1PULA

Solution structure for the 21kda caenorhabditis elegans protein ce32e8.3. northeast structural genomics consortium target wr33
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
NWDDADVKKRWDAFTKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKVLAFVAEDRARQSKKPIQDELDAITEKLAKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein C32E8.3 in chromosome I
publication title Backbone 1H, 15N and 13C assignments for the 21 kDa Caenorhabditis elegans homologue of "brain-specific" protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pulA00
1QV1A 2EC6C 2KAVA 2LM5A 3OHMB 4OR9B 1KSOA 5DKNA 2K7CA 1KFXS 1M39A 1AJ4A 1SY9A 1WY9A 4MVFA 3JVTC 2L2EA 1IQ3A 1IG5A 1OQPA 1OSAA 5AFPA 1HT9A 4YI8A 1JSAA 4AOMA 2M0RA 2GGZA 1MF8B 3I5FB 2GV5A 2K0JA 1WRLA 2NCOA 2BCBA 4P5OE 4OV2A 4MSPA 5IBWA 1UHNA 2M3WA 2KNEA 4GGNA 2MBXA 5HKWA 1A75A 2L50A 2MA2A 1MWNA 1TNQA 2BECA 1YTZC 1XFVO 1S6CA 4CLNA 1DJWA 1OZSA 2NXQA 1NP8A 1SCMC 1BT6A 1YX8A 2LHIA 3JTDC 4IL1A 4NDDA 3CS1A 5CSFA 1EG4A 1JFKA 2HETA 1J7RA 3GK1A 1FF1A 1GQMA 2KHNA 2KI4B 5KTYA 1AK8A 2L4HA 2KAYA 3M0WA 2LLUA 3HCMA 5AERA 4HSZA 1ODBA 3TS5B 2BL0C 1IJ5A 1TN4A 1NX1A 1Q80A 2KYFA 1AJ5A 3HX4A 1KFUS 2JULA 3FIAA 1YRUB 5HKZA 1S1EA 1WLMA 1S5GY 2F3ZA 1XYDA 3IF7A 1DMOA 1IJ6A 2KOTA 2RGIA 1S5GZ 4HRHA 3BUOB 4FTGA 1QIWA 2JU0A 4WRIA 4MEWA 4MZJA 1UUSA 3TUYC 1NX2A 1YUUA 1NCYA 1QX5B 2JWWA 1NX3A 1PULA 1A03A 4PE7A 1A2XA 1NUBA 1WRZA 2FCDA 1TRFA 3SG7A 4C0LA 4A4CA 1UURA 3NSOA 4YGBB 1QV0A 3DVEA 2E6WA 1KK8C 2LMVA 1CMGA 1EXRA 1MHOA 1JF2A 1KWOC 3KF9A 3VGOA 1GGZA 4N1GA 5HLOA 1F70A 1M46A 1CNPA 2K8MB 1JC2A 3TDZA 5I2OA 3FS7A 1M63B 2Q4UA 2L4IA 1FW4A 2JT3A 4D1EA 1J7OA 1QX7A 2I2RE 2KQYA 2K7OA 1IGVA 1PSBA 1A29A 1S6IA 1Y1XA 2F33A 2PALA 3RLZA 3CR5X 3PLFB 1BODA 2LP3A 5ER4X 1B8LA 1A4PA 1NIWA 3FWCA 3WHUB 1TCOB 1XO5A 1CLBA 4BY4A 1Y1UA 2LC5A 2LAPA 2PSRA 2EHBA 3OX5A 1CDNA 4YRUA 1A75B 3OB2B 2ZRSA 3I5GC 4GGFC 2CCMA 2M29A 2I18A 2LVIA 2PRUA 5TNCA 3SG6A 1MXEA 4OVNF 3D0YA 3DVMA 3I5HB 1QXPA 3LK1A 4PCWA 2KGRA 2JTTA 2OPOA 3IQQA 1YUSA 2LVVA 1EG3A 4GFTA 4ORBB 2HQ8A 3BQ3A 3VRRA 3KEVA 1F71A 4QJ4B 2BBMA 1K9UA 2AUCA 2Y4QA 2NLNA 5G08A 4C0JA 2QACA 3SIBA 3GOFA 1K8UA 2LP2A 3BUWB 2WCFA 1LXFC 1R2UA 1ZFSA 1K94A 1G33A 1LA3A 1WLZA 2KYCA 1D1OA 2WC8A 1G8IA 1KCYA 1SNLA 1JUOA 3BOWA 1CDLA 2ZNDA 1DGVA 4GPLB 1LKJA 4PE0A 2OTGB 1UHHA 2LUXA 3CR4X 2BKIB 4PHMA 1PSRA 3BUMB 3LCPC 1SYMA 3PN7B 2B1UA 2PMYA 1BF5A 5HLVA 1QIVA 1VRKA 1SBJA 1B9AA 1NCXA 1SL7A 1YURA 2D8NA 3BYAA 5CSJA 2FJUB 1J7QA 2CBLA 1B8RA 4E68A 4GUKA 5F6TA 1B47A 2JT8A 2OS8B 3I5IC 1DF0A 3WHTB 1XVJA 3O4YA 3ZNIA 1G4YR 2K7BA 2SCPA 1IWQA 1K2HA 3SG4A 3O6BA 1WDCB 2KBMA 1PVAA 2M97A 3OB1B 1UP5A 1BG1A 2EC6B 2KSPA 4AQJA 1CFPA 1CLMA 2KGBC 1AUIB 2WCEA 3JVTB 4JPZB 4NQGA 1DT7B 4YGDB 1YVLA 1NYAA 1H4BA 1B8CA 3GK4X 3FWBA 1SR6C 4ZCVA 2KFFA 2BE6A 2FCEA 2P6BB 1DTLA 1OMDA 4ORAB 4M2PA 2F8PA 4NDBA 3IQOA 4YI9A 5I2LA 2K61A 2L51A 2V53A 1CM4A 1MQ1A 2F2OA 3EVVA 2QPTA 4QJ5B 4M2OA 1QS7A 4I5NB 1F4OA 1XFXO 2JC2A 5I8NA 4GGFA 3AAKA 1K93D 1NPQA 1CFCA 1L7ZA 1SCMB 2CT9A 3JTDB 5J3XA 1OZOA 4FQOA 1F4QA 2G2BA 2H61C 3O2PA 3CLNA 2JXLA 2MJWB 1SL8A 2K7DA 1BR1B 1RROA 3TZ1A 2F3YA 2JNFA 2LNKA 1W7IB 2ISDA 2BL0B 4CFRA 2M8UA 1EH2A 1K96A 1X02A 1OMVA 4I5LB 2KDHA 5B8IB 3CR2A 2I94A 1FPWA 1IKUA 1BR4B 4HRGA 2ZNEA 3NSLA 4N1FA 3D0YB 1UWOA 1KK7Z 4UPGA 2KBIA 1BU3A 4CIDA 4MRYA 2H2KA 1R6PA 2BCAA 2KI6D 2JQ6A 3NSIA 1W7JB 2BE4A 3BUNB 3CZTX 2Y5IA 1AP4A 1DJYA 2JT0A 2MHHA 3TUYB 5ER5A 1ALVA 3BXKA 5KSZA 1YRTB 1JF0A 1CTRA 3A8RA 1DGUA 1J7PA 1V1GA 3VRNA 1DJGA 3VROA 2LMTA 1KQMC 3KO0A 3A4UB 3BOWB 4PHJA 4Q04A 3SG3A 1KK8B 2JRFA 3WNXB 1ZACA 5D7FA 1RK9A 4ZCUA 1XK4C 2I7AA 2LUCA 1KWOB 1RTP1 3DVKA 4TNCA 3CTNA 1SK6D 3K21A 1PALA 3MSEB 3AKBA 1LA0A 1NX0A 2A4JA 5DKRA 1CMFA 2IS9A 4A4BA 2LANA 2M49B 2BCXA 3I5FC 4N5XA 1DF0B 1BJFA 1Y0VH 4MN0A 1DJXA 4P2YB 1MUXA 1YR5A 5AXIA 1QJTA 1SMGA 2L5XB 1BMOA 2NCPA 3EKJA 2FOTA 4CFQA 4ETOA 4GAOA 1YVHA 1N0YA 1S36A 2AMIA 2HPSA 1L2OB 1KQVA 1NWDA 2WOSA 4CPVA 1F8HA 3LLEA 4XJKA 4PHNA 1UHJA 1OE9B 1N2DA 5JOLA 2H61A 3EK7A 1XFUO 1C7WA 1MR8A 1S3PA 1YUTA 2KI6C 5PALA 1Y1AA 2HQWA 3NSKA 3KHEA 1U5IA 1RJVA 5I2QA 1CLLA 1M31A 2KI4C 1J55A 2JXCA 2L0PA 1RECA 2LMUA 3GK2A 3I5GB 3LL8B 3TS5C 3SG2A 3CGAA 1KSMA 2ZKMX 5AEQA 1K90D 1GGWA 1QTXA 2F2PA 4F0ZB 1ZOTB 5CSNA 2MLEC 5FYXA 1B7TY 2WORA 3EK4A 1IQ5A 1LINA 1J1DA 1KFXL 1QLKA 4GNKB 5K89A 1J1EA 1TNWA 4PDZA 1XA5A 3ZWHA 1B7TZ 2DOQA 4YBHB 3VRQA 4I5KA 3H4SE 4I5JA 2PASA 1QASA 1AHRA 3AKAA 3BUXB 1TOPA 2AAOA 2CXJA 4XYNA 2M1UA 1BOCA 3DF0A 1SRAA 1ALWA 5BPJA 2EGDA 1TNXA 2CNPA 1UHKA 1UHIA 4R1EA 5HKYA 1C07A 1XFZO 3TDUA 5JJGA 2KAXA 1CM1A 1Y6WA 2M9GA 3SG5A 1JFJA 3AAJA 1K9PA 1XK4A 4HREE 4AQIA 2HF5A 4NDCA 3DVJA 1E8AA 1PVBA 2JTZA 2Y1NA 4MZKA 2M7NA 5KU1A 1QATA 2GGMA 1DVIA 2NZ0A 2TN4A 1S26D 1NCZA 2WNDA 1IRJA 3EK8A 1QLSA 1TTXA 3LK0A 1EL4A 5GQQC 3PM8A 2LLSA 3I5IB 3C1VA 4YGCB 2LVJA 1KFUL 2LV7A 1DJIA 1K95A 1QX2A 3RM1A 1V1FA 2COLB 1LVCD 2JPTA 1KK7Y 1SKTA 2LVKA 1SPYA 3F45A 2MLFC 2K2FA 4MLWA 4OKHA 1ZMZA 3O78A 1CFDA 4MRXA 1SR6B 4WQ3A 4MBEA 3TDIA 4PALA 4GBAA 1TNPA 1M45A 3ICBA 2R2IA 3PATA 1OOJA 2M7LA 5HYDA 4PE4A 3VRPA 1C7VA 2LHLA 1QVIY 1SL9A 4ORCB 1IH0A 1CDMA 2BBNA 1GJYA 4YGEB 1QVIZ 2LLTA 3SIAA 1F55A 4XJKB 4C0KA 1EJ3A 5DKQA 3D10A 3EKHA 3I5HC 2KFHA 4WQ2A 2ZFDA 4DCKA 1WRKA 2LE9B 1U5IB 1SCVA 3NXAA 1FI5A 1YX7A 1B4CA 1F54A 4JQ0D 4QJ3B 1FBVA 4ICBA 2PVBA 1PRWA 3PSRA 1CDPA 2WCBA 4OCIA 1CKKA 4PHKA 4PE1A 3OP0A 1K9KA 4DRWA 2KFGA 2JOJA 4DIRA 5D69A 2M1KB 1L2OC 3OX6A 4YGAA 2E30A 3PALA 2Q91A 1RWYA 2O60A 4DUQA 4USLA 3EVRA 2Y1MA 3EVUA 3QRXA 1SW8A 2VRGA 1CFFA 3PFVA 3KPXA 1JWDA 2BKHB 1DJHA 4MZLA 1ZUZA 3WXAA 1HQVA 2CTNA 2K2AA 4BY5A 2OTGC 4DS7A 5CPVA 1FI6A 2G9BA 1RFJA 2MAZA 3DD4A 1N65A 3PN7C 1MXLC 2ZRTA 3DF0B 1TIZA 1NSHA 1DJZA 1TCFA 2LCPA 2MRDA 4L9MA 2SASA 2ZN9A 1KQMB 1OMRA 2KQ6A 2ZN8A 1XFYO 2JNXA 1B1GA 3CWGA 4M2QA 1H8BA 1BLQA 1JBAA 2JZIA 5CSIA 2OS8C 1CB1A 3E3RA 1XFWO 1PK0D 2O5GA 2L98A 1S6JA 1AVSA 4JWQA 4U8DA 5AANA 1WDCC 3SJSA
