1PULA

Solution structure for the 21kda caenorhabditis elegans protein ce32e8.3. northeast structural genomics consortium target wr33
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
NWDDADVKKRWDAFTKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKVLAFVAEDRARQSKKPIQDELDAITEKLAKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein C32E8.3 in chromosome I
publication title Backbone 1H, 15N and 13C assignments for the 21 kDa Caenorhabditis elegans homologue of "brain-specific" protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pulA00
2NZ0A 2L0PA 2MBXA 3WXAA 2JRFA 1PULA 1OZOA 3D0YA 2QACA 2LMTA 1KK7Z 5D69A 1Y1AA 1TNXA 3I5IB 1JFJA 2M0RA 4U8DA 3HX4A 1NCXA 2GGZA 2ZFDA 4YI8A 1QATA 1DJXA 1BMOA 1KK8C 1R2UA 1KK8B 4OR9B 3PATA 1YRTB 2LM5A 2JXLA 1CTRA 3NSKA 1JC2A 4PHNA 1UHNA 1M39A 3PSRA 1KFUL 1J1EA 2BKIB 4GFTA 5I2QA 1G33A 3FS7A 1NSHA 5HKYA 1IGVA 2KGBC 1J7OA 2Q4UA 4CFQA 1F8HA 3AKBA 3SG2A 1CDPA 1SL7A 1EG4A 1ZMZA 2KBMA 1SCVA 3NSOA 1F55A 1SYMA 3BUWB 3SG5A 1XK4A 1A75A 4YGDB 3CR2A 2F8PA 1NUBA 2CT9A 3GK1A 1C7VA 2LMVA 1Y1XA 4HSZA 1FI6A 1BG1A 3FWBA 1K94A 1QLKA 2KBIA 4PCWA 1MQ1A 1RFJA 2RGIA 1B8CA 1NWDA 1BOCA 2EHBA 3VRQA 4MLWA 1BF5A 1KFXS 4M2OA 4TNCA 3SJSA 2HQ8A 2LANA 1S5GY 4OKHA 1IG5A 2EC6C 1G4YR 2EC6B 1OMRA 2ZNDA 1BR1B 1KQMC 3BYAA 1KQMB 1SPYA 5PALA 5KSZA 1S36A 2MHHA 1DGVA 3ZWHA 2JNXA 1M45A 2JC2A 3OX5A 1DVIA 1WLZA 1JF2A 1F71A 1CLLA 1OMDA 3BOWA 1YR5A 3O6BA 1AVSA 4DS7A 4C0LA 1CNPA 1LA3A 1F4OA 3EVUA 1Y0VH 1J1DA 5AERA 2L5XB 1U5IB 2M7LA 5DKRA 3VRNA 1CLMA 3O4YA 2K7CA 3IQOA 4GGFC 1EL4A 3H4SE 2KI6D 2LVVA 1YX8A 4HREE 1TCOB 1C07A 3E3RA 3F45A 4PE7A 2JT3A 3TUYC 1F4QA 1ZOTB 3TUYB 1QVIY 1XFVO 1KCYA 1KFUS 2BBMA 4OVNF 5DKNA 3DD4A 1UUSA 2MLEC 2WOSA 2I7AA 2H2KA 1QV0A 1UP5A 3GK4X 3MSEB 1IRJA 1LVCD 5J3XA 2PVBA 2OS8C 2JOJA 4ZCUA 1RWYA 3BOWB 1XFWO 4QJ3B 1M31A 2JQ6A 2LLSA 1M46A 2WCBA 1V1FA 3JVTB 3IQQA 3JVTC 3LLEA 3VGOA 4QJ5B 4AQIA 2B1UA 2FCDA 1SR6C 1QX5B 1PVAA 1UWOA 2FCEA 1DTLA 1K95A 2F2OA 5DKQA 1XYDA 3AAKA 1S5GZ 2WC8A 1PVBA 2BL0C 2CBLA 2BL0B 3TDUA 1IWQA 1KSMA 2PSRA 1E8AA 3I5FC 3LCPC 2L50A 3WHUB 2EGDA 2MA2A 3KEVA 1EJ3A 1S3PA 5F6TA 3FWCA 1SW8A 3PFVA 3EK7A 1NYAA 4F0ZB 1FBVA 1GJYA 1IH0A 2ZN9A 1W7JB 3IF7A 3VROA 3JTDC 1M63B 1WRKA 1QJTA 2BCXA 3I5HC 4GGNA 4DCKA 3I5HB 2Y1MA 2M3WA 3OX6A 3QRXA 1QASA 1LINA 1QLSA 2BCAA 4PE0A 1S6CA 1B8LA 4YGCB 5GQQC 2M8UA 1K9KA 1IQ3A 1B4CA 4MZKA 4PE1A 1UURA 1B7TY 1CFDA 1K96A 3PM8A 4E68A 1TIZA 2LCPA 4OCIA 5AEQA 2JTZA 3SG6A 2L51A 3LK0A 2AMIA 1SY9A 2M97A 1TTXA 4I5NB 1R6PA 3SIAA 4NQGA 2K2AA 1TOPA 2D8NA 3DVMA 2M7NA 1SL9A 5ER4X 5AXIA 2LUXA 1IQ5A 1FW4A 4AOMA 4PHJA 5AFPA 2KI6C 4FTGA 1RECA 2SCPA 1H8BA 2JU0A 1LA0A 4CPVA 1AP4A 4GBAA 1EG3A 2LP3A 3CLNA 1K9PA 5FYXA 1U5IA 2F33A 1QV1A 1IJ5A 2O60A 2G2BA 2LLUA 2PASA 2ZRSA 3DF0B 2L4HA 2NCOA 2BKHB 3RLZA 1AK8A 4P5OE 1OOJA 1DJWA 1BT6A 4GGFA 1WY9A 2KDHA 5HYDA 1CDLA 5CSJA 1TCFA 1GQMA 1YRUB 2NXQA 1RTP1 4XYNA 1ZACA 2NCPA 3PALA 1TRFA 2H61A 1HQVA 1NIWA 2F3ZA 1B8RA 5HLOA 2ISDA 1BLQA 2JTTA 4GPLB 1KWOC 1WDCC 1KWOB 1WDCB 1EXRA 4DUQA 1OSAA 4YGBB 2KFFA 2ZN8A 1ZUZA 2KAYA 2KFGA 1B1GA 3OHMB 3DVJA 4L9MA 1CB1A 2KFHA 1WLMA 1TNPA 1D1OA 1H4BA 2KAVA 2JZIA 1CDMA 2ZKMX 2Q91A 1DJHA 4OV2A 1ZFSA 4BY4A 1CM4A 4QJ4B 1PSBA 5KTYA 1B47A 3O78A 4IL1A 1ALWA 1CFCA 1B9AA 1SBJA 4JPZB 4MZLA 2K7DA 5HLVA 2KYFA 2MLFC 3EVRA 1QX2A 4MN0A 1A29A 1CM1A 2LVKA 2ZRTA 4WQ3A 4DRWA 1KK7Y 5CSFA 2KNEA 2KSPA 1QX7A 2GV5A 1DF0B 2WCEA 3CWGA 5CSIA 3LL8B 2HPSA 4USLA 4A4CA 2VRGA 3NXAA 3WHTB 1CDNA 2OS8B 2MAZA 3RM1A 1Y1UA 1DJZA 2KOTA 1SMGA 2L2EA 2Y1NA 1X02A 3OB1B 3EVVA 4PHKA 1QIVA 1S1EA 3BXKA 2HQWA 4ORCB 3K21A 1SR6B 3NSLA 3OB2B 1SNLA 2KAXA 1DJGA 2TN4A 2F2PA 4CFRA 3I5GC 1NX2A 1J7QA 3I5GB 1QIWA 1YURA 2M9GA 1L2OC 1PK0D 1TN4A 1V1GA 2P6BB 4MVFA 5G08A 1CMGA 4N1GA 3BUNB 1DMOA 1JWDA 1SCMC 2HETA 2F3YA 2LE9B 1NX3A 4I5KA 2K8MB 2BECA 3I5FB 1CFPA 3FIAA 2LP2A 2E30A 1YVHA 1F54A 4A4BA 2KGRA 1CFFA 2JULA 2LAPA 3VRRA 4MRYA 4WRIA 2KQYA 3GOFA 4ORAB 1IKUA 3D10A 2FOTA 2L4IA 4NDDA 2Y4QA 3JTDB 3EKHA 2CNPA 4PALA 1TNQA 3BUXB 3DF0A 2AUCA 4DIRA 1QTXA 5D7FA 1WRLA 2PRUA 2MRDA 1ODBA 4R1EA 1CKKA 3CS1A 2JWWA 1XFYO 1QXPA 1UHJA 3A8RA 1JFKA 1XA5A 3OP0A 1YUTA 5K89A 3CR4X 2G9BA 5CPVA 4Q04A 2SASA 4MEWA 4YBHB 4D1EA 1A03A 1QVIZ 1XVJA 4ORBB 3KF9A 1J7RA 4ETOA 1G8IA 1KSOA 3WNXB 1WRZA 2JT8A 2K7BA 1NCYA 3TZ1A 3I5IC 1PALA 4N1FA 5ER5A 2FJUB 1N65A 2KQ6A 1K93D 2I18A 2M29A 2MJWB 2M49B 3EK4A 1KQVA 5HKWA 1FI5A 1N2DA 4AQJA 1MWNA 2PMYA 1S26D 5KU1A 4ICBA 4N5XA 5BPJA 1YUSA 1S6IA 1XFUO 2LV7A 3A4UB 1YVLA 2CXJA 5I2OA 1BODA 3BUOB 2JT0A 5HKZA 1CMFA 4MZJA 5I2LA 1NX1A 1OZSA 2ZNEA 3TDIA 4CIDA 1HT9A 3SG4A 2COLB 3BQ3A 1JF0A 3M0WA 4P2YB 1J55A 1XFZO 3TS5C 1UHHA 3TS5B 1AJ5A 1GGZA 4PHMA 5JOLA 1DT7B 1YTZC 2M1KB 2K0JA 3DVEA 1PSRA 3VRPA 1N0YA 1Q80A 1FPWA 1OQPA 3D0YB 1K9UA 2KI4C 1DF0A 3CGAA 3PLFB 2KI4B 3EKJA 1IJ6A 1A4PA 1OMVA 1Y6WA 1CLBA 1C7WA 2NLNA 2LLTA 2L98A 2HF5A 1J7PA 1RJVA 4CLNA 4JWQA 2KYCA 1K90D 1NCZA 4HRHA 4XJKA 5JJGA 2BE6A 2BE4A 4GAOA 1MXEA 2BBNA 3PN7C 2PALA 3PN7B 1AUIB 2AAOA 1B7TZ 3LK1A 4JQ0D 2LVIA 1LXFC 1TNWA 4BY5A 1JBAA 2LNKA 4MRXA 4WQ2A 3BUMB 4YGAA 2LC5A 1LKJA 2V53A 2WORA 1F70A 1XFXO 2JPTA 2DOQA 4NDBA 1PRWA 1DGUA 4MSPA 4I5LB 1AJ4A 2JNFA 1XK4C 1A75B 2KHNA 3EK8A 2K7OA 1MF8B 5TNCA 1JUOA 4YGEB 1UHIA 1RK9A 2IS9A 4ZCVA 1L7ZA 1DJIA 2O5GA 1YUUA 2BCBA 1A2XA 4YRUA 1MHOA 2CTNA 4C0KA 2OPOA 2WNDA 2A4JA 4M2PA 3SG7A 1QS7A 3TDZA 4C0JA 1SKTA 1FF1A 4GUKA 1MXLC 2E6WA 3HCMA 3C1VA 4XJKB 5AANA 3CTNA 1GGWA 1SL8A 3ZNIA 1K8UA 2LHLA 2H61C 2QPTA 3O2PA 1W7IB 2M1UA 3SG3A 2R2IA 1DJYA 1L2OB 2CCMA 2OTGC 3DVKA 3ICBA 1YX7A 2OTGB 1SCMB 1NPQA 3CZTX 2I2RE 2I94A 4PDZA 1MR8A 1JSAA 1OE9B 1SK6D 3KO0A 4UPGA 1XO5A 3AKAA 1EH2A 1ALVA 2LVJA 4FQOA 2GGMA 4PE4A 4MBEA 2LUCA 1BU3A 2WCFA 2K61A 1BR4B 1SRAA 1NP8A 2K2FA 5B8IB 4YI9A 4HRGA 1KFXL 4NDCA 2Y5IA 2LMUA 1VRKA 2LHIA 3KPXA 1MUXA 3KHEA 1NX0A 1K2HA 1UHKA 5I8NA 4I5JA 3CR5X 3GK2A 3SIBA 3NSIA 1S6JA 1AHRA 3AAJA 1RROA 1BJFA 4M2QA 5CSNA 4GNKB 2JXCA 5IBWA
