1PULA

Solution structure for the 21kda caenorhabditis elegans protein ce32e8.3. northeast structural genomics consortium target wr33
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
b'NWDDADVKKRWDAFTKFGAATATEMTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKVLAFVAEDRARQSKKPIQDELDAITEKLAKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein C32E8.3 in chromosome I
publication title Backbone 1H, 15N and 13C assignments for the 21 kDa Caenorhabditis elegans homologue of "brain-specific" protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 30
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2003-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pulA00
3TS5B 4QJ4B 4C0KA 2I18A 5HKYA 1B9AA 1DF0A 5G08A 4CFRA 1WLZA 3E3RA 1BMOA 3LK0A 1CDMA 3M0WA 5JOLA 2K8MB 5DKRA 1WRLA 1WY9A 2GGMA 3I5GC 4MVFA 1NIWA 3O4YA 1UHIA 4DIRA 1F54A 1PALA 1RECA 3EVVA 1TN4A 1L2OB 5CPVA 2F2OA 3WNXB 1GJYA 1YUTA 2KAVA 5HYDA 3VRRA 4USLA 3AKAA 1XA5A 3AAKA 1SL7A 3NSKA 1YRTB 3LLEA 1JF2A 1H8BA 1TNQA 3SG7A 1OZSA 1C7WA 1S5GZ 1XFUO 4YBHB 1HT9A 2FCEA 1CFDA 1R6PA 1XFXO 1UWOA 2KQ6A 2O60A 1MF8B 1RROA 1TIZA 2F8PA 1UHHA 2LMVA 2CXJA 3EVRA 1XFYO 3O6BA 1H4BA 1CB1A 3TDUA 2M7LA 5IBWA 1NCZA 2LLSA 1TRFA 1LKJA 1PK0D 3BQ3A 3PATA 2ISDA 1CKKA 4QJ3B 1G8IA 2I7AA 1B1GA 3KHEA 2LANA 3DVMA 4F0ZB 1ZMZA 2WCBA 3AAJA 1CMGA 2LVKA 1SCVA 5B8IB 3K21A 2JWWA 1YVLA 2L50A 1MUXA 3ZWHA 1IGVA 3WHTB 1PVBA 1CLBA 1YTZC 2I94A 1V1GA 3FWCA 2LHLA 2LP2A 4GGFA 1SW8A 3SG6A 2M97A 1QIWA 2KSPA 1UP5A 1A4PA 3QRXA 1K95A 1KK8B 3JVTB 4XJKA 3CR5X 1OMDA 4ETOA 1FBVA 5D7FA 2ZRTA 2EC6B 2SCPA 5AANA 1EXRA 1MWNA 4HREE 3NSLA 2KI6D 4I5NB 5D69A 1BT6A 1JWDA 2ZKMX 1ALVA 1M31A 2K7CA 2JNXA 1A75A 1SR6B 1YRUB 1QV0A 1ZACA 2M1KB 3PFVA 1SPYA 1AHRA 4GAOA 1Y1XA 2L2EA 1DTLA 3CS1A 1XK4A 2K7BA 3BUWB 1JUOA 1K9KA 3PLFB 4CIDA 2G2BA 3I5IC 1VRKA 1F4QA 1S6JA 2M1UA 2AUCA 4GFTA 4YGBB 4PALA 1QVIY 5ER5A 1K90D 5AEQA 2LP3A 1KSMA 1AP4A 3HCMA 2LC5A 4MBEA 1LINA 2BCXA 2BKIB 2F3YA 1KFXS 1KK7Z 3HX4A 2PSRA 2M29A 4OV2A 5HLOA 4A4BA 4C0LA 1CDLA 1CLLA 1FW4A 1XFWO 2KBIA 1A2XA 1UHNA 5TNCA 1NX1A 4YRUA 1ODBA 1S3PA 4WRIA 2LAPA 4N1FA 4ORCB 4PE0A 4PHKA 2JXLA 4M2QA 1NUBA 1OZOA 2Y1NA 3PALA 1TCFA 2K2AA 1F70A 2AAOA 2NXQA 4NDCA 1NPQA 3KPXA 2JTZA 2KGBC 2JPTA 1HQVA 1TOPA 2MLFC 1W7IB 3CWGA 4PHMA 1F71A 1BOCA 1QXPA 1SL9A 3BUNB 1XK4C 1M63B 1SKTA 3DF0A 1CM4A 2NCOA 1SRAA 1J55A 2BCBA 1K93D 1YUUA 2BBNA 2KFFA 1DVIA 2BKHB 1B8CA 1QX7A 3BUMB 1NYAA 2EGDA 4N5XA 2K7OA 1GGZA 4OCIA 1NX3A 3SIBA 2KNEA 3NSOA 3CTNA 3IQOA 1CTRA 2M3WA 3OHMB 4DRWA 1A03A 2WCEA 4JPZB 5FYXA 2KHNA 1R2UA 4QJ5B 2L5XB 2RGIA 1QX2A 1S26D 1KQVA 1Y1AA 2L4IA 1SCMB 1G4YR 3KO0A 4PDZA 2PASA 2SASA 1B8RA 2FCDA 2KI6C 2JZIA 2L51A 3BYAA 1E8AA 1WDCC 4ZCUA 1B4CA 1DJGA 2LM5A 3FS7A 1J1DA 4FTGA 1KK7Y 1KQMB 1NX2A 1QS7A 2CBLA 3EKJA 4I5JA 2OTGC 3GK2A 2FJUB 2KQYA 2L0PA 3TUYC 5DKNA 2LMTA 1QTXA 1QV1A 3WHUB 2OS8C 2CNPA 1QVIZ 2ZNDA 1CFCA 1KFUL 5CSIA 1YX8A 1OSAA 2JT0A 4XYNA 3VGOA 2K2FA 2R2IA 5K89A 4AQJA 5BPJA 1D1OA 4PE1A 1UHJA 2F2PA 3I5FB 2H2KA 3I5IB 4UPGA 1NSHA 2JOJA 4MZJA 1OMVA 4MN0A 5AXIA 3DD4A 2LLTA 4YGDB 1QATA 2ZN8A 1N2DA 1ZUZA 1XFVO 2KOTA 1TNWA 3EK4A 3KF9A 1BLQA 4MZKA 2M49B 4PE4A 4PE7A 1K2HA 3SJSA 3I5HB 1TCOB 1B7TY 2KDHA 1AJ4A 1KCYA 3CR2A 1ZOTB 2TN4A 3LL8B 1JSAA 3OX6A 3C1VA 4WQ2A 4OR9B 3NXAA 4JWQA 4ORAB 2LVJA 3LK1A 2B1UA 4I5KA 1F8HA 3F45A 1IRJA 3ZNIA 1EJ3A 1CFPA 3EKHA 2E6WA 4AQIA 1IWQA 1AUIB 3BOWB 3PSRA 4M2OA 1B8LA 5GQQC 1QLKA 4MSPA 4ORBB 3OB2B 2E30A 1OMRA 2QPTA 3VRQA 2M0RA 1IQ3A 1IJ6A 1CDPA 2JC2A 3OX5A 4GGFC 1TNPA 2KAXA 2BE6A 2PRUA 4GNKB 2BCAA 2BBMA 2Y4QA 1DJXA 4ZCVA 1UHKA 2K61A 1L7ZA 2HPSA 3GK4X 2KI4C 4PCWA 1ZFSA 2MAZA 3D0YB 4IL1A 5HLVA 4DUQA 1PVAA 1NX0A 3I5GB 4PHNA 3BUXB 1OE9B 4OKHA 1FPWA 2HQ8A 1S36A 4P2YB 1IJ5A 1DJYA 2H61A 3DVEA 3OB1B 1RWYA 2ZNEA 1YURA 1MQ1A 2F3ZA 5KU1A 1MHOA 2M7NA 3A4UB 4MRYA 2NZ0A 3TDIA 1WDCB 1DGUA 2O5GA 1QJTA 1N0YA 1KWOC 1YVHA 2JNFA 4YI9A 1U5IA 3MSEB 1K9PA 1GQMA 2CT9A 1AVSA 1BR4B 1B47A 4ICBA 3SG3A 4CLNA 2LCPA 4MRXA 2MA2A 4GGNA 1NCYA 2OTGB 2KBMA 3GOFA 1FF1A 2CCMA 3A8RA 2VRGA 1FI5A 3KEVA 2KGRA 2LV7A 1M46A 2NLNA 2LUCA 1OQPA 2F33A 1IH0A 1XVJA 2JRFA 2OPOA 2LUXA 3EVUA 3IF7A 1SNLA 1GGWA 2OS8B 4GBAA 1DGVA 1BODA 1ALWA 2BECA 1DF0B 1LXFC 3VRPA 3CLNA 4YI8A 1CFFA 1DJHA 3JTDC 1MXLC 1B7TZ 5CSFA 3SG4A 1JF0A 1MXEA 1LA3A 2MLEC 1CM1A 4DCKA 2GV5A 2D8NA 4TNCA 2H61C 1SBJA 3AKBA 2BE4A 3FWBA 2LE9B 3EK7A 1QIVA 1SL8A 2AMIA 5HKWA 4HRGA 4L9MA 2LVVA 2WC8A 2FOTA 2KAYA 3PN7C 4MEWA 1IQ5A 2M9GA 1C7VA 4GPLB 2DOQA 1AK8A 1Q80A 4MLWA 2ZRSA 2BL0C 2GGZA 1J7QA 1J1EA 1LA0A 2JU0A 1YUSA 2P6BB 4D1EA 2JQ6A 1PSBA 1J7PA 2JXCA 2QACA 5I2QA 2LMUA 3SIAA 4E68A 4YGCB 3WXAA 1W7JB 1SMGA 1J7OA 4FQOA 1K8UA 2MBXA 1EG4A 5DKQA 5CSJA 1BR1B 1YR5A 4M2PA 2KFGA 1WLMA 1DJWA 2JULA 4U8DA 3TS5C 2LLUA 1S1EA 1WRKA 1WRZA 2Y1MA 1EL4A 4N1GA 5CSNA 1XFZO 4CPVA 1J7RA 4NDDA 3VRNA 4C0JA 1F55A 1Y1UA 2HF5A 2WNDA 2ZN9A 4YGEB 3SG5A 3OP0A 3IQQA 2HQWA 2MJWB 4XJKB 1PULA 1L2OC 2KI4B 2ZFDA 1SCMC 3DVKA 2JT8A 3EK8A 3VROA 3SG2A 1RK9A 2WOSA 1XO5A 3TZ1A 1QLSA 1Y6WA 2IS9A 2KFHA 1KFXL 1RFJA 1KQMC 4HSZA 3LCPC 1DJZA 4I5LB 1UUSA 1V1FA 2M8UA 4NQGA 5I8NA 4R1EA 5KTYA 1AJ5A 2PMYA 1X02A 1A75B 4CFQA 1K9UA 3O2PA 1KWOB 1JC2A 1KFUS 2JT3A 3H4SE 1DJIA 2HETA 5J3XA 1IG5A 1OOJA 2K0JA 2Y5IA 1S6CA 2LVIA 5AERA 1CNPA 1SK6D 1A29A 1CLMA 2PVBA 2Q4UA 1F4OA 5KSZA 1RJVA 1BJFA 4YGAA 1Y0VH 3BOWA 2V53A 1S5GY 1KSOA 1PSRA 4BY5A 1C07A 1EG3A 2LHIA 5I2LA 1XYDA 3CZTX 2NCPA 1PRWA 1DT7B 2L4HA 2COLB 2LNKA 1UURA 1NWDA 2EHBA 3BXKA 1NP8A 3I5FC 1TTXA 3BUOB 3JTDB 4PHJA 5F6TA 1LVCD 1TNXA 3GK1A 3RM1A 1NCXA 1QASA 1M39A 2CTNA 3TDZA 1DMOA 3O78A 1SY9A 2I2RE 3ICBA 4AOMA 5I2OA 2G9BA 1K94A 1YX7A 1BG1A 1SYMA 5HKZA 1KK8C 3JVTC 1FI6A 4WQ3A 3D0YA 3I5HC 1EH2A 1QX5B 3CR4X 2A4JA 2EC6C 2WORA 3D10A 3PN7B 1JBAA 1S6IA 1U5IB 5PALA 2L98A 1BU3A 4OVNF 4P5OE 2Q91A 1G33A 3TUYB 2BL0B 2JTTA 1M45A 3DVJA 5ER4X 3DF0B 1K96A 4GUKA 4BY4A 3FIAA 1SR6C 1BF5A 2MRDA 3NSIA 4HRHA 4A4CA 5AFPA 1CMFA 2K7DA 1JFJA 1N65A 4JQ0D 1CDNA 2MHHA 3CGAA 2PALA 1JFKA 4MZLA 4NDBA 2WCFA 1MR8A 1RTP1 3RLZA 4Q04A 2KYFA 2KYCA 5JJGA 1IKUA 4DS7A 3PM8A