chains in the Genus database with same CATH superfamily
1QV1A 2EC6C 2KAVA 2LM5A 3OHMB 4OR9B 1KSOA 5DKNA 2K7CA 1KFXS 1M39A 1AJ4A 1SY9A 1WY9A 3R72A 4MVFA 3JVTC 2L2EA 1IQ3A 1IG5A 1OQPA 1OSAA 5AFPA 1HT9A 4YI8A 1JSAA 4AOMA 2M0RA 2GGZA 1MF8B 3I5FB 2GV5A 2FJYA 1WRLA 2K0JA 2NCOA 2BCBA 4P5OE 4OV2A 4MSPA 5IBWA 1UHNA 1DQEA 4KYNA 2M3WA 3FE9A 2KNEA 4GGNA 2MBXA 5HKWA 1A75A 2L50A 2MA2A 1MWNA 1TNQA 3BFHA 2BECA 1YTZC 1XFVO 1S6CA 1P28A 1DJWA 3R1PA 1OZSA 4CLNA 2NXQA 1NP8A 1SCMC 1BT6A 1YX8A 2LHIA 3JTDC 4IL1A 4NDDA 3CS1A 5CSFA 1EG4A 1JFKA 2WCKA 2HETA 1J7RA 3GK1A 1FF1A 1GQMA 2KLEA 5HL1A 2KHNA 2KI4B 5KTYA 1AK8A 2L4HA 2KAYA 3M0WA 2LLUA 3HCMA 3B6XA 1DELA 4HSZA 5AERA 1ODBA 3TS5B 2BL0C 1IJ5A 1TN4A 1NX1A 2YGUA 1Q80A 2KYFA 1AJ5A 3HX4A 3K1EA 1KFUS 2JULA 3FIAA 4FQTA 1YRUB 5HKZA 1S1EA 1WLMA 1S5GY 3DY9A 2F3ZA 1XYDA 3IF7A 1DMOA 1IJ6A 2KOTA 2RGIA 1S5GZ 4HRHA 3BUOB 4FTGA 1QIWA 2JU0A 4WRIA 4MEWA 4MZJA 1UUSA 3TUYC 1NX2A 1YUUA 1NCYA 3SS4A 4PT1A 1QX5B 3OGNA 2JWWA 1NX3A 1PULA 1A03A 4PE7A 1A2XA 2PYQA 1NUBA 1WRZA 2FCDA 1TRFA 3SG7A 3RZSA 4C0LA 4A4CA 1UURA 3NSOA 4YGBB 1QV0A 3DVEA 2E6WA 1KK8C 2LMVA 1CMGA 1EXRA 1MHOA 4INXA 1JF2A 1KWOC 3KF9A 3VGOA 1GGZA 2K60A 4N1GA 3S0EA 5HLOA 1F70A 1M46A 1CNPA 2K8MB 1JC2A 3TDZA 4F7FA 5I2OA 3FS7A 3PJIA 1M63B 2Q4UA 2L4IA 1SSEB 4OZDA 1FW4A 3R1VA 2JT3A 3S0GA 4D1EA 1J7OA 1QX7A 2I2RE 3B7AA 5FI6A 2KQYA 2K7OA 1IGVA 1PSBA 1A29A 1S6IA 1Y1XA 2F33A 2PALA 3RLZA 3CR5X 3NHTA 1C3YA 3PLFB 2KPHA 1BODA 2LP3A 5ER4X 3R1OA 1B8LA 1A4PA 1NIWA 3FWCA 3WHUB 1TCOB 1XO5A 1CLBA 3UNWA 4BY4A 1Y1UA 2LC5A 2LAPA 2P70A 2PSRA 2EHBA 2WCMA 3OX5A 1CDNA 5DICA 4YRUA 1A75B 3OB2B 2ZRSA 3I5GC 4GGFC 2CCMA 2M29A 2I18A 2LVIA 2PRUA 5TNCA 3SG6A 1MXEA 1OOGA 4OVNF 3D0YA 3DVMA 3I5HB 1QXPA 3LK1A 4PCWA 2KGRA 2JTTA 2OPOA 3IQQA 1YUSA 2LVVA 1EG3A 4GFTA 4ORBB 2HQ8A 3BQ3A 3VRRA 3B88A 3KEVA 1F71A 4QJ4B 2BBMA 1K9UA 2AUCA 2Y4QA 4INWA 2NLNA 5G08A 4C0JA 2QACA 3BFAA 3SIBA 3GOFA 1K8UA 2LP2A 3BUWB 2WCFA 1LXFC 1R2UA 1ZFSA 3QMEA 1K94A 1G33A 1LA3A 1WLZA 2KYCA 1D1OA 2WC8A 1G8IA 1KCYA 1SNLA 1JUOA 3BOWA 1CDLA 2ZNDA 1DGVA 4GPLB 1LKJA 2QDIA 3D78A 1TWOA 2OTGB 4PE0A 1UHHA 2LUXA 3CR4X 3VB1A 2BKIB 3SS5A 4PHMA 1PSRA 3BUMB 3LCPC 1SYMA 3PN7B 2B1UA 2PMYA 5EL2A 1BF5A 2BAPA 5HLVA 1QIVA 1VRKA 1SBJA 1B9AA 1NCXA 1SL7A 1YURA 2D8NA 3BYAA 5CSJA 2FJUB 1LS8A 3NHIA 2CBLA 1J7QA 1B8RA 4E68A 4GUKA 5F6TA 3CYZA 1B47A 2JT8A 2OS8B 3I5IC 1DF0A 3WHTB 1XVJA 3O4YA 3ZNIA 1G4YR 2K7BA 2SCPA 1IWQA 1K2HA 1TUJA 3SG4A 3O6BA 1WDCB 2KBMA 1PVAA 2M97A 1OOFA 3OB1B 1UP5A 1BG1A 2EC6B 2KSPA 4AQJA 4IJ7A 2PQLA 1CFPA 1CLMA 2KGBC 1AUIB 2WCEA 3JVTB 4JPZB 4NQGA 1DT7B 4YGDB 1YVLA 1NYAA 1H4BA 1B8CA 2P71A 3GK4X 3FWBA 1SR6C 4ZCVA 3L4LA 2KFFA 3B87A 2BE6A 2FCEA 2P6BB 1DTLA 1OMDA 2WC6A 3DZTA 4M2PA 2F8PA 4NDBA 4ORAB 3IQOA 4YI9A 1TUZA 5I2LA 1T14A 2K61A 2L51A 2V53A 1CM4A 1MQ1A 2F2OA 3EVVA 2QPTA 5D3OA 4M2OA 1QS7A 4I5NB 4QJ5B 1F4OA 1XFXO 2JC2A 5I8NA 4GGFA 3AAKA 1K93D 1NPQA 1CFCA 1L7ZA 3D74A 1SCMB 5FI2A 2CT9A 3JTDB 5J3XA 1OZOA 3Q8IA 4FQOA 1F4QA 2G2BA 2H61C 3O2PA 3CLNA 2JXLA 2MJWB 1SL8A 1DC1A 2K7DA 1BR1B 1RROA 3TZ1A 2F3YA 3D76A 2JNFA 2LNKA 1OOHA 1W7IB 2ISDA 2BL0B 4CFRA 2M8UA 1EH2A 3CZ2A 1K96A 1X02A 1OMVA 2L5YA 3FE8A 4I5LB 2KDHA 5B8IB 3CR2A 2I94A 1FPWA 1IKUA 1BR4B 4HRGA 2ZNEA 3NSLA 4N1FA 3D0YB 1UWOA 1KK7Z 2WC5A 4UPGA 2KBIA 1BU3A 4CIDA 4MRYA 1XFRA 3CZ1A 2H2KA 1R6PA 2BCAA 2KI6D 2JQ6A 3NSIA 1W7JB 2BE4A 3BUNB 3CZTX 2Y5IA 1AP4A 1DJYA 3DXLA 2JT0A 2MHHA 3TUYB 3D73A 2GTEA 1QWVA 5ER5A 3OBVA 1ALVA 3BXKA 5KSZA 1YRTB 2BNXA 1JF0A 1CTRA 3A8RA 1DGUA 1J7PA 1V1GA 3VRNA 3CZ0A 1DJGA 3VROA 3IVTA 2LMTA 1KQMC 3KO0A 3A4UB 3BOWB 4PHJA 4Q04A 3SG3A 1KK8B 2JRFA 3WNXB 1ZACA 5D7FA 1RK9A 4ZCUA 1XK4C 2I7AA 2LUCA 1KWOB 2WCLA 2KLDA 1RTP1 3DVKA 3PM2A 4TNCA 3CTNA 1SK6D 3K21A 1PALA 3MSEB 3AKBA 1LA0A 1NX0A 2A4JA 5DKRA 3O4XA 1CMFA 2IS9A 4A4BA 2LANA 2M49B 2BCXA 3I5FC 4N5XA 1DF0B 1BJFA 1Y0VH 4MN0A 1DJXA 4P2YB 1MUXA 1YR5A 5AXIA 1QJTA 1IIOA 1SMGA 2L5XB 1BMOA 2L2CA 2NCPA 2FOTA 3EKJA 4JD9A 4CFQA 4ETOA 4GAOA 1DEKA 1ORGA 1N0YA 1S36A 1YVHA 2AMIA 1L2OB 2HPSA 1KQVA 1NWDA 2WOSA 4CPVA 1F8HA 3LLEA 4XJKA 4PHNA 1UHJA 1OE9B 1N2DA 5JOLA 2H61A 3EK7A 1XFUO 1C7WA 1MR8A 1YUTA 1S3PA 2KI6C 5PALA 1Y1AA 2HQWA 2QEHA 3NSKA 3KHEA 1U5IA 5FI7A 1RJVA 5I2QA 1CLLA 1M31A 2KI4C 3BJHA 1J55A 2JXCA 2L0PA 1RECA 2LMUA 3GK2A 3I5GB 3LL8B 3TS5C 3SG2A 3CGAA 1KSMA 4JKTA 2ZKMX 5AEQA 1K90D 1GGWA 1QTXA 2F2PA 4F0ZB 1ZOTB 1Z4HA 5CSNA 2MLEC 5FYXA 1B7TY 2WORA 3EK4A 1IQ5A 1LINA 1J1DA 1KFXL 1QLKA 4GNKB 3S0DA 5K89A 1J1EA 1TNWA 4PDZA 1XA5A 3CABA 3ZWHA 1B7TZ 2DOQA 4YBHB 3VRQA 4I5KA 3H4SE 4I5JA 2PASA 1QASA 3SS3A 1AHRA 2ERBA 3AKAA 3BUXB 1TOPA 2AAOA 2CXJA 3D77A 4XYNA 2M1UA 1BOCA 3DF0A 1SRAA 1ALWA 5BPJA 2EGDA 1TNXA 2CNPA 1UHKA 3D75A 1UHIA 2WCHA 3S0BA 1OOIX 4R1EA 5HKYA 1C07A 1XFZO 3TDUA 5JJGA 2KAXA 1CM1A 1Y6WA 2M9GA 3SG5A 1JFJA 3AAJA 1K9PA 1XK4A 4HREE 1GM0A 4AQIA 2HF5A 4NDCA 3DVJA 1E8AA 1PVBA 2JTZA 