QA 4YGCB 2FCEA 2ZFDA 2JC2A 2Y4QA 2O60A 2CCMA 3E3RA 1AJ4A 3OX6A 4FTGA 2JTZA 3SIBA 1TTXA 3PALA 1V1FA 1J1DA 1A75B 2OTGC 3I5FC 1B7TZ 2K0JA 4C0LA 2JU0A 2BE6A 2KAYA 2TN4A 1JUOA 5CSNA 1XFZO 1XO5A 2L50A 3RLZA 3IQOA 2JXLA 1SL7A 1MUXA 1SKTA 2ISDA 1PRWA 2LAPA 3CR2A 3KPXA 3SJSA 1KWOB 2KFFA 5ER5A 2ZN9A 2KI6D 1J55A 1SR6B 5D7FA 1F71A 2E6WA 1NX1A 1KSOA 4MRYA 4PE0A 2LE9B 1K9UA 1L2OC 1KFXS 2I94A 4PALA 5AEQA 3RM1A 2ZN8A 2V53A 2SASA 2KOTA 1TCOB 1FPWA 2KFGA 1UHIA 1JF0A 2PMYA 3LK0A 4P5OE 3FS7A 3ZNIA 1QIVA 2K7CA 1MWNA 1FF1A 3LK1A 2GGMA 3C1VA 1NYAA 2GGZA 2M29A 1S5GZ 2HETA 4XYNA 2JT3A 2K7OA 1DF0A 1NWDA 1CNPA 1YUTA 2LUCA 2R2IA 1RWYA 1BR4B 1TOPA 1WRLA 1DT7B 4BY4A 1OZOA 3PN7B 4QJ5B 3BOWA 1SL8A 5CPVA 1Y1XA 2AMIA 3IF7A 3EK8A 1WDCB 1C7WA 1OMRA 1L2OB 2M0RA 1K95A 3O4YA 1WRZA 4YBHB 1CMFA 4QJ4B 3SG6A 1EL4A 2BKHB 3PATA 4YGEB 1IKUA 1OMDA 1A2XA 1B8RA 2JT0A 1MXEA 4PHMA 3OP0A 5HKZA 1ZACA 3BUMB 3O6BA 1B8CA 3HCMA 1H8BA 5G08A 1TNPA 2LLSA 1FW4A 1TIZA 2L98A 5HYDA 2F3ZA 3O2PA 2PASA 5DKNA 1KK8C 1QXPA 1XFXO 1WRKA 2JT8A 1H4BA 2Y5IA 1G4YR 1EG4A 1K94A 3EKJA 5GQQC 3DVEA 1XFYO 2NXQA 3D0YB 1YX7A 1S1EA 4XJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYF A;  3A8R A;  1PVA A;  3CR4 X;  4AOM A;  1QVI Z;  5IBW A;  1TNQ A;  4NDB A;  1A75 A;  2M97 A;  1CKK A;  1EG3 A;  3OHM B;  1CLL A;  2BCA A;  3BYA A;  1J7O A;  1SCM C;  1M45 A;  4OCI A;  4OV2 A;  1YR5 A;  3LLE A;  4JPZ B;  1S6C A;  2LM5 A;  1LXF C;  1F4O A;  5HKY A;  3SIA A;  2KGB C;  1VRK A;  2KBM A;  4HSZ A;  1CTR A;  1N65 A;  5TNC A;  1QX5 B;  4QJ3 B;  2MHH A;  4HRG A;  4A4B A;  1CFF A;  4CPV A;  3BUO B;  2WND A;  4MBE A;  1MXL C;  2L5X B;  2ZND A;  3HX4 A;  4NQG A;  1EH2 A;  4Q04 A;  3QRX A;  2LHL A;  5D69 A;  2L0P A;  3CTN A;  2NZ0 A;  1AP4 A;  5I2O A;  1B4C A;  5JOL A;  2LP3 A;  5HLV A;  2CNP A;  3JTD B;  4HRE E;  1IJ5 A;  1MHO A;  4P2Y B;  1AJ5 A;  3ZWH A;  1SNL A;  4FQO A;  3EK7 A;  1HQV A;  5AXI A;  1NP8 A;  5I2L A;  1DJH A;  2H61 A;  1KWO C;  1YTZ C;  2LLT A;  2ZRT A;  1G8I A;  1DGU A;  1QAT A;  1SR6 C;  2HQ8 A;  2E30 A;  1A29 A;  2LC5 A;  2PRU A;  3TDI A;  4PCW A;  1UHH A;  1OZS A;  2BEC A;  2MA2 A;  1UWO A;  4AQI A;  2LVI A;  2JUL A;  2F2P A;  2KGR A;  2G9B A;  2HQW A;  1XYD A;  3VRP A;  1NSH A;  3WXA A;  1BF5 A;  1CDP A;  1IG5 A;  1NX0 A;  1ZMZ A;  2KBI A;  2KQY A;  4M2O A;  3VRN A;  5KTY A;  3MSE B;  1JF2 A;  1NCX A;  4PHN A;  1YVL A;  2H61 C;  1NX3 A;  2K7D A;  2F8P A;  4PHJ A;  3EVV A;  1A03 A;  2Q91 A;  1JSA A;  3K21 A;  1WLZ A;  1CM1 A;  2KFH A;  1IH0 A;  2AAO A;  3I5H B;  1HT9 A;  2ZKM X;  3ICB A;  3PN7 C;  2JTT A;  1N2D A;  4I5L B;  3SG7 A;  1DJX A;  1IJ6 A;  1DJW A;  2BCB A;  5HKW A;  3FIA A;  1WDC C;  3NSK A;  1W7I B;  1YX8 A;  4GGN A;  1QV0 A;  3CWG A;  1GJY A;  1XFV O;  4MSP A;  1K9K A;  1SL9 A;  2COL B;  5K89 A;  3LL8 B;  3SG3 A;  5FYX A;  1DGV A;  4YI9 A;  1NX2 A;  1ZUZ A;  3D0Y A;  2MJW B;  3GOF A;  2BE4 A;  4XJK A;  2M3W A;  2LNK A;  4OR9 B;  2JNF A;  1DJZ A;  1NUB A;  2P6B B;  1X02 A;  5F6T A;  1PAL A;  2L4I A;  2I2R E;  2PVB A;  4JQ0 D;  2LVK A;  1Y0V H;  4UPG A;  4DIR A;  1B7T Y;  2NCO A;  4R1E A;  4CFR A;  1QAS A;  1KCY A;  3I5I C;  2LMV A;  2VRG A;  4GFT A;  1AK8 A;  1OSA A;  5DKQ A;  2LCP A;  1NPQ A;  2KDH A;  2I18 A;  2EGD A;  2M7N A;  2JWW A;  2JXC A;  4USL A;  5CSF A;  3TDZ A;  1K93 D;  