chains in the Genus database with same CATH superfamily
3TS5B 4QJ4B 1TWOA 3CABA 4C0KA 2I18A 5HKYA 1B9AA 1DF0A 5G08A 4CFRA 1WLZA 3E3RA 1BMOA 3LK0A 1CDMA 3M0WA 5JOLA 2K8MB 5DKRA 1WRLA 1WY9A 2GGMA 3I5GC 4MVFA 1NIWA 3O4YA 4JD9A 1UHIA 3CZ2A 4DIRA 1F54A 1PALA 1RECA 3EVVA 1TN4A 1L2OB 5CPVA 2F2OA 3WNXB 1GJYA 1YUTA 2KAVA 5HYDA 3VRRA 4USLA 3AKAA 1XA5A 3AAKA 2L2CA 1SL7A 3NSKA 1YRTB 3LLEA 1JF2A 1H8BA 1TNQA 3S0EA 3SG7A 1OZSA 1C7WA 3BJHA 1S5GZ 1XFUO 4YBHB 1HT9A 2FCEA 1CFDA 1R6PA 1XFXO 1UWOA 2KQ6A 2O60A 1MF8B 1RROA 1TIZA 2F8PA 1UHHA 2LMVA 2CXJA 3EVRA 1XFYO 3O6BA 1H4BA 1CB1A 3TDUA 2M7LA 5IBWA 1NCZA 5D3OA 2LLSA 1TRFA 1LKJA 1PK0D 3BQ3A 3PATA 2ISDA 1CKKA 4QJ3B 1G8IA 2I7AA 1B1GA 3KHEA 2LANA 3DVMA 4F0ZB 1ZMZA 2WCBA 3AAJA 5FI6A 1CMGA 2LVKA 1SCVA 5B8IB 2QEBA 1DC1A 3K21A 2JWWA 1YVLA 3BFBA 2L50A 3D74A 1MUXA 3DZTA 3ZWHA 1IGVA 3WHTB 1PVBA 1CLBA 1YTZC 2I94A 1V1GA 3FWCA 2LHLA 2LP2A 3NHIA 4GGFA 1SW8A 3SG6A 2M97A 1QIWA 2KSPA 1UP5A 1A4PA 3QRXA 1K95A 1KK8B 3JVTB 4XJKA 3CR5X 1OMDA 4ETOA 1FBVA 1LS8A 2ZRTA 3O4XA 5D7FA 2EC6B 2SCPA 5AANA 1EXRA 3UO9A 1MWNA 1IIOA 4HREE 3DYEA 3NSLA 2KI6D 4I5NB 5D69A 1BT6A 1JWDA 2ZKMX 1ALVA 3D77A 1M31A 2K7CA 2JNXA 1A75A 3B87A 1SR6B 1YRUB 1QV0A 1ZACA 2M1KB 3PFVA 1SPYA 3D75A 1AHRA 4GAOA 2WC6A 1Y1XA 2L2EA 1DTLA 3CS1A 1XK4A 2K7BA 3BUWB 1JUOA 1K9KA 3PLFB 4CIDA 2G2BA 3I5IC 1VRKA 1F4QA 1S6JA 2M1UA 2AUCA 4GFTA 4YGBB 4PALA 1QVIY 5ER5A 3PM2A 1K90D 5AEQA 2LP3A 1KSMA 4OZDA 3HCMA 2LC5A 3B88A 1AP4A 4MBEA 1LINA 2BCXA 2BKIB 2F3YA 1KFXS 1KK7Z 3HX4A 2PSRA 2M29A 4OV2A 5HLOA 4A4BA 3Q8IA 1CDLA 4C0LA 1CLLA 1FW4A 1XFWO 2KBIA 1A2XA 1UHNA 5TNCA 1NX1A 4YRUA 1ODBA 1S3PA 4WRIA 3DXLA 2LAPA 4N1FA 4ORCB 4PE0A 4PHKA 2JXLA 4M2QA 1NUBA 1DQEA 1OZOA 2Y1NA 3PALA 1TCFA 2K2AA 1F70A 2AAOA 2NXQA 4NDCA 1NPQA 3KPXA 2JTZA 2KGBC 2JPTA 2L5YA 1HQVA 1TOPA 3SS4A 2MLFC 1W7IB 2H8VA 3QMEA 3CWGA 4PHMA 1F71A 1BOCA 1QXPA 1SL9A 1QWVA 3BUNB 1XK4C 1M63B 1P28A 1SKTA 1W9ZA 3DF0A 1CM4A 2NCOA 1SRAA 1J55A 1YUUA 1K93D 2BBNA 2BCBA 2KFFA 2WCMA 1DVIA 2BKHB 1B8CA 1QX7A 3BUMB 1NYAA 2EGDA 4N5XA 2K7OA 3V2LA 1GGZA 4OCIA 1NX3A 3SIBA 2KNEA 3NSOA 3CTNA 3IQOA 1CTRA 2M3WA 3OHMB 5FI7A 4DRWA 1A03A 2WCEA 4JPZB 5FYXA 2KHNA 1R2UA 4QJ5B 2L5XB 2RGIA 1QX2A 1S26D 1KQVA 1Y1AA 2L4IA 1SCMB 1G4YR 3KO0A 4PDZA 2PASA 2SASA 3EG5B 1B8RA 2FCDA 2KI6C 2JZIA 2L51A 3BYAA 2WC5A 1E8AA 1WDCC 4ZCUA 1B4CA 1DJGA 2LM5A 3FS7A 1J1DA 4FTGA 1KK7Y 1KQMB 1NX2A 1QS7A 2CBLA 5DICA 3EKJA 4I5JA 2OTGC 3GK2A 4INXA 2FJUB 2KQYA 2L0PA 3BFHA 3TUYC 3R72A 5DKNA 2LMTA 1QTXA 1QV1A 3NHTA 3WHUB 2OS8C 2CNPA 1QVIZ 3D78A 2ZNDA 1CFCA 1KFUL 5CSIA 1YX8A 1OSAA 2JT0A 4XYNA 3VGOA 2K2FA 3FE6A 2R2IA 5K89A 4AQJA 5BPJA 1D1OA 1SSEB 4PE1A 1UHJA 2F2PA 3I5FB 2WCHA 2H2KA 3I5IB 4UPGA 1NSHA 2JOJA 2QEHA 4MZJA 1OMVA 4MN0A 5AXIA 3DD4A 2LLTA 4YGDB 1QATA 2ZN8A 1N2DA 1ZUZA 1XFVO 3S0BA 4KYNA 2KOTA 1TNWA 3EK4A 3KF9A 1BLQA 4MZKA 2M49B 4PE4A 4PE7A 1K2HA 3FE9A 3I5HB 3SJSA 1TCOB 1B7TY 2KDHA 3SS5A 1AJ4A 1KCYA 3CR2A 1ZOTB 2TN4A 1XFRA 2P70A 3LL8B 3L4AA 4JKTA 3OGNA 3OX6A 1JSAA 3C1VA 4WQ2A 4OR9B 3NXAA 4JWQA 4ORAB 2LVJA 3D73A 3LK1A 2B1UA 4I5KA 1F8HA 3F45A 1IRJA 3ZNIA 1EJ3A 1CFPA 3EKHA 2E6WA 4AQIA 4FQTA 1GM0A 1IWQA 1AUIB 3BOWB 3PSRA 4M2OA 3IVTA 2KPHA 1B8LA 1ORGA 3R1OA 2WCKA 5GQQC 1QLKA 1OOGA 4MSPA 2JPOA 4ORBB 3OB2B 2E30A 1OMRA 2QPTA 3R1VA 2WCLA 2M0RA 3VRQA 1IQ3A 3FE8A 1IJ6A 4IJ7A 1CDPA 2JC2A 3OX5A 4GGFC 1TNPA 2KAXA 2BE6A 2GTEA 2PRUA 4GNKB 2BCAA 2BBMA 2FJYA 1DJXA 2Y4QA 4ZCVA 1UHKA 3L4LA 2K61A 1L7ZA 2HPSA 3GK4X 2KI4C 4PCWA 1ZFSA 2MAZA 3D0YB 4IL1A 5HLVA 4DUQA 1PVAA 1NX0A 1Z4HA 3I5GB 3BUXB 4PHNA 1OE9B 2KLDA 4OKHA 1FPWA 2HQ8A 1S36A 4P2YB 1IJ5A 1DJYA 2H61A 3DVEA 1C3ZA 3OB1B 1RWYA 2ZNEA 1YURA 1MQ1A 2F3ZA 5KU1A 1MHOA 2M7NA 3A4UB 4MRYA 2NZ0A 3TDIA 1WDCB 1DGUA 2O5GA 1QJTA 1N0YA 1KWOC 1YVHA 2JNFA 3NGVA 4YI9A 1U5IA 3MSEB 1K9PA 1GQMA 2CT9A 1AVSA 1BR4B 1B47A 4ICBA 3SG3A 4CLNA 2LCPA 4MRXA 2MA2A 4GGNA 1NCYA 2OTGB 1OOHA 3S0FA 2QEOA 3PJIA 2KBMA 3GOFA 1FF1A 2CCMA 3A8RA 2VRGA 1FI5A 3KEVA 2KGRA 3CZ0A 2LV7A 1M46A 2NLNA 2LUCA 1OQPA 2F33A 1IH0A 1XVJA 2JRFA 3B6XA 2OPOA 2LUXA 3EVUA 3IF7A 1SNLA 1GGWA 2OS8B 4GBAA 1DGVA 1BODA 1ALWA 2BECA 1DF0B 1LXFC 3D76A 3VRPA 3R1PA 1T14A 3CLNA 4YI8A 1CFFA 1DJHA 2PQLA 3JTDC 3DY9A 1MXLC 1B7TZ 5CSFA 3SG4A 1JF0A 1MXEA 1LA3A 2MLEC 1CM1A 4DCKA 2GV5A 2D8NA 4TNCA 2H61C 1SBJA 3AKBA 2BE4A 3FWBA 2LE9B 3EK7A 1QIVA 1SL8A 2AMIA 1Z2CB 4HRGA 5HKWA 4L9MA 2LVVA 2WC8A 3S0AA 2FOTA 3K1EA 2KAYA 3PN7C 1TUZA 4MEWA 1IQ5A 2M9GA 1C7VA 4GPLB 2DOQA 1AK8A 1Q80A 4MLWA 2ZRSA 2BL0C 2GGZA 1J7QA 1J1EA 1LA0A 2JU0A 1YUSA 2P6BB 4D1EA 2JQ6A 1PSBA 1J7PA 2JXCA 2QACA 5I2QA 2LMUA 3SIAA 4E68A 4YGCB 3WXAA 1W7JB 1SMGA 1J7OA 4FQOA 1K8UA 2MBXA 1EG4A 5DKQA 1OOFA 5CSJA 1BR1B 1YR5A 2WCJA 3B86A 4M2PA 2KFGA 1WLMA 1DJWA 2JULA 4U8DA 3TS5C 2LLUA 1S1EA 1WRKA 4PT1A 1WRZA 2Y1MA 