2LVKA

Solution structure of ca-bound phl p 7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
b'ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvkA00
5CSFA 3O6BA 1BMOA 2JT0A 3BUWB 5I2OA 1DGVA 2G2BA 2KAVA 2LANA 3I5HC 1JC2A 3SIAA 2B1UA 2BCBA 1MQ1A 2F33A 5CPVA 4YGBB 2OPOA 2DOQA 1IQ5A 1BJFA 1UP5A 3I5FC 5CSJA 4PDZA 4GNKB 1XFZO 4ETOA 1X02A 2COLB 2L2EA 2M7NA 1WRLA 1UUSA 1MXEA 1VRKA 2KFHA 1GGZA 5I2LA 3O78A 1DF0B 1BU3A 2KI4C 1XFYO 4D1EA 1PRWA 4I5LB 5HKYA 1PULA 5PALA 1W7IB 1YRUB 3KPXA 1QLSA 4ZCUA 4XYNA 4QJ4B 2LVIA 1UHNA 3KEVA 1DTLA 1UHIA 2LHLA 4ZCVA 1JSAA 4AOMA 4DRWA 1DGUA 1M39A 3TS5B 1OMVA 1NX1A 2K7BA 4YI9A 1QTXA 5J3XA 1KFUL 2K61A 2LAPA 2R2IA 4CIDA 4N1FA 3RM1A 2JXLA 4MRXA 4GGFA 2LVVA 2EGDA 2EC6C 1J7RA 5AFPA 4ORBB 2LC5A 3F45A 2K2FA 1K93D 3BUMB 5IBWA 1DMOA 1K95A 3LCPC 3AAJA 1SL8A 2K7OA 1B9AA 2KOTA 4FQOA 2I7AA 5HLOA 2M29A 1E8AA 2OS8C 1D1OA 4A4CA 1S5GY 5JOLA 4CFRA 4WQ2A 4A4BA 3FWBA 1K96A 3PN7B 1MF8B 1B8RA 1Y1AA 3VRQA 3EVRA 1QX2A 1ALWA 2KNEA 1FI6A 1N0YA 1RTP1 1WDCC 3SG6A 2BCAA 4HRGA 1KK7Y 3C1VA 1U5IB 3KHEA 2F2OA 1R2UA 2KSPA 2P6BB 3AKAA 5HYDA 2MLFC 1J7QA 5ER5A 2WCBA 3I5HB 4CLNA 1OE9B 1CM4A 4YGEB 2BE6A 1SK6D 3I5FB 1DJZA 2JOJA 1K9KA 3PSRA 4GBAA 4GAOA 4MSPA 1FI5A 3A8RA 2K2AA 2KI6C 5AXIA 1AK8A 2MHHA 3CR4X 2KAYA 1NUBA 1G33A 1L7ZA 3PLFB 2KI4B 1SBJA 4F0ZB 1YUSA 2PMYA 3K21A 5KSZA 2O5GA 1GQMA 2F2PA 2MA2A 2ZNDA 3FWCA 1PSBA 4PHMA 4UPGA 1B1GA 1CFFA 4FTGA 1QJTA 1IH0A 2KQYA 1G8IA 3WNXB 1RFJA 2QPTA 4NDBA 3MSEB 2HQ8A 4MEWA 1S3PA 4I5NB 4TNCA 1K8UA 2EHBA 2WOSA 3PATA 3HCMA 3AKBA 4MZKA 3OX5A 3HX4A 2EC6B 2GV5A 1TNXA 1ODBA 1AUIB 4XJKA 1XFWO 1CDPA 1MXLC 1LA0A 4YGAA 2HETA 2LLUA 1J1DA 1ZFSA 4OV2A 3VROA 1FF1A 2OS8B 1F71A 1JWDA 4MN0A 2LLTA 1S1EA 3TUYC 1KQMC 1A75A 2KFGA 4PHJA 2KQ6A 1B7TZ 3I5IC 2CTNA 3JTDC 1MUXA 2BCXA 2LVKA 3KO0A 4P5OE 1BG1A 1WDCB 2D8NA 2PALA 1XK4C 4PE4A 2PSRA 1K2HA 5AEQA 1C07A 3BUOB 4P2YB 4YGDB 1B4CA 2FCDA 1YUTA 4MLWA 1A4PA 1RECA 3EVUA 1UURA 2JC2A 1OQPA 3SIBA 1GGWA 1SRAA 3CR2A 1XA5A 2NZ0A 1CLBA 1XO5A 1GJYA 3EKJA 4AQIA 4PALA 2KGRA 3BUNB 1JFKA 5F6TA 1AVSA 3DVEA 1CTRA 1YUUA 2PASA 2VRGA 2LLSA 1NP8A 1K90D 1ZUZA 3OHMB 1MR8A 1QVIZ 4YRUA 2ZKMX 4C0KA 3NSKA 2SASA 