1UHN A;  1SCV A;  3BQ3 A;  1PVB A;  1CDN A;  3PFV A;  2LAN A;  4YRU A;  4PE1 A;  3LCP C;  1DJG A;  1Y6W A;  2LP2 A;  1ODB A;  4I5J A;  4TNC A;  1BOC A;  1RJV A;  3BUN B;  4GGF A;  1S26 D;  3GK1 A;  3SG5 A;  1R6P A;  3O78 A;  2K2F A;  1LA3 A;  2PSR A;  3PM8 A;  1F70 A;  2F2O A;  1JBA A;  3KHE A;  4MZK A;  3I5I B;  2CXJ A;  2JOJ A;  1TNW A;  3F45 A;  3H4S E;  5JJG A;  5KSZ A;  4GPL B;  1UHK A;  4GAO A;  1GQM A;  1S5G Y;  3DVM A;  1C07 A;  1MF8 B;  1J7R A;  2BBM A;  1Q80 A;  1B1G A;  3KO0 A;  2OPO A;  2ZRS A;  1TN4 A;  4JWQ A;  4MZL A;  1S3P A;  1QJT A;  2WCB A;  3JTD C;  1M39 A;  3FWB A;  4IL1 A;  3PLF B;  4GGF C;  2IS9 A;  4AQJ A;  1M31 A;  4PDZ A;  3DVJ A;  1EJ3 A;  1KK7 Z;  1YUS A;  3EKH A;  1PSB A;  4MZJ A;  1OE9 B;  2ZNE A;  4PHK A;  2A4J A;  1K8U A;  4DUQ A;  3WHU B;  3D10 A;  4DRW A;  4F0Z B;  1CDL A;  1CM4 A;  1NIW A;  2QPT A;  2NLN A;  3NSO A;  2M49 B;  2F3Y A;  2OS8 B;  2EHB A;  2LVV A;  1F55 A;  4A4C A;  1BLQ A;  4ZCV A;  4HRH A;  2AUC A;  1B47 A;  1QLK A;  2DOQ A;  2Y1M A;  2KAV A;  1K9P A;  1G33 A;  2WCE A;  4I5K A;  4L9M A;  3CGA A;  1Y1U A;  4NDC A;  2Y1N A;  3SG2 A;  1DTL A;  1YUR A;  4ORC B;  1M46 A;  1IQ5 A;  1SY9 A;  3VRQ A;  1AHR A;  1K96 A;  1XK4 A;  1SRA A;  1YRT B;  1ALW A;  3I5H C;  2BCX A;  1AVS A;  2CTN A;  1N0Y A;  5CSJ A;  1AUI B;  4ICB A;  4N1F A;  3M0W A;  1YUU A;  2F33 A;  1ZFS A;  1E8A A;  1MQ1 A;  1S36 A;  2KNE A;  1BOD A;  1LA0 A;  1QTX A;  2M9G A;  4MLW A;  1RFJ A;  4D1E A;  2FCD A;  3AAK A;  3WNX B;  2EC6 B;  1S6I A;  2LMU A;  5HLO A;  1XFW O;  1J7P A;  1KFU L;  1SK6 D;  1XK4 C;  5J3X A;  1DJY A;  2SCP A;  1CFD A;  1SMG A;  4MRX A;  1DVI A;  3VRR A;  3CS1 A;  1NCZ A;  1QS7 A;  3NSI A;  2JNX A;  1XA5 A;  2MLE C;  1IQ3 A;  3DVK A;  2LVJ A;  1C7V A;  2KQ6 A;  3CLN A;  3TUY B;  2L2E A;  2I7A A;  3EK4 A;  4GUK A;  3EVR A;  4CFQ A;  3NSL A;  4WQ3 A;  2G2B A;  1LIN A;  1QX7 A;  2BL0 B;  2LUX A;  5PAL A;  1V1G A;  5CSI A;  1FBV A;  1PSR A;  2JZI A;  1SBJ A;  2BBN A;  2B1U A;  2FOT A;  3DF0 B;  1LKJ A;  5DKR A;  4E68 A;  2LMT A;  5BPJ A;  2QAC A;  1XFU O;  1PUL A;  2MBX A;  3FWC A;  2H2K A;  2LHI A;  2MLF C;  4GNK B;  1BR1 B;  2M1K B;  1GGZ A;  1ZOT B;  4YI8 A;  1KFX L;  1W7J B;  2CBL A;  4I5N B;  4DCK A;  2WOS A;  2KSP A;  1K2H A;  1B8L A;  1PK0 D;  3BUW B;  3KF9 A;  3KEV A;  4WQ2 A;  1EXR A;  2OTG B;  1IGV A;  3I5F B;  3PSR A;  1ALV A;  1JFK A;  4BY5 A;  2FJU B;  4M2P A;  1CFC A;  1WLM A;  1YVH A;  2HPS A;  5AFP A;  1CFP A;  1L7Z A;  2LV7 A;  4ORA B;  4N5X A;  4PE4 A;  4YGB B;  2K61 A;  1KSM A;  1OMV A;  4OVN F;  3I5G C;  2LLU A;  3TDU A;  1OQP A;  1UP5 A;  2JRF A;  1KQV A;  1TCF A;  2K7B A;  2KAX A;  3EVU A;  1IRJ A;  1U5I A;  1BG1 A;  4C0K A;  1R2U A;  4DS7 A;  1F8H A;  4ORB B;  3BUX B;  1REC A;  2M7L A;  2MAZ A;  2MRD A;  2BKI B;  4NDD A;  2NCP A;  2Q4U A;  1UUR A;  2OS8 C;  3OX5 A;  5AER A;  2PAL A;  3NXA A;  4MEW A;  1RTP 1;  3IQQ A;  5KU1 A;  1CDM A;  3DD4 A;  1UHJ A;  1BT6 A;  1CLM A;  1QLS A;  1A4P A;  2HF5 A;  1WY9 A;  1F54 A;  3SG4 A;  1B9A A;  4M2Q A;  3GK4 X;  4YGD B;  3VGO A;  3I5G B;  1SW8 A;  2CT9 A;  4ETO A;  2WOR A;  4CLN A;  4PE7 A;  1JFJ A;  1KQM C;  3AKB A;  2K2A A;  1GGW A;  2WC8 A;  1CLB A;  2D8N A;  1YRU B;  3TS5 C;  3JVT C;  3BXK A;  4OKH A;  1M63 B;  1RK9 A;  2GV5 A;  