1EL4A 1OW4A 4N1GA 5CSNA 1XFZO 4CPVA 1J7RA 4NDDA 3VRNA 4C0JA 1F55A 1Y1UA 2HF5A 2WNDA 2ZN9A 2ERBA 4YGEB 3SG5A 3OP0A 3IQQA 3S0DA 2HQWA 2MJWB 4XJKB 1PULA 1L2OC 2KI4B 2ZFDA 1SCMC 3DVKA 3CZ1A 2JT8A 3EK8A 3VROA 3SG2A 1RK9A 2WOSA 1XO5A 3TZ1A 1QLSA 1Y6WA 3VB1A 2IS9A 2KFHA 1KFXL 5HL1A 1RFJA 1KQMC 4HSZA 3LCPC 1DJZA 4I5LB 1UUSA 1V1FA 2M8UA 4NQGA 5I8NA 4R1EA 5KTYA 1AJ5A 2PMYA 1X02A 1A75B 4CFQA 1K9UA 3O2PA 1KWOB 1JC2A 1KFUS 2JT3A 3H4SE 1DJIA 2HETA 5J3XA 1IG5A 1OOJA 2K0JA 2Y5IA 1S6CA 2LVIA 5AERA 1CNPA 3SS3A 1SK6D 1A29A 1CLMA 2PVBA 2Q4UA 1F4OA 5KSZA 1RJVA 1BJFA 3B7AA 1Y0VH 3BOWA 2V53A 1S5GY 4YGAA 1KSOA 3S0GA 1PSRA 4BY5A 1C07A 1EG3A 2LHIA 5I2LA 1XYDA 3CZTX 2NCPA 1PRWA 1DELA 1DT7B 2L4HA 2COLB 2LNKA 1UURA 3UNWA 1NWDA 2EHBA 3BXKA 1NP8A 1TUJA 3I5FC 1TTXA 3BUOB 3CYZA 3JTDB 4PHJA 1LVCD 1TNXA 5F6TA 5FI2A 3GK1A 3RM1A 4F7FA 5I94A 1NCXA 1QASA 1M39A 2CTNA 3TDZA 1DMOA 3O78A 1SY9A 2K60A 2I2RE 2KLEA 2QEVA 3ICBA 4AOMA 5I2OA 2G9BA 1K94A 5EL2A 1YX7A 1BG1A 1SYMA 5HKZA 1KK8C 1OOIX 3JVTC 1FI6A 4WQ3A 3D0YA 3I5HC 1EH2A 1QX5B 3CR4X 2A4JA 2EC6C 2WORA 2PYQA 3D10A 3PN7B 1JBAA 3BFAA 1S6IA 1U5IB 5PALA 3CDNA 2L98A 1C3YA 1BU3A 4OVNF 4P5OE 1DEKA 2QDIA 4INWA 2Q91A 1G33A 3TUYB 2BL0B 2JTTA 1M45A 2P71A 3DVJA 3DF0B 5ER4X 1K96A 4GUKA 4BY4A 3FIAA 1SR6C 1BF5A 2MRDA 3NSIA 4HRHA 4A4CA 5AFPA 1CMFA 2K7DA 1JFJA 1N65A 4JQ0D 1CDNA 2MHHA 3CGAA 2PALA 1JFKA 4MZLA 4NDBA 3N7HA 2WCFA 2BAPA 1MR8A 3L47A 3RZSA 1RTP1 3RLZA 4Q04A 2KYFA 2KYCA 2BNXA 5JJGA 1IKUA 3OBVA 4DS7A 2YGUA 3PM8A
chains in the Genus database with same CATH topology
3TS5B 4QJ4B 4C0KA 2I18A 5HKYA 1B9AA 1DF0A 5G08A 4CFRA 1WLZA 3E3RA 1BMOA 3LK0A 1CDMA 3M0WA 5JOLA 2K8MB 5DKRA 1WRLA 1WY9A 2GGMA 3I5GC 4MVFA 1NIWA 3O4YA 1UHIA 4DIRA 1F54A 1PALA 1RECA 3EVVA 1TN4A 1L2OB 5CPVA 2F2OA 3WNXB 1GJYA 1YUTA 2KAVA 5HYDA 3VRRA 4USLA 3AKAA 1XA5A 3AAKA 1SL7A 3NSKA 1YRTB 3LLEA 1JF2A 1H8BA 1TNQA 3SG7A 1OZSA 1C7WA 1S5GZ 1XFUO 4YBHB 1HT9A 2FCEA 1CFDA 1R6PA 1XFXO 1UWOA 2KQ6A 2O60A 1MF8B 1RROA 1TIZA 2F8PA 1UHHA 2LMVA 2CXJA 3EVRA 1XFYO 3O6BA 1H4BA 1CB1A 3TDUA 2M7LA 5IBWA 1NCZA 2LLSA 1TRFA 1LKJA 1PK0D 3BQ3A 3PATA 2ISDA 1CKKA 4QJ3B 1G8IA 2I7AA 1B1GA 3KHEA 2LANA 3DVMA 4F0ZB 1ZMZA 2WCBA 3AAJA 1CMGA 2LVKA 1SCVA 5B8IB 3K21A 2JWWA 1YVLA 2L50A 1MUXA 3ZWHA 1IGVA 3WHTB 1PVBA 1CLBA 1YTZC 2I94A 1V1GA 3FWCA 2LHLA 2LP2A 4GGFA 1SW8A 3SG6A 2M97A 1QIWA 2KSPA 1UP5A 1A4PA 3QRXA 1K95A 1KK8B 3JVTB 4XJKA 3CR5X 1OMDA 4ETOA 1FBVA 5D7FA 2ZRTA 2EC6B 2SCPA 5AANA 1EXRA 1MWNA 4HREE 3NSLA 2KI6D 4I5NB 5D69A 1BT6A 1JWDA 2ZKMX 1ALVA 1M31A 2K7CA 2JNXA 1A75A 1SR6B 1YRUB 1QV0A 1ZACA 2M1KB 3PFVA 1SPYA 1AHRA 4GAOA 1Y1XA 2L2EA 1DTLA 3CS1A 1XK4A 2K7BA 3BUWB 1JUOA 1K9KA 3PLFB 4CIDA 2G2BA 3I5IC 1VRKA 1F4QA 1S6JA 2M1UA 2AUCA 4GFTA 4YGBB 4PALA 1QVIY 5ER5A 1K90D 5AEQA 2LP3A 1KSMA 1AP4A 3HCMA 2LC5A 4MBEA 1LINA 2BCXA 2BKIB 2F3YA 1KFXS 1KK7Z 3HX4A 2PSRA 2M29A 4OV2A 5HLOA 4A4BA 4C0LA 1CDLA 1CLLA 1FW4A 1XFWO 2KBIA 1A2XA 1UHNA 5TNCA 1NX1A 4YRUA 1ODBA 1S3PA 4WRIA 2LAPA 4N1FA 4ORCB 4PE0A 4PHKA 2JXLA 4M2QA 1NUBA 1OZOA 2Y1NA 3PALA 1TCFA 2K2AA 1F70A 2AAOA 2NXQA 4NDCA 1NPQA 3KPXA 2JTZA 2KGBC 2JPTA 1HQVA 1TOPA 2MLFC 1W7IB 3CWGA 4PHMA 1F71A 1BOCA 1QXPA 1SL9A 3BUNB 1XK4C 1M63B 1SKTA 3DF0A 1CM4A 2NCOA 1SRAA 1J55A 2BCBA 1K93D 1YUUA 2BBNA 2KFFA 1DVIA 2BKHB 1B8CA 1QX7A 3BUMB 1NYAA 2EGDA 4N5XA 2K7OA 1GGZA 4OCIA 1NX3A 3SIBA 2KNEA 3NSOA 3CTNA 3IQOA 1CTRA 2M3WA 3OHMB 4DRWA 1A03A 2WCEA 4JPZB 5FYXA 2KHNA 1R2UA 4QJ5B 2L5XB 2RGIA 1QX2A 1S26D 1KQVA 1Y1AA 2L4IA 1SCMB 1G4YR 3KO0A 4PDZA 2PASA 2SASA 1B8RA 2FCDA 2KI6C 2JZIA 2L51A 3BYAA 1E8AA 1WDCC 4ZCUA 1B4CA 1DJGA 2LM5A 3FS7A 1J1DA 4FTGA 1KK7Y 1KQMB 1NX2A 1QS7A 2CBLA 3EKJA 4I5JA 2OTGC 3GK2A 2FJUB 2KQYA 2L0PA 3TUYC 5DKNA 2LMTA 1QTXA 1QV1A 3WHUB 2OS8C 2CNPA 1QVIZ 2ZNDA 1CFCA 1KFUL 5CSIA 1YX8A 1OSAA 2JT0A 4XYNA 3VGOA 2K2FA 2R2IA 5K89A 4AQJA 5BPJA 1D1OA 4PE1A 1UHJA 2F2PA 3I5FB 2H2KA 3I5IB 4UPGA 1NSHA 2JOJA 4MZJA 1OMVA 4MN0A 5AXIA 3DD4A 2LLTA 4YGDB 1QATA 2ZN8A 1N2DA 1ZUZA 1XFVO 2KOTA 1TNWA 3EK4A 3KF9A 1BLQA 4MZKA 2M49B 4PE4A 4PE7A 1K2HA 3SJSA 3I5HB 1TCOB 1B7TY 2KDHA 1AJ4A 1KCYA 3CR2A 1ZOTB 2TN4A 3LL8B 1JSAA 3OX6A 3C1VA 4WQ2A 4OR9B 3NXAA 4JWQA 4ORAB 2LVJA 3LK1A 2B1UA 4I5KA 1F8HA 3F45A 1IRJA 3ZNIA 1EJ3A 1CFPA 3EKHA 2E6WA 4AQIA 1IWQA 1AUIB 3BOWB 3PSRA 4M2OA 1B8LA 5GQQC 1QLKA 4MSPA 4ORBB 3OB2B 2E30A 1OMRA 2QPTA 3VRQA 2M0RA 1IQ3A 1IJ6A 1CDPA 2JC2A 3OX5A 4GGFC 1TNPA 2KAXA 2BE6A 2PRUA 4GNKB 2BCAA 2BBMA 2Y4QA 1DJXA 4ZCVA 1UHKA 2K61A 1L7ZA 2HPSA 3GK4X 2KI4C 4PCWA 1ZFSA 2MAZA 3D0YB 4IL1A 5HLVA 4DUQA 1PVAA 1NX0A 3I5GB 4PHNA 3BUXB 1OE9B 4OKHA 1FPWA 2HQ8A 1S36A 4P2YB 1IJ5A 1DJYA 2H61A 3DVEA 3OB1B 1RWYA 2ZNEA 1YURA 1MQ1A 2F3ZA 5KU1A 1MHOA 2M7NA 3A4UB 4MRYA 2NZ0A 3TDIA 1WDCB 1DGUA 2O5GA 1QJTA 1N0YA 1KWOC 1YVHA 2JNFA 4YI9A 1U5IA 3MSEB 1K9PA 1GQMA 2CT9A 1AVSA 1BR4B 1B47A 4ICBA 3SG3A 4CLNA 2LCPA 4MRXA 2MA2A 4GGNA 1NCYA 2OTGB 2KBMA 3GOFA 1FF1A 2CCMA 3A8RA 2VRGA 1FI5A 3KEVA 2KGRA 2LV7A 1M46A 2NLNA 2LUCA 1OQPA 2F33A 1IH0A 1XVJA 2JRFA 2OPOA 2LUXA 3EVUA 3IF7A 1SNLA 1GGWA 2OS8B 4GBAA 1DGVA 1BODA 1ALWA 2BECA 1DF0B 1LXFC 3VRPA 3CLNA 4YI8A 1CFFA 1DJHA 3JTDC 1MXLC 1B7TZ 5CSFA 3SG4A 1JF0A 1MXEA 1LA3A 2MLEC 1CM1A 4DCKA 2GV5A 2D8NA 4TNCA 2H61C 1SBJA 3AKBA 2BE4A 3FWBA 2LE9B 3EK7A 1QIVA 1SL8A 2AMIA 5HKWA 4HRGA 4L9MA 2LVVA 2WC8A 2FOTA 2KAYA 3PN7C 4MEWA 1IQ5A 2M9GA 1C7VA 4GPLB 2DOQA 1AK8A 1Q80A 4MLWA 2ZRSA 2BL0C 2GGZA 1J7QA 1J1EA 1LA0A 2JU0A 1YUSA 2P6BB 4D1EA 