4DIRA 1KFXS 1YR5A 2AUCA 1M45A 2KDHA 2ZRTA 1ZOTB 3FIAA 2FOTA 1QIVA 1H8BA 3VGOA 1XYDA 3GK1A 1J1EA 2L4HA 4I5JA 1SW8A 1QV1A 1TNWA 3PFVA 2KYCA 1KWOC 2Y4QA 1SPYA 1UHHA 4GFTA 5B8IB 5CSNA 3IQQA 1S6IA 2K7DA 1NX2A 2WORA 1NWDA 2JTTA 1DF0A 3NXAA 1BR1B 2GGMA 4PHNA 3VRPA 5ER4X 3SJSA 1Q80A 3AAKA 3BOWB 4DCKA 3JVTC 2CBLA 4MZLA 2LE9B 3WHTB 2BE4A 1IQ3A 1IG5A 2ZRSA 3TUYB 1IJ5A 3LK1A 3PM8A 2PRUA 4CPVA 3KF9A 1WLZA 1KQMB 2TN4A 4BY4A 1JFJA 4N5XA 3I5IB 1CLLA 1V1FA 3EVVA 3JTDB 3CLNA 1KQVA 4GGNA 4C0LA 2JNXA 4E68A 3OB2B 1OOJA 4U8DA 1CLMA 1TN4A 4MRYA 2I18A 3FS7A 1TRFA 4QJ5B 1BF5A 1A03A 3H4SE 5BPJA 3CWGA 1DJIA 4M2QA 1L2OC 5DKQA 3EKHA 2K0JA 3IQOA 3CGAA 3DVKA 1G4YR 1PK0D 4OR9B 2LUCA 2O60A 2BECA 2WCFA 1KCYA 1RROA 2NCOA 3TDIA 3VRRA 1K9PA 2JWWA 1JBAA 5CSIA 3IF7A 4M2OA 4JWQA 2JULA 1SR6C 1QX5B 3TDZA 5I8NA 1KSOA 3CR5X 1RK9A 4IL1A 3SG7A 1MWNA 3NSOA 1CFDA 4Q04A 3D10A 4PCWA 1IRJA 3EK4A 4GGFC 5KTYA 1LA3A 1CMGA 1NSHA 2QACA 1CMFA 1BODA 1U5IA 3OB1B 1A2XA 1QASA 2E6WA 1WRZA 3LLEA 1R6PA 1FPWA 2LMUA 2KYFA 1KK8C 1OMDA 1M63B 2M0RA 3DVJA 5DKRA 4HREE 2LP2A 1LKJA 1EG4A 1KWOB 2FCEA 1EG3A 1IGVA 3OX6A 2M97A 1TIZA 2H61C 3GK4X 1OMRA 2KI6D 2LMTA 1NX0A 2KFFA 2L51A 1F55A 1RWYA 3M0WA 1JUOA 2M1KB 2LNKA 2L0PA 1HQVA 2KGBC 3JVTB 1BR4B 3O4YA 2L98A 3BQ3A 2CNPA 1PVBA 2BKIB 3CTNA 4MBEA 1M31A 1NYAA 1SMGA 2K7CA 1LVCD 3D0YB 1EH2A 4HSZA 1WLMA 3GK2A 4OCIA 5TNCA 4AQJA 2MRDA 2V53A 1BLQA 4JPZB 2JPTA 1QV0A 1YRTB 5KU1A 1CFPA 2ZN8A 2JXCA 1HT9A 1AJ5A 1QIWA 1Y1UA 2OTGC 4ICBA 4MVFA 1YURA 3I5GC 4WRIA 1C7VA 1QLKA 1L2OB 2MAZA 1A29A 3VRNA 1YVLA 1CFCA 4M2PA 1LINA 2WCEA 4DS7A 1WRKA 3GOFA 3ZWHA 3BXKA 1EXRA 2M7LA 2JU0A 2FJUB 2LVJA 1S5GZ 5AANA 3TDUA 1N65A 1SR6B 1DJHA 2F8PA 1J7OA 1DT7B 1SL9A 2NLNA 2Y1MA 3SG4A 1S36A 2F3YA 1SY9A 2L4IA 4L9MA 4JQ0D 1KK7Z 3D0YA 3ICBA 4BY5A 1YX8A 2ZNEA 2I2RE 1V1GA 2M49B 4CFQA 1NCZA 1NX3A 1CNPA 1W7JB 1SYMA 4I5KA 1IJ6A 1DJWA 3DD4A 4PE1A 2JRFA 1TCOB 2BL0C 2M3WA 5I2QA 1FBVA 1KK8B 1OZSA 2I94A 1PVAA 1KFXL 2PVBA 3LK0A 1SCMC 1KFUS 2LMVA 4GPLB 1QX7A 1F70A 1QXPA 3NSIA 1J55A 2M9GA 1UWOA 4YGCB 1H4BA 1M46A 5FYXA 1B7TY 3E3RA 3SG5A 3DVMA 2WC8A 2Y1NA 4YI8A 5HKWA 2LCPA 3CS1A 1SNLA 2M1UA 4OVNF 1CM1A 2NCPA 1J7PA 1YTZC 5D69A 