3CR5 X;  2M8U A;  2JQ6 A;  1JWD A;  1MR8 A;  2KI4 C;  2M1U A;  1QIW A;  3VRO A;  2KHN A;  5AAN A;  2WCF A;  3A4U B;  2EC6 C;  1RRO A;  1UUS A;  4ZCU A;  1DF0 B;  4WRI A;  4YGA A;  4N1G A;  1U5I B;  1CMG A;  1IWQ A;  3BOW B;  1BU3 A;  1DJI A;  3WHT B;  2JPT A;  3DF0 A;  2L51 A;  5B8I B;  2L4H A;  4MVF A;  3GK2 A;  1Y1A A;  3AAJ A;  5ER4 X;  1KK8 B;  1TRF A;  1XVJ A;  1KQM B;  3AKA A;  4MN0 A;  4C0J A;  1J7Q A;  1CB1 A;  1QVI Y;  4U8D A;  1LVC D;  3TZ1 A;  3OB1 B;  2RGI A;  1BMO A;  1SYM A;  1FI5 A;  3TS5 B;  3JVT B;  1BJF A;  3OB2 B;  3TUY C;  1NCY A;  1FI6 A;  1KK7 Y;  2KI4 B;  2BL0 C;  2O5G A;  1SPY A;  5I8N A;  1QX2 A;  1TNX A;  1S6J A;  1SCM B;  1DMO A;  3CZT X;  4GBA A;  1D1O A;  1J1E A;  1OOJ A;  4CID A;  1JC2 A;  1K90 D;  1F4Q A;  1KFU S;  1QV1 A;  2K8M B;  2KI6 C;  2KYC A;  5I2Q A;  4YGC B;  2FCE A;  2ZFD A;  2JC2 A;  2Y4Q A;  2O60 A;  2CCM A;  3E3R A;  1AJ4 A;  3OX6 A;  4FTG A;  2JTZ A;  3SIB A;  1TTX A;  3PAL A;  1V1F A;  1J1D A;  1A75 B;  2OTG C;  3I5F C;  1B7T Z;  2K0J A;  4C0L A;  2JU0 A;  2BE6 A;  2KAY A;  2TN4 A;  1JUO A;  5CSN A;  1XFZ O;  1XO5 A;  2L50 A;  3RLZ A;  3IQO A;  2JXL A;  1SL7 A;  1MUX A;  1SKT A;  2ISD A;  1PRW A;  2LAP A;  3CR2 A;  3KPX A;  3SJS A;  1KWO B;  2KFF A;  5ER5 A;  2ZN9 A;  2KI6 D;  1J55 A;  1SR6 B;  5D7F A;  1F71 A;  2E6W A;  1NX1 A;  1KSO A;  4MRY A;  4PE0 A;  2LE9 B;  1K9U A;  1L2O C;  1KFX S;  2I94 A;  4PAL A;  5AEQ A;  3RM1 A;  2ZN8 A;  2V53 A;  2SAS A;  2KOT A;  1TCO B;  1FPW A;  2KFG A;  1UHI A;  1JF0 A;  2PMY A;  3LK0 A;  4P5O E;  3FS7 A;  3ZNI A;  1QIV A;  2K7C A;  1MWN A;  1FF1 A;  3LK1 A;  2GGM A;  3C1V A;  1NYA A;  2GGZ A;  2M29 A;  1S5G Z;  2HET A;  4XYN A;  2JT3 A;  2K7O A;  1DF0 A;  1NWD A;  1CNP A;  1YUT A;  2LUC A;  2R2I A;  1RWY A;  1BR4 B;  1TOP A;  1WRL A;  1DT7 B;  4BY4 A;  1OZO A;  3PN7 B;  4QJ5 B;  3BOW A;  1SL8 A;  5CPV A;  1Y1X A;  2AMI A;  3IF7 A;  3EK8 A;  1WDC B;  1C7W A;  1OMR A;  1L2O B;  2M0R A;  1K95 A;  3O4Y A;  1WRZ A;  4YBH B;  1CMF A;  4QJ4 B;  3SG6 A;  1EL4 A;  2BKH B;  3PAT A;  4YGE B;  1IKU A;  1OMD A;  1A2X A;  1B8R A;  2JT0 A;  1MXE A;  4PHM A;  3OP0 A;  5HKZ A;  1ZAC A;  3BUM B;  3O6B A;  1B8C A;  3HCM A;  1H8B A;  5G08 A;  1TNP A;  2LLS A;  1FW4 A;  1TIZ A;  2L98 A;  5HYD A;  2F3Z A;  3O2P A;  2PAS A;  5DKN A;  1KK8 C;  1QXP A;  1XFX O;  1WRK A;  2JT8 A;  1H4B A;  2Y5I A;  1G4Y R;  1EG4 A;  1K94 A;  3EKJ A;  5GQQ C;  3DVE A;  1XFY O;  2NXQ A;  3D0Y B;  1YX7 A;  1S1E A;  4XJK B; 
#chains in the Genus database with same CATH topology
 2KYF A;  3A8R A;  1PVA A;  3CR4 X;  4AOM A;  1QVI Z;  5IBW A;  1DEK A;  1TNQ A;  4NDB A;  1A75 A;  2M97 A;  3UO9 A;  1EG3 A;  3OHM B;  1CLL A;  2BCA A;  3BYA A;  1CKK A;  1J7O A;  1TUZ A;  1SCM C;  1M45 A;  4OCI A;  4OV2 A;  1YR5 A;  3LLE A;  4JPZ B;  1S6C A;  2LM5 A;  1LXF C;  2JPO A;  1F4O A;  5HKY A;  3SIA A;  2KGB C;  1VRK A;  2KBM A;  4HSZ A;  1CTR A;  1N65 A;  5TNC A;  1QX5 B;  4QJ3 B;  2MHH A;  2P70 A;  4HRG A;  4A4B A;  1CFF A;  4CPV A;  3BUO B;  4YBH B;  2WND A;  4MBE A;  1MXL C;  2L5X B;  3N7H A;  2ZND A;  3HX4 A;  4NQG A;  1EH2 A;  4Q04 A;  1C3Z A;  3QRX A;  2LHL A;  5D69 A;  2L0P A;  3CTN A;  2NZ0 A;  1AP4 A;  5I2O A;  3NHI A;  2FJY A;  1B4C A;  5JOL A;  2LP3 A;  5HLV A;  3CZ1 A;  2BAP A;  2CNP A;  3L4A