2JQ6A 1PSBA 1J7PA 2JXCA 2QACA 5I2QA 2LMUA 3SIAA 4E68A 4YGCB 3WXAA 1W7JB 1SMGA 1J7OA 4FQOA 1K8UA 2MBXA 1EG4A 5DKQA 5CSJA 1BR1B 1YR5A 4M2PA 2KFGA 1WLMA 1DJWA 2JULA 4U8DA 3TS5C 2LLUA 1S1EA 1WRKA 1WRZA 2Y1MA 1EL4A 4N1GA 5CSNA 1XFZO 4CPVA 1J7RA 4NDDA 3VRNA 4C0JA 1F55A 1Y1UA 2HF5A 2WNDA 2ZN9A 4YGEB 3SG5A 3OP0A 3IQQA 2HQWA 2MJWB 4XJKB 1PULA 1L2OC 2KI4B 2ZFDA 1SCMC 3DVKA 2JT8A 3EK8A 3VROA 3SG2A 1RK9A 2WOSA 1XO5A 3TZ1A 1QLSA 1Y6WA 2IS9A 2KFHA 1KFXL 1RFJA 1KQMC 4HSZA 3LCPC 1DJZA 4I5LB 1UUSA 1V1FA 2M8UA 4NQGA 5I8NA 4R1EA 5KTYA 1AJ5A 2PMYA 1X02A 1A75B 4CFQA 1K9UA 3O2PA 1KWOB 1JC2A 1KFUS 2JT3A 3H4SE 1DJIA 2HETA 5J3XA 1IG5A 1OOJA 2K0JA 2Y5IA 1S6CA 2LVIA 5AERA 1CNPA 1SK6D 1A29A 1CLMA 2PVBA 2Q4UA 1F4OA 5KSZA 1RJVA 1BJFA 4YGAA 1Y0VH 3BOWA 2V53A 1S5GY 1KSOA 1PSRA 4BY5A 1C07A 1EG3A 2LHIA 5I2LA 1XYDA 3CZTX 2NCPA 1PRWA 1DT7B 2L4HA 2COLB 2LNKA 1UURA 1NWDA 2EHBA 3BXKA 1NP8A 3I5FC 1TTXA 3BUOB 3JTDB 4PHJA 5F6TA 1LVCD 1TNXA 3GK1A 3RM1A 1NCXA 1QASA 1M39A 2CTNA 3TDZA 1DMOA 3O78A 1SY9A 2I2RE 3ICBA 4AOMA 5I2OA 2G9BA 1K94A 1YX7A 1BG1A 1SYMA 5HKZA 1KK8C 3JVTC 1FI6A 4WQ3A 3D0YA 3I5HC 1EH2A 1QX5B 3CR4X 2A4JA 2EC6C 2WORA 3D10A 3PN7B 1JBAA 1S6IA 1U5IB 5PALA 2L98A 1BU3A 4OVNF 4P5OE 2Q91A 1G33A 3TUYB 2BL0B 2JTTA 1M45A 3DVJA 5ER4X 3DF0B 1K96A 4GUKA 4BY4A 3FIAA 1SR6C 1BF5A 2MRDA 3NSIA 4HRHA 4A4CA 5AFPA 1CMFA 2K7DA 1JFJA 1N65A 4JQ0D 1CDNA 2MHHA 3CGAA 2PALA 1JFKA 4MZLA 4NDBA 2WCFA 1MR8A 1RTP1 3RLZA 4Q04A 2KYFA 2KYCA 5JJGA 1IKUA 4DS7A 3PM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 B;  4QJ4 B;  4C0K A;  2I18 A;  5HKY A;  1B9A A;  1DF0 A;  5G08 A;  4CFR A;  1WLZ A;  3E3R A;  1BMO A;  3LK0 A;  1CDM A;  3M0W A;  5JOL A;  2K8M B;  5DKR A;  1WRL A;  1WY9 A;  2GGM A;  3I5G C;  4MVF A;  1NIW A;  3O4Y A;  1UHI A;  4DIR A;  1F54 A;  1PAL A;  1REC A;  3EVV A;  1TN4 A;  1L2O B;  5CPV A;  2F2O A;  3WNX B;  1GJY A;  1YUT A;  2KAV A;  5HYD A;  3VRR A;  4USL A;  3AKA A;  1XA5 A;  3AAK A;  1SL7 A;  3NSK A;  1YRT B;  3LLE A;  1JF2 A;  1H8B A;  1TNQ A;  3SG7 A;  1OZS A;  1C7W A;  1S5G Z;  1XFU O;  4YBH B;  1HT9 A;  2FCE A;  1CFD A;  1R6P A;  1XFX O;  1UWO A;  2KQ6 A;  2O60 A;  1MF8 B;  1RRO A;  1TIZ A;  2F8P A;  1UHH A;  2LMV A;  2CXJ A;  3EVR A;  1XFY O;  3O6B A;  1H4B A;  1CB1 A;  3TDU A;  2M7L A;  5IBW A;  1NCZ A;  2LLS A;  1TRF A;  1LKJ A;  1PK0 D;  3BQ3 A;  3PAT A;  2ISD A;  1CKK A;  4QJ3 B;  1G8I A;  2I7A A;  1B1G A;  3KHE A;  2LAN A;  3DVM A;  4F0Z B;  1ZMZ A;  2WCB A;  3AAJ A;  1CMG A;  2LVK A;  1SCV A;  5B8I B;  3K21 A;  2JWW A;  1YVL A;  2L50 A;  1MUX A;  3ZWH A;  1IGV A;  3WHT B;  1PVB A;  1CLB A;  1YTZ C;  2I94 A;  1V1G A;  3FWC A;  2LHL A;  2LP2 A;  4GGF A;  1SW8 A;  3SG6 A;  2M97 A;  1QIW A;  2KSP A;  1UP5 A;  1A4P A;  3QRX A;  1K95 A;  1KK8 B;  3JVT B;  4XJK A;  3CR5 X;  1OMD A;  4ETO A;  1FBV A;  5D7F A;  2ZRT A;  2EC6 B;  2SCP A;  5AAN A;  1EXR A;  1MWN A;  4HRE E;  3NSL A;  2KI6 D;  4I5N B;  5D69 A;  1BT6 A;  1JWD A;  2ZKM X;  1ALV A;  1M31 A;  2K7C A;  2JNX A;  1A75 A;  1SR6 B;  1YRU B;  1QV0 A;  1ZAC A;  2M1K B;  3PFV A;  1SPY A;  1AHR A;  4GAO A;  1Y1X A;  2L2E A;  1DTL A;  3CS1 A;  1XK4 A;  2K7B A;  3BUW B;  1JUO A;  1K9K A;  3PLF B;  4CID A;  2G2B A;  3I5I C;  1VRK A;  1F4Q A;  1S6J A;  2M1U A;  2AUC A;  4GFT A;  4YGB B;  4PAL A;  1QVI Y;  5ER5 A;  1K90 D;  5AEQ A;  2LP3 A;  1KSM A;  1AP4 A;  3HCM A;  2LC5 A;  4MBE A;  1LIN A;  2BCX A;  2BKI B;  2F3Y A;  1KFX S;  1KK7 Z;  3HX4 A;  2PSR A;  2M29 A;  4OV2 A;  5HLO A;  4A4B A;  4C0L A;  1CDL A;  1CLL A;  1FW4 A;  1XFW O;  2KBI A;  1A2X A;  1UHN A;  5TNC A;  1NX1 A;  4YRU A;  1ODB A;  1S3P A;  4WRI A;  2LAP A;  4N1F A;  4ORC B;  4PE0 A;  4PHK A;  2JXL A;  4M2Q A;  1NUB A;  1OZO A;  2Y1N A;  3PAL A;  1TCF A;  2K2A A;  1F70 A;  2AAO A;  2NXQ A;  4NDC A;  1NPQ A;  3KPX A;  2JTZ A;  2KGB C;  2JPT A;  1HQV A;  1TOP A;  2MLF C;  1W7I B;  3CWG A;  4PHM A;  1F71 A;  1BOC A;  1QXP A;  1SL9 A;  3BUN B;  1XK4 C;  1M63 B;  1SKT A;  3DF0 A;  1CM4 A;  2NCO A;  1SRA A;  1J55 A;  2BCB A;  1K93 D;  1YUU A;  2BBN A;  2KFF A;  1DVI A;  2BKH B;  1B8C A;  1QX7 A;  3BUM B;  1NYA A;  2EGD A;  4N5X A;  2K7O A;  1GGZ A;  4OCI A;  1NX3 A;  3SIB A;  2KNE A;  3NSO A;  3CTN A;  3IQO A;  1CTR A;  2M3W A;  3OHM B;  4DRW A;  1A03 A;  2WCE A;  4JPZ B;  5FYX A;  2KHN A;  1R2U A;  4QJ5 B;  2L5X B;  2RGI A;  1QX2 A;  1S26 D;  1KQV A;  1Y1A A;  2L4I A;  1SCM B;  1G4Y R;  3KO0 A;  4PDZ A;  2PAS A;  2SAS A;  1B8R A;  2FCD A;  2KI6 C;  2JZI A;  2L51 A;  3BYA A;  1E8A A;  1WDC C;  4ZCU A;  1B4C A;  1DJG A;  2LM5 A;  3FS7 A;  1J1D A;  4FTG A;  1KK7 Y;  1KQM B;  1NX2 A;  1QS7 A;  2CBL A;  3EKJ A;  4I5J A;  2OTG C;  3GK2 A;  2FJU B;  2KQY A;  2L0P A;  3TUY C;  5DKN A;  2LMT A;  1QTX A;  1QV1 A;  3WHU B;  2OS8 C;  2CNP A;  1QVI Z;  2ZND A;  1CFC A;  1KFU L;  5CSI A;  1YX8 A;  1OSA A;  2JT0 A;  4XYN A;  3VGO A;  2K2F A;  2R2I A;  5K89 A;  4AQJ A;  5BPJ A;  1D1O A;  4PE1 A;  1UHJ A;  2F2P A;  3I5F B;  2H2K A;  3I5I B;  4UPG A;  1NSH A;  2JOJ A;  4MZJ A;  1OMV A;  4MN0 A;  5AXI A;  3DD4 A;  2LLT A;  4YGD B;  1QAT A;  2ZN8 A;  1N2D A;  1ZUZ A;  1XFV O;  2KOT A;  1TNW A;  3EK4 A;  3KF9 A;  1BLQ A;  4MZK A;  2M49 B;  4PE4 A;  4PE7 A;  1K2H A;  3SJS A;  3I5H B;  1TCO B;  1B7T Y;  2KDH A;  1AJ4 A;  1KCY A;  3CR2 A;  1ZOT B;  2TN4 A;  3LL8 B;  1JSA A;  3OX6 A;  3C1V A;  4WQ2 A;  4OR9 B;  3NXA