2Y1NA 4MZKA 2M7NA 5KU1A 1QATA 2GGMA 1DVIA 3S0FA 2NZ0A 3S0AA 2TN4A 1S26D 1NCZA 2WNDA 1IRJA 3EK8A 2QEVA 1QLSA 1TTXA 3NGVA 3LK0A 1EL4A 5GQQC 3PM8A 2LLSA 3I5IB 3C1VA 4YGCB 1OW4A 2LVJA 1KFUL 2LV7A 1DJIA 1K95A 1QX2A 3RM1A 1V1FA 2COLB 1LVCD 2JPTA 1KK7Y 1SKTA 2LVKA 1SPYA 3F45A 2MLFC 2K2FA 4MLWA 4OKHA 1ZMZA 3O78A 1CFDA 4MRXA 1SR6B 4WQ3A 4MBEA 3TDIA 4PALA 4GBAA 1TNPA 1M45A 3ICBA 2R2IA 3PATA 1OOJA 2M7LA 5HYDA 4PE4A 3VRPA 1C7VA 2LHLA 1QVIY 1SL9A 3BFBA 4ORCB 1CDMA 2BBNA 3EG5B 3V2LA 5I94A 1IH0A 1GJYA 4YGEB 1QVIZ 2H8VA 2LLTA 3SIAA 3N7HA 1F55A 4XJKB 4C0KA 1EJ3A 5DKQA 3D10A 3EKHA 3I5HC 2KFHA 4WQ2A 2ZFDA 4DCKA 1WRKA 2LE9B 2JPOA 2QEOA 1U5IB 1SCVA 3NXAA 1FI5A 1YX7A 1B4CA 1F54A 3L47A 4JQ0D 4QJ3B 1FBVA 4ICBA 2PVBA 1PRWA 3PSRA 1CDPA 2WCBA 4OCIA 1CKKA 4PHKA 4PE1A 3OP0A 1K9KA 4DRWA 2KFGA 2JOJA 4DIRA 5D69A 2M1KB 1L2OC 3OX6A 4YGAA 2E30A 3PALA 2Q91A 1RWYA 2O60A 1Z2CB 4USLA 4DUQA 3EVRA 2Y1MA 3EVUA 3QRXA 1SW8A 2VRGA 1CFFA 3PFVA 3KPXA 1JWDA 2BKHB 2QEBA 1DJHA 4MZLA 1ZUZA 2WCJA 3WXAA 1HQVA 2CTNA 2K2AA 1C3ZA 4BY5A 2OTGC 4DS7A 5CPVA 1FI6A 2G9BA 1RFJA 2MAZA 3DD4A 1N65A 3CDNA 3PN7C 1MXLC 2ZRTA 3DF0B 1TIZA 1NSHA 3DYEA 1DJZA 1TCFA 2LCPA 2MRDA 4L9MA 2SASA 2ZN9A 1KQMB 1OMRA 2KQ6A 2ZN8A 1XFYO 2JNXA 1B1GA 3CWGA 4M2QA 1H8BA 1BLQA 3FE6A 2JZIA 5CSIA 3UO9A 1JBAA 2OS8C 1CB1A 3E3RA 1XFWO 1PK0D 2O5GA 2L98A 1S6JA 3L4AA 1AVSA 4JWQA 4U8DA 5AANA 1W9ZA 1WDCC 3SJSA 3B86A
chains in the Genus database with same CATH topology
1QV1A 2EC6C 2KAVA 2LM5A 3OHMB 4OR9B 1KSOA 5DKNA 2K7CA 1KFXS 1M39A 1AJ4A 1SY9A 1WY9A 4MVFA 3JVTC 2L2EA 1IQ3A 1IG5A 1OQPA 1OSAA 5AFPA 1HT9A 4YI8A 1JSAA 4AOMA 2M0RA 2GGZA 1MF8B 3I5FB 2GV5A 2K0JA 1WRLA 2NCOA 2BCBA 4P5OE 4OV2A 4MSPA 5IBWA 1UHNA 2M3WA 2KNEA 4GGNA 2MBXA 5HKWA 1A75A 2L50A 2MA2A 1MWNA 1TNQA 2BECA 1YTZC 1XFVO 1S6CA 4CLNA 1DJWA 1OZSA 2NXQA 1NP8A 1SCMC 1BT6A 1YX8A 2LHIA 3JTDC 4IL1A 4NDDA 3CS1A 5CSFA 1EG4A 1JFKA 2HETA 1J7RA 3GK1A 1FF1A 1GQMA 2KHNA 2KI4B 5KTYA 1AK8A 2L4HA 2KAYA 3M0WA 2LLUA 3HCMA 5AERA 4HSZA 1ODBA 3TS5B 2BL0C 1IJ5A 1TN4A 1NX1A 1Q80A 2KYFA 1AJ5A 3HX4A 1KFUS 2JULA 3FIAA 1YRUB 5HKZA 1S1EA 1WLMA 1S5GY 2F3ZA 1XYDA 3IF7A 1DMOA 1IJ6A 2KOTA 2RGIA 1S5GZ 4HRHA 3BUOB 4FTGA 1QIWA 2JU0A 4WRIA 4MEWA 4MZJA 1UUSA 3TUYC 1NX2A 1YUUA 1NCYA 1QX5B 2JWWA 1NX3A 1PULA 1A03A 4PE7A 1A2XA 1NUBA 1WRZA 2FCDA 1TRFA 3SG7A 4C0LA 4A4CA 1UURA 3NSOA 4YGBB 1QV0A 3DVEA 2E6WA 1KK8C 2LMVA 1CMGA 1EXRA 1MHOA 1JF2A 1KWOC 3KF9A 3VGOA 1GGZA 4N1GA 5HLOA 1F70A 1M46A 1CNPA 2K8MB 1JC2A 3TDZA 5I2OA 3FS7A 1M63B 2Q4UA 2L4IA 1FW4A 2JT3A 4D1EA 1J7OA 1QX7A 2I2RE 2KQYA 2K7OA 1IGVA 1PSBA 1A29A 1S6IA 1Y1XA 2F33A 2PALA 3RLZA 3CR5X 3PLFB 1BODA 2LP3A 5ER4X 1B8LA 1A4PA 1NIWA 3FWCA 3WHUB 1TCOB 1XO5A 1CLBA 4BY4A 1Y1UA 2LC5A 2LAPA 2PSRA 2EHBA 3OX5A 1CDNA 4YRUA 1A75B 3OB2B 2ZRSA 3I5GC 4GGFC 2CCMA 2M29A 2I18A 2LVIA 2PRUA 5TNCA 3SG6A 1MXEA 4OVNF 3D0YA 3DVMA 3I5HB 1QXPA 3LK1A 4PCWA 2KGRA 2JTTA 2OPOA 3IQQA 1YUSA 2LVVA 1EG3A 4GFTA 4ORBB 2HQ8A 3BQ3A 3VRRA 3KEVA 1F71A 4QJ4B 2BBMA 1K9UA 2AUCA 2Y4QA 2NLNA 5G08A 4C0JA 2QACA 3SIBA 3GOFA 1K8UA 2LP2A 3BUWB 2WCFA 1LXFC 1R2UA 1ZFSA 1K94A 1G33A 1LA3A 1WLZA 2KYCA 1D1OA 2WC8A 1G8IA 1KCYA 1SNLA 1JUOA 3BOWA 1CDLA 2ZNDA 1DGVA 4GPLB 1LKJA 4PE0A 2OTGB 1UHHA 2LUXA 3CR4X 2BKIB 4PHMA 1PSRA 3BUMB 3LCPC 1SYMA 3PN7B 2B1UA 2PMYA 1BF5A 5HLVA 1QIVA 1VRKA 1SBJA 1B9AA 1NCXA 1SL7A 1YURA 2D8NA 3BYAA 5CSJA 2FJUB 1J7QA 2CBLA 1B8RA 4E68A 4GUKA 5F6TA 1B47A 2JT8A 2OS8B 3I5IC 1DF0A 3WHTB 1XVJA 3O4YA 3ZNIA 1G4YR 2K7BA 2SCPA 1IWQA 1K2HA 3SG4A 3O6BA 1WDCB 2KBMA 1PVAA 2M97A 3OB1B 1UP5A 1BG1A 2EC6B 2KSPA 4AQJA 1CFPA 1CLMA 2KGBC 1AUIB 2WCEA 3JVTB 4JPZB 4NQGA 1DT7B 4YGDB 1YVLA 1NYAA 1H4BA 1B8CA 3GK4X 3FWBA 1SR6C 4ZCVA 2KFFA 2BE6A 2FCEA 2P6BB 1DTLA 1OMDA 4ORAB 4M2PA 2F8PA 4NDBA 3IQOA 4YI9A 5I2LA 2K61A 2L51A 2V53A 1CM4A 1MQ1A 2F2OA 3EVVA 2QPTA 4QJ5B 4M2OA 1QS7A 4I5NB 1F4OA 1XFXO 2JC2A 5I8NA 4GGFA 3AAKA 1K93D 1NPQA 1CFCA 1L7ZA 1SCMB 2CT9A 3JTDB 5J3XA 1OZOA 4FQOA 1F4QA 2G2BA 2H61C 3O2PA 3CLNA 2JXLA 2MJWB 1SL8A 2K7DA 1BR1B 1RROA 3TZ1A 2F3YA 2JNFA 2LNKA 1W7IB 2ISDA 2BL0B 4CFRA 2M8UA 1EH2A 1K96A 1X02A 1OMVA 4I5LB 2KDHA 5B8IB 3CR2A 2I94A 1FPWA 1IKUA 1BR4B 4HRGA 2ZNEA 3NSLA 4N1FA 3D0YB 1UWOA 1KK7Z 4UPGA 2KBIA 1BU3A 4CIDA 4MRYA 2H2KA 1R6PA 2BCAA 2KI6D 2JQ6A 3NSIA 1W7JB 2BE4A 3BUNB 3CZTX 2Y5IA 1AP4A 1DJYA 2JT0A 2MHHA 3TUYB 5ER5A 1ALVA 3BXKA 5KSZA 1YRTB 1JF0A 1CTRA 3A8RA 1DGUA 1J7PA 1V1GA 3VRNA 1DJGA 3VROA 2LMTA 1KQMC 3KO0A 3A4UB 3BOWB 4PHJA 4Q04A 3SG3A 1KK8B 2JRFA 3WNXB 1ZACA 5D7FA 1RK9A 4ZCUA 1XK4C 2I7AA 2LUCA 1KWOB 1RTP1 3DVKA 4TNCA 3CTNA 1SK6D 3K21A 1PALA 3MSEB 3AKBA 1LA0A 1NX0A 2A4JA 5DKRA 1CMFA 2IS9A 4A4BA 2LANA 2M49B 2BCXA 3I5FC 4N5XA 1DF0B 1BJFA 1Y0VH 4MN0A 1DJXA 4P2YB 1MUXA 1YR5A 5AXIA 1QJTA 1SMGA 2L5XB 1BMOA 2NCPA 3EKJA 2FOTA 4CFQA 4ETOA 4GAOA 1YVHA 1N0YA 1S36A 2AMIA 2HPSA 1L2OB 1KQVA 1NWDA 2WOSA 4CPVA 1F8HA 3LLEA 4XJKA 4PHNA 1UHJA 1OE9B 1N2DA 5JOLA 2H61A 3EK7A 1XFUO 1C7WA 1MR8A 1S3PA 1YUTA 2KI6C 5PALA 1Y1AA 2HQWA 3NSKA 3KHEA 1U5IA 1RJVA 5I2QA 1CLLA 1M31A 2KI4C 1J55A 2JXCA 2L0PA 1RECA 2LMUA 3GK2A 3I5GB 3LL8B 3TS5C 3SG2A 3CGAA 1KSMA 2ZKMX 5AEQA 1K90D 1GGWA 1QTXA 2F2PA 4F0ZB 1ZOTB 5CSNA 2MLEC 5FYXA 1B7TY 2WORA 3EK4A 1IQ5A 1LINA 1J1DA 1KFXL 1QLKA 4GNKB 5K89A 1J1EA 1TNWA 4PDZA 1XA5A 3ZWHA 1B7TZ 2DOQA 4YBHB 3VRQA 4I5KA 3H4SE 4I5JA 2PASA 1QASA 1AHRA 3AKAA 3BUXB 1TOPA 2AAOA 2CXJA 4XYNA 2M1UA 1BOCA 3DF0A 1SRAA 1ALWA 5BPJA 2EGDA 1TNXA 