chains in the Genus database with same CATH superfamily
2NZ0A 2L0PA 2MBXA 3WXAA 2JRFA 1PULA 1OZOA 3D0YA 2QACA 2LMTA 1KK7Z 5D69A 1Y1AA 3QMEA 1TNXA 3I5IB 1JFJA 2M0RA 4U8DA 3HX4A 1NCXA 2GGZA 2ZFDA 4YI8A 1QATA 1DJXA 1BMOA 1KK8C 4FQTA 1R2UA 1KK8B 3DXLA 4OR9B 3PATA 1YRTB 2LM5A 2JXLA 1CTRA 3NSKA 1JC2A 2YGUA 4PHNA 1UHNA 1M39A 3PSRA 1KFUL 1J1EA 2BKIB 4GFTA 5I2QA 1G33A 2KLEA 1NSHA 3FS7A 1IGVA 2KGBC 5D3OA 5HKYA 2Q4UA 4CFQA 1J7OA 1F8HA 3AKBA 3SG2A 1CDPA 1SL7A 1EG4A 1ZMZA 2KBMA 1SCVA 3NSOA 1F55A 1SYMA 3BUWB 3SG5A 1XK4A 1A75A 2WC5A 3D77A 4YGDB 3S0EA 3UNWA 3CR2A 2F8PA 1NUBA 1TWOA 3D75A 2CT9A 3GK1A 3CABA 3UO9A 1C7VA 2LMVA 1Y1XA 3EG5B 2WCJA 4HSZA 1FI6A 3CZ0A 2QEBA 1BG1A 3FWBA 1K94A 1QLKA 2KBIA 4PCWA 1MQ1A 1RFJA 2RGIA 1OW4A 1B8CA 1NWDA 1BOCA 2EHBA 3VRQA 4MLWA 1BF5A 1KFXS 4M2OA 4TNCA 3SJSA 2HQ8A 2LANA 1S5GY 4OKHA 1IG5A 2QEOA 1QWVA 2EC6C 1G4YR 2EC6B 3R1OA 1OMRA 2ZNDA 1BR1B 1KQMC 3BYAA 1KQMB 1SPYA 5PALA 5KSZA 1S36A 3DY9A 2MHHA 1DGVA 3ZWHA 2JNXA 1M45A 2JC2A 3OX5A 3B86A 1DVIA 1WLZA 1JF2A 1F71A 1CLLA 1OMDA 3BOWA 1YR5A 2L2CA 1AVSA 3O6BA 4DS7A 4C0LA 1CNPA 1LA3A 2FJYA 1F4OA 3B6XA 3EVUA 1Y0VH 1J1DA 5AERA 1W9ZA 2L5XB 1U5IB 2M7LA 5DKRA 3VRNA 1CLMA 3SS3A 3DZTA 3Q8IA 2JPOA 3S0GA 3O4YA 2K7CA 3IQOA 4GGFC 1EL4A 3H4SE 3R72A 2KI6D 2LVVA 1YX8A 4HREE 3N7HA 3D78A 1TCOB 1C07A 3E3RA 3F45A 3NHIA 2JT3A 4PE7A 2WCMA 3TUYC 1F4QA 1ZOTB 3TUYB 1QVIY 2QEHA 1XFVO 1KCYA 1KFUS 2BBMA 4OVNF 5DKNA 3DD4A 1UUSA 2MLEC 2WOSA 2I7AA 2H2KA 2QDIA 1QV0A 1UP5A 3GK4X 3MSEB 1IRJA 1LVCD 5J3XA 2PVBA 2OS8C 2JOJA 4ZCUA 1RWYA 2ERBA 3BOWB 3FE9A 1XFWO 4QJ3B 1M31A 2JQ6A 2LLSA 1M46A 2WCBA 1V1FA 3JVTB 3IQQA 3JVTC 3LLEA 3VGOA 4QJ5B 1C3ZA 4AQIA 2B1UA 2FCDA 1SR6C 1QX5B 1PVAA 1UWOA 3BFHA 2FCEA 4F7FA 2QEVA 1DTLA 4KYNA 1K95A 2F2OA 5DKQA 1XYDA 3AAKA 4INXA 1S5GZ 2WC8A 1PVBA 2BL0C 2CBLA 2BL0B 4JD9A 3TDUA 1IWQA 1KSMA 2PSRA 1E8AA 3I5FC 3LCPC 2L50A 3WHUB 2EGDA 2MA2A 2PQLA 3KEVA 1EJ3A 5EL2A 1S3PA 3D73A 5F6TA 5DICA 3FWCA 1SW8A 3PFVA 3EK7A 1NYAA 4F0ZB 1FBVA 4JKTA 1C3YA 1GJYA 3BFAA 3OGNA 1IH0A 1SSEB 2ZN9A 1W7JB 3IF7A 3VROA 3JTDC 1M63B 3D74A 1WRKA 1QJTA 3B88A 2BCXA 3I5HC 4GGNA 4DCKA 3I5HB 2Y1MA 2M3WA 3OX6A 3QRXA 1QASA 1DC1A 1LINA 1LS8A 1QLSA 2BCAA 4PE0A 1S6CA 1B8LA 4YGCB 5GQQC 2M8UA 1K9KA 1IQ3A 1B4CA 4MZKA 4PE1A 1UURA 1B7TY 1CFDA 1K96A 3PM8A 4E68A 1DQEA 1TIZA 2LCPA 4OCIA 5AEQA 2JTZA 3SG6A 2L51A 3LK0A 2AMIA 1SY9A 2M97A 1TTXA 4I5NB 1R6PA 3SIAA 4NQGA 2K2AA 1IIOA 1TOPA 2D8NA 3DVMA 2M7NA 1SL9A 5ER4X 5AXIA 2LUXA 3OBVA 1IQ5A 1FW4A 4AOMA 4PHJA 3FE8A 5AFPA 2KI6C 4FTGA 1RECA 2SCPA 3IVTA 1H8BA 2JU0A 1LA0A 4CPVA 3S0FA 1AP4A 4GBAA 1EG3A 2LP3A 3CLNA 1K9PA 5FYXA 1U5IA 2F33A 1QV1A 1IJ5A 2O60A 2G2BA 2LLUA 2PASA 2ZRSA 3DF0B 2L4HA 2NCOA 2BKHB 3RLZA 1AK8A 4P5OE 1OOJA 1DJWA 1BT6A 4GGFA 1WY9A 2KDHA 5HYDA 3PM2A 1CDLA 5CSJA 1TCFA 1GQMA 1YRUB 2NXQA 1RTP1 4XYNA 1ZACA 1T14A 3S0AA 2NCPA 3PALA 1TRFA 2H61A 1HQVA 1NIWA 4INWA 2F3ZA 1B8RA 3D76A 5HLOA 2ISDA 1BLQA 2JTTA 5KU1A 4GPLB 1P28A 1KWOC 1OOFA 1WDCC 3DYEA 1KWOB 1WDCB 1EXRA 4DUQA 1OSAA 4YGBB 2KFFA 2ZN8A 1ZUZA 2KAYA 2KFGA 1B1GA 1GM0A 3OHMB 3DVJA 4L9MA 1CB1A 2KFHA 1WLMA 1TNPA 3S0BA 1D1OA 1H4BA 1XFRA 2JZIA 1CDMA 2KAVA 2Q91A 1DJHA 2ZKMX 1ZFSA 4OV2A 1CM4A 4BY4A 1PSBA 4QJ4B 1B47A 3O78A 4IL1A 1ALWA 1CFCA 3B87A 4IJ7A 1B9AA 1SBJA 4JPZB 4MZLA 2K7DA 5HLVA 2KYFA 2MLFC 3EVRA 3SS5A 1QX2A 4MN0A 1A29A 1CM1A 2LVKA 2ZRTA 2K60A 4WQ3A 4DRWA 1KK7Y 5CSFA 2KNEA 2KSPA 1QX7A 2GV5A 1DF0B 2WCEA 2P71A 3CWGA 5CSIA 3LL8B 2HPSA 4USLA 4A4CA 2VRGA 1Z4HA 3NXAA 3WHTB 1CDNA 2OS8B 2MAZA 3RM1A 1Y1UA 1DJZA 2KOTA 1SMGA 2L2EA 2Y1NA 3CYZA 1X02A 3OB1B 3EVVA 4PHKA 1QIVA 1S1EA 3BXKA 1OOGA 2HQWA 3K21A 4ORCB 1SR6B 3BFBA 3NSLA 3OB2B 1SNLA 2KAXA 1DJGA 2TN4A 2F2PA 4CFRA 3I5GC 1NX2A 1J7QA 3I5GB 3S0DA 1QIWA 1YURA 2M9GA 5I94A 1L2OC 1PK0D 1TN4A 1V1GA 2P6BB 3PJIA 4MVFA 5G08A 4N1GA 3BUNB 1CMGA 1DMOA 1SCMC 2HETA 1JWDA 2F3YA 2LE9B 1NX3A 4I5KA 5FI2A 2K8MB 2BECA 3I5FB 1CFPA 3FIAA 2LP2A 2BAPA 2E30A 1YVHA 2KPHA 1F54A 4A4BA 2WCKA 3O4XA 2KGRA 1CFFA 2JULA 2LAPA 3VRRA 4MRYA 4WRIA 2KQYA 3GOFA 3K1EA 4ORAB 1IKUA 3D10A 2FOTA 2L4IA 4NDDA 2Y4QA 3JTDB 3EKHA 3RZSA 2CNPA 3L4AA 4PALA 1TNQA 3BUXB 3DF0A 2AUCA 2H8VA 4DIRA 1QTXA 5D7FA 1WRLA 2PRUA 2MRDA 1ODBA 4R1EA 1CKKA 3CS1A 2JWWA 1XFYO 1QXPA 1UHJA 3A8RA 1JFKA 1XA5A 3OP0A 1YUTA 5K89A 3CR4X 2G9BA 5CPVA 4Q04A 2SASA 4MEWA 4YBHB 4D1EA 1A03A 1QVIZ 1XVJA 4ORBB 3KF9A 1J7RA 4ETOA 3SS4A 1G8IA 1KSOA 3WNXB 1WRZA 2JT8A 2K7BA 1NCYA 3TZ1A 3I5IC 1PALA 4PT1A 4N1FA 5ER5A 3FE6A 2FJUB 1N65A 2KQ6A 1K93D 2I18A 2M29A 2MJWB 2M49B 3EK4A 5FI6A 3V2LA 5HKWA 1KQVA 3CZ2A 1FI5A 1TUZA 1N2DA 4AQJA 1MWNA 2PMYA 1S26D 3BJHA 3NHTA 3VB1A 4ICBA 4N5XA 5BPJA 1YUSA 1S6IA 1XFUO 2LV7A 3A4UB 1YVLA 2CXJA 5I2OA 1BODA 3BUOB 2JT0A 5HKZA 2WCHA 1CMFA 4MZJA 5I2LA 3CZ1A 1NX1A 1OZSA 2ZNEA 3TDIA 4CIDA 1HT9A 3SG4A 1ORGA 2COLB 3BQ3A 1JF0A 3M0WA 4P2YB 1J55A 1XFZO 3TS5C 1UHHA 3TS5B 1AJ5A 1GGZA 4PHMA 5JOLA 