A;  4JWQ A;  4ORA B;  2LVJ A;  3LK1 A;  2B1U A;  4I5K A;  1F8H A;  3F45 A;  1IRJ A;  3ZNI A;  1EJ3 A;  1CFP A;  3EKH A;  2E6W A;  4AQI A;  1IWQ A;  1AUI B;  3BOW B;  3PSR A;  4M2O A;  1B8L A;  5GQQ C;  1QLK A;  4MSP A;  4ORB B;  3OB2 B;  2E30 A;  1OMR A;  2QPT A;  3VRQ A;  2M0R A;  1IQ3 A;  1IJ6 A;  1CDP A;  2JC2 A;  3OX5 A;  4GGF C;  1TNP A;  2KAX A;  2BE6 A;  2PRU A;  4GNK B;  2BCA A;  2BBM A;  2Y4Q A;  1DJX A;  4ZCV A;  1UHK A;  2K61 A;  1L7Z A;  2HPS A;  3GK4 X;  2KI4 C;  4PCW A;  1ZFS A;  2MAZ A;  3D0Y B;  4IL1 A;  5HLV A;  4DUQ A;  1PVA A;  1NX0 A;  3I5G B;  4PHN A;  3BUX B;  1OE9 B;  4OKH A;  1FPW A;  2HQ8 A;  1S36 A;  4P2Y B;  1IJ5 A;  1DJY A;  2H61 A;  3DVE A;  3OB1 B;  1RWY A;  2ZNE A;  1YUR A;  1MQ1 A;  2F3Z A;  5KU1 A;  1MHO A;  2M7N A;  3A4U B;  4MRY A;  2NZ0 A;  3TDI A;  1WDC B;  1DGU A;  2O5G A;  1QJT A;  1N0Y A;  1KWO C;  1YVH A;  2JNF A;  4YI9 A;  1U5I A;  3MSE B;  1K9P A;  1GQM A;  2CT9 A;  1AVS A;  1BR4 B;  1B47 A;  4ICB A;  3SG3 A;  4CLN A;  2LCP A;  4MRX A;  2MA2 A;  4GGN A;  1NCY A;  2OTG B;  2KBM A;  3GOF A;  1FF1 A;  2CCM A;  3A8R A;  2VRG A;  1FI5 A;  3KEV A;  2KGR A;  2LV7 A;  1M46 A;  2NLN A;  2LUC A;  1OQP A;  2F33 A;  1IH0 A;  1XVJ A;  2JRF A;  2OPO A;  2LUX A;  3EVU A;  3IF7 A;  1SNL A;  1GGW A;  2OS8 B;  4GBA A;  1DGV A;  1BOD A;  1ALW A;  2BEC A;  1DF0 B;  1LXF C;  3VRP A;  3CLN A;  4YI8 A;  1CFF A;  1DJH A;  3JTD C;  1MXL C;  1B7T Z;  5CSF A;  3SG4 A;  1JF0 A;  1MXE A;  1LA3 A;  2MLE C;  1CM1 A;  4DCK A;  2GV5 A;  2D8N A;  4TNC A;  2H61 C;  1SBJ A;  3AKB A;  2BE4 A;  3FWB A;  2LE9 B;  3EK7 A;  1QIV A;  1SL8 A;  2AMI A;  5HKW A;  4HRG A;  4L9M A;  2LVV A;  2WC8 A;  2FOT A;  2KAY A;  3PN7 C;  4MEW A;  1IQ5 A;  2M9G A;  1C7V A;  4GPL B;  2DOQ A;  1AK8 A;  1Q80 A;  4MLW A;  2ZRS A;  2BL0 C;  2GGZ A;  1J7Q A;  1J1E A;  1LA0 A;  2JU0 A;  1YUS A;  2P6B B;  4D1E A;  2JQ6 A;  1PSB A;  1J7P A;  2JXC A;  2QAC A;  5I2Q A;  2LMU A;  3SIA A;  4E68 A;  4YGC B;  3WXA A;  1W7J B;  1SMG A;  1J7O A;  4FQO A;  1K8U A;  2MBX A;  1EG4 A;  5DKQ A;  5CSJ A;  1BR1 B;  1YR5 A;  4M2P A;  2KFG A;  1WLM A;  1DJW A;  2JUL A;  4U8D A;  3TS5 C;  2LLU A;  1S1E A;  1WRK A;  1WRZ A;  2Y1M A;  1EL4 A;  4N1G A;  5CSN A;  1XFZ O;  4CPV A;  1J7R A;  4NDD A;  3VRN A;  4C0J A;  1F55 A;  1Y1U A;  2HF5 A;  2WND A;  2ZN9 A;  4YGE B;  3SG5 A;  3OP0 A;  3IQQ A;  2HQW A;  2MJW B;  4XJK B;  1PUL A;  1L2O C;  2KI4 B;  2ZFD A;  1SCM C;  3DVK A;  2JT8 A;  3EK8 A;  3VRO A;  3SG2 A;  1RK9 A;  2WOS A;  1XO5 A;  3TZ1 A;  1QLS A;  1Y6W A;  2IS9 A;  2KFH A;  1KFX L;  1RFJ A;  1KQM C;  4HSZ A;  3LCP C;  1DJZ A;  4I5L B;  1UUS A;  1V1F A;  2M8U A;  4NQG A;  5I8N A;  4R1E A;  5KTY A;  1AJ5 A;  2PMY A;  1X02 A;  1A75 B;  4CFQ A;  1K9U A;  3O2P A;  1KWO B;  1JC2 A;  1KFU S;  2JT3 A;  3H4S E;  1DJI A;  2HET A;  5J3X A;  1IG5 A;  1OOJ A;  2K0J A;  2Y5I A;  1S6C A;  2LVI A;  5AER A;  1CNP A;  1SK6 D;  1A29 A;  1CLM A;  2PVB A;  2Q4U A;  1F4O A;  5KSZ A;  1RJV A;  1BJF A;  4YGA A;  1Y0V H;  3BOW A;  2V53 A;  1S5G Y;  1KSO A;  1PSR A;  4BY5 A;  1C07 A;  1EG3 A;  2LHI A;  5I2L A;  1XYD A;  3CZT X;  2NCP A;  1PRW A;  1DT7 B;  2L4H A;  2COL B;  2LNK A;  1UUR A;  1NWD A;  2EHB A;  3BXK A;  1NP8 A;  3I5F C;  1TTX A;  3BUO B;  3JTD B;  4PHJ A;  5F6T A;  1LVC D;  1TNX A;  3GK1 A;  3RM1 A;  1NCX A;  1QAS A;  1M39 A;  2CTN A;  3TDZ A;  1DMO A;  3O78 A;  1SY9 A;  2I2R E;  3ICB A;  4AOM A;  5I2O A;  2G9B A;  1K94 A;  1YX7 A;  1BG1 A;  1SYM A;  5HKZ A;  1KK8 C;  3JVT C;  1FI6 A;  4WQ3 A;  3D0Y A;  3I5H C;  1EH2 A;  1QX5 B;  3CR4 X;  2A4J A;  2EC6 C;  2WOR A;  3D10 A;  3PN7 B;  1JBA A;  1S6I A;  1U5I B;  5PAL A;  2L98 A;  1BU3 A;  4OVN F;  4P5O E;  2Q91 A;  1G33 A;  3TUY B;  2BL0 B;  2JTT A;  1M45 A;  3DVJ A;  5ER4 X;  3DF0 B;  1K96 A;  4GUK A;  4BY4 A;  3FIA A;  1SR6 C;  1BF5 A;  2MRD A;  3NSI A;  4HRH A;  4A4C A;  5AFP A;  1CMF A;  2K7D A;  1JFJ A;  1N65 A;  4JQ0 D;  1CDN A;  2MHH A;  3CGA A;  2PAL A;  1JFK A;  4MZL A;  4NDB A;  2WCF A;  1MR8 A;  1RTP 1;  3RLZ A;  4Q04 A;  2KYF A;  2KYC A;  5JJG A;  1IKU A;  4DS7 A;  3PM8 A; 
#chains in the Genus database with same CATH topology
 3TS5 B;  4QJ4 B;  1TWO A;  3CAB A;  4C0K A;  2I18 A;  5HKY A;  1B9A A;  1DF0 A;  5G08 A;  4CFR A;  1WLZ A;  3E3R A;  1BMO A;  3LK0 A;  1CDM A;  3M0W A;  5JOL A;  2K8M B;  5DKR A;  1WRL A;  1WY9 A;  2GGM A;  3I5G C;  4MVF A;  1NIW A;  3O4Y A;  4JD9 A;  1UHI A;  3CZ2 A;  4DIR A;  1F54 A;  1PAL A;  1REC A;  3EVV A;  1TN4 A;  1L2O B;  5CPV A;  2F2O A;  3WNX B;  1GJY A;  1YUT A;  2KAV A;  5HYD A;  3VRR A;  4USL A;  3AKA A;  1XA5 A;  3AAK A;  2L2C A;  1SL7 A;  3NSK A;  1YRT B;  3LLE A;  1JF2 A;  1H8B A;  1TNQ A;  3S0E A;  3SG7 A;  1OZS A;  1C7W A;  3BJH A;  1S5G Z;  1XFU O;  4YBH B;  1HT9 A;  2FCE A;  1CFD A;  1R6P A;  1XFX O;  1UWO A;  2KQ6 A;  2O60 A;  1MF8 B;  1RRO A;  1TIZ A;  2F8P A;  1UHH A;  2LMV A;  2CXJ A;  3EVR A;  1XFY O;  3O6B A;  1H4B A;  1CB1 A;  3TDU A;  2M7L A;  5IBW A;  1NCZ A;  5D3O A;  2LLS A;  1TRF A;  1LKJ A;  1PK0 D;  3BQ3 A;  3PAT A;  2ISD A;  1CKK A;  4QJ3 B;  1G8I A;  2I7A A;  1B1G A;  3KHE A;  2LAN A;  3DVM A;  4F0Z B;  1ZMZ A;  2WCB A;  3AAJ A;  5FI6 A;  1CMG A;  2LVK A;  1SCV A;  5B8I B;  2QEB A;  1DC1 A;  3K21 A;  2JWW A;  1YVL A;  3BFB A;  2L50 A;  3D74 A;  1MUX A;  3DZT A;  3ZWH A;  1IGV A;  3WHT B;  1PVB