2CNPA 1UHKA 1UHIA 4R1EA 5HKYA 1C07A 1XFZO 3TDUA 5JJGA 2KAXA 1CM1A 1Y6WA 2M9GA 3SG5A 1JFJA 3AAJA 1K9PA 1XK4A 4HREE 4AQIA 2HF5A 4NDCA 3DVJA 1E8AA 1PVBA 2JTZA 2Y1NA 4MZKA 2M7NA 5KU1A 1QATA 2GGMA 1DVIA 2NZ0A 2TN4A 1S26D 1NCZA 2WNDA 1IRJA 3EK8A 1QLSA 1TTXA 3LK0A 1EL4A 5GQQC 3PM8A 2LLSA 3I5IB 3C1VA 4YGCB 2LVJA 1KFUL 2LV7A 1DJIA 1K95A 1QX2A 3RM1A 1V1FA 2COLB 1LVCD 2JPTA 1KK7Y 1SKTA 2LVKA 1SPYA 3F45A 2MLFC 2K2FA 4MLWA 4OKHA 1ZMZA 3O78A 1CFDA 4MRXA 1SR6B 4WQ3A 4MBEA 3TDIA 4PALA 4GBAA 1TNPA 1M45A 3ICBA 2R2IA 3PATA 1OOJA 2M7LA 5HYDA 4PE4A 3VRPA 1C7VA 2LHLA 1QVIY 1SL9A 4ORCB 1IH0A 1CDMA 2BBNA 1GJYA 4YGEB 1QVIZ 2LLTA 3SIAA 1F55A 4XJKB 4C0KA 1EJ3A 5DKQA 3D10A 3EKHA 3I5HC 2KFHA 4WQ2A 2ZFDA 4DCKA 1WRKA 2LE9B 1U5IB 1SCVA 3NXAA 1FI5A 1YX7A 1B4CA 1F54A 4JQ0D 4QJ3B 1FBVA 4ICBA 2PVBA 1PRWA 3PSRA 1CDPA 2WCBA 4OCIA 1CKKA 4PHKA 4PE1A 3OP0A 1K9KA 4DRWA 2KFGA 2JOJA 4DIRA 5D69A 2M1KB 1L2OC 3OX6A 4YGAA 2E30A 3PALA 2Q91A 1RWYA 2O60A 4DUQA 4USLA 3EVRA 2Y1MA 3EVUA 3QRXA 1SW8A 2VRGA 1CFFA 3PFVA 3KPXA 1JWDA 2BKHB 1DJHA 4MZLA 1ZUZA 3WXAA 1HQVA 2CTNA 2K2AA 4BY5A 2OTGC 4DS7A 5CPVA 1FI6A 2G9BA 1RFJA 2MAZA 3DD4A 1N65A 3PN7C 1MXLC 2ZRTA 3DF0B 1TIZA 1NSHA 1DJZA 1TCFA 2LCPA 2MRDA 4L9MA 2SASA 2ZN9A 1KQMB 1OMRA 2KQ6A 2ZN8A 1XFYO 2JNXA 1B1GA 3CWGA 4M2QA 1H8BA 1BLQA 1JBAA 2JZIA 5CSIA 2OS8C 1CB1A 3E3RA 1XFWO 1PK0D 2O5GA 2L98A 1S6JA 1AVSA 4JWQA 4U8DA 5AANA 1WDCC 3SJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QV1 A;  2EC6 C;  2KAV A;  2LM5 A;  3OHM B;  4OR9 B;  1KSO A;  5DKN A;  2K7C A;  1KFX S;  1M39 A;  1AJ4 A;  1SY9 A;  1WY9 A;  4MVF A;  3JVT C;  2L2E A;  1IQ3 A;  1IG5 A;  1OQP A;  1OSA A;  5AFP A;  1HT9 A;  4YI8 A;  1JSA A;  4AOM A;  2M0R A;  2GGZ A;  1MF8 B;  3I5F B;  2GV5 A;  2K0J A;  1WRL A;  2NCO A;  2BCB A;  4P5O E;  4OV2 A;  4MSP A;  5IBW A;  1UHN A;  2M3W A;  2KNE A;  4GGN A;  2MBX A;  5HKW A;  1A75 A;  2L50 A;  2MA2 A;  1MWN A;  1TNQ A;  2BEC A;  1YTZ C;  1XFV O;  1S6C A;  4CLN A;  1DJW A;  1OZS A;  2NXQ A;  1NP8 A;  1SCM C;  1BT6 A;  1YX8 A;  2LHI A;  3JTD C;  4IL1 A;  4NDD A;  3CS1 A;  5CSF A;  1EG4 A;  1JFK A;  2HET A;  1J7R A;  3GK1 A;  1FF1 A;  1GQM A;  2KHN A;  2KI4 B;  5KTY A;  1AK8 A;  2L4H A;  2KAY A;  3M0W A;  2LLU A;  3HCM A;  5AER A;  4HSZ A;  1ODB A;  3TS5 B;  2BL0 C;  1IJ5 A;  1TN4 A;  1NX1 A;  1Q80 A;  2KYF A;  1AJ5 A;  3HX4 A;  1KFU S;  2JUL A;  3FIA A;  1YRU B;  5HKZ A;  1S1E A;  1WLM A;  1S5G Y;  2F3Z A;  1XYD A;  3IF7 A;  1DMO A;  1IJ6 A;  2KOT A;  2RGI A;  1S5G Z;  4HRH A;  3BUO B;  4FTG A;  1QIW A;  2JU0 A;  4WRI A;  4MEW A;  4MZJ A;  1UUS A;  3TUY C;  1NX2 A;  1YUU A;  1NCY A;  1QX5 B;  2JWW A;  1NX3 A;  1PUL A;  1A03 A;  4PE7 A;  1A2X A;  1NUB A;  1WRZ A;  2FCD A;  1TRF A;  3SG7 A;  4C0L A;  4A4C A;  1UUR A;  3NSO A;  4YGB B;  1QV0 A;  3DVE A;  2E6W A;  1KK8 C;  2LMV A;  1CMG A;  1EXR A;  1MHO A;  1JF2 A;  1KWO C;  3KF9 A;  3VGO A;  1GGZ A;  4N1G A;  5HLO A;  1F70 A;  1M46 A;  1CNP A;  2K8M B;  1JC2 A;  3TDZ A;  5I2O A;  3FS7 A;  1M63 B;  2Q4U A;  2L4I A;  1FW4 A;  2JT3 A;  4D1E A;  1J7O A;  1QX7 A;  2I2R E;  2KQY A;  2K7O A;  1IGV A;  1PSB A;  1A29 A;  1S6I A;  1Y1X A;  2F33 A;  2PAL A;  3RLZ A;  3CR5 X;  3PLF B;  1BOD A;  2LP3 A;  5ER4 X;  1B8L A;  1A4P A;  1NIW A;  3FWC A;  3WHU B;  1TCO B;  1XO5 A;  1CLB A;  4BY4 A;  1Y1U A;  2LC5 A;  2LAP A;  2PSR A;  2EHB A;  3OX5 A;  1CDN A;  4YRU A;  1A75 B;  3OB2 B;  2ZRS A;  3I5G C;  4GGF C;  2CCM A;  2M29 A;  2I18 A;  2LVI A;  2PRU A;  5TNC A;  3SG6 A;  1MXE A;  4OVN F;  3D0Y A;  3DVM A;  3I5H B;  1QXP A;  3LK1 A;  4PCW A;  2KGR A;  2JTT A;  2OPO A;  3IQQ A;  1YUS A;  2LVV A;  1EG3 A;  4GFT A;  4ORB B;  2HQ8 A;  3BQ3 A;  3VRR A;  3KEV A;  1F71 A;  4QJ4 B;  2BBM A;  1K9U A;  2AUC A;  2Y4Q A;  2NLN A;  5G08 A;  4C0J A;  2QAC A;  3SIB A;  3GOF A;  1K8U A;  2LP2 A;  3BUW B;  2WCF A;  1LXF C;  1R2U A;  1ZFS A;  1K94 A;  1G33 A;  1LA3 A;  1WLZ A;  2KYC A;  1D1O A;  2WC8 A;  1G8I A;  1KCY A;  1SNL A;  1JUO A;  3BOW A;  1CDL A;  2ZND A;  1DGV A;  4GPL B;  1LKJ A;  4PE0 A;  2OTG B;  1UHH A;  2LUX A;  3CR4 X;  2BKI B;  4PHM A;  1PSR A;  3BUM B;  3LCP C;  1SYM A;  3PN7 B;  2B1U A;  2PMY A;  1BF5 A;  5HLV A;  1QIV A;  1VRK A;  1SBJ A;  1B9A A;  1NCX A;  1SL7 A;  1YUR A;  2D8N A;  3BYA A;  5CSJ A;  2FJU B;  1J7Q A;  2CBL A;  1B8R A;  4E68 A;  4GUK A;  5F6T A;  1B47 A;  2JT8 A;  2OS8 B;  3I5I C;  1DF0 A;  3WHT B;  1XVJ A;  3O4Y A;  3ZNI A;  1G4Y R;  2K7B A;  2SCP A;  1IWQ A;  1K2H A;  3SG4 A;  3O6B A;  1WDC B;  2KBM A;  1PVA A;  2M97 A;  3OB1 B;  1UP5 A;  1BG1 A;  2EC6 B;  2KSP A;  4AQJ A;  1CFP A;  1CLM A;  2KGB C;  1AUI B;  2WCE A;  3JVT B;  4JPZ B;  4NQG A;  1DT7 B;  4YGD B;  1YVL A;  1NYA A;  1H4B A;  1B8C A;  3GK4 X;  3FWB A;  1SR6 C;  4ZCV A;  2KFF A;  2BE6 A;  2FCE A;  2P6B B;  1DTL A;  1OMD A;  4ORA B;  4M2P A;  2F8P A;  4NDB A;  3IQO A;  4YI9 A;  5I2L A;  2K61 A;  2L51 A;  2V53 A;  1CM4 A;  1MQ1 A;  2F2O A;  3EVV A;  2QPT A;  4QJ5 B;  4M2O A;  1QS7 A;  4I5N B;  1F4O A;  1XFX O;  2JC2 A;  5I8N A;  4GGF A;  3AAK A;  1K93 D;  1NPQ A;  1CFC A;  1L7Z A;  1SCM B;  2CT9 A;  3JTD B;  5J3X A;  1OZO A;  4FQO A;  1F4Q A;  2G2B A;  2H61 C;  3O2P A;  3CLN A;  2JXL A;  2MJW B;  1SL8 A;  2K7D A;  1BR1 B;  1RRO A;  3TZ1 A;  2F3Y A;  2JNF A;  2LNK A;  1W7I B;  2ISD A;  2BL0 B;  4CFR A;  2M8U A;  1EH2 A;  1K96 A;  1X02 A;  1OMV