1DT7B 1YTZC 2M1KB 3L47A 2K0JA 3DVEA 1PSRA 3VRPA 1N0YA 1Q80A 1FPWA 2WC6A 1OQPA 3D0YB 1K9UA 5KTYA 2KI4C 1DF0A 3CGAA 3PLFB 2KI4B 3EKJA 1IJ6A 1A4PA 1OMVA 1Y6WA 1OOIX 1CLBA 1C7WA 2NLNA 2LLTA 2L98A 2HF5A 1J7PA 1RJVA 4CLNA 3NGVA 4JWQA 2KYCA 1K90D 1NCZA 4HRHA 4XJKA 5JJGA 2BE6A 2BE4A 2KLDA 4GAOA 1MXEA 2BBNA 3PN7C 2PALA 3L4LA 3PN7B 1AUIB 1OOHA 2AAOA 1B7TZ 3LK1A 4JQ0D 2LVIA 1LXFC 1TNWA 4BY5A 1JBAA 5FI7A 2LNKA 2PYQA 4MRXA 3BUMB 4WQ2A 4YGAA 2LC5A 1LKJA 2V53A 2WORA 1F70A 1XFXO 2JPTA 1Z2CB 2DOQA 4NDBA 1PRWA 1DGUA 4MSPA 4I5LB 3R1PA 1AJ4A 2JNFA 1XK4C 1A75B 4OZDA 2KHNA 3EK8A 2K7OA 1MF8B 5TNCA 1JUOA 4YGEB 1UHIA 1RK9A 2IS9A 4ZCVA 1L7ZA 1DJIA 2O5GA 1YUUA 2BCBA 1A2XA 2L5YA 4YRUA 1MHOA 2CTNA 4C0KA 2OPOA 2WNDA 2A4JA 4M2PA 3SG7A 1QS7A 3TDZA 4C0JA 1SKTA 1FF1A 4GUKA 1MXLC 2E6WA 3HCMA 3C1VA 4XJKB 5AANA 3CTNA 1GGWA 1SL8A 3ZNIA 1K8UA 2LHLA 2H61C 2QPTA 3O2PA 1W7IB 2M1UA 3SG3A 2R2IA 1DJYA 1L2OB 2BNXA 2CCMA 2OTGC 3DVKA 3ICBA 1YX7A 2OTGB 2WCLA 1DEKA 1SCMB 1NPQA 3CZTX 2I2RE 2I94A 4PDZA 1MR8A 1JSAA 1OE9B 1SK6D 3KO0A 2GTEA 4UPGA 1XO5A 3AKAA 1EH2A 1ALVA 2LVJA 4FQOA 2GGMA 5HL1A 4PE4A 4MBEA 2LUCA 1BU3A 2P70A 2WCFA 3B7AA 2K61A 1BR4B 1SRAA 1NP8A 2K2FA 5B8IB 4YI9A 4HRGA 1KFXL 4NDCA 2Y5IA 2LMUA 1VRKA 2LHIA 3KPXA 1MUXA 3KHEA 1NX0A 1TUJA 1K2HA 1UHKA 5I8NA 1DELA 4I5JA 3CR5X 3GK2A 3SIBA 3NSIA 1S6JA 3R1VA 1AHRA 3AAJA 1RROA 1BJFA 4M2QA 5CSNA 4GNKB 3CDNA 2JXCA 5IBWA
chains in the Genus database with same CATH topology
2NZ0A 2L0PA 2MBXA 3WXAA 2JRFA 1PULA 1OZOA 3D0YA 2QACA 2LMTA 1KK7Z 5D69A 1Y1AA 1TNXA 3I5IB 1JFJA 2M0RA 4U8DA 3HX4A 1NCXA 2GGZA 2ZFDA 4YI8A 1QATA 1DJXA 1BMOA 1KK8C 1R2UA 1KK8B 4OR9B 3PATA 1YRTB 2LM5A 2JXLA 1CTRA 3NSKA 1JC2A 4PHNA 1UHNA 1M39A 3PSRA 1KFUL 1J1EA 2BKIB 4GFTA 5I2QA 1G33A 3FS7A 1NSHA 5HKYA 1IGVA 2KGBC 1J7OA 2Q4UA 4CFQA 1F8HA 3AKBA 3SG2A 1CDPA 1SL7A 1EG4A 1ZMZA 2KBMA 1SCVA 3NSOA 1F55A 1SYMA 3BUWB 3SG5A 1XK4A 1A75A 4YGDB 3CR2A 2F8PA 1NUBA 2CT9A 3GK1A 1C7VA 2LMVA 1Y1XA 4HSZA 1FI6A 1BG1A 3FWBA 1K94A 1QLKA 2KBIA 4PCWA 1MQ1A 1RFJA 2RGIA 1B8CA 1NWDA 1BOCA 2EHBA 3VRQA 4MLWA 1BF5A 1KFXS 4M2OA 4TNCA 3SJSA 2HQ8A 2LANA 1S5GY 4OKHA 1IG5A 2EC6C 1G4YR 2EC6B 1OMRA 2ZNDA 1BR1B 1KQMC 3BYAA 1KQMB 1SPYA 5PALA 5KSZA 1S36A 2MHHA 1DGVA 3ZWHA 2JNXA 1M45A 2JC2A 3OX5A 1DVIA 1WLZA 1JF2A 1F71A 1CLLA 1OMDA 3BOWA 1YR5A 3O6BA 1AVSA 4DS7A 4C0LA 1CNPA 1LA3A 1F4OA 3EVUA 1Y0VH 1J1DA 5AERA 2L5XB 1U5IB 2M7LA 5DKRA 3VRNA 1CLMA 3O4YA 2K7CA 3IQOA 4GGFC 1EL4A 3H4SE 2KI6D 2LVVA 1YX8A 4HREE 1TCOB 1C07A 3E3RA 3F45A 4PE7A 2JT3A 3TUYC 1F4QA 1ZOTB 3TUYB 1QVIY 1XFVO 1KCYA 1KFUS 2BBMA 4OVNF 5DKNA 3DD4A 1UUSA 2MLEC 2WOSA 2I7AA 2H2KA 1QV0A 1UP5A 3GK4X 3MSEB 1IRJA 1LVCD 5J3XA 2PVBA 2OS8C 2JOJA 4ZCUA 1RWYA 3BOWB 1XFWO 4QJ3B 1M31A 2JQ6A 2LLSA 1M46A 2WCBA 1V1FA 3JVTB 3IQQA 3JVTC 3LLEA 3VGOA 4QJ5B 4AQIA 2B1UA 2FCDA 1SR6C 1QX5B 1PVAA 1UWOA 2FCEA 1DTLA 1K95A 2F2OA 5DKQA 1XYDA 3AAKA 1S5GZ 2WC8A 1PVBA 2BL0C 2CBLA 2BL0B 3TDUA 1IWQA 1KSMA 2PSRA 1E8AA 3I5FC 3LCPC 2L50A 3WHUB 2EGDA 2MA2A 3KEVA 1EJ3A 1S3PA 5F6TA 3FWCA 1SW8A 3PFVA 3EK7A 1NYAA 4F0ZB 1FBVA 1GJYA 1IH0A 2ZN9A 1W7JB 3IF7A 3VROA 3JTDC 1M63B 1WRKA 1QJTA 2BCXA 3I5HC 4GGNA 4DCKA 3I5HB 2Y1MA 2M3WA 3OX6A 3QRXA 1QASA 1LINA 1QLSA 2BCAA 4PE0A 1S6CA 1B8LA 4YGCB 5GQQC 2M8UA 1K9KA 1IQ3A 1B4CA 4MZKA 4PE1A 1UURA 1B7TY 1CFDA 1K96A 3PM8A 4E68A 1TIZA 2LCPA 4OCIA 5AEQA 2JTZA 3SG6A 2L51A 3LK0A 2AMIA 1SY9A 2M97A 1TTXA 4I5NB 1R6PA 3SIAA 4NQGA 2K2AA 1TOPA 2D8NA 3DVMA 2M7NA 1SL9A 5ER4X 5AXIA 2LUXA 1IQ5A 1FW4A 4AOMA 4PHJA 5AFPA 2KI6C 4FTGA 1RECA 2SCPA 1H8BA 2JU0A 1LA0A 4CPVA 1AP4A 4GBAA 1EG3A 2LP3A 3CLNA 1K9PA 5FYXA 1U5IA 2F33A 1QV1A 1IJ5A 2O60A 2G2BA 2LLUA 2PASA 2ZRSA 3DF0B 2L4HA 2NCOA 2BKHB 3RLZA 1AK8A 4P5OE 1OOJA 1DJWA 1BT6A 4GGFA 1WY9A 2KDHA 5HYDA 1CDLA 5CSJA 1TCFA 1GQMA 1YRUB 2NXQA 1RTP1 4XYNA 1ZACA 2NCPA 3PALA 1TRFA 2H61A 1HQVA 1NIWA 2F3ZA 1B8RA 5HLOA 2ISDA 1BLQA 2JTTA 4GPLB 1KWOC 1WDCC 1KWOB 1WDCB 1EXRA 4DUQA 1OSAA 4YGBB 2KFFA 2ZN8A 1ZUZA 2KAYA 2KFGA 1B1GA 3OHMB 3DVJA 4L9MA 1CB1A 2KFHA 1WLMA 1TNPA 1D1OA 1H4BA 2KAVA 2JZIA 1CDMA 2ZKMX 2Q91A 1DJHA 4OV2A 1ZFSA 4BY4A 1CM4A 4QJ4B 1PSBA 5KTYA 1B47A 3O78A 4IL1A 1ALWA 1CFCA 1B9AA 1SBJA 4JPZB 4MZLA 2K7DA 5HLVA 2KYFA 2MLFC 3EVRA 1QX2A 4MN0A 1A29A 1CM1A 2LVKA 2ZRTA 4WQ3A 4DRWA 1KK7Y 5CSFA 2KNEA 2KSPA 1QX7A 2GV5A 1DF0B 2WCEA 3CWGA 5CSIA 3LL8B 2HPSA 4USLA 4A4CA 2VRGA 3NXAA 3WHTB 1CDNA 2OS8B 2MAZA 3RM1A 1Y1UA 1DJZA 2KOTA 1SMGA 2L2EA 2Y1NA 1X02A 3OB1B 3EVVA 4PHKA 1QIVA 1S1EA 3BXKA 2HQWA 4ORCB 3K21A 1SR6B 3NSLA 3OB2B 1SNLA 2KAXA 1DJGA 2TN4A 2F2PA 4CFRA 3I5GC 1NX2A 1J7QA 3I5GB 1QIWA 1YURA 2M9GA 1L2OC 1PK0D 1TN4A 1V1GA 2P6BB 4MVFA 5G08A 1CMGA 4N1GA 3BUNB 1DMOA 1JWDA 1SCMC 2HETA 2F3YA 2LE9B 1NX3A 4I5KA 2K8MB 2BECA 3I5FB 1CFPA 3FIAA 2LP2A 2E30A 1YVHA 1F54A 4A4BA 2KGRA 1CFFA 2JULA 2LAPA 3VRRA 4MRYA 4WRIA 2KQYA 3GOFA 4ORAB 1IKUA 3D10A 2FOTA 2L4IA 4NDDA 2Y4QA 3JTDB 3EKHA 2CNPA 4PALA 1TNQA 3BUXB 3DF0A 2AUCA 4DIRA 1QTXA 5D7FA 1WRLA 2PRUA 2MRDA 1ODBA 4R1EA 1CKKA 3CS1A 2JWWA 1XFYO 1QXPA 1UHJA 3A8RA 1JFKA 1XA5A 3OP0A 1YUTA 5K89A 3CR4X 2G9BA 5CPVA 4Q04A 2SASA 4MEWA 4YBHB 4D1EA 1A03A 1QVIZ 1XVJA 4ORBB 3KF9A 1J7RA 4ETOA 1G8IA 1KSOA 3WNXB 1WRZA 2JT8A 2K7BA 1NCYA 3TZ1A 3I5IC 1PALA 4N1FA 5ER5A 2FJUB 1N65A 2KQ6A 1K93D 2I18A 2M29A 2MJWB 2M49B 3EK4A 1KQVA 5HKWA 1FI5A 1N2DA 4AQJA 1MWNA 2PMYA 1S26D 5KU1A 4ICBA 4N5XA 5BPJA 1YUSA 1S6IA 1XFUO 2LV7A 3A4UB 1YVLA 2CXJA 5I2OA 1BODA 3BUOB 