3A4UB 1Y1XA 5HLVA 2ZFDA 2JTZA 1BT6A 1DJYA 2JQ6A 3SG3A 1UHJA 2JT3A 5K89A 5AERA 1YVHA 1XVJA 2HF5A 3BYAA 1OSAA 2E30A 1B8CA 2F3ZA 4NDCA 1FW4A 2MJWB 1S26D 4GUKA 2WNDA 3OP0A 1AHRA 2BKHB 2KBMA 3WHUB 2OTGB 5DKNA 1CDNA 1BOCA 3I5GB 1JF2A 2MBXA 2HQWA 5JJGA 1AP4A 1B47A 1IWQA 1DJGA 1QS7A 1K94A 5GQQC 5HKZA 1XFUO 1TNQA 2H61A 2SCPA 1QVIY 2M8UA 2Q4UA 4C0JA 4NQGA 4YBHB 1CKKA 4PHKA 3BOWA 2GGZA 2KBIA 1KSMA 1YX7A 2LV7A 2CT9A 1NCXA 2G9BA 2LM5A 3DF0B 1C7WA 1DVIA 1TOPA 4R1EA 3BUXB 4WQ3A 3LL8B 2LP3A 2L5XB 4PE7A 1SL7A 1F8HA 1Y0VH 2ZN9A 1F4OA 2AMIA 2BBNA 2Q91A 4USLA 1DJXA 4NDDA 1IKUA 1LXFC 1XK4A 1K9UA 3PALA 1Y6WA 2A4JA 4XJKB 1QATA 2ISDA 1TTXA 2JNFA 2LHIA 1MHOA 3NSLA 1OZOA 1WY9A 2BL0B 3SG2A 1SKTA 4HRHA 1TCFA 1TNPA 2Y5IA 1SCMB 2KAXA 2MLEC 1ZACA 2HPSA 1ZMZA 2H2KA 2K8MB 1PSRA 3TZ1A 1A75B 1RJVA 3EK7A 2L50A 1B8LA 3RLZA 3O2PA 1S6CA 4MZJA 1S6JA 4OKHA 3TS5C 2AAOA 2BBMA 2CCMA 3DF0A 5D7FA 1CB1A 2LUXA 4DUQA 1F4QA 3ZNIA 3EK8A 1CDMA 1EL4A 1ALVA 2KHNA 1CDLA 3WXAA 1EJ3A 1NIWA 4QJ3B 2JT8A 1AJ4A 1UHKA 1XFXO 4N1GA 2JZIA 1NCYA 1XFVO 2CXJA 1JF0A 1F54A 5G08A 2IS9A 2RGIA 1SCVA 3QRXA 3PN7C 1PALA 2NXQA 1N2DA 4PE0A 4ORCB 3CZTX 4ORAB 1NPQA
chains in the Genus database with same CATH superfamily
3D75A 5CSFA 3O6BA 1BMOA 2JT0A 3BUWB 5I2OA 1DGVA 2G2BA 2KAVA 2LANA 3I5HC 1JC2A 3SIAA 2B1UA 2BCBA 1MQ1A 2F33A 5CPVA 4YGBB 2OPOA 2DOQA 1IQ5A 1BJFA 1UP5A 3I5FC 5CSJA 4PDZA 4GNKB 1XFZO 1OOIX 4ETOA 1X02A 2COLB 2L2EA 2M7NA 1WRLA 1UUSA 1MXEA 1VRKA 4PT1A 2KLDA 2KFHA 1GGZA 5I2LA 3O78A 1DF0B 4JD9A 1BU3A 2KI4C 1XFYO 3S0BA 4D1EA 1PRWA 1DEKA 4I5LB 5HKYA 2PQLA 1PULA 5PALA 1C3YA 1W7IB 1YRUB 3KPXA 1QLSA 4ZCUA 4XYNA 4QJ4B 2LVIA 1UHNA 3Q8IA 3KEVA 3B87A 1DTLA 1UHIA 2LHLA 4ZCVA 1JSAA 4AOMA 4DRWA 1DGUA 1M39A 3SS3A 3TS5B 1OMVA 1NX1A 2K7BA 4YI9A 1QTXA 5J3XA 1KFUL 2K61A 2LAPA 2R2IA 4CIDA 4N1FA 3RM1A 2JXLA 4MRXA 4GGFA 2LVVA 2EGDA 3S0AA 3B86A 2EC6C 1J7RA 5AFPA 4ORBB 3PM2A 2LC5A 3F45A 2K2FA 1K93D 3BUMB 5IBWA 1DMOA 1K95A 3LCPC 3AAJA 1SL8A 2K7OA 1B9AA 2KOTA 3FE9A 4FQOA 2I7AA 5HLOA 1GM0A 2M29A 1E8AA 2OS8C 1D1OA 4A4CA 1S5GY 5JOLA 4CFRA 4WQ2A 2BAPA 4A4BA 3FWBA 1K96A 3PN7B 3CABA 2JPOA 4INWA 1MF8B 1B8RA 1Y1AA 3VRQA 3EVRA 1QX2A 1ALWA 1OOHA 