A;  1CLB A;  1YTZ C;  2I94 A;  1V1G A;  3FWC A;  2LHL A;  2LP2 A;  3NHI A;  4GGF A;  1SW8 A;  3SG6 A;  2M97 A;  1QIW A;  2KSP A;  1UP5 A;  1A4P A;  3QRX A;  1K95 A;  1KK8 B;  3JVT B;  4XJK A;  3CR5 X;  1OMD A;  4ETO A;  1FBV A;  1LS8 A;  2ZRT A;  3O4X A;  5D7F A;  2EC6 B;  2SCP A;  5AAN A;  1EXR A;  3UO9 A;  1MWN A;  1IIO A;  4HRE E;  3DYE A;  3NSL A;  2KI6 D;  4I5N B;  5D69 A;  1BT6 A;  1JWD A;  2ZKM X;  1ALV A;  3D77 A;  1M31 A;  2K7C A;  2JNX A;  1A75 A;  3B87 A;  1SR6 B;  1YRU B;  1QV0 A;  1ZAC A;  2M1K B;  3PFV A;  1SPY A;  3D75 A;  1AHR A;  4GAO A;  2WC6 A;  1Y1X A;  2L2E A;  1DTL A;  3CS1 A;  1XK4 A;  2K7B A;  3BUW B;  1JUO A;  1K9K A;  3PLF B;  4CID A;  2G2B A;  3I5I C;  1VRK A;  1F4Q A;  1S6J A;  2M1U A;  2AUC A;  4GFT A;  4YGB B;  4PAL A;  1QVI Y;  5ER5 A;  3PM2 A;  1K90 D;  5AEQ A;  2LP3 A;  1KSM A;  4OZD A;  3HCM A;  2LC5 A;  3B88 A;  1AP4 A;  4MBE A;  1LIN A;  2BCX A;  2BKI B;  2F3Y A;  1KFX S;  1KK7 Z;  3HX4 A;  2PSR A;  2M29 A;  4OV2 A;  5HLO A;  4A4B A;  3Q8I A;  1CDL A;  4C0L A;  1CLL A;  1FW4 A;  1XFW O;  2KBI A;  1A2X A;  1UHN A;  5TNC A;  1NX1 A;  4YRU A;  1ODB A;  1S3P A;  4WRI A;  3DXL A;  2LAP A;  4N1F A;  4ORC B;  4PE0 A;  4PHK A;  2JXL A;  4M2Q A;  1NUB A;  1DQE A;  1OZO A;  2Y1N A;  3PAL A;  1TCF A;  2K2A A;  1F70 A;  2AAO A;  2NXQ A;  4NDC A;  1NPQ A;  3KPX A;  2JTZ A;  2KGB C;  2JPT A;  2L5Y A;  1HQV A;  1TOP A;  3SS4 A;  2MLF C;  1W7I B;  2H8V A;  3QME A;  3CWG A;  4PHM A;  1F71 A;  1BOC A;  1QXP A;  1SL9 A;  1QWV A;  3BUN B;  1XK4 C;  1M63 B;  1P28 A;  1SKT A;  1W9Z A;  3DF0 A;  1CM4 A;  2NCO A;  1SRA A;  1J55 A;  1YUU A;  1K93 D;  2BBN A;  2BCB A;  2KFF A;  2WCM A;  1DVI A;  2BKH B;  1B8C A;  1QX7 A;  3BUM B;  1NYA A;  2EGD A;  4N5X A;  2K7O A;  3V2L A;  1GGZ A;  4OCI A;  1NX3 A;  3SIB A;  2KNE A;  3NSO A;  3CTN A;  3IQO A;  1CTR A;  2M3W A;  3OHM B;  5FI7 A;  4DRW A;  1A03 A;  2WCE A;  4JPZ B;  5FYX A;  2KHN A;  1R2U A;  4QJ5 B;  2L5X B;  2RGI A;  1QX2 A;  1S26 D;  1KQV A;  1Y1A A;  2L4I A;  1SCM B;  1G4Y R;  3KO0 A;  4PDZ A;  2PAS A;  2SAS A;  3EG5 B;  1B8R A;  2FCD A;  2KI6 C;  2JZI A;  2L51 A;  3BYA A;  2WC5 A;  1E8A A;  1WDC C;  4ZCU A;  1B4C A;  1DJG A;  2LM5 A;  3FS7 A;  1J1D A;  4FTG A;  1KK7 Y;  1KQM B;  1NX2 A;  1QS7 A;  2CBL A;  5DIC A;  3EKJ A;  4I5J A;  2OTG C;  3GK2 A;  4INX A;  2FJU B;  2KQY A;  2L0P A;  3BFH A;  3TUY C;  3R72 A;  5DKN A;  2LMT A;  1QTX A;  1QV1 A;  3NHT A;  3WHU B;  2OS8 C;  2CNP A;  1QVI Z;  3D78 A;  2ZND A;  1CFC A;  1KFU L;  5CSI A;  1YX8 A;  1OSA A;  2JT0 A;  4XYN A;  3VGO A;  2K2F A;  3FE6 A;  2R2I A;  5K89 A;  4AQJ A;  5BPJ A;  1D1O A;  1SSE B;  4PE1 A;  1UHJ A;  2F2P A;  3I5F B;  2WCH A;  2H2K A;  3I5I B;  4UPG A;  1NSH A;  2JOJ A;  2QEH A;  4MZJ A;  1OMV A;  4MN0 A;  5AXI A;  3DD4 A;  2LLT A;  4YGD B;  1QAT A;  2ZN8 A;  1N2D A;  1ZUZ A;  1XFV O;  3S0B A;  4KYN A;  2KOT A;  1TNW A;  3EK4 A;  3KF9 A;  1BLQ A;  4MZK A;  2M49 B;  4PE4 A;  4PE7 A;  1K2H A;  3FE9 A;  3I5H B;  3SJS A;  1TCO B;  1B7T Y;  2KDH A;  3SS5 A;  1AJ4 A;  1KCY A;  3CR2 A;  1ZOT B;  2TN4 A;  1XFR A;  2P70 A;  3LL8 B;  3L4A A;  4JKT A;  3OGN A;  3OX6 A;  1JSA A;  3C1V A;  4WQ2 A;  4OR9 B;  3NXA A;  4JWQ A;  4ORA B;  2LVJ A;  3D73 A;  3LK1 A;  2B1U A;  4I5K A;  1F8H A;  3F45 A;  1IRJ A;  3ZNI A;  1EJ3 A;  1CFP A;  3EKH A;  2E6W A;  4AQI A;  4FQT A;  1GM0 A;  1IWQ A;  1AUI B;  3BOW B;  3PSR A;  4M2O A;  3IVT A;  2KPH A;  1B8L A;  1ORG A;  3R1O A;  2WCK A;  5GQQ C;  1QLK A;  1OOG A;  4MSP A;  2JPO A;  4ORB B;  3OB2 B;  2E30 A;  1OMR A;  2QPT A;  3R1V A;  2WCL A;  2M0R A;  3VRQ A;  1IQ3 A;  3FE8 A;  1IJ6 A;  4IJ7 A;  1CDP A;  2JC2 A;  3OX5 A;  4GGF C;  1TNP A;  2KAX A;  2BE6 A;  2GTE A;  2PRU A;  4GNK B;  2BCA A;  2BBM A;  2FJY A;  1DJX A;  2Y4Q A;  4ZCV A;  1UHK A;  3L4L A;  2K61 A;  1L7Z A;  2HPS A;  3GK4 X;  2KI4 C;  4PCW A;  1ZFS A;  2MAZ A;  3D0Y B;  4IL1 A;  5HLV A;  4DUQ A;  1PVA A;  1NX0 A;  1Z4H A;  3I5G B;  3BUX B;  4PHN A;  1OE9 B;  2KLD A;  4OKH A;  1FPW A;  2HQ8 A;  1S36 A;  4P2Y B;  1IJ5 A;  1DJY A;  2H61 A;  3DVE A;  1C3Z A;  3OB1 B;  1RWY A;  2ZNE A;  1YUR A;  1MQ1 A;  2F3Z A;  5KU1 A;  1MHO A;  2M7N A;  3A4U B;  4MRY A;  2NZ0 A;  3TDI A;  1WDC B;  1DGU A;  2O5G A;  1QJT A;  1N0Y A;  1KWO C;  1YVH A;  2JNF A;  3NGV A;  4YI9 A;  1U5I A;  3MSE B;  1K9P A;  1GQM A;  2CT9 A;  1AVS A;  1BR4 B;  1B47 A;  4ICB A;  3SG3 A;  4CLN A;  2LCP A;  4MRX A;  2MA2 A;  4GGN A;  1NCY A;  2OTG B;  1OOH A;  3S0F A;  2QEO A;  3PJI A;  2KBM A;  3GOF A;  1FF1 A;  2CCM A;  3A8R A;  2VRG A;  1FI5 A;  3KEV A;  2KGR A;  3CZ0 A;  2LV7 A;  1M46 A;  2NLN A;  2LUC A;  1OQP A;  2F33 A;  1IH0 A;  1XVJ A;  2JRF A;  3B6X A;  2OPO A;  2LUX A;  3EVU A;  3IF7 A;  1SNL A;  1GGW A;  2OS8 B;  4GBA A;  1DGV A;  1BOD A;  1ALW A;  2BEC A;  1DF0 B;  1LXF C;  3D76 A;  3VRP A;  3R1P A;  1T14 A;  3CLN A;  4YI8 A;  1CFF A;  1DJH A;  2PQL A;  3JTD C;  3DY9 A;  1MXL C;  1B7T Z;  5CSF A;  3SG4 A;  1JF0 A;  1MXE A;  1LA3 A;  2MLE C;  1CM1 A;  4DCK A;  2GV5 A;  2D8N A;  4TNC A;  2H61 C;  1SBJ A;  3AKB A;  2BE4 A;  3FWB A;  2LE9 B;  3EK7 A;  1QIV A;  1SL8 A;  2AMI A;  1Z2C B;  4HRG A;  5HKW A;  4L9M A;  2LVV A;  2WC8 A;  3S0A A;  2FOT A;  3K1E A;  2KAY A;  3PN7 C;  1TUZ A;  4MEW A;  1IQ5 A;  2M9G A;  1C7V A;  4GPL B;  2DOQ A;  1AK8 A;  1Q80 A;  4MLW A;  2ZRS A;  2BL0 