A;  3JTD B;  4HRE E;  1IJ5 A;  1MHO A;  3BJH A;  4P2Y B;  1AJ5 A;  3ZWH A;  3CAB A;  1SNL A;  4FQO A;  3EK7 A;  1HQV A;  4JD9 A;  5AXI A;  1NP8 A;  5I2L A;  1DJH A;  1OW4 A;  2H61 A;  1KWO C;  1YTZ C;  2LLT A;  2ZRT A;  1G8I A;  2WC6 A;  1DGU A;  1QAT A;  1SR6 C;  2HQ8 A;  2E30 A;  1A29 A;  2LC5 A;  2PRU A;  3TDI A;  4PCW A;  1UHH A;  1OZS A;  2BEC A;  2MA2 A;  1UWO A;  4AQI A;  2LVI A;  2JUL A;  2F2P A;  2KGR A;  2G9B A;  2HQW A;  3BFB A;  1XYD A;  4INW A;  3VRP A;  1NSH A;  3WXA A;  1BF5 A;  1CDP A;  1IG5 A;  1NX0 A;  1ZMZ A;  2KBI A;  2KQY A;  4M2O A;  3VRN A;  4OZD A;  5KTY A;  3MSE B;  1JF2 A;  1NCX A;  3CYZ A;  4PHN A;  1YVL A;  2H61 C;  1NX3 A;  2K7D A;  2F8P A;  4PHJ A;  3EVV A;  1A03 A;  2Q91 A;  1JSA A;  2QEB A;  3K21 A;  1WLZ A;  1CM1 A;  2KFH A;  1IH0 A;  2AAO A;  3I5H B;  1HT9 A;  2ZKM X;  3ICB A;  3PN7 C;  2JTT A;  1N2D A;  4I5L B;  3SG7 A;  1DJX A;  1IJ6 A;  1DJW A;  2BCB A;  5HKW A;  3FIA A;  1WDC C;  3NSK A;  1W7I B;  1YX8 A;  4GGN A;  1QV0 A;  1Z2C B;  3CWG A;  1GJY A;  1XFV O;  2WCH A;  3CZ0 A;  1K9K A;  4MSP A;  1SL9 A;  2COL B;  5K89 A;  3LL8 B;  2KPH A;  3EG5 B;  1DQE A;  5FYX A;  3SG3 A;  1DGV A;  4YI9 A;  1LS8 A;  1NX2 A;  1ORG A;  1ZUZ A;  2MJW B;  3D0Y A;  2BE4 A;  3GOF A;  4PT1 A;  4XJK A;  2M3W A;  2LNK A;  4OR9 B;  2JNF A;  1DJZ A;  1NUB A;  2P6B B;  1X02 A;  5F6T A;  1PAL A;  2L4I A;  2I2R E;  2PVB A;  4JQ0 D;  2LVK A;  1Y0V H;  4UPG A;  4DIR A;  1B7T Y;  3R1O A;  2NCO A;  4R1E A;  4CFR A;  1QAS A;  1KCY A;  3I5I C;  2LMV A;  2VRG A;  4GFT A;  1AK8 A;  1OSA A;  4KYN A;  5DKQ A;  2LCP A;  1NPQ A;  5FI7 A;  2KDH A;  2I18 A;  3B88 A;  3NHT A;  2EGD A;  3SS5 A;  1OOG A;  2M7N A;  2JWW A;  2JXC A;  4USL A;  5CSF A;  5FI2 A;  3TDZ A;  1K93 D;  1UHN A;  1SCV A;  3BQ3 A;  1PVB A;  1CDN A;  3FE6 A;  3PFV A;  2LAN A;  4YRU A;  4PE1 A;  3LCP C;  1DJG A;  1Y6W A;  2LP2 A;  1ODB A;  4I5J A;  4TNC A;  1BOC A;  1RJV A;  3BUN B;  4GGF A;  1S26 D;  3GK1 A;  3SG5 A;  1R6P A;  3O78 A;  2K2F A;  1LA3 A;  2PSR A;  3PM8 A;  2QEO A;  1F70 A;  3S0B A;  2F2O A;  1JBA A;  3KHE A;  4MZK A;  3I5I B;  3V2L A;  3CZ2 A;  3R1V A;  2CXJ A;  2JOJ A;  1TNW A;  2KLD A;  2QEV A;  3F45 A;  1DEL A;  2H8V A;  3H4S E;  5JJG A;  5KSZ A;  4GPL B;  1UHK A;  4GAO A;  1GQM A;  1S5G Y;  3DVM A;  3B86 A;  1W9Z A;  3L47 A;  1C07 A;  1MF8 B;  1J7R A;  3SS3 A;  4JKT A;  3DXL A;  2BBM A;  1Q80 A;  1B1G A;  3KO0 A;  2OPO A;  2ZRS A;  1TN4 A;  4JWQ A;  4MZL A;  5EL2 A;  1S3P A;  1QJT A;  2WCB A;  3JTD C;  3DY9 A;  1M39 A;  3FWB A;  3PM2 A;  3PLF B;  4IL1 A;  4GGF C;  2IS9 A;  4AQJ A;  1M31 A;  4PDZ A;  3DVJ A;  1EJ3 A;  2PQL A;  1KK7 Z;  1YUS A;  1OOH A;  3EKH A;  1PSB A;  4MZJ A;  1OE9 B;  2ZNE A;  4PHK A;  2A4J A;  3D78 A;  1K8U A;  4DUQ A;  1TUJ A;  3D10 A;  3WHU B;  4DRW A;  4F0Z B;  1CDL A;  1CM4 A;  1NIW A;  3S0E A;  2QPT A;  2NLN A;  3DZT A;  3NSO A;  4IJ7 A;  2M49 B;  2F3Y A;  2OS8 B;  2EHB A;  2LVV A;  1F55 A;  1GM0 A;  4A4C A;  1BLQ A;  4ZCV A;  4HRH A;  2AUC A;  3CDN A;  1B47 A;  1QLK A;  2DOQ A;  2Y1M A;  2KAV A;  1K9P A;  1G33 A;  3OGN A;  2WCE A;  4I5K A;  4L9M A;  3CGA A;  1Y1U A;  4NDC A;  2Y1N A;  3SG2 A;  1DTL A;  1YUR A;  4ORC B;  1M46 A;  1IQ5 A;  1SY9 A;  3VRQ A;  2BNX A;  1AHR A;  1K96 A;  1XK4 A;  1SRA A;  1YRT B;  1ALW