2KNEA 1N0YA 1RTP1 1WDCC 3SG6A 2BNXA 1FI6A 2BCAA 4HRGA 3BFHA 1KK7Y 3C1VA 1U5IB 3S0DA 3KHEA 2F2OA 1R2UA 2KSPA 2P6BB 3AKAA 5HYDA 2MLFC 1J7QA 5ER5A 2WCBA 3I5HB 3B6XA 1OE9B 4CLNA 1CM4A 3RZSA 4YGEB 2BE6A 1SK6D 3I5FB 3OGNA 2P71A 1DJZA 2JOJA 1K9KA 3PSRA 4GBAA 4GAOA 4MSPA 1FI5A 3A8RA 3O4XA 2K2AA 2KI6C 5AXIA 1AK8A 2MHHA 3CR4X 2KAYA 1NUBA 1G33A 1L7ZA 3PLFB 2KI4B 1SBJA 4F0ZB 1YUSA 2PMYA 3K21A 2K60A 5KSZA 2O5GA 1GQMA 2F2PA 2MA2A 2ZNDA 3FWCA 3NHIA 1Z2CB 1PSBA 4PHMA 4UPGA 1B1GA 1CFFA 4FTGA 1QJTA 1IH0A 2KQYA 1G8IA 3WNXB 1RFJA 2QPTA 4NDBA 3MSEB 3PJIA 2HQ8A 4MEWA 1S3PA 4I5NB 4TNCA 1K8UA 2EHBA 2WOSA 3PATA 3HCMA 3AKBA 4MZKA 3OX5A 5FI7A 3HX4A 5FI6A 2EC6B 2GV5A 1TNXA 1ODBA 1AUIB 2QEOA 4XJKA 1XFWO 3UO9A 1CDPA 1MXLC 1LA0A 4YGAA 2HETA 2LLUA 1J1DA 1ZFSA 3R1VA 4OV2A 3VROA 1FF1A 2OS8B 3EG5B 1F71A 1JWDA 4MN0A 2LLTA 1OW4A 1S1EA 4OZDA 3TUYC 1KQMC 1A75A 2KFGA 4PHJA 2KQ6A 1B7TZ 3I5IC 2CTNA 3JTDC 1MUXA 2BCXA 2LVKA 3KO0A 4P5OE 1BG1A 3CZ1A 1WDCB 2D8NA 2PALA 1OOFA 1XK4C 4PE4A 1XFRA 2PSRA 1K2HA 5AEQA 1C07A 3BUOB 4P2YB 4YGDB 1B4CA 2FCDA 1YUTA 4MLWA 3BFAA 1DC1A 1A4PA 1RECA 3EVUA 1UURA 2JC2A 2PYQA 1OQPA 3SIBA 1GGWA 1SRAA 3CR2A 1XA5A 2NZ0A 1CLBA 1XO5A 1GJYA 3EKJA 4AQIA 4PALA 2KGRA 3BUNB 1JFKA 5F6TA 3B88A 1AVSA 3DVEA 3CZ2A 1CTRA 1YUUA 2PASA 2VRGA 2LLSA 1NP8A 1K90D 1TUZA 1ZUZA 3OHMB 1MR8A 1QVIZ 4YRUA 2ZKMX 4C0KA 3NSKA 2SASA 4DIRA 1KFXS 1YR5A 2AUCA 1M45A 2KDHA 2ZRTA 1ZOTB 3FIAA 2FOTA 1QIVA 1H8BA 3VGOA 1XYDA 3GK1A 1J1EA 2L4HA 4I5JA 1SW8A 1QV1A 1TNWA 3PFVA 2KYCA 1KWOC 2Y4QA 1SPYA 1UHHA 4GFTA 5B8IB 5CSNA 3DXLA 3IQQA 1S6IA 2K7DA 1NX2A 2WORA 1NWDA 2JTTA 1DF0A 3NXAA 1BR1B 2GGMA 4PHNA 3VRPA 5ER4X 3SJSA 1Q80A 3AAKA 3BOWB 4DCKA 3JVTC 2CBLA 4MZLA 2H8VA 1T14A 2LE9B 3SS4A 3WHTB 2BE4A 1IQ3A 1IG5A 2ZRSA 3TUYB 1IJ5A 3LK1A 3NGVA 2PRUA 3PM8A 4CPVA 3KF9A 1WLZA 1KQMB 2TN4A 4BY4A 1JFJA 4N5XA 3I5IB 1CLLA 1V1FA 3EVVA 3QMEA 3JTDB 3DYEA 3CLNA 1KQVA 4GGNA 4C0LA 2JNXA 4E68A 3OB2B 1OOJA 4U8DA 1CLMA 1P28A 2GTEA 1TN4A 3BJHA 2I18A 3FS7A 1TRFA 4MRYA 4QJ5B 1BF5A 1A03A 2ERBA 3H4SE 5BPJA 3CWGA 1DJIA 3N7HA 4M2QA 1L2OC 1ORGA 5DKQA 3CYZA 3EKHA 2L2CA 2K0JA 3IQOA 1W9ZA 2KPHA 3CGAA 4JKTA 3DVKA 1G4YR 1PK0D 4OR9B 2LUCA 