2JT0A 5HKZA 1CMFA 4MZJA 5I2LA 1NX1A 1OZSA 2ZNEA 3TDIA 4CIDA 1HT9A 3SG4A 2COLB 3BQ3A 1JF0A 3M0WA 4P2YB 1J55A 1XFZO 3TS5C 1UHHA 3TS5B 1AJ5A 1GGZA 4PHMA 5JOLA 1DT7B 1YTZC 2M1KB 2K0JA 3DVEA 1PSRA 3VRPA 1N0YA 1Q80A 1FPWA 1OQPA 3D0YB 1K9UA 2KI4C 1DF0A 3CGAA 3PLFB 2KI4B 3EKJA 1IJ6A 1A4PA 1OMVA 1Y6WA 1CLBA 1C7WA 2NLNA 2LLTA 2L98A 2HF5A 1J7PA 1RJVA 4CLNA 4JWQA 2KYCA 1K90D 1NCZA 4HRHA 4XJKA 5JJGA 2BE6A 2BE4A 4GAOA 1MXEA 2BBNA 3PN7C 2PALA 3PN7B 1AUIB 2AAOA 1B7TZ 3LK1A 4JQ0D 2LVIA 1LXFC 1TNWA 4BY5A 1JBAA 2LNKA 4MRXA 4WQ2A 3BUMB 4YGAA 2LC5A 1LKJA 2V53A 2WORA 1F70A 1XFXO 2JPTA 2DOQA 4NDBA 1PRWA 1DGUA 4MSPA 4I5LB 1AJ4A 2JNFA 1XK4C 1A75B 2KHNA 3EK8A 2K7OA 1MF8B 5TNCA 1JUOA 4YGEB 1UHIA 1RK9A 2IS9A 4ZCVA 1L7ZA 1DJIA 2O5GA 1YUUA 2BCBA 1A2XA 4YRUA 1MHOA 2CTNA 4C0KA 2OPOA 2WNDA 2A4JA 4M2PA 3SG7A 1QS7A 3TDZA 4C0JA 1SKTA 1FF1A 4GUKA 1MXLC 2E6WA 3HCMA 3C1VA 4XJKB 5AANA 3CTNA 1GGWA 1SL8A 3ZNIA 1K8UA 2LHLA 2H61C 2QPTA 3O2PA 1W7IB 2M1UA 3SG3A 2R2IA 1DJYA 1L2OB 2CCMA 2OTGC 3DVKA 3ICBA 1YX7A 2OTGB 1SCMB 1NPQA 3CZTX 2I2RE 2I94A 4PDZA 1MR8A 1JSAA 1OE9B 1SK6D 3KO0A 4UPGA 1XO5A 3AKAA 1EH2A 1ALVA 2LVJA 4FQOA 2GGMA 4PE4A 4MBEA 2LUCA 1BU3A 2WCFA 2K61A 1BR4B 1SRAA 1NP8A 2K2FA 5B8IB 4YI9A 4HRGA 1KFXL 4NDCA 2Y5IA 2LMUA 1VRKA 2LHIA 3KPXA 1MUXA 3KHEA 1NX0A 1K2HA 1UHKA 5I8NA 4I5JA 3CR5X 3GK2A 3SIBA 3NSIA 1S6JA 1AHRA 3AAJA 1RROA 1BJFA 4M2QA 5CSNA 4GNKB 2JXCA 5IBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ0 A;  2L0P A;  2MBX A;  3WXA A;  2JRF A;  1PUL A;  1OZO A;  3D0Y A;  2QAC A;  2LMT A;  1KK7 Z;  5D69 A;  1Y1A A;  1TNX A;  3I5I B;  1JFJ A;  2M0R A;  4U8D A;  3HX4 A;  1NCX A;  2GGZ A;  2ZFD A;  4YI8 A;  1QAT A;  1DJX A;  1BMO A;  1KK8 C;  1R2U A;  1KK8 B;  4OR9 B;  3PAT A;  1YRT B;  2LM5 A;  2JXL A;  1CTR A;  3NSK A;  1JC2 A;  4PHN A;  1UHN A;  1M39 A;  3PSR A;  1KFU L;  1J1E A;  2BKI B;  4GFT A;  5I2Q A;  1G33 A;  3FS7 A;  1NSH A;  5HKY A;  1IGV A;  2KGB C;  1J7O A;  2Q4U A;  4CFQ A;  1F8H A;  3AKB A;  3SG2 A;  1CDP A;  1SL7 A;  1EG4 A;  1ZMZ A;  2KBM A;  1SCV A;  3NSO A;  1F55 A;  1SYM A;  3BUW B;  3SG5 A;  1XK4 A;  1A75 A;  4YGD B;  3CR2 A;  2F8P A;  1NUB A;  2CT9 A;  3GK1 A;  1C7V A;  2LMV A;  1Y1X A;  4HSZ A;  1FI6 A;  1BG1 A;  3FWB A;  1K94 A;  1QLK A;  2KBI A;  4PCW A;  1MQ1 A;  1RFJ A;  2RGI A;  1B8C A;  1NWD A;  1BOC A;  2EHB A;  3VRQ A;  4MLW A;  1BF5 A;  1KFX S;  4M2O A;  4TNC A;  3SJS A;  2HQ8 A;  2LAN A;  1S5G Y;  4OKH A;  1IG5 A;  2EC6 C;  1G4Y R;  2EC6 B;  1OMR A;  2ZND A;  1BR1 B;  1KQM C;  3BYA A;  1KQM B;  1SPY A;  5PAL A;  5KSZ A;  1S36 A;  2MHH A;  1DGV A;  3ZWH A;  2JNX A;  1M45 A;  2JC2 A;  3OX5 A;  1DVI A;  1WLZ A;  1JF2 A;  1F71 A;  1CLL A;  1OMD A;  3BOW A;  1YR5 A;  3O6B A;  1AVS A;  4DS7 A;  4C0L A;  1CNP A;  1LA3 A;  1F4O A;  3EVU A;  1Y0V H;  1J1D A;  5AER A;  2L5X B;  1U5I B;  2M7L A;  5DKR A;  3VRN A;  1CLM A;  3O4Y A;  2K7C A;  3IQO A;  4GGF C;  1EL4 A;  3H4S E;  2KI6 D;  2LVV A;  1YX8 A;  4HRE E;  1TCO B;  1C07 A;  3E3R A;  3F45 A;  4PE7 A;  2JT3 A;  3TUY C;  1F4Q A;  1ZOT B;  3TUY B;  1QVI Y;  1XFV O;  1KCY A;  1KFU S;  2BBM A;  4OVN F;  5DKN A;  3DD4 A;  1UUS A;  2MLE C;  2WOS A;  2I7A A;  2H2K A;  1QV0 A;  1UP5 A;  3GK4 X;  3MSE B;  1IRJ A;  1LVC D;  5J3X A;  2PVB A;  2OS8 C;  2JOJ A;  4ZCU A;  1RWY A;  3BOW B;  1XFW O;  4QJ3 B;  1M31 A;  2JQ6 A;  2LLS A;  1M46 A;  2WCB A;  1V1F A;  3JVT B;  3IQQ A;  3JVT C;  3LLE A;  3VGO A;  4QJ5 B;  4AQI A;  2B1U A;  2FCD A;  1SR6 C;  1QX5 B;  1PVA A;  1UWO A;  2FCE A;  1DTL A;  1K95 A;  2F2O A;  5DKQ A;  1XYD A;  3AAK A;  1S5G Z;  2WC8 A;  1PVB A;  2BL0 C;  2CBL A;  2BL0 B;  3TDU A;  1IWQ A;  1KSM A;  2PSR A;  1E8A A;  3I5F C;  3LCP C;  2L50 A;  3WHU B;  2EGD A;  2MA2 A;  3KEV A;  1EJ3 A;  1S3P A;  5F6T A;  3FWC A;  1SW8 A;  3PFV A;  3EK7 A;  1NYA A;  4F0Z B;  1FBV A;  1GJY A;  1IH0 A;  2ZN9 A;  1W7J B;  3IF7 A;  3VRO A;  3JTD C;  1M63 B;  1WRK A;  1QJT A;  2BCX A;  3I5H C;  4GGN A;  4DCK A;  3I5H B;  2Y1M A;  2M3W A;  3OX6 A;  3QRX A;  1QAS A;  1LIN A;  1QLS A;  2BCA A;  4PE0 A;  1S6C A;  1B8L A;  4YGC B;  5GQQ C;  2M8U A;  1K9K A;  1IQ3 A;  1B4C A;  4MZK A;  4PE1 A;  1UUR A;  1B7T Y;  1CFD A;  1K96 A;  3PM8 A;  4E68 A;  1TIZ A;  2LCP A;  4OCI A;  5AEQ A;  2JTZ A;  3SG6 A;  2L51 A;  3LK0 A;  2AMI A;  1SY9 A;  2M97 A;  1TTX A;  4I5N B;  1R6P A;  3SIA A;  4NQG A;  2K2A A;  1TOP A;  2D8N A;  3DVM A;  2M7N A;  1SL9 A;  5ER4 X;  5AXI A;  2LUX A;  1IQ5 A;  1FW4 A;  4AOM A;  4PHJ A;  5AFP A;  2KI6 C;  4FTG A;  1REC A;  2SCP A;  1H8B A;  2JU0 A;  1LA0 A;  4CPV A;  1AP4 A;  4GBA A;  1EG3 A;  2LP3 A;  3CLN A;  1K9P A;  5FYX A;  1U5I A;  2F33 A;  1QV1 A;  1IJ5 A;  2O60 A;  2G2B A;  2LLU A;  2PAS A;  2ZRS A;  3DF0 B;  2L4H A;  2NCO A;  2BKH B;  3RLZ A;  1AK8 A;  4P5O E;  1OOJ A;  1DJW A;  1BT6 A;  4GGF A;  1WY9 A;  2KDH A;  5HYD A;  1CDL A;  5CSJ A;  1TCF A;  1GQM A;  1YRU B;  2NXQ A;  1RTP 1;  4XYN A;  1ZAC A;  2NCP A;  3PAL A;  1TRF A;  2H61 A;  1HQV A;  1NIW A;  2F3Z A;  1B8R A;  5HLO A;  2ISD A;  1BLQ A;  2JTT A;  4GPL B;  1KWO C;  1WDC C;  1KWO B;  1WDC B;  1EXR A;  4DUQ A;  1OSA A;  4YGB B;  2KFF A;  2ZN8 A;  1ZUZ A;  2KAY A;  2KFG A;  1B1G A;  3OHM B;  3DVJ A;  4L9M A;  1CB1 A;  2KFH A;  1WLM A;  1TNP A;  1D1O A;  1H4B A;  2KAV A;  2JZI A;  1CDM A;  2ZKM X;  2Q91 A;  1DJH A;  4OV2 A;  1ZFS A;  4BY4 A;  1CM4 