C;  2GGZ A;  1J7Q A;  1J1E A;  1LA0 A;  2JU0 A;  1YUS A;  2P6B B;  4D1E A;  2JQ6 A;  1PSB A;  1J7P A;  2JXC A;  2QAC A;  5I2Q A;  2LMU A;  3SIA A;  4E68 A;  4YGC B;  3WXA A;  1W7J B;  1SMG A;  1J7O A;  4FQO A;  1K8U A;  2MBX A;  1EG4 A;  5DKQ A;  1OOF A;  5CSJ A;  1BR1 B;  1YR5 A;  2WCJ A;  3B86 A;  4M2P A;  2KFG A;  1WLM A;  1DJW A;  2JUL A;  4U8D A;  3TS5 C;  2LLU A;  1S1E A;  1WRK A;  4PT1 A;  1WRZ A;  2Y1M A;  1EL4 A;  1OW4 A;  4N1G A;  5CSN A;  1XFZ O;  4CPV A;  1J7R A;  4NDD A;  3VRN A;  4C0J A;  1F55 A;  1Y1U A;  2HF5 A;  2WND A;  2ZN9 A;  2ERB A;  4YGE B;  3SG5 A;  3OP0 A;  3IQQ A;  3S0D A;  2HQW A;  2MJW B;  4XJK B;  1PUL A;  1L2O C;  2KI4 B;  2ZFD A;  1SCM C;  3DVK A;  3CZ1 A;  2JT8 A;  3EK8 A;  3VRO A;  3SG2 A;  1RK9 A;  2WOS A;  1XO5 A;  3TZ1 A;  1QLS A;  1Y6W A;  3VB1 A;  2IS9 A;  2KFH A;  1KFX L;  5HL1 A;  1RFJ A;  1KQM C;  4HSZ A;  3LCP C;  1DJZ A;  4I5L B;  1UUS A;  1V1F A;  2M8U A;  4NQG A;  5I8N A;  4R1E A;  5KTY A;  1AJ5 A;  2PMY A;  1X02 A;  1A75 B;  4CFQ A;  1K9U A;  3O2P A;  1KWO B;  1JC2 A;  1KFU S;  2JT3 A;  3H4S E;  1DJI A;  2HET A;  5J3X A;  1IG5 A;  1OOJ A;  2K0J A;  2Y5I A;  1S6C A;  2LVI A;  5AER A;  1CNP A;  3SS3 A;  1SK6 D;  1A29 A;  1CLM A;  2PVB A;  2Q4U A;  1F4O A;  5KSZ A;  1RJV A;  1BJF A;  3B7A A;  1Y0V H;  3BOW A;  2V53 A;  1S5G Y;  4YGA A;  1KSO A;  3S0G A;  1PSR A;  4BY5 A;  1C07 A;  1EG3 A;  2LHI A;  5I2L A;  1XYD A;  3CZT X;  2NCP A;  1PRW A;  1DEL A;  1DT7 B;  2L4H A;  2COL B;  2LNK A;  1UUR A;  3UNW A;  1NWD A;  2EHB A;  3BXK A;  1NP8 A;  1TUJ A;  3I5F C;  1TTX A;  3BUO B;  3CYZ A;  3JTD B;  4PHJ A;  1LVC D;  1TNX A;  5F6T A;  5FI2 A;  3GK1 A;  3RM1 A;  4F7F A;  5I94 A;  1NCX A;  1QAS A;  1M39 A;  2CTN A;  3TDZ A;  1DMO A;  3O78 A;  1SY9 A;  2K60 A;  2I2R E;  2KLE A;  2QEV A;  3ICB A;  4AOM A;  5I2O A;  2G9B A;  1K94 A;  5EL2 A;  1YX7 A;  1BG1 A;  1SYM A;  5HKZ A;  1KK8 C;  1OOI X;  3JVT C;  1FI6 A;  4WQ3 A;  3D0Y A;  3I5H C;  1EH2 A;  1QX5 B;  3CR4 X;  2A4J A;  2EC6 C;  2WOR A;  2PYQ A;  3D10 A;  3PN7 B;  1JBA A;  3BFA A;  1S6I A;  1U5I B;  5PAL A;  3CDN A;  2L98 A;  1C3Y A;  1BU3 A;  4OVN F;  4P5O E;  1DEK A;  2QDI A;  4INW A;  2Q91 A;  1G33 A;  3TUY B;  2BL0 B;  2JTT A;  1M45 A;  2P71 A;  3DVJ A;  3DF0 B;  5ER4 X;  1K96 A;  4GUK A;  4BY4 A;  3FIA A;  1SR6 C;  1BF5 A;  2MRD A;  3NSI A;  4HRH A;  4A4C A;  5AFP A;  1CMF A;  2K7D A;  1JFJ A;  1N65 A;  4JQ0 D;  1CDN A;  2MHH A;  3CGA A;  2PAL A;  1JFK A;  4MZL A;  4NDB A;  3N7H A;  2WCF A;  2BAP A;  1MR8 A;  3L47 A;  3RZS A;  1RTP 1;  3RLZ A;  4Q04 A;  2KYF A;  2KYC A;  2BNX A;  5JJG A;  1IKU A;  3OBV A;  4DS7 A;  2YGU A;  3PM8 A; 
#chains in the Genus database with same CATH homology
 3TS5 B;  4QJ4 B;  4C0K A;  2I18 A;  5HKY A;  1B9A A;  1DF0 A;  5G08 A;  4CFR A;  1WLZ A;  3E3R A;  1BMO A;  3LK0 A;  1CDM A;  3M0W A;  5JOL A;  2K8M B;  5DKR A;  1WRL A;  1WY9 A;  2GGM A;  3I5G C;  4MVF A;  1NIW A;  3O4Y A;  1UHI A;  4DIR A;  1F54 A;  1PAL A;  1REC A;  3EVV A;  1TN4 A;  1L2O B;  5CPV A;  2F2O A;  3WNX B;  1GJY A;  1YUT A;  2KAV A;  5HYD A;  3VRR A;  4USL A;  3AKA A;  1XA5 A;  3AAK A;  1SL7 A;  3NSK A;  1YRT B;  3LLE A;  1JF2 A;  1H8B A;  1TNQ A;  3SG7 A;  1OZS A;  1C7W A;  1S5G Z;  1XFU O;  4YBH B;  1HT9 A;  2FCE A;  1CFD A;  1R6P A;  1XFX O;  1UWO A;  2KQ6 A;  2O60 A;  1MF8 B;  1RRO A;  1TIZ A;  2F8P A;  1UHH A;  2LMV A;  2CXJ A;  3EVR A;  1XFY O;  3O6B A;  1H4B A;  1CB1 A;  3TDU A;  2M7L A;  5IBW A;  1NCZ A;  2LLS A;  1TRF A;  1LKJ A;  1PK0 D;  3BQ3 A;  3PAT A;  2ISD A;  1CKK A;  4QJ3 B;  1G8I A;  2I7A A;  1B1G A;  3KHE A;  2LAN A;  3DVM A;  4F0Z B;  1ZMZ A;  2WCB A;  3AAJ A;  1CMG A;  2LVK A;  1SCV A;  5B8I B;  3K21 A;  2JWW A;  1YVL A;  2L50 A;  1MUX A;  3ZWH A;  1IGV A;  3WHT B;  1PVB A;  1CLB A;  1YTZ C;  2I94 A;  1V1G A;  3FWC A;  2LHL A;  2LP2 A;  4GGF A;  1SW8 A;  3SG6 A;  2M97 A;  1QIW A;  2KSP A;  1UP5 A;  1A4P A;  3QRX A;  1K95 A;  1KK8 B;  3JVT B;  4XJK A;  3CR5 X;  1OMD A;  4ETO A;  1FBV A;  5D7F A;  2ZRT A;  2EC6 B;  2SCP A;  5AAN A;  1EXR A;  1MWN A;  4HRE E;  3NSL A;  2KI6 D;  4I5N B;  5D69 A;  1BT6 A;  1JWD A;  2ZKM X;  1ALV A;  1M31 A;  2K7C A;  2JNX A;  1A75 A;  1SR6 B;  1YRU B;  1QV0 A;  1ZAC A;  2M1K B;  3PFV A;  1SPY A;  1AHR A;  4GAO A;  1Y1X A;  2L2E A;  1DTL A;  3CS1 A;  1XK4 A;  2K7B A;  3BUW B;  1JUO A;  1K9K A;  3PLF B;  4CID A;  2G2B A;  3I5I C;  1VRK A;  1F4Q A;  1S6J A;  2M1U A;  2AUC A;  4GFT A;  4YGB B;  4PAL A;  1QVI Y;  5ER5 A;  1K90 D;  5AEQ A;  2LP3 A;  1KSM A;  1AP4 A;  3HCM A;  2LC5 A;  4MBE A;  1LIN A;  2BCX A;  2BKI B;  2F3Y A;  1KFX S;  1KK7 Z;  3HX4 A;  2PSR A;  2M29 A;  4OV2 A;  5HLO A;  4A4B A;  4C0L A;  1CDL A;  1CLL A;  1FW4 A;  1XFW O;  2KBI A;  1A2X A;  1UHN A;  5TNC A;  1NX1 A;  4YRU A;  1ODB A;  1S3P A;  4WRI A;  2LAP A;  4N1F A;  4ORC B;  4PE0 A;  4PHK A;  2JXL A;  4M2Q A;  1NUB A;  1OZO A;  2Y1N A;  3PAL A;  1TCF A;  2K2A A;  1F70 A;  2AAO A;  2NXQ A;  4NDC A;  1NPQ A;  3KPX A;  2JTZ A;  2KGB C;  2JPT A;  1HQV A;  1TOP A;  2MLF C;  1W7I B;  3CWG A;  4PHM A;  1F71 A;  1BOC A;  1QXP A;  1SL9 A;  3BUN B;  1XK4 C;  1M63 B;  1SKT A;  3DF0 A;  1CM4 A;  2NCO A;  1SRA A;  1J55 A;  2BCB A;  1K93 D;  1YUU A;  2BBN A;  2KFF A;  1DVI A;  2BKH B;  1B8C A;  1QX7 A;  3BUM B;  1NYA A;  2EGD A;  4N5X A;  2K7O A;  1GGZ A;  4OCI A;  1NX3 