2O60A 2BECA 2WCFA 1KCYA 1RROA 2NCOA 3TDIA 3VRRA 1K9PA 2JWWA 2WCJA 1JBAA 5CSIA 3IF7A 4M2OA 4JWQA 2JULA 1SR6C 1QX5B 2WCKA 3TDZA 5I8NA 1KSOA 3CR5X 1RK9A 4IL1A 2WCHA 3SG7A 1MWNA 3NSOA 1CFDA 4Q04A 3D10A 4IJ7A 4PCWA 1IRJA 3EK4A 4GGFC 5KTYA 1LA3A 1CMGA 1NSHA 2QACA 1CMFA 1BODA 1U5IA 3FE6A 3OB1B 1A2XA 1QASA 2E6WA 1WRZA 3LLEA 3V2LA 1R6PA 3BFBA 1FPWA 2LMUA 2KYFA 1KK8C 1OMDA 1M63B 2M0RA 3DVJA 5DKRA 4HREE 2LP2A 1LKJA 1EG4A 1KWOB 2FCEA 1EG3A 1IGVA 3OX6A 2M97A 1TIZA 2H61C 3GK4X 1OMRA 2KI6D 2LMTA 1NX0A 5FI2A 2KFFA 2L51A 1F55A 1RWYA 3M0WA 1JUOA 2M1KB 2LNKA 2WCMA 2L0PA 1HQVA 1OOGA 2KGBC 3JVTB 1BR4B 3O4YA 2L98A 2WC6A 3BQ3A 3D78A 2CNPA 1PVBA 3D77A 2BKIB 2QEHA 3CTNA 4MBEA 1M31A 1NYAA 1SMGA 2K7CA 2KLEA 1LVCD 3D0YB 1EH2A 3R1PA 4FQTA 4HSZA 1WLMA 3GK2A 4OCIA 5TNCA 4AQJA 2MRDA 2V53A 3UNWA 1BLQA 4JPZB 2JPTA 1QV0A 1YRTB 5KU1A 1CFPA 2ZN8A 2JXCA 1HT9A 1AJ5A 1QIWA 1Y1UA 2OTGC 4ICBA 4MVFA 1YURA 3I5GC 4WRIA 1C7VA 1QLKA 1TUJA 1L2OB 2MAZA 1A29A 3VRNA 1YVLA 1CFCA 4M2PA 1LINA 2WCEA 4DS7A 2QEBA 1WRKA 3GOFA 3ZWHA 3BXKA 1EXRA 2M7LA 2JU0A 4F7FA 2FJUB 2LVJA 3S0EA 1S5GZ 3NHTA 5AANA 3TDUA 1N65A 1SR6B 1DJHA 1Z4HA 2F8PA 1J7OA 1DT7B 1SL9A 2NLNA 2Y1MA 3SG4A 1S36A 2F3YA 1SY9A 2L4IA 4L9MA 5HL1A 4JQ0D 1KK7Z 3D0YA 3ICBA 3IVTA 4BY5A 1YX8A 2ZNEA 2I2RE 3L4AA 2WCLA 1V1GA 2M49B 4CFQA 1NCZA 1NX3A 1SSEB 1CNPA 3L47A 1W7JB 1SYMA 4I5KA 1IJ6A 1DJWA 3DD4A 4PE1A 2JRFA 1TCOB 2BL0C 2M3WA 5I2QA 3D76A 1FBVA 1KK8B 1OZSA 2I94A 1PVAA 1KFXL 1DQEA 2PVBA 3LK0A 1SCMC 1KFUS 2LMVA 4GPLB 1QX7A 1F70A 1QXPA 3NSIA 1J55A 2M9GA 2QEVA 1UWOA 4YGCB 3OBVA 1H4BA 1M46A 5FYXA 1B7TY 3E3RA 3SG5A 3DVMA 2WC8A 4KYNA 2Y1NA 4YI8A 5HKWA 2LCPA 3CS1A 1SNLA 2M1UA 3VB1A 4OVNF 1CM1A 2NCPA 1J7PA 1YTZC 5D69A 3A4UB 1Y1XA 5HLVA 2ZFDA 2JTZA 1BT6A 1DJYA 2JQ6A 3SG3A 1UHJA 2JT3A 5K89A 5AERA 1YVHA 1XVJA 2HF5A 3BYAA 1OSAA 2E30A 1B8CA 2F3ZA 4NDCA 1FW4A 2MJWB 1S26D 5EL2A 4GUKA 2WNDA 3OP0A 1AHRA 2BKHB 2KBMA 3WHUB 2OTGB 5DKNA 1CDNA 1BOCA 3I5GB 1JF2A 3S0FA 2MBXA 2HQWA 5DICA 5JJGA 1AP4A 1B47A 1IWQA 1DJGA 1QS7A 1K94A 1C3ZA 4INXA 1XFUO 5GQQC 5HKZA 1TNQA 2H61A 2SCPA 1QVIY 2M8UA 2Q4UA 4C0JA 4NQGA 4YBHB 1CKKA 4PHKA 1LS8A 3BOWA 2GGZA 2KBIA 1KSMA 5I94A 1YX7A 2LV7A 