A;  4I5L B;  2KDH A;  5B8I B;  3CR2 A;  2I94 A;  1FPW A;  1IKU A;  1BR4 B;  4HRG A;  2ZNE A;  3NSL A;  4N1F A;  3D0Y B;  1UWO A;  1KK7 Z;  4UPG A;  2KBI A;  1BU3 A;  4CID A;  4MRY A;  2H2K A;  1R6P A;  2BCA A;  2KI6 D;  2JQ6 A;  3NSI A;  1W7J B;  2BE4 A;  3BUN B;  3CZT X;  2Y5I A;  1AP4 A;  1DJY A;  2JT0 A;  2MHH A;  3TUY B;  5ER5 A;  1ALV A;  3BXK A;  5KSZ A;  1YRT B;  1JF0 A;  1CTR A;  3A8R A;  1DGU A;  1J7P A;  1V1G A;  3VRN A;  1DJG A;  3VRO A;  2LMT A;  1KQM C;  3KO0 A;  3A4U B;  3BOW B;  4PHJ A;  4Q04 A;  3SG3 A;  1KK8 B;  2JRF A;  3WNX B;  1ZAC A;  5D7F A;  1RK9 A;  4ZCU A;  1XK4 C;  2I7A A;  2LUC A;  1KWO B;  1RTP 1;  3DVK A;  4TNC A;  3CTN A;  1SK6 D;  3K21 A;  1PAL A;  3MSE B;  3AKB A;  1LA0 A;  1NX0 A;  2A4J A;  5DKR A;  1CMF A;  2IS9 A;  4A4B A;  2LAN A;  2M49 B;  2BCX A;  3I5F C;  4N5X A;  1DF0 B;  1BJF A;  1Y0V H;  4MN0 A;  1DJX A;  4P2Y B;  1MUX A;  1YR5 A;  5AXI A;  1QJT A;  1SMG A;  2L5X B;  1BMO A;  2NCP A;  3EKJ A;  2FOT A;  4CFQ A;  4ETO A;  4GAO A;  1YVH A;  1N0Y A;  1S36 A;  2AMI A;  2HPS A;  1L2O B;  1KQV A;  1NWD A;  2WOS A;  4CPV A;  1F8H A;  3LLE A;  4XJK A;  4PHN A;  1UHJ A;  1OE9 B;  1N2D A;  5JOL A;  2H61 A;  3EK7 A;  1XFU O;  1C7W A;  1MR8 A;  1S3P A;  1YUT A;  2KI6 C;  5PAL A;  1Y1A A;  2HQW A;  3NSK A;  3KHE A;  1U5I A;  1RJV A;  5I2Q A;  1CLL A;  1M31 A;  2KI4 C;  1J55 A;  2JXC A;  2L0P A;  1REC A;  2LMU A;  3GK2 A;  3I5G B;  3LL8 B;  3TS5 C;  3SG2 A;  3CGA A;  1KSM A;  2ZKM X;  5AEQ A;  1K90 D;  1GGW A;  1QTX A;  2F2P A;  4F0Z B;  1ZOT B;  5CSN A;  2MLE C;  5FYX A;  1B7T Y;  2WOR A;  3EK4 A;  1IQ5 A;  1LIN A;  1J1D A;  1KFX L;  1QLK A;  4GNK B;  5K89 A;  1J1E A;  1TNW A;  4PDZ A;  1XA5 A;  3ZWH A;  1B7T Z;  2DOQ A;  4YBH B;  3VRQ A;  4I5K A;  3H4S E;  4I5J A;  2PAS A;  1QAS A;  1AHR A;  3AKA A;  3BUX B;  1TOP A;  2AAO A;  2CXJ A;  4XYN A;  2M1U A;  1BOC A;  3DF0 A;  1SRA A;  1ALW A;  5BPJ A;  2EGD A;  1TNX A;  2CNP A;  1UHK A;  1UHI A;  4R1E A;  5HKY A;  1C07 A;  1XFZ O;  3TDU A;  5JJG A;  2KAX A;  1CM1 A;  1Y6W A;  2M9G A;  3SG5 A;  1JFJ A;  3AAJ A;  1K9P A;  1XK4 A;  4HRE E;  4AQI A;  2HF5 A;  4NDC A;  3DVJ A;  1E8A A;  1PVB A;  2JTZ A;  2Y1N A;  4MZK A;  2M7N A;  5KU1 A;  1QAT A;  2GGM A;  1DVI A;  2NZ0 A;  2TN4 A;  1S26 D;  1NCZ A;  2WND A;  1IRJ A;  3EK8 A;  1QLS A;  1TTX A;  3LK0 A;  1EL4 A;  5GQQ C;  3PM8 A;  2LLS A;  3I5I B;  3C1V A;  4YGC B;  2LVJ A;  1KFU L;  2LV7 A;  1DJI A;  1K95 A;  1QX2 A;  3RM1 A;  1V1F A;  2COL B;  1LVC D;  2JPT A;  1KK7 Y;  1SKT A;  2LVK A;  1SPY A;  3F45 A;  2MLF C;  2K2F A;  4MLW A;  4OKH A;  1ZMZ A;  3O78 A;  1CFD A;  4MRX A;  1SR6 B;  4WQ3 A;  4MBE A;  3TDI A;  4PAL A;  4GBA A;  1TNP A;  1M45 A;  3ICB A;  2R2I A;  3PAT A;  1OOJ A;  2M7L A;  5HYD A;  4PE4 A;  3VRP A;  1C7V A;  2LHL A;  1QVI Y;  1SL9 A;  4ORC B;  1IH0 A;  1CDM A;  2BBN A;  1GJY A;  4YGE B;  1QVI Z;  2LLT A;  3SIA A;  1F55 A;  4XJK B;  4C0K A;  1EJ3 A;  5DKQ A;  3D10 A;  3EKH A;  3I5H C;  2KFH A;  4WQ2 A;  2ZFD A;  4DCK A;  1WRK A;  2LE9 B;  1U5I B;  1SCV A;  3NXA A;  1FI5 A;  1YX7 A;  1B4C A;  1F54 A;  4JQ0 D;  4QJ3 B;  1FBV A;  4ICB A;  2PVB A;  1PRW A;  3PSR A;  1CDP A;  2WCB A;  4OCI A;  1CKK A;  4PHK A;  4PE1 A;  3OP0 A;  1K9K A;  4DRW A;  2KFG A;  2JOJ A;  4DIR A;  5D69 A;  2M1K B;  1L2O C;  3OX6 A;  4YGA A;  2E30 A;  3PAL A;  2Q91 A;  1RWY A;  2O60 A;  4DUQ A;  4USL A;  3EVR A;  2Y1M A;  3EVU A;  3QRX A;  1SW8 A;  2VRG A;  1CFF A;  3PFV A;  3KPX A;  1JWD A;  2BKH B;  1DJH A;  4MZL A;  1ZUZ A;  3WXA A;  1HQV A;  2CTN A;  2K2A A;  4BY5 A;  2OTG C;  4DS7 A;  5CPV A;  1FI6 A;  2G9B A;  1RFJ A;  2MAZ A;  3DD4 A;  1N65 A;  3PN7 C;  1MXL C;  2ZRT A;  3DF0 B;  1TIZ A;  1NSH A;  1DJZ A;  1TCF A;  2LCP A;  2MRD A;  4L9M A;  2SAS A;  2ZN9 A;  1KQM B;  1OMR A;  2KQ6 A;  2ZN8 A;  1XFY O;  2JNX A;  1B1G A;  3CWG A;  4M2Q A;  1H8B A;  1BLQ A;  1JBA A;  2JZI A;  5CSI A;  2OS8 C;  1CB1 A;  3E3R A;  1XFW O;  1PK0 D;  2O5G A;  2L98 A;  1S6J A;  1AVS A;  4JWQ A;  4U8D A;  5AAN A;  1WDC C;  3SJS A; 
#chains in the Genus database with same CATH topology
 1QV1 A;  2EC6 C;  2KAV A;  2LM5 A;  3OHM B;  4OR9 B;  1KSO A;  5DKN A;  2K7C A;  1KFX S;  1M39 A;  1AJ4 A;  1SY9 A;  1WY9 A;  3R72 A;  4MVF A;  3JVT C;  2L2E A;  1IQ3 A;  1IG5 A;  1OQP A;  1OSA A;  5AFP A;  1HT9 A;  4YI8 A;  1JSA A;  4AOM A;  2M0R A;  2GGZ A;  1MF8 B;  3I5F B;  2GV5 A;  2FJY A;  1WRL A;  2K0J A;  2NCO A;  2BCB A;  4P5O E;  4OV2 A;  4MSP A;  5IBW A;  1UHN A;  1DQE A;  4KYN A;  2M3W A;  3FE9 A;  2KNE A;  4GGN A;  2MBX A;  5HKW A;  1A75 A;  2L50 A;  2MA2 A;  1MWN A;  1TNQ A;  3BFH A;  2BEC A;  1YTZ C;  1XFV O;  1S6C A;  1P28 A;  1DJW A;  3R1P A;  1OZS A;  4CLN A;  2NXQ A;  1NP8 A;  1SCM C;  1BT6 A;  1YX8 A;  2LHI A;  3JTD C;  4IL1 A;  4NDD A;  3CS1 A;  5CSF A;  1EG4 A;  1JFK A;  2WCK A;  2HET A;  1J7R A;  3GK1 A;  1FF1 A;  1GQM A;  2KLE A;  5HL1 A;  2KHN A;  2KI4 B;  5KTY A;  1AK8 A;  2L4H A;  2KAY A;  3M0W A;  2LLU A;  3HCM A;  3B6X A;  1DEL A;  4HSZ A;  5AER A;  1ODB A;  3TS5 B;  2BL0 C;  1IJ5 A;  1TN4 A;  1NX1 A;  2YGU A;  1Q80 A;  2KYF A;  1AJ5 A;  3HX4 A;  3K1E A;  1KFU S;  2JUL A;  3FIA A;  4FQT A;  1YRU B;  5HKZ A;  1S1E A;  1WLM A;  1S5G Y;  3DY9 A;  2F3Z A;  1XYD A;  3IF7 A;  1DMO A;  1IJ6 A;  2KOT A;  2RGI A;  1S5G Z;  4HRH A;  3BUO B;  4FTG A;  1QIW