A;  3I5H C;  2BCX A;  1AVS A;  2CTN A;  1N0Y A;  5CSJ A;  1AUI B;  4ICB A;  4N1F A;  3M0W A;  1YUU A;  2F33 A;  4INX A;  1ZFS A;  1E8A A;  1MQ1 A;  1S36 A;  2KNE A;  1BOD A;  1LA0 A;  1QTX A;  2M9G A;  4MLW A;  1RFJ A;  4D1E A;  3O4X A;  2FCD A;  3AAK A;  3WNX B;  2EC6 B;  1S6I A;  2LMU A;  5I94 A;  5HLO A;  1XFW O;  2WCL A;  1J7P A;  1KFU L;  1SK6 D;  1XK4 C;  5J3X A;  1DJY A;  2SCP A;  1CFD A;  1SMG A;  4MRX A;  2QEH A;  1DVI A;  3VRR A;  3CS1 A;  1NCZ A;  1QS7 A;  3NSI A;  2JNX A;  1XA5 A;  2MLE C;  1IQ3 A;  3DVK A;  1P28 A;  2LVJ A;  3R1P A;  1C7V A;  1TWO A;  2KQ6 A;  3CLN A;  3TUY B;  1C3Y A;  2L2E A;  2I7A A;  3EK4 A;  4GUK A;  3EVR A;  2WCK A;  4CFQ A;  3NSL A;  4WQ3 A;  2G2B A;  1LIN A;  1QX7 A;  2BL0 B;  2LUX A;  5PAL A;  1V1G A;  5CSI A;  1FBV A;  3B87 A;  1PSR A;  2JZI A;  1SBJ A;  2BBN A;  2B1U A;  2FOT A;  3DF0 B;  1LKJ A;  5DKR A;  4E68 A;  2LMT A;  5BPJ A;  2QAC A;  1XFU O;  1PUL A;  2MBX A;  3FWC A;  2ERB A;  2H2K A;  2LHI A;  2MLF C;  4GNK B;  1BR1 B;  2M1K B;  1GGZ A;  1ZOT B;  4YI8 A;  1KFX L;  1W7J B;  2CBL A;  4I5N B;  4DCK A;  1QWV A;  2WOS A;  4FQT A;  2KSP A;  1K2H A;  1B8L A;  1PK0 D;  3BUW B;  3KF9 A;  3KEV A;  4WQ2 A;  1EXR A;  2OTG B;  1IGV A;  3I5F B;  3PSR A;  1ALV A;  1JFK A;  3SS4 A;  4BY5 A;  2FJU B;  3NGV A;  2WCM A;  1WLM A;  1YVH A;  2HPS A;  4M2P A;  5AFP A;  1CFC A;  3K1E A;  1CFP A;  1L7Z A;  2LV7 A;  4ORA B;  4N5X A;  4PE4 A;  4YGB B;  2K61 A;  3D75 A;  1KSM A;  1OMV A;  3D73 A;  4OVN F;  3I5G C;  2LLU A;  3TDU A;  1OQP A;  1UP5 A;  2JRF A;  1KQV A;  1IIO A;  1TCF A;  2K7B A;  2KAX A;  3EVU A;  1IRJ A;  1U5I A;  1BG1 A;  4C0K A;  1R2U A;  4DS7 A;  1F8H A;  4ORB B;  3BUX B;  1REC A;  2M7L A;  1OOF A;  2MAZ A;  2MRD A;  2BKI B;  4NDD A;  2NCP A;  2Q4U A;  5FI6 A;  1UUR A;  2L5Y A;  2OS8 C;  3OX5 A;  5AER A;  2PAL A;  3NXA A;  4MEW A;  1RTP 1;  3IQQ A;  5KU1 A;  1CDM A;  3DD4 A;  3BFA A;  1UHJ A;  1BT6 A;  1CLM A;  1QLS A;  1A4P A;  2HF5 A;  1WY9 A;  3B7A A;  1F54 A;  3SG4 A;  1B9A A;  5D3O A;  4M2Q A;  3GK4 X;  4YGD B;  3VGO A;  3I5G B;  1SW8 A;  2CT9 A;  4ETO A;  2WOR A;  4CLN A;  3S0F A;  4PE7 A;  1JFJ A;  1KQM C;  3AKB A;  1OOI X;  2K2A A;  1GGW A;  2WC8 A;  3S0G A;  3RZS A;  2D8N A;  1CLB A;  1YRU B;  3TS5 C;  3JVT C;  3BXK A;  4OKH A;  1M63 B;  1RK9 A;  2GV5 A;  3CR5 X;  2M8U A;  2JQ6 A;  4F7F A;  1JWD A;  1MR8 A;  2KI4 C;  2M1U A;  1QIW A;  3VRO A;  2KHN A;  5AAN A;  2WCF A;  3A4U B;  2EC6 C;  3D74 A;  1RRO A;  1UUS A;  4ZCU A;  1DF0 B;  4WRI A;  4YGA A;  4N1G A;  5HL1 A;  3UNW A;  1U5I B;  1CMG A;  1IWQ A;  3BOW B;  1BU3 A;  1DJI A;  3WHT B;  2JPT A;  3DF0 A;  2L51 A;  5B8I B;  2L4H A;  4MVF A;  3GK2 A;  2KLE A;  1Y1A A;  3AAJ A;  5ER4 X;  1KK8 B;  1TRF A;  1XVJ A;  1KQM B;  3AKA A;  4MN0 A;  4C0J A;  1J7Q A;  1CB1 A;  1QVI Y;  2L2C A;  4U8D A;  1LVC D;  3TZ1 A;  3OB1 B;  2RGI A;  1BMO A;  1SYM A;  1FI5 A;  2P71 A;  3DYE A;  3TS5 B;  3JVT B;  1BJF A;  3OB2 B;  3TUY C;  3VB1 A;  1NCY A;  1FI6 A;  1KK7 Y;  2KI4 B;  2BL0 C;  2O5G A;  1SPY A;  5I8N A;  3FE9 A;  1QX2 A;  1T14 A;  1TNX A;  1S6J A;  1SCM B;  1DMO A;  3CZT X;  4GBA A;  1D1O A;  1J1E A;  1OOJ A;  4CID A;  1JC2 A;  1K90 D;  1F4Q A;  1KFU S;  1QV1 A;  2K8M B;  3OBV A;  3QME A;  2KI6 C;  2KYC A;  5I2Q A;  3PJI A;  4YGC B;  