2CT9A 1NCXA 2G9BA 2LM5A 3DF0B 1C7WA 1DVIA 1TOPA 4R1EA 3BUXB 4WQ3A 3LL8B 2LP3A 2L5XB 3D73A 2WC5A 3FE8A 4PE7A 1SL7A 1F8HA 1Y0VH 1QWVA 2ZN9A 1F4OA 2AMIA 2BBNA 2FJYA 2Q91A 4USLA 1DJXA 4NDDA 1IKUA 2P70A 1LXFC 3DY9A 1XK4A 1K9UA 3PALA 1Y6WA 2A4JA 3DZTA 4XJKB 1DELA 1QATA 2ISDA 3R1OA 1TTXA 2JNFA 2LHIA 1MHOA 2YGUA 3NSLA 1OZOA 1WY9A 2BL0B 3SG2A 3CDNA 1SKTA 3CZ0A 4HRHA 1TCFA 1TNPA 2Y5IA 1SCMB 2KAXA 2MLEC 1ZACA 2HPSA 1IIOA 1ZMZA 2H2KA 3R72A 2K8MB 1PSRA 3TZ1A 1A75B 1RJVA 3EK7A 2L50A 1B8LA 3RLZA 3O2PA 1S6CA 4MZJA 1S6JA 4OKHA 3TS5C 2AAOA 2BBMA 3D74A 2CCMA 3DF0A 3SS5A 5D7FA 1CB1A 1TWOA 3L4LA 2LUXA 3B7AA 4DUQA 1F4QA 3ZNIA 3EK8A 1CDMA 1EL4A 5D3OA 1ALVA 2KHNA 1CDLA 3K1EA 3WXAA 1EJ3A 1NIWA 4QJ3B 2JT8A 1AJ4A 1UHKA 1XFXO 4N1GA 2JZIA 1NCYA 1XFVO 3S0GA 2CXJA 1JF0A 1F54A 5G08A 2IS9A 2RGIA 1SCVA 3QRXA 3PN7C 1PALA 2L5YA 2NXQA 1N2DA 4PE0A 4ORCB 3CZTX 4ORAB 1NPQA 2QDIA
chains in the Genus database with same CATH topology
5CSFA 3O6BA 1BMOA 2JT0A 3BUWB 5I2OA 1DGVA 2G2BA 2KAVA 2LANA 3I5HC 1JC2A 3SIAA 2B1UA 2BCBA 1MQ1A 2F33A 5CPVA 4YGBB 2OPOA 2DOQA 1IQ5A 1BJFA 1UP5A 3I5FC 5CSJA 4PDZA 4GNKB 1XFZO 4ETOA 1X02A 2COLB 2L2EA 2M7NA 1WRLA 1UUSA 1MXEA 1VRKA 2KFHA 1GGZA 5I2LA 3O78A 1DF0B 1BU3A 2KI4C 1XFYO 4D1EA 1PRWA 4I5LB 5HKYA 1PULA 5PALA 1W7IB 1YRUB 3KPXA 1QLSA 4ZCUA 4XYNA 4QJ4B 2LVIA 1UHNA 3KEVA 1DTLA 1UHIA 2LHLA 4ZCVA 1JSAA 4AOMA 4DRWA 1DGUA 1M39A 3TS5B 1OMVA 1NX1A 2K7BA 4YI9A 1QTXA 5J3XA 1KFUL 2K61A 2LAPA 2R2IA 4CIDA 4N1FA 3RM1A 2JXLA 4MRXA 4GGFA 2LVVA 2EGDA 2EC6C 1J7RA 5AFPA 4ORBB 2LC5A 3F45A 2K2FA 1K93D 3BUMB 5IBWA 1DMOA 1K95A 3LCPC 3AAJA 1SL8A 2K7OA 1B9AA 2KOTA 4FQOA 2I7AA 5HLOA 2M29A 1E8AA 2OS8C 1D1OA 4A4CA 1S5GY 5JOLA 4CFRA 4WQ2A 4A4BA 3FWBA 1K96A 3PN7B 1MF8B 1B8RA 1Y1AA 3VRQA 3EVRA 1QX2A 1ALWA 2KNEA 1FI6A 1N0YA 1RTP1 1WDCC 3SG6A 2BCAA 4HRGA 1KK7Y 3C1VA 1U5IB 3KHEA 2F2OA 1R2UA 2KSPA 2P6BB 3AKAA 5HYDA 2MLFC 1J7QA 5ER5A 2WCBA 3I5HB 4CLNA 1OE9B 1CM4A 4YGEB 2BE6A 1SK6D 3I5FB 1DJZA 2JOJA 1K9KA 3PSRA 4GBAA 4GAOA 4MSPA 1FI5A 3A8RA 2K2AA 2KI6C 5AXIA 1AK8A 2MHHA 3CR4X 2KAYA 1NUBA 1G33A 1L7ZA 3PLFB 2KI4B 1SBJA 4F0ZB 1YUSA 2PMYA 3K21A 5KSZA 2O5GA 1GQMA 2F2PA 2MA2A 2ZNDA 3FWCA 1PSBA 