A;  2JU0 A;  4WRI A;  4MEW A;  4MZJ A;  1UUS A;  3TUY C;  1NX2 A;  1YUU A;  1NCY A;  3SS4 A;  4PT1 A;  1QX5 B;  3OGN A;  2JWW A;  1NX3 A;  1PUL A;  1A03 A;  4PE7 A;  1A2X A;  2PYQ A;  1NUB A;  1WRZ A;  2FCD A;  1TRF A;  3SG7 A;  3RZS A;  4C0L A;  4A4C A;  1UUR A;  3NSO A;  4YGB B;  1QV0 A;  3DVE A;  2E6W A;  1KK8 C;  2LMV A;  1CMG A;  1EXR A;  1MHO A;  4INX A;  1JF2 A;  1KWO C;  3KF9 A;  3VGO A;  1GGZ A;  2K60 A;  4N1G A;  3S0E A;  5HLO A;  1F70 A;  1M46 A;  1CNP A;  2K8M B;  1JC2 A;  3TDZ A;  4F7F A;  5I2O A;  3FS7 A;  3PJI A;  1M63 B;  2Q4U A;  2L4I A;  1SSE B;  4OZD A;  1FW4 A;  3R1V A;  2JT3 A;  3S0G A;  4D1E A;  1J7O A;  1QX7 A;  2I2R E;  3B7A A;  5FI6 A;  2KQY A;  2K7O A;  1IGV A;  1PSB A;  1A29 A;  1S6I A;  1Y1X A;  2F33 A;  2PAL A;  3RLZ A;  3CR5 X;  3NHT A;  1C3Y A;  3PLF B;  2KPH A;  1BOD A;  2LP3 A;  5ER4 X;  3R1O A;  1B8L A;  1A4P A;  1NIW A;  3FWC A;  3WHU B;  1TCO B;  1XO5 A;  1CLB A;  3UNW A;  4BY4 A;  1Y1U A;  2LC5 A;  2LAP A;  2P70 A;  2PSR A;  2EHB A;  2WCM A;  3OX5 A;  1CDN A;  5DIC A;  4YRU A;  1A75 B;  3OB2 B;  2ZRS A;  3I5G C;  4GGF C;  2CCM A;  2M29 A;  2I18 A;  2LVI A;  2PRU A;  5TNC A;  3SG6 A;  1MXE A;  1OOG A;  4OVN F;  3D0Y A;  3DVM A;  3I5H B;  1QXP A;  3LK1 A;  4PCW A;  2KGR A;  2JTT A;  2OPO A;  3IQQ A;  1YUS A;  2LVV A;  1EG3 A;  4GFT A;  4ORB B;  2HQ8 A;  3BQ3 A;  3VRR A;  3B88 A;  3KEV A;  1F71 A;  4QJ4 B;  2BBM A;  1K9U A;  2AUC A;  2Y4Q A;  4INW A;  2NLN A;  5G08 A;  4C0J A;  2QAC A;  3BFA A;  3SIB A;  3GOF A;  1K8U A;  2LP2 A;  3BUW B;  2WCF A;  1LXF C;  1R2U A;  1ZFS A;  3QME A;  1K94 A;  1G33 A;  1LA3 A;  1WLZ A;  2KYC A;  1D1O A;  2WC8 A;  1G8I A;  1KCY A;  1SNL A;  1JUO A;  3BOW A;  1CDL A;  2ZND A;  1DGV A;  4GPL B;  1LKJ A;  2QDI A;  3D78 A;  1TWO A;  2OTG B;  4PE0 A;  1UHH A;  2LUX A;  3CR4 X;  3VB1 A;  2BKI B;  3SS5 A;  4PHM A;  1PSR A;  3BUM B;  3LCP C;  1SYM A;  3PN7 B;  2B1U A;  2PMY A;  5EL2 A;  1BF5 A;  2BAP A;  5HLV A;  1QIV A;  1VRK A;  1SBJ A;  1B9A A;  1NCX A;  1SL7 A;  1YUR A;  2D8N A;  3BYA A;  5CSJ A;  2FJU B;  1LS8 A;  3NHI A;  2CBL A;  1J7Q A;  1B8R A;  4E68 A;  4GUK A;  5F6T A;  3CYZ A;  1B47 A;  2JT8 A;  2OS8 B;  3I5I C;  1DF0 A;  3WHT B;  1XVJ A;  3O4Y A;  3ZNI A;  1G4Y R;  2K7B A;  2SCP A;  1IWQ A;  1K2H A;  1TUJ A;  3SG4 A;  3O6B A;  1WDC B;  2KBM A;  1PVA A;  2M97 A;  1OOF A;  3OB1 B;  1UP5 A;  1BG1 A;  2EC6 B;  2KSP A;  4AQJ A;  4IJ7 A;  2PQL A;  1CFP A;  1CLM A;  2KGB C;  1AUI B;  2WCE A;  3JVT B;  4JPZ B;  4NQG A;  1DT7 B;  4YGD B;  1YVL A;  1NYA A;  1H4B A;  1B8C A;  2P71 A;  3GK4 X;  3FWB A;  1SR6 C;  4ZCV A;  3L4L A;  2KFF A;  3B87 A;  2BE6 A;  2FCE A;  2P6B B;  1DTL A;  1OMD A;  2WC6 A;  3DZT A;  4M2P A;  2F8P A;  4NDB A;  4ORA B;  3IQO A;  4YI9 A;  1TUZ A;  5I2L A;  1T14 A;  2K61 A;  2L51 A;  2V53 A;  1CM4 A;  1MQ1 A;  2F2O A;  3EVV A;  2QPT A;  5D3O A;  4M2O A;  1QS7 A;  4I5N B;  4QJ5 B;  1F4O A;  1XFX O;  2JC2 A;  5I8N A;  4GGF A;  3AAK A;  1K93 D;  1NPQ A;  1CFC A;  1L7Z A;  3D74 A;  1SCM B;  5FI2 A;  2CT9 A;  3JTD B;  5J3X A;  1OZO A;  3Q8I A;  4FQO A;  1F4Q A;  2G2B A;  2H61 C;  3O2P A;  3CLN A;  2JXL A;  2MJW B;  1SL8 A;  1DC1 A;  2K7D A;  1BR1 B;  1RRO A;  3TZ1 A;  2F3Y A;  3D76 A;  2JNF A;  2LNK A;  1OOH A;  1W7I B;  2ISD A;  2BL0 B;  4CFR A;  2M8U A;  1EH2 A;  3CZ2 A;  1K96 A;  1X02 A;  1OMV A;  2L5Y A;  3FE8 A;  4I5L B;  2KDH A;  5B8I B;  3CR2 A;  2I94 A;  1FPW A;  1IKU A;  1BR4 B;  4HRG A;  2ZNE A;  3NSL A;  4N1F A;  3D0Y B;  1UWO A;  1KK7 Z;  2WC5 A;  4UPG A;  2KBI A;  1BU3 A;  4CID A;  4MRY A;  1XFR A;  3CZ1 A;  2H2K A;  1R6P A;  2BCA A;  2KI6 D;  2JQ6 A;  3NSI A;  1W7J B;  2BE4 A;  3BUN B;  3CZT X;  2Y5I A;  1AP4 A;  1DJY A;  3DXL A;  2JT0 A;  2MHH A;  3TUY B;  3D73 A;  2GTE A;  1QWV A;  5ER5 A;  3OBV A;  1ALV A;  3BXK A;  5KSZ A;  1YRT B;  2BNX A;  1JF0 A;  1CTR A;  3A8R A;  1DGU A;  1J7P A;  1V1G A;  3VRN A;  3CZ0 A;  1DJG A;  3VRO A;  3IVT A;  2LMT A;  1KQM C;  3KO0 A;  3A4U B;  3BOW B;  4PHJ A;  4Q04 A;  3SG3 A;  1KK8 B;  2JRF A;  3WNX B;  1ZAC A;  5D7F A;  1RK9 A;  4ZCU A;  1XK4 C;  2I7A A;  2LUC A;  1KWO B;  2WCL A;  2KLD A;  1RTP 1;  3DVK A;  3PM2 A;  4TNC A;  3CTN A;  1SK6 D;  3K21 A;  1PAL A;  3MSE B;  3AKB A;  1LA0 A;  1NX0 A;  2A4J A;  5DKR A;  3O4X A;  1CMF A;  2IS9 A;  4A4B A;  2LAN A;  2M49 B;  2BCX A;  3I5F C;  4N5X A;  1DF0 B;  1BJF A;  1Y0V H;  4MN0 A;  1DJX A;  4P2Y B;  1MUX A;  1YR5 A;  5AXI A;  1QJT A;  1IIO A;  1SMG A;  2L5X B;  1BMO A;  2L2C A;  2NCP A;  2FOT A;  3EKJ A;  4JD9 A;  4CFQ A;  4ETO A;  4GAO A;  1DEK A;  1ORG A;  1N0Y A;  1S36 A;  1YVH A;  2AMI A;  1L2O B;  2HPS A;  1KQV A;  1NWD A;  2WOS A;  4CPV A;  1F8H A;  3LLE A;  4XJK A;  4PHN A;  1UHJ A;  1OE9 B;  1N2D A;  5JOL A;  2H61 A;  3EK7 A;  1XFU O;  1C7W A;  1MR8 A;  1YUT A;  1S3P A;  2KI6 C;  5PAL A;  1Y1A A;  2HQW A;  2QEH A;  3NSK A;  3KHE A;  1U5I A;  5FI7 A;  1RJV A;  5I2Q A;  1CLL A;  1M31 A;  2KI4 C;  3BJH A;  1J55 A;  2JXC A;  2L0P A;  1REC A;  2LMU A;  3GK2 A;  3I5G B;  3LL8 B;  3TS5 C;  3SG2 A;  3CGA A;  1KSM A;  4JKT A;  2ZKM X;  5AEQ A;  1K90 D;  1GGW A;  1QTX A;  2F2P A;  4F0Z B;  1ZOT B;  1Z4H A;  5CSN A;  2MLE C;  5FYX A;  1B7T Y;  2WOR A;  3EK4 A;  1IQ5 A;  1LIN A;  1J1D A;  1KFX L;  1QLK A;  4GNK B;  3S0D A;  5K89 A;  1J1E A;  1TNW A;  4PDZ A;  1XA5 A;  3CAB A;  