2FCE A;  2ZFD A;  2JC2 A;  2Y4Q A;  2O60 A;  2CCM A;  3E3R A;  1AJ4 A;  3OX6 A;  4FTG A;  2JTZ A;  3SIB A;  1TTX A;  3PAL A;  1V1F A;  1J1D A;  1A75 B;  2OTG C;  3I5F C;  1B7T Z;  2K0J A;  4C0L A;  2JU0 A;  2BE6 A;  2KAY A;  3Q8I A;  2TN4 A;  1JUO A;  5CSN A;  1XFZ O;  2K60 A;  1XO5 A;  2L50 A;  3RLZ A;  3IQO A;  3B6X A;  2JXL A;  1SL7 A;  1MUX A;  1SKT A;  2ISD A;  1PRW A;  2LAP A;  3CR2 A;  3KPX A;  3SJS A;  1KWO B;  2KFF A;  5ER5 A;  2ZN9 A;  2KI6 D;  1J55 A;  1SR6 B;  5D7F A;  1F71 A;  2E6W A;  1NX1 A;  1KSO A;  4MRY A;  4PE0 A;  2LE9 B;  1K9U A;  1L2O C;  1KFX S;  2I94 A;  4PAL A;  5AEQ A;  3D76 A;  3L4L A;  3RM1 A;  2ZN8 A;  2V53 A;  2SAS A;  2KOT A;  1TCO B;  3S0D A;  1FPW A;  2KFG A;  1UHI A;  1JF0 A;  2PMY A;  3LK0 A;  4P5O E;  3FS7 A;  3ZNI A;  1QIV A;  2K7C A;  1MWN A;  1FF1 A;  3LK1 A;  2GGM A;  3C1V A;  1NYA A;  2GGZ A;  2WC5 A;  2M29 A;  1S5G Z;  2GTE A;  2HET A;  2JT3 A;  2K7O A;  4XYN A;  3IVT A;  1XFR A;  1DF0 A;  1NWD A;  2PYQ A;  1CNP A;  2QDI A;  1YUT A;  2LUC A;  2R2I A;  1RWY A;  1BR4 B;  1TOP A;  1WRL A;  1DT7 B;  4BY4 A;  1OZO A;  3PN7 B;  4QJ5 B;  3BOW A;  1SL8 A;  5CPV A;  1Y1X A;  2AMI A;  3IF7 A;  3EK8 A;  1WDC B;  1C7W A;  1OMR A;  1L2O B;  2M0R A;  1K95 A;  1Z4H A;  1WRZ A;  3O4Y A;  1CMF A;  4QJ4 B;  3SG6 A;  1EL4 A;  2BKH B;  3PAT A;  3D77 A;  4YGE B;  1IKU A;  1OMD A;  3BFH A;  1A2X A;  3S0A A;  1B8R A;  2JT0 A;  1MXE A;  4PHM A;  3OP0 A;  5HKZ A;  1ZAC A;  3BUM B;  3O6B A;  3FE8 A;  1B8C A;  1DC1 A;  3HCM A;  1H8B A;  5G08 A;  1TNP A;  3R72 A;  2LLS A;  1FW4 A;  1TIZ A;  2L98 A;  5HYD A;  2YGU A;  2F3Z A;  3O2P A;  5DIC A;  2PAS A;  5DKN A;  1KK8 C;  1QXP A;  1XFX O;  2WCJ A;  1WRK A;  2JT8 A;  1H4B A;  2Y5I A;  1G4Y R;  1EG4 A;  1K94 A;  3EKJ A;  5GQQ C;  3DVE A;  1XFY O;  1SSE B;  2NXQ A;  3D0Y B;  1YX7 A;  1S1E A;  4XJK B; 
#chains in the Genus database with same CATH homology
 2KYF A;  3A8R A;  1PVA A;  3CR4 X;  4AOM A;  1QVI Z;  5IBW A;  1TNQ A;  4NDB A;  1A75 A;  2M97 A;  1CKK A;  1EG3 A;  3OHM B;  1CLL A;  2BCA A;  3BYA A;  1J7O A;  1SCM C;  1M45 A;  4OCI A;  4OV2 A;  1YR5 A;  3LLE A;  4JPZ B;  1S6C A;  2LM5 A;  1LXF C;  1F4O A;  5HKY A;  3SIA A;  2KGB C;  1VRK A;  2KBM A;  4HSZ A;  1CTR A;  1N65 A;  5TNC A;  1QX5 B;  4QJ3 B;  2MHH A;  4HRG A;  4A4B A;  1CFF A;  4CPV A;  3BUO B;  2WND A;  4MBE A;  1MXL C;  2L5X B;  2ZND A;  3HX4 A;  4NQG A;  1EH2 A;  4Q04 A;  3QRX A;  2LHL A;  5D69 A;  2L0P A;  3CTN A;  2NZ0 A;  1AP4 A;  5I2O A;  1B4C A;  5JOL A;  2LP3 A;  5HLV A;  2CNP A;  3JTD B;  4HRE E;  1IJ5 A;  1MHO A;  4P2Y B;  1AJ5 A;  3ZWH A;  1SNL A;  4FQO A;  3EK7 A;  1HQV A;  5AXI A;  1NP8 A;  5I2L A;  1DJH A;  2H61 A;  1KWO C;  1YTZ C;  2LLT A;  2ZRT A;  1G8I A;  1DGU A;  1QAT A;  1SR6 C;  2HQ8 A;  2E30 A;  1A29 A;  2LC5 A;  2PRU A;  3TDI A;  4PCW A;  1UHH A;  1OZS A;  2BEC A;  2MA2 A;  1UWO A;  4AQI A;  2LVI A;  2JUL A;  2F2P A;  2KGR A;  2G9B A;  2HQW A;  1XYD A;  3VRP A;  1NSH A;  3WXA A;  1BF5 A;  1CDP A;  1IG5 A;  1NX0 A;  1ZMZ A;  2KBI A;  2KQY A;  4M2O A;  3VRN A;  5KTY A;  3MSE B;  1JF2 A;  1NCX A;  4PHN A;  1YVL A;  2H61 C;  1NX3 A;  2K7D A;  2F8P A;  4PHJ A;  3EVV A;  1A03 A;  2Q91 A;  1JSA A;  3K21 A;  1WLZ A;  1CM1 A;  2KFH A;  1IH0 A;  2AAO A;  3I5H B;  1HT9 A;  2ZKM X;  