A;  4QJ4 B;  1PSB A;  5KTY A;  1B47 A;  3O78 A;  4IL1 A;  1ALW A;  1CFC A;  1B9A A;  1SBJ A;  4JPZ B;  4MZL A;  2K7D A;  5HLV A;  2KYF A;  2MLF C;  3EVR A;  1QX2 A;  4MN0 A;  1A29 A;  1CM1 A;  2LVK A;  2ZRT A;  4WQ3 A;  4DRW A;  1KK7 Y;  5CSF A;  2KNE A;  2KSP A;  1QX7 A;  2GV5 A;  1DF0 B;  2WCE A;  3CWG A;  5CSI A;  3LL8 B;  2HPS A;  4USL A;  4A4C A;  2VRG A;  3NXA A;  3WHT B;  1CDN A;  2OS8 B;  2MAZ A;  3RM1 A;  1Y1U A;  1DJZ A;  2KOT A;  1SMG A;  2L2E A;  2Y1N A;  1X02 A;  3OB1 B;  3EVV A;  4PHK A;  1QIV A;  1S1E A;  3BXK A;  2HQW A;  4ORC B;  3K21 A;  1SR6 B;  3NSL A;  3OB2 B;  1SNL A;  2KAX A;  1DJG A;  2TN4 A;  2F2P A;  4CFR A;  3I5G C;  1NX2 A;  1J7Q A;  3I5G B;  1QIW A;  1YUR A;  2M9G A;  1L2O C;  1PK0 D;  1TN4 A;  1V1G A;  2P6B B;  4MVF A;  5G08 A;  1CMG A;  4N1G A;  3BUN B;  1DMO A;  1JWD A;  1SCM C;  2HET A;  2F3Y A;  2LE9 B;  1NX3 A;  4I5K A;  2K8M B;  2BEC A;  3I5F B;  1CFP A;  3FIA A;  2LP2 A;  2E30 A;  1YVH A;  1F54 A;  4A4B A;  2KGR A;  1CFF A;  2JUL A;  2LAP A;  3VRR A;  4MRY A;  4WRI A;  2KQY A;  3GOF A;  4ORA B;  1IKU A;  3D10 A;  2FOT A;  2L4I A;  4NDD A;  2Y4Q A;  3JTD B;  3EKH A;  2CNP A;  4PAL A;  1TNQ A;  3BUX B;  3DF0 A;  2AUC A;  4DIR A;  1QTX A;  5D7F A;  1WRL A;  2PRU A;  2MRD A;  1ODB A;  4R1E A;  1CKK A;  3CS1 A;  2JWW A;  1XFY O;  1QXP A;  1UHJ A;  3A8R A;  1JFK A;  1XA5 A;  3OP0 A;  1YUT A;  5K89 A;  3CR4 X;  2G9B A;  5CPV A;  4Q04 A;  2SAS A;  4MEW A;  4YBH B;  4D1E A;  1A03 A;  1QVI Z;  1XVJ A;  4ORB B;  3KF9 A;  1J7R A;  4ETO A;  1G8I A;  1KSO A;  3WNX B;  1WRZ A;  2JT8 A;  2K7B A;  1NCY A;  3TZ1 A;  3I5I C;  1PAL A;  4N1F A;  5ER5 A;  2FJU B;  1N65 A;  2KQ6 A;  1K93 D;  2I18 A;  2M29 A;  2MJW B;  2M49 B;  3EK4 A;  1KQV A;  5HKW A;  1FI5 A;  1N2D A;  4AQJ A;  1MWN A;  2PMY A;  1S26 D;  5KU1 A;  4ICB A;  4N5X A;  5BPJ A;  1YUS A;  1S6I A;  1XFU O;  2LV7 A;  3A4U B;  1YVL A;  2CXJ A;  5I2O A;  1BOD A;  3BUO B;  2JT0 A;  5HKZ A;  1CMF A;  4MZJ A;  5I2L A;  1NX1 A;  1OZS A;  2ZNE A;  3TDI A;  4CID A;  1HT9 A;  3SG4 A;  2COL B;  3BQ3 A;  1JF0 A;  3M0W A;  4P2Y B;  1J55 A;  1XFZ O;  3TS5 C;  1UHH A;  3TS5 B;  1AJ5 A;  1GGZ A;  4PHM A;  5JOL A;  1DT7 B;  1YTZ C;  2M1K B;  2K0J A;  3DVE A;  1PSR A;  3VRP A;  1N0Y A;  1Q80 A;  1FPW A;  1OQP A;  3D0Y B;  1K9U A;  2KI4 C;  1DF0 A;  3CGA A;  3PLF B;  2KI4 B;  3EKJ A;  1IJ6 A;  1A4P A;  1OMV A;  1Y6W A;  1CLB A;  1C7W A;  2NLN A;  2LLT A;  2L98 A;  2HF5 A;  1J7P A;  1RJV A;  4CLN A;  4JWQ A;  2KYC A;  1K90 D;  1NCZ A;  4HRH A;  4XJK A;  5JJG A;  2BE6 A;  2BE4 A;  4GAO A;  1MXE A;  2BBN A;  3PN7 C;  2PAL A;  3PN7 B;  1AUI B;  2AAO A;  1B7T Z;  3LK1 A;  4JQ0 D;  2LVI A;  1LXF C;  1TNW A;  4BY5 A;  1JBA A;  2LNK A;  4MRX A;  4WQ2 A;  3BUM B;  4YGA A;  2LC5 A;  1LKJ A;  2V53 A;  2WOR A;  1F70 A;  1XFX O;  2JPT A;  2DOQ A;  4NDB A;  1PRW A;  1DGU A;  4MSP A;  4I5L B;  1AJ4 A;  2JNF A;  1XK4 C;  1A75 B;  2KHN A;  3EK8 A;  2K7O A;  1MF8 B;  5TNC A;  1JUO A;  4YGE B;  1UHI A;  1RK9 A;  2IS9 A;  4ZCV A;  1L7Z A;  1DJI A;  2O5G A;  1YUU A;  2BCB A;  1A2X A;  4YRU A;  1MHO A;  2CTN A;  4C0K A;  2OPO A;  2WND A;  2A4J A;  4M2P A;  3SG7 A;  1QS7 A;  3TDZ A;  4C0J A;  1SKT A;  1FF1 A;  4GUK A;  1MXL C;  2E6W A;  3HCM A;  3C1V A;  4XJK B;  5AAN A;  3CTN A;  1GGW A;  1SL8 A;  3ZNI A;  1K8U A;  2LHL A;  2H61 C;  2QPT A;  3O2P A;  1W7I B;  2M1U A;  3SG3 A;  2R2I A;  1DJY A;  1L2O B;  2CCM A;  2OTG C;  3DVK A;  3ICB A;  1YX7 A;  2OTG B;  1SCM B;  1NPQ A;  3CZT X;  2I2R E;  2I94 A;  4PDZ A;  1MR8 A;  1JSA A;  1OE9 B;  1SK6 D;  3KO0 A;  4UPG A;  1XO5 A;  3AKA A;  1EH2 A;  1ALV A;  2LVJ A;  4FQO A;  2GGM A;  4PE4 A;  4MBE A;  2LUC A;  1BU3 A;  2WCF A;  2K61 A;  1BR4 B;  1SRA A;  1NP8 A;  2K2F A;  5B8I B;  4YI9 A;  4HRG A;  1KFX L;  4NDC A;  2Y5I A;  2LMU A;  1VRK A;  2LHI A;  3KPX A;  1MUX A;  3KHE A;  1NX0 A;  1K2H A;  1UHK A;  5I8N A;  4I5J A;  3CR5 X;  3GK2 A;  3SIB A;  3NSI A;  1S6J A;  1AHR A;  3AAJ A;  1RRO A;  1BJF A;  4M2Q A;  5CSN A;  4GNK B;  2JXC A;  5IBW A; 
#chains in the Genus database with same CATH topology
 2NZ0 A;  2L0P A;  2MBX A;  3WXA A;  2JRF A;  1PUL A;  1OZO A;  3D0Y A;  2QAC A;  2LMT A;  1KK7 Z;  5D69 A;  1Y1A A;  3QME A;  1TNX A;  3I5I B;  1JFJ A;  2M0R A;  4U8D A;  3HX4 A;  1NCX A;  2GGZ A;  2ZFD A;  4YI8 A;  1QAT A;  1DJX A;  1BMO A;  1KK8 C;  4FQT A;  1R2U A;  1KK8 B;  3DXL A;  4OR9 B;  3PAT A;  1YRT B;  2LM5 A;  2JXL A;  1CTR A;  3NSK A;  1JC2 A;  2YGU A;  4PHN A;  1UHN A;  1M39 A;  3PSR A;  1KFU L;  1J1E A;  2BKI B;  4GFT A;  5I2Q A;  1G33 A;  2KLE A;  1NSH A;  3FS7 A;  1IGV A;  2KGB C;  5D3O A;  5HKY A;  2Q4U A;  4CFQ A;  1J7O A;  1F8H A;  3AKB A;  3SG2 A;  1CDP A;  1SL7 A;  1EG4 A;  1ZMZ A;  2KBM A;  1SCV A;  3NSO A;  1F55 A;  1SYM A;  3BUW B;  3SG5 A;  1XK4 A;  1A75 A;  2WC5 A;  3D77 A;  4YGD B;  3S0E A;  3UNW A;  3CR2 A;  2F8P A;  1NUB A;  1TWO A;  3D75 A;  2CT9 A;  3GK1 A;  3CAB A;  3UO9 A;  1C7V A;  2LMV A;  1Y1X A;  3EG5 B;  2WCJ A;  4HSZ A;  1FI6 A;  3CZ0 A;  2QEB A;  1BG1 A;  3FWB A;  1K94 A;  1QLK A;  2KBI A;  4PCW A;  1MQ1 A;  1RFJ A;  2RGI A;  1OW4 A;  1B8C A;  1NWD A;  1BOC A;  2EHB A;  3VRQ A;  4MLW A;  1BF5 A;  1KFX S;  4M2O A;  4TNC A;  3SJS A;  2HQ8 A;  2LAN A;  1S5G Y;  4OKH A;  1IG5 A;  2QEO A;  1QWV A;  2EC6 C;  1G4Y R;  2EC6 B;  3R1O A;  1OMR A;  