3ZWH A;  1B7T Z;  2DOQ A;  4YBH B;  3VRQ A;  4I5K A;  3H4S E;  4I5J A;  2PAS A;  1QAS A;  3SS3 A;  1AHR A;  2ERB A;  3AKA A;  3BUX B;  1TOP A;  2AAO A;  2CXJ A;  3D77 A;  4XYN A;  2M1U A;  1BOC A;  3DF0 A;  1SRA A;  1ALW A;  5BPJ A;  2EGD A;  1TNX A;  2CNP A;  1UHK A;  3D75 A;  1UHI A;  2WCH A;  3S0B A;  1OOI X;  4R1E A;  5HKY A;  1C07 A;  1XFZ O;  3TDU A;  5JJG A;  2KAX A;  1CM1 A;  1Y6W A;  2M9G A;  3SG5 A;  1JFJ A;  3AAJ A;  1K9P A;  1XK4 A;  4HRE E;  1GM0 A;  4AQI A;  2HF5 A;  4NDC A;  3DVJ A;  1E8A A;  1PVB A;  2JTZ A;  2Y1N A;  4MZK A;  2M7N A;  5KU1 A;  1QAT A;  2GGM A;  1DVI A;  3S0F A;  2NZ0 A;  3S0A A;  2TN4 A;  1S26 D;  1NCZ A;  2WND A;  1IRJ A;  3EK8 A;  2QEV A;  1QLS A;  1TTX A;  3NGV A;  3LK0 A;  1EL4 A;  5GQQ C;  3PM8 A;  2LLS A;  3I5I B;  3C1V A;  4YGC B;  1OW4 A;  2LVJ A;  1KFU L;  2LV7 A;  1DJI A;  1K95 A;  1QX2 A;  3RM1 A;  1V1F A;  2COL B;  1LVC D;  2JPT A;  1KK7 Y;  1SKT A;  2LVK A;  1SPY A;  3F45 A;  2MLF C;  2K2F A;  4MLW A;  4OKH A;  1ZMZ A;  3O78 A;  1CFD A;  4MRX A;  1SR6 B;  4WQ3 A;  4MBE A;  3TDI A;  4PAL A;  4GBA A;  1TNP A;  1M45 A;  3ICB A;  2R2I A;  3PAT A;  1OOJ A;  2M7L A;  5HYD A;  4PE4 A;  3VRP A;  1C7V A;  2LHL A;  1QVI Y;  1SL9 A;  3BFB A;  4ORC B;  1CDM A;  2BBN A;  3EG5 B;  3V2L A;  5I94 A;  1IH0 A;  1GJY A;  4YGE B;  1QVI Z;  2H8V A;  2LLT A;  3SIA A;  3N7H A;  1F55 A;  4XJK B;  4C0K A;  1EJ3 A;  5DKQ A;  3D10 A;  3EKH A;  3I5H C;  2KFH A;  4WQ2 A;  2ZFD A;  4DCK A;  1WRK A;  2LE9 B;  2JPO A;  2QEO A;  1U5I B;  1SCV A;  3NXA A;  1FI5 A;  1YX7 A;  1B4C A;  1F54 A;  3L47 A;  4JQ0 D;  4QJ3 B;  1FBV A;  4ICB A;  2PVB A;  1PRW A;  3PSR A;  1CDP A;  2WCB A;  4OCI A;  1CKK A;  4PHK A;  4PE1 A;  3OP0 A;  1K9K A;  4DRW A;  2KFG A;  2JOJ A;  4DIR A;  5D69 A;  2M1K B;  1L2O C;  3OX6 A;  4YGA A;  2E30 A;  3PAL A;  2Q91 A;  1RWY A;  2O60 A;  1Z2C B;  4USL A;  4DUQ A;  3EVR A;  2Y1M A;  3EVU A;  3QRX A;  1SW8 A;  2VRG A;  1CFF A;  3PFV A;  3KPX A;  1JWD A;  2BKH B;  2QEB A;  1DJH A;  4MZL A;  1ZUZ A;  2WCJ A;  3WXA A;  1HQV A;  2CTN A;  2K2A A;  1C3Z A;  4BY5 A;  2OTG C;  4DS7 A;  5CPV A;  1FI6 A;  2G9B A;  1RFJ A;  2MAZ A;  3DD4 A;  1N65 A;  3CDN A;  3PN7 C;  1MXL C;  2ZRT A;  3DF0 B;  1TIZ A;  1NSH A;  3DYE A;  1DJZ A;  1TCF A;  2LCP A;  2MRD A;  4L9M A;  2SAS A;  2ZN9 A;  1KQM B;  1OMR A;  2KQ6 A;  2ZN8 A;  1XFY O;  2JNX A;  1B1G A;  3CWG A;  4M2Q A;  1H8B A;  1BLQ A;  3FE6 A;  2JZI A;  5CSI A;  3UO9 A;  1JBA A;  2OS8 C;  1CB1 A;  3E3R A;  1XFW O;  1PK0 D;  2O5G A;  2L98 A;  1S6J A;  3L4A A;  1AVS A;  4JWQ A;  4U8D A;  5AAN A;  1W9Z A;  1WDC C;  3SJS A;  3B86 A; 
#chains in the Genus database with same CATH homology
 1QV1 A;  2EC6 C;  2KAV A;  2LM5 A;  3OHM B;  4OR9 B;  1KSO A;  5DKN A;  2K7C A;  1KFX S;  1M39 A;  1AJ4 A;  1SY9 A;  1WY9 A;  4MVF A;  3JVT C;  2L2E A;  1IQ3 A;  1IG5 A;  1OQP A;  1OSA A;  5AFP A;  1HT9 A;  4YI8 A;  1JSA A;  4AOM A;  2M0R A;  2GGZ A;  1MF8 B;  3I5F B;  2GV5 A;  2K0J A;  1WRL A;  2NCO A;  2BCB A;  4P5O E;  4OV2 A;  4MSP A;  5IBW A;  1UHN A;  2M3W A;  2KNE A;  4GGN A;  2MBX A;  5HKW A;  1A75 A;  2L50 A;  2MA2 A;  1MWN A;  1TNQ A;  2BEC A;  1YTZ C;  1XFV O;  1S6C A;  4CLN A;  1DJW A;  1OZS A;  2NXQ A;  1NP8 A;  1SCM C;  1BT6 A;  1YX8 A;  2LHI A;  3JTD C;  4IL1 A;  4NDD A;  3CS1 A;  5CSF A;  1EG4 A;  1JFK A;  2HET A;  1J7R A;  3GK1 A;  1FF1 A;  1GQM A;  2KHN A;  2KI4 B;  5KTY A;  1AK8 A;  2L4H A;  2KAY A;  3M0W A;  2LLU A;  3HCM A;  5AER A;  4HSZ A;  1ODB A;  3TS5 B;  2BL0 C;  1IJ5 A;  1TN4 A;  1NX1 A;  1Q80 A;  2KYF A;  1AJ5 A;  3HX4 A;  1KFU S;  2JUL A;  3FIA A;  1YRU B;  5HKZ A;  1S1E A;  1WLM A;  1S5G Y;  2F3Z A;  1XYD A;  3IF7 A;  1DMO A;  1IJ6 A;  2KOT A;  2RGI A;  1S5G Z;  4HRH A;  3BUO B;  4FTG A;  1QIW A;  2JU0 A;  4WRI A;  4MEW A;  4MZJ A;  1UUS A;  3TUY C;  1NX2 A;  1YUU A;  1NCY A;  1QX5 B;  2JWW A;  1NX3 A;  1PUL A;  1A03 A;  4PE7 A;  1A2X A;  1NUB A;  1WRZ A;  2FCD A;  1TRF A;  3SG7 A;  4C0L A;  4A4C A;  1UUR A;  3NSO A;  4YGB B;  1QV0 A;  3DVE A;  2E6W A;  1KK8 C;  2LMV A;  1CMG A;  1EXR A;  1MHO A;  1JF2 A;  1KWO C;  3KF9 A;  3VGO A;  1GGZ A;  4N1G A;  5HLO A;  1F70 A;  1M46 A;  1CNP A;  2K8M B;  1JC2 A;  3TDZ A;  5I2O A;  3FS7 A;  1M63 B;  2Q4U A;  2L4I A;  1FW4 A;  2JT3 A;  4D1E A;  1J7O A;  1QX7 A;  2I2R E;  2KQY A;  2K7O A;  1IGV A;  1PSB A;  1A29 A;  1S6I A;  1Y1X A;  2F33 A;  2PAL A;  3RLZ A;  3CR5 X;  3PLF B;  1BOD A;  2LP3 A;  5ER4 X;  1B8L A;  1A4P A;  1NIW A;  3FWC A;  3WHU B;  1TCO B;  1XO5 A;  1CLB A;  4BY4 A;  1Y1U A;  2LC5 A;  2LAP A;  2PSR A;  2EHB A;  3OX5 A;  1CDN A;  4YRU A;  1A75 B;  3OB2 B;  2ZRS A;  3I5G C;  4GGF C;  2CCM A;  2M29 A;  2I18 A;  2LVI A;  2PRU A;  5TNC A;  3SG6 A;  1MXE A;  4OVN F;  3D0Y A;  3DVM A;  3I5H B;  1QXP A;  3LK1 A;  4PCW A;  2KGR A;  2JTT A;  2OPO A;  3IQQ A;  1YUS A;  2LVV A;  1EG3 A;  4GFT A;  4ORB B;  2HQ8 A;  3BQ3 A;  3VRR A;  3KEV A;  1F71 A;  4QJ4 B;  2BBM A;  1K9U A;  2AUC A;  2Y4Q A;  2NLN A;  5G08 A;  4C0J A;  2QAC A;  3SIB A;  3GOF A;  1K8U A;  2LP2 A;  3BUW B;  2WCF A;  1LXF C;  1R2U A;  1ZFS A;  1K94 A;  1G33 A;  1LA3 A;  1WLZ A;  2KYC A;  1D1O A;  2WC8 A;  1G8I A;  1KCY A;  1SNL A;  1JUO A;  3BOW A;  1CDL A;  2ZND A;  1DGV A;  4GPL B;  1LKJ A;  4PE0 A;  2OTG B;  1UHH A;  2LUX A;  3CR4 X;  2BKI B;  4PHM A;  1PSR A;  