3ICB A;  3PN7 C;  2JTT A;  1N2D A;  4I5L B;  3SG7 A;  1DJX A;  1IJ6 A;  1DJW A;  2BCB A;  5HKW A;  3FIA A;  1WDC C;  3NSK A;  1W7I B;  1YX8 A;  4GGN A;  1QV0 A;  3CWG A;  1GJY A;  1XFV O;  4MSP A;  1K9K A;  1SL9 A;  2COL B;  5K89 A;  3LL8 B;  3SG3 A;  5FYX A;  1DGV A;  4YI9 A;  1NX2 A;  1ZUZ A;  3D0Y A;  2MJW B;  3GOF A;  2BE4 A;  4XJK A;  2M3W A;  2LNK A;  4OR9 B;  2JNF A;  1DJZ A;  1NUB A;  2P6B B;  1X02 A;  5F6T A;  1PAL A;  2L4I A;  2I2R E;  2PVB A;  4JQ0 D;  2LVK A;  1Y0V H;  4UPG A;  4DIR A;  1B7T Y;  2NCO A;  4R1E A;  4CFR A;  1QAS A;  1KCY A;  3I5I C;  2LMV A;  2VRG A;  4GFT A;  1AK8 A;  1OSA A;  5DKQ A;  2LCP A;  1NPQ A;  2KDH A;  2I18 A;  2EGD A;  2M7N A;  2JWW A;  2JXC A;  4USL A;  5CSF A;  3TDZ A;  1K93 D;  1UHN A;  1SCV A;  3BQ3 A;  1PVB A;  1CDN A;  3PFV A;  2LAN A;  4YRU A;  4PE1 A;  3LCP C;  1DJG A;  1Y6W A;  2LP2 A;  1ODB A;  4I5J A;  4TNC A;  1BOC A;  1RJV A;  3BUN B;  4GGF A;  1S26 D;  3GK1 A;  3SG5 A;  1R6P A;  3O78 A;  2K2F A;  1LA3 A;  2PSR A;  3PM8 A;  1F70 A;  2F2O A;  1JBA A;  3KHE A;  4MZK A;  3I5I B;  2CXJ A;  2JOJ A;  1TNW A;  3F45 A;  3H4S E;  5JJG A;  5KSZ A;  4GPL B;  1UHK A;  4GAO A;  1GQM A;  1S5G Y;  3DVM A;  1C07 A;  1MF8 B;  1J7R A;  2BBM A;  1Q80 A;  1B1G A;  3KO0 A;  2OPO A;  2ZRS A;  1TN4 A;  4JWQ A;  4MZL A;  1S3P A;  1QJT A;  2WCB A;  3JTD C;  1M39 A;  3FWB A;  4IL1 A;  3PLF B;  4GGF C;  2IS9 A;  4AQJ A;  1M31 A;  4PDZ A;  3DVJ A;  1EJ3 A;  1KK7 Z;  1YUS A;  3EKH A;  1PSB A;  4MZJ A;  1OE9 B;  2ZNE A;  4PHK A;  2A4J A;  1K8U A;  4DUQ A;  3WHU B;  3D10 A;  4DRW A;  4F0Z B;  1CDL A;  1CM4 A;  1NIW A;  2QPT A;  2NLN A;  3NSO A;  2M49 B;  2F3Y A;  2OS8 B;  2EHB A;  2LVV A;  1F55 A;  4A4C A;  1BLQ A;  4ZCV A;  4HRH A;  2AUC A;  1B47 A;  1QLK A;  2DOQ A;  2Y1M A;  2KAV A;  1K9P A;  1G33 A;  2WCE A;  4I5K A;  4L9M A;  3CGA A;  1Y1U A;  4NDC A;  2Y1N A;  3SG2 A;  1DTL A;  1YUR A;  4ORC B;  1M46 A;  1IQ5 A;  1SY9 A;  3VRQ A;  1AHR A;  1K96 A;  1XK4 A;  1SRA A;  1YRT B;  1ALW A;  3I5H C;  2BCX A;  1AVS A;  2CTN A;  1N0Y A;  5CSJ A;  1AUI B;  4ICB A;  4N1F A;  3M0W A;  1YUU A;  2F33 A;  1ZFS A;  1E8A A;  1MQ1 A;  1S36 A;  2KNE A;  1BOD A;  1LA0 A;  1QTX A;  2M9G A;  4MLW A;  1RFJ A;  4D1E A;  2FCD A;  3AAK A;  3WNX B;  2EC6 B;  1S6I A;  2LMU A;  5HLO A;  1XFW O;  1J7P A;  1KFU L;  1SK6 D;  1XK4 C;  5J3X A;  1DJY A;  2SCP A;  1CFD A;  1SMG A;  4MRX A;  1DVI A;  3VRR A;  3CS1 A;  1NCZ A;  1QS7 A;  3NSI A;  2JNX A;  1XA5 A;  2MLE C;  1IQ3 A;  3DVK A;  2LVJ A;  1C7V A;  2KQ6 A;  3CLN A;  3TUY B;  2L2E A;  2I7A A;  3EK4 A;  4GUK A;  3EVR A;  4CFQ A;  3NSL A;  4WQ3 A;  2G2B A;  1LIN A;  1QX7 A;  2BL0 B;  2LUX A;  5PAL A;  1V1G A;  5CSI A;  1FBV A;  1PSR A;  2JZI A;  1SBJ A;  2BBN A;  2B1U A;  2FOT A;  3DF0 B;  1LKJ A;  5DKR A;  4E68 A;  2LMT A;  5BPJ A;  2QAC A;  1XFU O;  1PUL A;  2MBX A;  3FWC A;  2H2K A;  2LHI A;  2MLF C;  4GNK B;  1BR1 B;  2M1K B;  1GGZ A;  1ZOT B;  4YI8 A;  1KFX L;  1W7J B;  2CBL A;  4I5N B;  4DCK A;  2WOS A;  2KSP A;  1K2H A;  1B8L A;  1PK0 D;  3BUW B;  3KF9 A;  3KEV A;  4WQ2 A;  1EXR A;  2OTG B;  1IGV A;  3I5F B;  3PSR A;  1ALV A;  1JFK A;  4BY5 A;  2FJU B;  4M2P A;  1CFC A;  1WLM A;  1YVH A;  2HPS A;  5AFP A;  1CFP A;  1L7Z A;  2LV7 A;  4ORA B;  4N5X A;  4PE4 A;  4YGB B;  2K61 