2ZND A;  1BR1 B;  1KQM C;  3BYA A;  1KQM B;  1SPY A;  5PAL A;  5KSZ A;  1S36 A;  3DY9 A;  2MHH A;  1DGV A;  3ZWH A;  2JNX A;  1M45 A;  2JC2 A;  3OX5 A;  3B86 A;  1DVI A;  1WLZ A;  1JF2 A;  1F71 A;  1CLL A;  1OMD A;  3BOW A;  1YR5 A;  2L2C A;  1AVS A;  3O6B A;  4DS7 A;  4C0L A;  1CNP A;  1LA3 A;  2FJY A;  1F4O A;  3B6X A;  3EVU A;  1Y0V H;  1J1D A;  5AER A;  1W9Z A;  2L5X B;  1U5I B;  2M7L A;  5DKR A;  3VRN A;  1CLM A;  3SS3 A;  3DZT A;  3Q8I A;  2JPO A;  3S0G A;  3O4Y A;  2K7C A;  3IQO A;  4GGF C;  1EL4 A;  3H4S E;  3R72 A;  2KI6 D;  2LVV A;  1YX8 A;  4HRE E;  3N7H A;  3D78 A;  1TCO B;  1C07 A;  3E3R A;  3F45 A;  3NHI A;  2JT3 A;  4PE7 A;  2WCM A;  3TUY C;  1F4Q A;  1ZOT B;  3TUY B;  1QVI Y;  2QEH A;  1XFV O;  1KCY A;  1KFU S;  2BBM A;  4OVN F;  5DKN A;  3DD4 A;  1UUS A;  2MLE C;  2WOS A;  2I7A A;  2H2K A;  2QDI A;  1QV0 A;  1UP5 A;  3GK4 X;  3MSE B;  1IRJ A;  1LVC D;  5J3X A;  2PVB A;  2OS8 C;  2JOJ A;  4ZCU A;  1RWY A;  2ERB A;  3BOW B;  3FE9 A;  1XFW O;  4QJ3 B;  1M31 A;  2JQ6 A;  2LLS A;  1M46 A;  2WCB A;  1V1F A;  3JVT B;  3IQQ A;  3JVT C;  3LLE A;  3VGO A;  4QJ5 B;  1C3Z A;  4AQI A;  2B1U A;  2FCD A;  1SR6 C;  1QX5 B;  1PVA A;  1UWO A;  3BFH A;  2FCE A;  4F7F A;  2QEV A;  1DTL A;  4KYN A;  1K95 A;  2F2O A;  5DKQ A;  1XYD A;  3AAK A;  4INX A;  1S5G Z;  2WC8 A;  1PVB A;  2BL0 C;  2CBL A;  2BL0 B;  4JD9 A;  3TDU A;  1IWQ A;  1KSM A;  2PSR A;  1E8A A;  3I5F C;  3LCP C;  2L50 A;  3WHU B;  2EGD A;  2MA2 A;  2PQL A;  3KEV A;  1EJ3 A;  5EL2 A;  1S3P A;  3D73 A;  5F6T A;  5DIC A;  3FWC A;  1SW8 A;  3PFV A;  3EK7 A;  1NYA A;  4F0Z B;  1FBV A;  4JKT A;  1C3Y A;  1GJY A;  3BFA A;  3OGN A;  1IH0 A;  1SSE B;  2ZN9 A;  1W7J B;  3IF7 A;  3VRO A;  3JTD C;  1M63 B;  3D74 A;  1WRK A;  1QJT A;  3B88 A;  2BCX A;  3I5H C;  4GGN A;  4DCK A;  3I5H B;  2Y1M A;  2M3W A;  3OX6 A;  3QRX A;  1QAS A;  1DC1 A;  1LIN A;  1LS8 A;  1QLS A;  2BCA A;  4PE0 A;  1S6C A;  1B8L A;  4YGC B;  5GQQ C;  2M8U A;  1K9K A;  1IQ3 A;  1B4C A;  4MZK A;  4PE1 A;  1UUR A;  1B7T Y;  1CFD A;  1K96 A;  3PM8 A;  4E68 A;  1DQE A;  1TIZ A;  2LCP A;  4OCI A;  5AEQ A;  2JTZ A;  3SG6 A;  2L51 A;  3LK0 A;  2AMI A;  1SY9 A;  2M97 A;  1TTX A;  4I5N B;  1R6P A;  3SIA A;  4NQG A;  2K2A A;  1IIO A;  1TOP A;  2D8N A;  3DVM A;  2M7N A;  1SL9 A;  5ER4 X;  5AXI A;  2LUX A;  3OBV A;  1IQ5 A;  1FW4 A;  4AOM A;  4PHJ A;  3FE8 A;  5AFP A;  2KI6 C;  4FTG A;  1REC A;  2SCP A;  3IVT A;  1H8B A;  2JU0 A;  1LA0 A;  4CPV A;  3S0F A;  1AP4 A;  4GBA A;  1EG3 A;  2LP3 A;  3CLN A;  1K9P A;  5FYX A;  1U5I A;  2F33 A;  1QV1 A;  1IJ5 A;  2O60 A;  2G2B A;  2LLU A;  2PAS A;  2ZRS A;  3DF0 B;  2L4H A;  2NCO A;  2BKH B;  3RLZ A;  1AK8 A;  4P5O E;  1OOJ A;  1DJW A;  1BT6 A;  4GGF A;  1WY9 A;  2KDH A;  5HYD A;  3PM2 A;  1CDL A;  5CSJ A;  1TCF A;  1GQM A;  1YRU B;  2NXQ A;  1RTP 1;  4XYN A;  1ZAC A;  1T14 A;  3S0A A;  2NCP A;  3PAL A;  1TRF A;  2H61 A;  1HQV A;  1NIW A;  4INW A;  2F3Z A;  1B8R A;  3D76 A;  5HLO A;  2ISD A;  1BLQ A;  2JTT A;  5KU1 A;  4GPL B;  1P28 A;  1KWO C;  1OOF A;  1WDC C;  3DYE A;  1KWO B;  1WDC B;  1EXR A;  4DUQ A;  1OSA A;  4YGB B;  2KFF A;  2ZN8 A;  1ZUZ A;  2KAY A;  2KFG A;  1B1G A;  1GM0 A;  3OHM B;  3DVJ A;  4L9M A;  1CB1 A;  2KFH A;  1WLM A;  1TNP A;  3S0B A;  1D1O A;  1H4B A;  1XFR A;  2JZI A;  1CDM A;  2KAV A;  2Q91 A;  1DJH A;  2ZKM X;  1ZFS A;  4OV2 A;  1CM4 A;  4BY4 A;  1PSB A;  4QJ4 B;  1B47 A;  3O78 A;  4IL1 A;  1ALW A;  1CFC A;  3B87 A;  4IJ7 A;  1B9A A;  1SBJ A;  4JPZ B;  4MZL A;  2K7D A;  5HLV A;  2KYF A;  2MLF C;  3EVR A;  3SS5 A;  1QX2 A;  4MN0 A;  1A29 A;  1CM1 A;  2LVK A;  2ZRT A;  2K60 A;  4WQ3 A;  4DRW A;  1KK7 Y;  5CSF A;  2KNE A;  2KSP A;  1QX7 A;  2GV5 A;  1DF0 B;  2WCE A;  2P71 A;  3CWG A;  5CSI A;  3LL8 B;  2HPS A;  4USL A;  4A4C A;  2VRG A;  1Z4H A;  3NXA A;  3WHT B;  1CDN A;  2OS8 B;  2MAZ A;  3RM1 A;  1Y1U A;  1DJZ A;  2KOT A;  1SMG A;  2L2E A;  2Y1N A;  3CYZ A;  1X02 A;  3OB1 B;  3EVV A;  4PHK A;  1QIV A;  1S1E A;  3BXK A;  1OOG A;  2HQW A;  3K21 A;  4ORC B;  1SR6 B;  3BFB A;  3NSL A;  3OB2 B;  1SNL A;  2KAX A;  1DJG A;  2TN4 A;  2F2P A;  4CFR A;  3I5G C;  1NX2 A;  1J7Q A;  3I5G B;  3S0D A;  1QIW A;  1YUR A;  2M9G A;  5I94 A;  1L2O C;  1PK0 D;  1TN4 A;  1V1G A;  2P6B B;  3PJI A;  4MVF A;  5G08 A;  4N1G A;  3BUN B;  1CMG A;  1DMO A;  1SCM C;  2HET A;  1JWD A;  2F3Y A;  2LE9 B;  1NX3 A;  4I5K A;  5FI2 A;  2K8M B;  2BEC A;  3I5F B;  1CFP A;  3FIA A;  2LP2 A;  2BAP A;  2E30 A;  1YVH A;  2KPH A;  1F54 A;  4A4B A;  2WCK A;  3O4X A;  2KGR A;  1CFF A;  2JUL A;  2LAP A;  3VRR A;  4MRY A;  4WRI A;  2KQY A;  3GOF A;  3K1E A;  4ORA B;  1IKU A;  3D10 A;  2FOT A;  2L4I A;  4NDD A;  2Y4Q A;  3JTD B;  3EKH A;  3RZS A;  2CNP A;  3L4A A;  4PAL A;  1TNQ A;  3BUX B;  3DF0 A;  2AUC A;  2H8V A;  4DIR A;  1QTX A;  5D7F A;  1WRL A;  2PRU A;  2MRD A;  1ODB A;  4R1E A;  1CKK A;  3CS1 A;  2JWW A;  1XFY O;  1QXP A;  1UHJ A;  3A8R A;  1JFK A;  1XA5 A;  3OP0 A;  1YUT A;  5K89 A;  3CR4 X;  2G9B A;  5CPV A;  4Q04 A;  2SAS A;  4MEW A;  4YBH B;  4D1E A;  1A03 A;  1QVI Z;  1XVJ A;  4ORB B;  3KF9 A;  1J7R A;  4ETO A;  3SS4 A;  1G8I A;  1KSO A;  3WNX B;  1WRZ A;  2JT8 A;  2K7B A;  1NCY A;  3TZ1 A;  3I5I C;  1PAL A;  4PT1 A;  4N1F A;  5ER5 A;  3FE6 A;  2FJU B;  1N65 A;  2KQ6 A;  1K93 D;  2I18 A;  2M29 A;  2MJW B;  