4PHMA 4UPGA 1B1GA 1CFFA 4FTGA 1QJTA 1IH0A 2KQYA 1G8IA 3WNXB 1RFJA 2QPTA 4NDBA 3MSEB 2HQ8A 4MEWA 1S3PA 4I5NB 4TNCA 1K8UA 2EHBA 2WOSA 3PATA 3HCMA 3AKBA 4MZKA 3OX5A 3HX4A 2EC6B 2GV5A 1TNXA 1ODBA 1AUIB 4XJKA 1XFWO 1CDPA 1MXLC 1LA0A 4YGAA 2HETA 2LLUA 1J1DA 1ZFSA 4OV2A 3VROA 1FF1A 2OS8B 1F71A 1JWDA 4MN0A 2LLTA 1S1EA 3TUYC 1KQMC 1A75A 2KFGA 4PHJA 2KQ6A 1B7TZ 3I5IC 2CTNA 3JTDC 1MUXA 2BCXA 2LVKA 3KO0A 4P5OE 1BG1A 1WDCB 2D8NA 2PALA 1XK4C 4PE4A 2PSRA 1K2HA 5AEQA 1C07A 3BUOB 4P2YB 4YGDB 1B4CA 2FCDA 1YUTA 4MLWA 1A4PA 1RECA 3EVUA 1UURA 2JC2A 1OQPA 3SIBA 1GGWA 1SRAA 3CR2A 1XA5A 2NZ0A 1CLBA 1XO5A 1GJYA 3EKJA 4AQIA 4PALA 2KGRA 3BUNB 1JFKA 5F6TA 1AVSA 3DVEA 1CTRA 1YUUA 2PASA 2VRGA 2LLSA 1NP8A 1K90D 1ZUZA 3OHMB 1MR8A 1QVIZ 4YRUA 2ZKMX 4C0KA 3NSKA 2SASA 4DIRA 1KFXS 1YR5A 2AUCA 1M45A 2KDHA 2ZRTA 1ZOTB 3FIAA 2FOTA 1QIVA 1H8BA 3VGOA 1XYDA 3GK1A 1J1EA 2L4HA 4I5JA 1SW8A 1QV1A 1TNWA 3PFVA 2KYCA 1KWOC 2Y4QA 1SPYA 1UHHA 4GFTA 5B8IB 5CSNA 3IQQA 1S6IA 2K7DA 1NX2A 2WORA 1NWDA 2JTTA 1DF0A 3NXAA 1BR1B 2GGMA 4PHNA 3VRPA 5ER4X 3SJSA 1Q80A 3AAKA 3BOWB 4DCKA 3JVTC 2CBLA 4MZLA 2LE9B 3WHTB 2BE4A 1IQ3A 1IG5A 2ZRSA 3TUYB 1IJ5A 3LK1A 3PM8A 2PRUA 4CPVA 3KF9A 1WLZA 1KQMB 2TN4A 4BY4A 1JFJA 4N5XA 3I5IB 1CLLA 1V1FA 3EVVA 3JTDB 3CLNA 1KQVA 4GGNA 4C0LA 2JNXA 4E68A 3OB2B 1OOJA 4U8DA 1CLMA 1TN4A 4MRYA 2I18A 3FS7A 1TRFA 4QJ5B 1BF5A 1A03A 3H4SE 5BPJA 3CWGA 1DJIA 4M2QA 1L2OC 5DKQA 3EKHA 2K0JA 3IQOA 3CGAA 3DVKA 1G4YR 1PK0D 4OR9B 2LUCA 2O60A 2BECA 2WCFA 1KCYA 1RROA 2NCOA 3TDIA 3VRRA 1K9PA 2JWWA 1JBAA 5CSIA 3IF7A 4M2OA 4JWQA 2JULA 1SR6C 1QX5B 3TDZA 5I8NA 1KSOA 3CR5X 1RK9A 4IL1A 3SG7A 1MWNA 3NSOA 1CFDA 4Q04A 3D10A 4PCWA 1IRJA 3EK4A 4GGFC 5KTYA 1LA3A 1CMGA 1NSHA 2QACA 1CMFA 1BODA 1U5IA 3OB1B 1A2XA 1QASA 2E6WA 1WRZA 3LLEA 1R6PA 1FPWA 2LMUA 2KYFA 1KK8C 1OMDA 1M63B 2M0RA 3DVJA 5DKRA 4HREE 2LP2A 1LKJA 1EG4A 1KWOB 2FCEA 1EG3A 1IGVA 3OX6A 2M97A 1TIZA 2H61C 3GK4X 1OMRA 2KI6D 2LMTA 1NX0A 2KFFA 2L51A 1F55A 1RWYA 3M0WA 1JUOA 2M1KB 2LNKA 2L0PA 1HQVA 2KGBC 3JVTB 1BR4B 3O4YA 2L98A 3BQ3A 2CNPA 1PVBA 2BKIB 3CTNA 4MBEA 1M31A 1NYAA 1SMGA 2K7CA 1LVCD 3D0YB 1EH2A 4HSZA 1WLMA 3GK2A 4OCIA 5TNCA 4AQJA 2MRDA 2V53A 1BLQA 