A;  1KSM A;  1OMV A;  4OVN F;  3I5G C;  2LLU A;  3TDU A;  1OQP A;  1UP5 A;  2JRF A;  1KQV A;  1TCF A;  2K7B A;  2KAX A;  3EVU A;  1IRJ A;  1U5I A;  1BG1 A;  4C0K A;  1R2U A;  4DS7 A;  1F8H A;  4ORB B;  3BUX B;  1REC A;  2M7L A;  2MAZ A;  2MRD A;  2BKI B;  4NDD A;  2NCP A;  2Q4U A;  1UUR A;  2OS8 C;  3OX5 A;  5AER A;  2PAL A;  3NXA A;  4MEW A;  1RTP 1;  3IQQ A;  5KU1 A;  1CDM A;  3DD4 A;  1UHJ A;  1BT6 A;  1CLM A;  1QLS A;  1A4P A;  2HF5 A;  1WY9 A;  1F54 A;  3SG4 A;  1B9A A;  4M2Q A;  3GK4 X;  4YGD B;  3VGO A;  3I5G B;  1SW8 A;  2CT9 A;  4ETO A;  2WOR A;  4CLN A;  4PE7 A;  1JFJ A;  1KQM C;  3AKB A;  2K2A A;  1GGW A;  2WC8 A;  1CLB A;  2D8N A;  1YRU B;  3TS5 C;  3JVT C;  3BXK A;  4OKH A;  1M63 B;  1RK9 A;  2GV5 A;  3CR5 X;  2M8U A;  2JQ6 A;  1JWD A;  1MR8 A;  2KI4 C;  2M1U A;  1QIW A;  3VRO A;  2KHN A;  5AAN A;  2WCF A;  3A4U B;  2EC6 C;  1RRO A;  1UUS A;  4ZCU A;  1DF0 B;  4WRI A;  4YGA A;  4N1G A;  1U5I B;  1CMG A;  1IWQ A;  3BOW B;  1BU3 A;  1DJI A;  3WHT B;  2JPT A;  3DF0 A;  2L51 A;  5B8I B;  2L4H A;  4MVF A;  3GK2 A;  1Y1A A;  3AAJ A;  5ER4 X;  1KK8 B;  1TRF A;  1XVJ A;  1KQM B;  3AKA A;  4MN0 A;  4C0J A;  1J7Q A;  1CB1 A;  1QVI Y;  4U8D A;  1LVC D;  3TZ1 A;  3OB1 B;  2RGI A;  1BMO A;  1SYM A;  1FI5 A;  3TS5 B;  3JVT B;  1BJF A;  3OB2 B;  3TUY C;  1NCY A;  1FI6 A;  1KK7 Y;  2KI4 B;  2BL0 C;  2O5G A;  1SPY A;  5I8N A;  1QX2 A;  1TNX A;  1S6J A;  1SCM B;  1DMO A;  3CZT X;  4GBA A;  1D1O A;  1J1E A;  1OOJ A;  4CID A;  1JC2 A;  1K90 D;  1F4Q A;  1KFU S;  1QV1 A;  2K8M B;  2KI6 C;  2KYC A;  5I2Q A;  4YGC B;  2FCE A;  2ZFD A;  2JC2 A;  2Y4Q A;  2O60 A;  2CCM A;  3E3R A;  1AJ4 A;  3OX6 A;  4FTG A;  2JTZ A;  3SIB A;  1TTX A;  3PAL A;  1V1F A;  1J1D A;  1A75 B;  2OTG C;  3I5F C;  1B7T Z;  2K0J A;  4C0L A;  2JU0 A;  2BE6 A;  2KAY A;  2TN4 A;  1JUO A;  5CSN A;  1XFZ O;  1XO5 A;  2L50 A;  3RLZ A;  3IQO A;  2JXL A;  1SL7 A;  1MUX A;  1SKT A;  2ISD A;  1PRW A;  2LAP A;  3CR2 A;  3KPX A;  3SJS A;  1KWO B;  2KFF A;  5ER5 A;  2ZN9 A;  2KI6 D;  1J55 A;  1SR6 B;  5D7F A;  1F71 A;  2E6W A;  1NX1 A;  1KSO A;  4MRY A;  4PE0 A;  2LE9 B;  1K9U A;  1L2O C;  1KFX S;  2I94 A;  4PAL A;  5AEQ A;  3RM1 A;  2ZN8 A;  2V53 A;  2SAS A;  2KOT A;  1TCO B;  1FPW A;  2KFG A;  1UHI A;  1JF0 A;  2PMY A;  3LK0 A;  4P5O E;  3FS7 A;  3ZNI A;  1QIV A;  2K7C A;  1MWN A;  1FF1 A;  3LK1 A;  2GGM A;  3C1V A;  1NYA A;  2GGZ A;  2M29 A;  1S5G Z;  2HET A;  4XYN A;  2JT3 A;  2K7O A;  1DF0 A;  1NWD A;  1CNP A;  1YUT A;  2LUC A;  2R2I A;  1RWY A;  1BR4 B;  1TOP A;  1WRL A;  1DT7 B;  4BY4 A;  1OZO A;  3PN7 B;  4QJ5 B;  3BOW A;  1SL8 A;  5CPV A;  1Y1X A;  2AMI A;  3IF7 A;  3EK8 A;  1WDC B;  1C7W A;  1OMR A;  1L2O B;  2M0R A;  1K95 A;  3O4Y A;  1WRZ A;  4YBH B;  1CMF A;  4QJ4 B;  3SG6 A;  1EL4 A;  2BKH B;  3PAT A;  4YGE B;  1IKU A;  1OMD A;  1A2X A;  1B8R A;  2JT0 A;  1MXE A;  4PHM A;  3OP0 A;  5HKZ A;  1ZAC A;  3BUM B;  3O6B A;  1B8C A;  3HCM A;  1H8B A;  5G08 A;  1TNP A;  2LLS A;  1FW4 A;  1TIZ A;  2L98 A;  5HYD A;  2F3Z A;  3O2P A;  2PAS A;  5DKN A;  1KK8 C;  1QXP A;  1XFX O;  1WRK A;  2JT8 A;  1H4B A;  2Y5I A;  1G4Y R;  1EG4 A;  1K94 A;  3EKJ A;  5GQQ C;  3DVE A;  1XFY O;  2NXQ A;  3D0Y B;  1YX7 A;  1S1E A;  4XJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...