2M49 B;  3EK4 A;  5FI6 A;  3V2L A;  5HKW A;  1KQV A;  3CZ2 A;  1FI5 A;  1TUZ A;  1N2D A;  4AQJ A;  1MWN A;  2PMY A;  1S26 D;  3BJH A;  3NHT A;  3VB1 A;  4ICB A;  4N5X A;  5BPJ A;  1YUS A;  1S6I A;  1XFU O;  2LV7 A;  3A4U B;  1YVL A;  2CXJ A;  5I2O A;  1BOD A;  3BUO B;  2JT0 A;  5HKZ A;  2WCH A;  1CMF A;  4MZJ A;  5I2L A;  3CZ1 A;  1NX1 A;  1OZS A;  2ZNE A;  3TDI A;  4CID A;  1HT9 A;  3SG4 A;  1ORG A;  2COL B;  3BQ3 A;  1JF0 A;  3M0W A;  4P2Y B;  1J55 A;  1XFZ O;  3TS5 C;  1UHH A;  3TS5 B;  1AJ5 A;  1GGZ A;  4PHM A;  5JOL A;  1DT7 B;  1YTZ C;  2M1K B;  3L47 A;  2K0J A;  3DVE A;  1PSR A;  3VRP A;  1N0Y A;  1Q80 A;  1FPW A;  2WC6 A;  1OQP A;  3D0Y B;  1K9U A;  5KTY A;  2KI4 C;  1DF0 A;  3CGA A;  3PLF B;  2KI4 B;  3EKJ A;  1IJ6 A;  1A4P A;  1OMV A;  1Y6W A;  1OOI X;  1CLB A;  1C7W A;  2NLN A;  2LLT A;  2L98 A;  2HF5 A;  1J7P A;  1RJV A;  4CLN A;  3NGV A;  4JWQ A;  2KYC A;  1K90 D;  1NCZ A;  4HRH A;  4XJK A;  5JJG A;  2BE6 A;  2BE4 A;  2KLD A;  4GAO A;  1MXE A;  2BBN A;  3PN7 C;  2PAL A;  3L4L A;  3PN7 B;  1AUI B;  1OOH A;  2AAO A;  1B7T Z;  3LK1 A;  4JQ0 D;  2LVI A;  1LXF C;  1TNW A;  4BY5 A;  1JBA A;  5FI7 A;  2LNK A;  2PYQ A;  4MRX A;  3BUM B;  4WQ2 A;  4YGA A;  2LC5 A;  1LKJ A;  2V53 A;  2WOR A;  1F70 A;  1XFX O;  2JPT A;  1Z2C B;  2DOQ A;  4NDB A;  1PRW A;  1DGU A;  4MSP A;  4I5L B;  3R1P A;  1AJ4 A;  2JNF A;  1XK4 C;  1A75 B;  4OZD A;  2KHN A;  3EK8 A;  2K7O A;  1MF8 B;  5TNC A;  1JUO A;  4YGE B;  1UHI A;  1RK9 A;  2IS9 A;  4ZCV A;  1L7Z A;  1DJI A;  2O5G A;  1YUU A;  2BCB A;  1A2X A;  2L5Y A;  4YRU A;  1MHO A;  2CTN A;  4C0K A;  2OPO A;  2WND A;  2A4J A;  4M2P A;  3SG7 A;  1QS7 A;  3TDZ A;  4C0J A;  1SKT A;  1FF1 A;  4GUK A;  1MXL C;  2E6W A;  3HCM A;  3C1V A;  4XJK B;  5AAN A;  3CTN A;  1GGW A;  1SL8 A;  3ZNI A;  1K8U A;  2LHL A;  2H61 C;  2QPT A;  3O2P A;  1W7I B;  2M1U A;  3SG3 A;  2R2I A;  1DJY A;  1L2O B;  2BNX A;  2CCM A;  2OTG C;  3DVK A;  3ICB A;  1YX7 A;  2OTG B;  2WCL A;  1DEK A;  1SCM B;  1NPQ A;  3CZT X;  2I2R E;  2I94 A;  4PDZ A;  1MR8 A;  1JSA A;  1OE9 B;  1SK6 D;  3KO0 A;  2GTE A;  4UPG A;  1XO5 A;  3AKA A;  1EH2 A;  1ALV A;  2LVJ A;  4FQO A;  2GGM A;  5HL1 A;  4PE4 A;  4MBE A;  2LUC A;  1BU3 A;  2P70 A;  2WCF A;  3B7A A;  2K61 A;  1BR4 B;  1SRA A;  1NP8 A;  2K2F A;  5B8I B;  4YI9 A;  4HRG A;  1KFX L;  4NDC A;  2Y5I A;  2LMU A;  1VRK A;  2LHI A;  3KPX A;  1MUX A;  3KHE A;  1NX0 A;  1TUJ A;  1K2H A;  1UHK A;  5I8N A;  1DEL A;  4I5J A;  3CR5 X;  3GK2 A;  3SIB A;  3NSI A;  1S6J A;  3R1V A;  1AHR A;  3AAJ A;  1RRO A;  1BJF A;  4M2Q A;  5CSN A;  4GNK B;  3CDN A;  2JXC A;  5IBW A; 
#chains in the Genus database with same CATH homology
 2NZ0 A;  2L0P A;  2MBX A;  3WXA A;  2JRF A;  1PUL A;  1OZO A;  3D0Y A;  2QAC A;  2LMT A;  1KK7 Z;  5D69 A;  1Y1A A;  1TNX A;  3I5I B;  1JFJ A;  2M0R A;  4U8D A;  3HX4 A;  1NCX A;  2GGZ A;  2ZFD A;  4YI8 A;  1QAT A;  1DJX A;  1BMO A;  1KK8 C;  1R2U A;  1KK8 B;  4OR9 B;  3PAT A;  1YRT B;  2LM5 A;  2JXL A;  1CTR A;  3NSK A;  1JC2 A;  4PHN A;  1UHN A;  1M39 A;  3PSR A;  1KFU L;  1J1E A;  2BKI B;  4GFT A;  5I2Q A;  1G33 A;  3FS7 A;  1NSH A;  5HKY A;  1IGV A;  2KGB C;  1J7O A;  2Q4U A;  4CFQ A;  1F8H A;  3AKB A;  3SG2 A;  1CDP A;  1SL7 A;  1EG4 A;  1ZMZ A;  2KBM A;  1SCV A;  3NSO A;  1F55 A;  1SYM A;  3BUW B;  3SG5 A;  1XK4 A;  1A75 A;  4YGD B;  3CR2 A;  2F8P A;  1NUB A;  2CT9 A;  3GK1 A;  1C7V A;  2LMV A;  1Y1X A;  4HSZ A;  1FI6 A;  1BG1 A;  3FWB A;  1K94 A;  1QLK A;  2KBI A;  4PCW A;  1MQ1 A;  1RFJ A;  2RGI A;  1B8C A;  1NWD A;  1BOC A;  2EHB A;  3VRQ A;  4MLW A;  1BF5 A;  1KFX S;  4M2O A;  4TNC A;  3SJS A;  2HQ8 A;  2LAN A;  1S5G Y;  4OKH A;  1IG5 A;  2EC6 C;  1G4Y R;  2EC6 B;  1OMR A;  2ZND A;  1BR1 B;  1KQM C;  3BYA A;  1KQM B;  1SPY A;  5PAL A;  5KSZ A;  1S36 A;  2MHH A;  1DGV A;  3ZWH A;  2JNX A;  1M45 A;  2JC2 A;  3OX5 A;  1DVI A;  1WLZ A;  1JF2 A;  1F71 A;  1CLL A;  1OMD A;  3BOW A;  1YR5 A;  3O6B A;  1AVS A;  4DS7 A;  4C0L A;  1CNP A;  1LA3 A;  1F4O A;  3EVU A;  1Y0V H;  1J1D A;  5AER A;  2L5X B;  1U5I B;  2M7L A;  5DKR A;  3VRN A;  1CLM A;  3O4Y A;  2K7C A;  3IQO A;  4GGF C;  1EL4 A;  3H4S E;  2KI6 D;  2LVV A;  1YX8 A;  4HRE E;  1TCO B;  1C07 A;  3E3R A;  3F45 A;  4PE7 A;  2JT3 A;  3TUY C;  1F4Q A;  1ZOT B;  3TUY B;  1QVI Y;  1XFV O;  1KCY A;  1KFU S;  2BBM A;  4OVN F;  5DKN A;  3DD4 A;  1UUS A;  2MLE C;  2WOS A;  2I7A A;  2H2K A;  1QV0 A;  1UP5 A;  3GK4 X;  3MSE B;  1IRJ A;  1LVC D;  5J3X A;  2PVB A;  2OS8 C;  2JOJ A;  4ZCU A;  1RWY A;  3BOW B;  1XFW O;  4QJ3 B;  1M31 A;  2JQ6 A;  2LLS A;  1M46 A;  2WCB A;  1V1F A;  3JVT B;  3IQQ A;  3JVT C;  3LLE A;  3VGO A;  4QJ5 B;  4AQI A;  2B1U A;  2FCD A;  1SR6 C;  1QX5 B;  1PVA A;  1UWO A;  2FCE A;  1DTL A;  1K95 A;  2F2O A;  5DKQ A;  1XYD A;  3AAK A;  1S5G Z;  2WC8 A;  1PVB A;  2BL0 C;  2CBL A;  2BL0 B;  3TDU A;  1IWQ A;  1KSM A;  2PSR A;  1E8A A;  3I5F C;  3LCP C;  2L50 A;  3WHU B;  2EGD A;  2MA2 A;  3KEV A;  1EJ3 A;  1S3P A;  5F6T A;  3FWC A;  1SW8 A;  3PFV A;  3EK7 A;  1NYA A;  4F0Z B;  1FBV A;  1GJY A;  1IH0 A;  2ZN9 A;  1W7J B;  3IF7 A;  3VRO A;  3JTD C;  1M63 B;  1WRK A;  1QJT A;  2BCX A;  3I5H C;  4GGN A;  4DCK A;  3I5H B;  2Y1M A;  2M3W A;  3OX6 A;  3QRX A;  1QAS A;  1LIN A;  1QLS A;  2BCA A;  4PE0 A;  1S6C A;  1B8L A;  4YGC B;  5GQQ C;  2M8U A;  