3BUM B;  3LCP C;  1SYM A;  3PN7 B;  2B1U A;  2PMY A;  1BF5 A;  5HLV A;  1QIV A;  1VRK A;  1SBJ A;  1B9A A;  1NCX A;  1SL7 A;  1YUR A;  2D8N A;  3BYA A;  5CSJ A;  2FJU B;  1J7Q A;  2CBL A;  1B8R A;  4E68 A;  4GUK A;  5F6T A;  1B47 A;  2JT8 A;  2OS8 B;  3I5I C;  1DF0 A;  3WHT B;  1XVJ A;  3O4Y A;  3ZNI A;  1G4Y R;  2K7B A;  2SCP A;  1IWQ A;  1K2H A;  3SG4 A;  3O6B A;  1WDC B;  2KBM A;  1PVA A;  2M97 A;  3OB1 B;  1UP5 A;  1BG1 A;  2EC6 B;  2KSP A;  4AQJ A;  1CFP A;  1CLM A;  2KGB C;  1AUI B;  2WCE A;  3JVT B;  4JPZ B;  4NQG A;  1DT7 B;  4YGD B;  1YVL A;  1NYA A;  1H4B A;  1B8C A;  3GK4 X;  3FWB A;  1SR6 C;  4ZCV A;  2KFF A;  2BE6 A;  2FCE A;  2P6B B;  1DTL A;  1OMD A;  4ORA B;  4M2P A;  2F8P A;  4NDB A;  3IQO A;  4YI9 A;  5I2L A;  2K61 A;  2L51 A;  2V53 A;  1CM4 A;  1MQ1 A;  2F2O A;  3EVV A;  2QPT A;  4QJ5 B;  4M2O A;  1QS7 A;  4I5N B;  1F4O A;  1XFX O;  2JC2 A;  5I8N A;  4GGF A;  3AAK A;  1K93 D;  1NPQ A;  1CFC A;  1L7Z A;  1SCM B;  2CT9 A;  3JTD B;  5J3X A;  1OZO A;  4FQO A;  1F4Q A;  2G2B A;  2H61 C;  3O2P A;  3CLN A;  2JXL A;  2MJW B;  1SL8 A;  2K7D A;  1BR1 B;  1RRO A;  3TZ1 A;  2F3Y A;  2JNF A;  2LNK A;  1W7I B;  2ISD A;  2BL0 B;  4CFR A;  2M8U A;  1EH2 A;  1K96 A;  1X02 A;  1OMV A;  4I5L B;  2KDH A;  5B8I B;  3CR2 A;  2I94 A;  1FPW A;  1IKU A;  1BR4 B;  4HRG A;  2ZNE A;  3NSL A;  4N1F A;  3D0Y B;  1UWO A;  1KK7 Z;  4UPG A;  2KBI A;  1BU3 A;  4CID A;  4MRY A;  2H2K A;  1R6P A;  2BCA A;  2KI6 D;  2JQ6 A;  3NSI A;  1W7J B;  2BE4 A;  3BUN B;  3CZT X;  2Y5I A;  1AP4 A;  1DJY A;  2JT0 A;  2MHH A;  3TUY B;  5ER5 A;  1ALV A;  3BXK A;  5KSZ A;  1YRT B;  1JF0 A;  1CTR A;  3A8R A;  1DGU A;  1J7P A;  1V1G A;  3VRN A;  1DJG A;  3VRO A;  2LMT A;  1KQM C;  3KO0 A;  3A4U B;  3BOW B;  4PHJ A;  4Q04 A;  3SG3 A;  1KK8 B;  2JRF A;  3WNX B;  1ZAC A;  5D7F A;  1RK9 A;  4ZCU A;  1XK4 C;  2I7A A;  2LUC A;  1KWO B;  1RTP 1;  3DVK A;  4TNC A;  3CTN A;  1SK6 D;  3K21 A;  1PAL A;  3MSE B;  3AKB A;  1LA0 A;  1NX0 A;  2A4J A;  5DKR A;  1CMF A;  2IS9 A;  4A4B A;  2LAN A;  2M49 B;  2BCX A;  3I5F C;  4N5X A;  1DF0 B;  1BJF A;  1Y0V H;  4MN0 A;  1DJX A;  4P2Y B;  1MUX A;  1YR5 A;  5AXI A;  1QJT A;  1SMG A;  2L5X B;  1BMO A;  2NCP A;  3EKJ A;  2FOT A;  4CFQ A;  4ETO A;  4GAO A;  1YVH A;  1N0Y A;  1S36 A;  2AMI A;  2HPS A;  1L2O B;  1KQV A;  1NWD A;  2WOS A;  4CPV A;  1F8H A;  3LLE A;  4XJK A;  4PHN A;  1UHJ A;  1OE9 B;  1N2D A;  5JOL A;  2H61 A;  3EK7 A;  1XFU O;  1C7W A;  1MR8 A;  1S3P A;  1YUT A;  2KI6 C;  5PAL A;  1Y1A A;  2HQW A;  3NSK A;  3KHE A;  1U5I A;  1RJV A;  5I2Q A;  1CLL A;  1M31 A;  2KI4 C;  1J55 A;  2JXC A;  2L0P A;  1REC A;  2LMU A;  3GK2 A;  3I5G B;  3LL8 B;  3TS5 C;  3SG2 A;  3CGA A;  1KSM A;  2ZKM X;  5AEQ A;  1K90 D;  1GGW A;  1QTX A;  2F2P A;  4F0Z B;  1ZOT B;  5CSN A;  2MLE C;  5FYX A;  1B7T Y;  2WOR A;  3EK4 A;  1IQ5 A;  1LIN A;  1J1D A;  1KFX L;  1QLK A;  4GNK B;  5K89 A;  1J1E A;  1TNW A;  4PDZ A;  1XA5 A;  3ZWH A;  1B7T Z;  2DOQ A;  4YBH B;  3VRQ A;  4I5K A;  3H4S E;  4I5J A;  2PAS A;  1QAS A;  1AHR A;  3AKA A;  3BUX B;  1TOP A;  2AAO A;  2CXJ A;  4XYN A;  2M1U A;  1BOC A;  3DF0 A;  1SRA A;  1ALW A;  5BPJ A;  2EGD A;  1TNX A;  2CNP A;  1UHK A;  1UHI A;  4R1E A;  5HKY A;  1C07 A;  1XFZ O;  3TDU A;  5JJG A;  2KAX A;  1CM1 A;  1Y6W A;  2M9G A;  3SG5 A;  1JFJ A;  3AAJ A;  1K9P A;  1XK4 A;  4HRE E;  4AQI A;  2HF5 A;  4NDC A;  3DVJ A;  1E8A A;  1PVB A;  2JTZ A;  2Y1N A;  4MZK A;  2M7N A;  5KU1 A;  1QAT A;  2GGM A;  1DVI A;  2NZ0 A;  2TN4 A;  1S26 D;  1NCZ A;  2WND A;  1IRJ A;  3EK8 A;  1QLS A;  1TTX A;  3LK0 A;  1EL4 A;  5GQQ C;  3PM8 A;  2LLS A;  3I5I B;  3C1V A;  4YGC B;  2LVJ A;  1KFU L;  2LV7 A;  1DJI A;  1K95 A;  1QX2 A;  3RM1 A;  1V1F A;  2COL B;  1LVC D;  2JPT A;  1KK7 Y;  1SKT A;  2LVK A;  1SPY A;  3F45 A;  2MLF C;  2K2F A;  4MLW A;  4OKH A;  1ZMZ A;  3O78 A;  1CFD A;  4MRX A;  1SR6 B;  4WQ3 A;  4MBE A;  3TDI A;  4PAL A;  4GBA A;  1TNP A;  1M45 A;  3ICB A;  2R2I A;  3PAT A;  1OOJ A;  2M7L A;  5HYD A;  4PE4 A;  3VRP A;  1C7V A;  2LHL A;  1QVI Y;  1SL9 A;  4ORC B;  1IH0 A;  1CDM A;  2BBN A;  1GJY A;  4YGE B;  1QVI Z;  2LLT A;  3SIA A;  1F55 A;  4XJK B;  4C0K A;  1EJ3 A;  5DKQ A;  3D10 A;  3EKH A;  3I5H C;  2KFH A;  4WQ2 A;  2ZFD A;  4DCK A;  1WRK A;  2LE9 B;  1U5I B;  1SCV A;  3NXA A;  1FI5 A;  1YX7 A;  1B4C A;  1F54 A;  4JQ0 D;  4QJ3 B;  1FBV A;  4ICB A;  2PVB A;  1PRW A;  3PSR A;  1CDP A;  2WCB A;  4OCI A;  1CKK A;  4PHK A;  4PE1 A;  3OP0 A;  1K9K A;  4DRW A;  2KFG A;  2JOJ A;  4DIR A;  5D69 A;  2M1K B;  1L2O C;  3OX6 A;  4YGA A;  2E30 A;  3PAL A;  2Q91 A;  1RWY A;  2O60 A;  4DUQ A;  4USL A;  3EVR A;  2Y1M A;  3EVU A;  3QRX A;  1SW8 A;  2VRG A;  1CFF A;  3PFV A;  3KPX A;  1JWD A;  2BKH B;  1DJH A;  4MZL A;  1ZUZ A;  3WXA A;  1HQV A;  2CTN A;  2K2A A;  4BY5 A;  2OTG C;  4DS7 A;  5CPV A;  1FI6 A;  2G9B A;  1RFJ A;  2MAZ A;  3DD4 A;  1N65 A;  3PN7 C;  1MXL C;  2ZRT A;  3DF0 B;  1TIZ A;  1NSH A;  1DJZ A;  1TCF A;  2LCP A;  2MRD A;  4L9M A;  2SAS A;  2ZN9 A;  1KQM B;  1OMR A;  2KQ6 A;  2ZN8 A;  1XFY O;  2JNX A;  1B1G A;  3CWG A;  4M2Q A;  1H8B A;  1BLQ A;  1JBA A;  2JZI A;  5CSI A;  2OS8 C;  1CB1 A;  3E3R A;  1XFW O;  1PK0 D;  2O5G A;  2L98 A;  1S6J A;  1AVS A;  4JWQ A;  4U8D A;  5AAN A;  1WDC C;  3SJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...