A;  3SIB A;  2KNE A;  3NSO A;  3CTN A;  3IQO A;  1CTR A;  2M3W A;  3OHM B;  4DRW A;  1A03 A;  2WCE A;  4JPZ B;  5FYX A;  2KHN A;  1R2U A;  4QJ5 B;  2L5X B;  2RGI A;  1QX2 A;  1S26 D;  1KQV A;  1Y1A A;  2L4I A;  1SCM B;  1G4Y R;  3KO0 A;  4PDZ A;  2PAS A;  2SAS A;  1B8R A;  2FCD A;  2KI6 C;  2JZI A;  2L51 A;  3BYA A;  1E8A A;  1WDC C;  4ZCU A;  1B4C A;  1DJG A;  2LM5 A;  3FS7 A;  1J1D A;  4FTG A;  1KK7 Y;  1KQM B;  1NX2 A;  1QS7 A;  2CBL A;  3EKJ A;  4I5J A;  2OTG C;  3GK2 A;  2FJU B;  2KQY A;  2L0P A;  3TUY C;  5DKN A;  2LMT A;  1QTX A;  1QV1 A;  3WHU B;  2OS8 C;  2CNP A;  1QVI Z;  2ZND A;  1CFC A;  1KFU L;  5CSI A;  1YX8 A;  1OSA A;  2JT0 A;  4XYN A;  3VGO A;  2K2F A;  2R2I A;  5K89 A;  4AQJ A;  5BPJ A;  1D1O A;  4PE1 A;  1UHJ A;  2F2P A;  3I5F B;  2H2K A;  3I5I B;  4UPG A;  1NSH A;  2JOJ A;  4MZJ A;  1OMV A;  4MN0 A;  5AXI A;  3DD4 A;  2LLT A;  4YGD B;  1QAT A;  2ZN8 A;  1N2D A;  1ZUZ A;  1XFV O;  2KOT A;  1TNW A;  3EK4 A;  3KF9 A;  1BLQ A;  4MZK A;  2M49 B;  4PE4 A;  4PE7 A;  1K2H A;  3SJS A;  3I5H B;  1TCO B;  1B7T Y;  2KDH A;  1AJ4 A;  1KCY A;  3CR2 A;  1ZOT B;  2TN4 A;  3LL8 B;  1JSA A;  3OX6 A;  3C1V A;  4WQ2 A;  4OR9 B;  3NXA A;  4JWQ A;  4ORA B;  2LVJ A;  3LK1 A;  2B1U A;  4I5K A;  1F8H A;  3F45 A;  1IRJ A;  3ZNI A;  1EJ3 A;  1CFP A;  3EKH A;  2E6W A;  4AQI A;  1IWQ A;  1AUI B;  3BOW B;  3PSR A;  4M2O A;  1B8L A;  5GQQ C;  1QLK A;  4MSP A;  4ORB B;  3OB2 B;  2E30 A;  1OMR A;  2QPT A;  3VRQ A;  2M0R A;  1IQ3 A;  1IJ6 A;  1CDP A;  2JC2 A;  3OX5 A;  4GGF C;  1TNP A;  2KAX A;  2BE6 A;  2PRU A;  4GNK B;  2BCA A;  2BBM A;  2Y4Q A;  1DJX A;  4ZCV A;  1UHK A;  2K61 A;  1L7Z A;  2HPS A;  3GK4 X;  2KI4 C;  4PCW A;  1ZFS A;  2MAZ A;  3D0Y B;  4IL1 A;  5HLV A;  4DUQ A;  1PVA A;  1NX0 A;  3I5G B;  4PHN A;  3BUX B;  1OE9 B;  4OKH A;  1FPW A;  2HQ8 A;  1S36 A;  4P2Y B;  1IJ5 A;  1DJY A;  2H61 A;  3DVE A;  3OB1 B;  1RWY A;  2ZNE A;  1YUR A;  1MQ1 A;  2F3Z A;  5KU1 A;  1MHO A;  2M7N A;  3A4U B;  4MRY A;  2NZ0 A;  3TDI A;  1WDC B;  1DGU A;  2O5G A;  1QJT A;  1N0Y A;  1KWO C;  1YVH A;  2JNF A;  4YI9 A;  1U5I A;  3MSE B;  1K9P A;  1GQM A;  2CT9 A;  1AVS A;  1BR4 B;  1B47 A;  4ICB A;  3SG3 A;  4CLN A;  2LCP A;  4MRX A;  2MA2 A;  4GGN A;  1NCY A;  2OTG B;  2KBM A;  3GOF A;  1FF1 A;  2CCM A;  3A8R A;  2VRG A;  1FI5 A;  3KEV A;  2KGR A;  2LV7 A;  1M46 A;  2NLN A;  2LUC A;  1OQP A;  2F33 A;  1IH0 A;  1XVJ A;  2JRF A;  2OPO A;  2LUX A;  3EVU A;  3IF7 A;  1SNL A;  1GGW A;  2OS8 B;  4GBA A;  1DGV A;  1BOD A;  1ALW A;  2BEC A;  1DF0 B;  1LXF C;  3VRP A;  3CLN A;  4YI8 A;  1CFF A;  1DJH A;  3JTD C;  1MXL C;  1B7T Z;  5CSF A;  3SG4 A;  1JF0 A;  1MXE A;  1LA3 A;  2MLE C;  1CM1 A;  4DCK A;  2GV5 A;  2D8N A;  4TNC A;  2H61 C;  1SBJ A;  3AKB A;  2BE4 A;  3FWB A;  2LE9 B;  3EK7 A;  1QIV A;  1SL8 A;  2AMI A;  5HKW A;  4HRG A;  4L9M A;  2LVV A;  2WC8 A;  2FOT A;  2KAY A;  3PN7 C;  4MEW A;  1IQ5 A;  2M9G A;  1C7V A;  4GPL B;  2DOQ A;  1AK8 A;  1Q80 A;  4MLW A;  2ZRS A;  2BL0 C;  2GGZ A;  1J7Q A;  1J1E A;  1LA0 A;  2JU0 A;  1YUS A;  2P6B B;  4D1E A;  2JQ6 A;  1PSB A;  1J7P A;  2JXC A;  2QAC A;  5I2Q A;  2LMU A;  3SIA A;  4E68 A;  4YGC B;  3WXA A;  1W7J B;  1SMG A;  1J7O A;  4FQO A;  1K8U A;  2MBX A;  1EG4 A;  5DKQ A;  5CSJ A;  1BR1 B;  1YR5 A;  4M2P A;  2KFG A;  1WLM A;  1DJW A;  2JUL A;  4U8D A;  3TS5 C;  2LLU A;  1S1E A;  1WRK A;  1WRZ A;  2Y1M A;  1EL4 A;  4N1G A;  5CSN A;  1XFZ O;  4CPV A;  1J7R A;  4NDD A;  3VRN A;  4C0J A;  1F55 A;  1Y1U A;  2HF5 A;  2WND A;  2ZN9 A;  4YGE B;  3SG5 A;  3OP0 A;  3IQQ A;  2HQW A;  2MJW B;  4XJK B;  1PUL A;  1L2O C;  2KI4 B;  2ZFD A;  1SCM C;  3DVK A;  2JT8 A;  3EK8 A;  3VRO A;  3SG2 A;  1RK9 A;  2WOS A;  1XO5 A;  3TZ1 A;  1QLS A;  1Y6W A;  2IS9 A;  2KFH A;  1KFX L;  1RFJ A;  1KQM C;  4HSZ A;  3LCP C;  1DJZ A;  4I5L B;  1UUS A;  1V1F A;  2M8U A;  4NQG A;  5I8N A;  4R1E A;  5KTY A;  1AJ5 A;  2PMY A;  1X02 A;  1A75 B;  4CFQ A;  1K9U A;  3O2P A;  1KWO B;  1JC2 A;  1KFU S;  2JT3 A;  3H4S E;  1DJI A;  2HET A;  5J3X A;  1IG5 A;  1OOJ A;  2K0J A;  2Y5I A;  1S6C A;  2LVI A;  5AER A;  1CNP A;  1SK6 D;  1A29 A;  1CLM A;  2PVB A;  2Q4U A;  1F4O A;  5KSZ A;  1RJV A;  1BJF A;  4YGA A;  1Y0V H;  3BOW A;  2V53 A;  1S5G Y;  1KSO A;  1PSR A;  4BY5 A;  1C07 A;  1EG3 A;  2LHI A;  5I2L A;  1XYD A;  3CZT X;  2NCP A;  1PRW A;  1DT7 B;  2L4H A;  2COL B;  2LNK A;  1UUR A;  1NWD A;  2EHB A;  3BXK A;  1NP8 A;  3I5F C;  1TTX A;  3BUO B;  3JTD B;  4PHJ A;  5F6T A;  1LVC D;  1TNX A;  3GK1 A;  3RM1 A;  1NCX A;  1QAS A;  1M39 A;  2CTN A;  3TDZ A;  1DMO A;  3O78 A;  1SY9 A;  2I2R E;  3ICB A;  4AOM A;  5I2O A;  2G9B A;  1K94 A;  1YX7 A;  1BG1 A;  1SYM A;  5HKZ A;  1KK8 C;  3JVT C;  1FI6 A;  4WQ3 A;  3D0Y A;  3I5H C;  1EH2 A;  1QX5 B;  3CR4 X;  2A4J A;  2EC6 C;  2WOR A;  3D10 A;  3PN7 B;  1JBA A;  1S6I A;  1U5I B;  5PAL A;  2L98 A;  1BU3 A;  4OVN F;  4P5O E;  2Q91 A;  1G33 A;  3TUY B;  2BL0 B;  2JTT A;  1M45 A;  3DVJ A;  5ER4 X;  3DF0 B;  1K96 A;  4GUK A;  4BY4 A;  3FIA A;  1SR6 C;  1BF5 A;  2MRD A;  3NSI A;  4HRH A;  4A4C A;  5AFP A;  1CMF A;  2K7D A;  1JFJ A;  1N65 A;  4JQ0 D;  1CDN A;  2MHH A;  3CGA A;  2PAL A;  1JFK A;  4MZL A;  4NDB A;  2WCF A;  1MR8 A;  1RTP 1;  3RLZ A;  4Q04 A;  2KYF A;  2KYC A;  5JJG A;  1IKU A;  4DS7 A;  3PM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...