1K9K A;  1IQ3 A;  1B4C A;  4MZK A;  4PE1 A;  1UUR A;  1B7T Y;  1CFD A;  1K96 A;  3PM8 A;  4E68 A;  1TIZ A;  2LCP A;  4OCI A;  5AEQ A;  2JTZ A;  3SG6 A;  2L51 A;  3LK0 A;  2AMI A;  1SY9 A;  2M97 A;  1TTX A;  4I5N B;  1R6P A;  3SIA A;  4NQG A;  2K2A A;  1TOP A;  2D8N A;  3DVM A;  2M7N A;  1SL9 A;  5ER4 X;  5AXI A;  2LUX A;  1IQ5 A;  1FW4 A;  4AOM A;  4PHJ A;  5AFP A;  2KI6 C;  4FTG A;  1REC A;  2SCP A;  1H8B A;  2JU0 A;  1LA0 A;  4CPV A;  1AP4 A;  4GBA A;  1EG3 A;  2LP3 A;  3CLN A;  1K9P A;  5FYX A;  1U5I A;  2F33 A;  1QV1 A;  1IJ5 A;  2O60 A;  2G2B A;  2LLU A;  2PAS A;  2ZRS A;  3DF0 B;  2L4H A;  2NCO A;  2BKH B;  3RLZ A;  1AK8 A;  4P5O E;  1OOJ A;  1DJW A;  1BT6 A;  4GGF A;  1WY9 A;  2KDH A;  5HYD A;  1CDL A;  5CSJ A;  1TCF A;  1GQM A;  1YRU B;  2NXQ A;  1RTP 1;  4XYN A;  1ZAC A;  2NCP A;  3PAL A;  1TRF A;  2H61 A;  1HQV A;  1NIW A;  2F3Z A;  1B8R A;  5HLO A;  2ISD A;  1BLQ A;  2JTT A;  4GPL B;  1KWO C;  1WDC C;  1KWO B;  1WDC B;  1EXR A;  4DUQ A;  1OSA A;  4YGB B;  2KFF A;  2ZN8 A;  1ZUZ A;  2KAY A;  2KFG A;  1B1G A;  3OHM B;  3DVJ A;  4L9M A;  1CB1 A;  2KFH A;  1WLM A;  1TNP A;  1D1O A;  1H4B A;  2KAV A;  2JZI A;  1CDM A;  2ZKM X;  2Q91 A;  1DJH A;  4OV2 A;  1ZFS A;  4BY4 A;  1CM4 A;  4QJ4 B;  1PSB A;  5KTY A;  1B47 A;  3O78 A;  4IL1 A;  1ALW A;  1CFC A;  1B9A A;  1SBJ A;  4JPZ B;  4MZL A;  2K7D A;  5HLV A;  2KYF A;  2MLF C;  3EVR A;  1QX2 A;  4MN0 A;  1A29 A;  1CM1 A;  2LVK A;  2ZRT A;  4WQ3 A;  4DRW A;  1KK7 Y;  5CSF A;  2KNE A;  2KSP A;  1QX7 A;  2GV5 A;  1DF0 B;  2WCE A;  3CWG A;  5CSI A;  3LL8 B;  2HPS A;  4USL A;  4A4C A;  2VRG A;  3NXA A;  3WHT B;  1CDN A;  2OS8 B;  2MAZ A;  3RM1 A;  1Y1U A;  1DJZ A;  2KOT A;  1SMG A;  2L2E A;  2Y1N A;  1X02 A;  3OB1 B;  3EVV A;  4PHK A;  1QIV A;  1S1E A;  3BXK A;  2HQW A;  4ORC B;  3K21 A;  1SR6 B;  3NSL A;  3OB2 B;  1SNL A;  2KAX A;  1DJG A;  2TN4 A;  2F2P A;  4CFR A;  3I5G C;  1NX2 A;  1J7Q A;  3I5G B;  1QIW A;  1YUR A;  2M9G A;  1L2O C;  1PK0 D;  1TN4 A;  1V1G A;  2P6B B;  4MVF A;  5G08 A;  1CMG A;  4N1G A;  3BUN B;  1DMO A;  1JWD A;  1SCM C;  2HET A;  2F3Y A;  2LE9 B;  1NX3 A;  4I5K A;  2K8M B;  2BEC A;  3I5F B;  1CFP A;  3FIA A;  2LP2 A;  2E30 A;  1YVH A;  1F54 A;  4A4B A;  2KGR A;  1CFF A;  2JUL A;  2LAP A;  3VRR A;  4MRY A;  4WRI A;  2KQY A;  3GOF A;  4ORA B;  1IKU A;  3D10 A;  2FOT A;  2L4I A;  4NDD A;  2Y4Q A;  3JTD B;  3EKH A;  2CNP A;  4PAL A;  1TNQ A;  3BUX B;  3DF0 A;  2AUC A;  4DIR A;  1QTX A;  5D7F A;  1WRL A;  2PRU A;  2MRD A;  1ODB A;  4R1E A;  1CKK A;  3CS1 A;  2JWW A;  1XFY O;  1QXP A;  1UHJ A;  3A8R A;  1JFK A;  1XA5 A;  3OP0 A;  1YUT A;  5K89 A;  3CR4 X;  2G9B A;  5CPV A;  4Q04 A;  2SAS A;  4MEW A;  4YBH B;  4D1E A;  1A03 A;  1QVI Z;  1XVJ A;  4ORB B;  3KF9 A;  1J7R A;  4ETO A;  1G8I A;  1KSO A;  3WNX B;  1WRZ A;  2JT8 A;  2K7B A;  1NCY A;  3TZ1 A;  3I5I C;  1PAL A;  4N1F A;  5ER5 A;  2FJU B;  1N65 A;  2KQ6 A;  1K93 D;  2I18 A;  2M29 A;  2MJW B;  2M49 B;  3EK4 A;  1KQV A;  5HKW A;  1FI5 A;  1N2D A;  4AQJ A;  1MWN A;  2PMY A;  1S26 D;  5KU1 A;  4ICB A;  4N5X A;  5BPJ A;  1YUS A;  1S6I A;  1XFU O;  2LV7 A;  3A4U B;  1YVL A;  2CXJ A;  5I2O A;  1BOD A;  3BUO B;  2JT0 A;  5HKZ A;  1CMF A;  4MZJ A;  5I2L A;  1NX1 A;  1OZS A;  2ZNE A;  3TDI A;  4CID A;  1HT9 A;  3SG4 A;  2COL B;  3BQ3 A;  1JF0 A;  3M0W A;  4P2Y B;  1J55 A;  1XFZ O;  3TS5 C;  1UHH A;  3TS5 B;  1AJ5 A;  1GGZ A;  4PHM A;  5JOL A;  1DT7 B;  1YTZ C;  2M1K B;  2K0J A;  3DVE A;  1PSR A;  3VRP A;  1N0Y A;  1Q80 A;  1FPW A;  1OQP A;  3D0Y B;  1K9U A;  2KI4 C;  1DF0 A;  3CGA A;  3PLF B;  2KI4 B;  3EKJ A;  1IJ6 A;  1A4P A;  1OMV A;  1Y6W A;  1CLB A;  1C7W A;  2NLN A;  2LLT A;  2L98 A;  2HF5 A;  1J7P A;  1RJV A;  4CLN A;  4JWQ A;  2KYC A;  1K90 D;  1NCZ A;  4HRH A;  4XJK A;  5JJG A;  2BE6 A;  2BE4 A;  4GAO A;  1MXE A;  2BBN A;  3PN7 C;  2PAL A;  3PN7 B;  1AUI B;  2AAO A;  1B7T Z;  3LK1 A;  4JQ0 D;  2LVI A;  1LXF C;  1TNW A;  4BY5 A;  1JBA A;  2LNK A;  4MRX A;  4WQ2 A;  3BUM B;  4YGA A;  2LC5 A;  1LKJ A;  2V53 A;  2WOR A;  1F70 A;  1XFX O;  2JPT A;  2DOQ A;  4NDB A;  1PRW A;  1DGU A;  4MSP A;  4I5L B;  1AJ4 A;  2JNF A;  1XK4 C;  1A75 B;  2KHN A;  3EK8 A;  2K7O A;  1MF8 B;  5TNC A;  1JUO A;  4YGE B;  1UHI A;  1RK9 A;  2IS9 A;  4ZCV A;  1L7Z A;  1DJI A;  2O5G A;  1YUU A;  2BCB A;  1A2X A;  4YRU A;  1MHO A;  2CTN A;  4C0K A;  2OPO A;  2WND A;  2A4J A;  4M2P A;  3SG7 A;  1QS7 A;  3TDZ A;  4C0J A;  1SKT A;  1FF1 A;  4GUK A;  1MXL C;  2E6W A;  3HCM A;  3C1V A;  4XJK B;  5AAN A;  3CTN A;  1GGW A;  1SL8 A;  3ZNI A;  1K8U A;  2LHL A;  2H61 C;  2QPT A;  3O2P A;  1W7I B;  2M1U A;  3SG3 A;  2R2I A;  1DJY A;  1L2O B;  2CCM A;  2OTG C;  3DVK A;  3ICB A;  1YX7 A;  2OTG B;  1SCM B;  1NPQ A;  3CZT X;  2I2R E;  2I94 A;  4PDZ A;  1MR8 A;  1JSA A;  1OE9 B;  1SK6 D;  3KO0 A;  4UPG A;  1XO5 A;  3AKA A;  1EH2 A;  1ALV A;  2LVJ A;  4FQO A;  2GGM A;  4PE4 A;  4MBE A;  2LUC A;  1BU3 A;  2WCF A;  2K61 A;  1BR4 B;  1SRA A;  1NP8 A;  2K2F A;  5B8I B;  4YI9 A;  4HRG A;  1KFX L;  4NDC A;  2Y5I A;  2LMU A;  1VRK A;  2LHI A;  3KPX A;  1MUX A;  3KHE A;  1NX0 A;  1K2H A;  1UHK A;  5I8N A;  4I5J A;  3CR5 X;  3GK2 A;  3SIB A;  3NSI A;  1S6J A;  1AHR A;  3AAJ A;  1RRO A;  1BJF A;  4M2Q A;  5CSN A;  4GNK B;  2JXC A;  5IBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...