4JPZB 2JPTA 1QV0A 1YRTB 5KU1A 1CFPA 2ZN8A 2JXCA 1HT9A 1AJ5A 1QIWA 1Y1UA 2OTGC 4ICBA 4MVFA 1YURA 3I5GC 4WRIA 1C7VA 1QLKA 1L2OB 2MAZA 1A29A 3VRNA 1YVLA 1CFCA 4M2PA 1LINA 2WCEA 4DS7A 1WRKA 3GOFA 3ZWHA 3BXKA 1EXRA 2M7LA 2JU0A 2FJUB 2LVJA 1S5GZ 5AANA 3TDUA 1N65A 1SR6B 1DJHA 2F8PA 1J7OA 1DT7B 1SL9A 2NLNA 2Y1MA 3SG4A 1S36A 2F3YA 1SY9A 2L4IA 4L9MA 4JQ0D 1KK7Z 3D0YA 3ICBA 4BY5A 1YX8A 2ZNEA 2I2RE 1V1GA 2M49B 4CFQA 1NCZA 1NX3A 1CNPA 1W7JB 1SYMA 4I5KA 1IJ6A 1DJWA 3DD4A 4PE1A 2JRFA 1TCOB 2BL0C 2M3WA 5I2QA 1FBVA 1KK8B 1OZSA 2I94A 1PVAA 1KFXL 2PVBA 3LK0A 1SCMC 1KFUS 2LMVA 4GPLB 1QX7A 1F70A 1QXPA 3NSIA 1J55A 2M9GA 1UWOA 4YGCB 1H4BA 1M46A 5FYXA 1B7TY 3E3RA 3SG5A 3DVMA 2WC8A 2Y1NA 4YI8A 5HKWA 2LCPA 3CS1A 1SNLA 2M1UA 4OVNF 1CM1A 2NCPA 1J7PA 1YTZC 5D69A 3A4UB 1Y1XA 5HLVA 2ZFDA 2JTZA 1BT6A 1DJYA 2JQ6A 3SG3A 1UHJA 2JT3A 5K89A 5AERA 1YVHA 1XVJA 2HF5A 3BYAA 1OSAA 2E30A 1B8CA 2F3ZA 4NDCA 1FW4A 2MJWB 1S26D 4GUKA 2WNDA 3OP0A 1AHRA 2BKHB 2KBMA 3WHUB 2OTGB 5DKNA 1CDNA 1BOCA 3I5GB 1JF2A 2MBXA 2HQWA 5JJGA 1AP4A 1B47A 1IWQA 1DJGA 1QS7A 1K94A 5GQQC 5HKZA 1XFUO 1TNQA 2H61A 2SCPA 1QVIY 2M8UA 2Q4UA 4C0JA 4NQGA 4YBHB 1CKKA 4PHKA 3BOWA 2GGZA 2KBIA 1KSMA 1YX7A 2LV7A 2CT9A 1NCXA 2G9BA 2LM5A 3DF0B 1C7WA 1DVIA 1TOPA 4R1EA 3BUXB 4WQ3A 3LL8B 2LP3A 2L5XB 4PE7A 1SL7A 1F8HA 1Y0VH 2ZN9A 1F4OA 2AMIA 2BBNA 2Q91A 4USLA 1DJXA 4NDDA 1IKUA 1LXFC 1XK4A 1K9UA 3PALA 1Y6WA 2A4JA 4XJKB 1QATA 2ISDA 1TTXA 2JNFA 2LHIA 1MHOA 3NSLA 1OZOA 1WY9A 2BL0B 3SG2A 1SKTA 4HRHA 1TCFA 1TNPA 2Y5IA 1SCMB 2KAXA 2MLEC 1ZACA 2HPSA 1ZMZA 2H2KA 2K8MB 1PSRA 3TZ1A 1A75B 1RJVA 3EK7A 2L50A 1B8LA 3RLZA 3O2PA 1S6CA 4MZJA 1S6JA 4OKHA 3TS5C 2AAOA 2BBMA 2CCMA 3DF0A 5D7FA 1CB1A 2LUXA 4DUQA 1F4QA 3ZNIA 3EK8A 1CDMA 1EL4A 1ALVA 2KHNA 1CDLA 3WXAA 1EJ3A 1NIWA 4QJ3B 2JT8A 1AJ4A 1UHKA 1XFXO 4N1GA 2JZIA 1NCYA 1XFVO 2CXJA 1JF0A 1F54A 5G08A 2IS9A 2RGIA 1SCVA 3QRXA 3PN7C 1PALA 2NXQA 1N2DA 4PE0A 4ORCB 3CZTX 4ORAB 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSF A;  3O6B A;  1BMO A;  2JT0 A;  3BUW B;  5I2O A;  1DGV A;  2G2B A;  2KAV A;  2LAN A;  3I5H C;  1JC2 A;  3SIA A;  2B1U A;  2BCB A;  1MQ1 A;  2F33 A;  5CPV A;  4YGB B;  2OPO A;  2DOQ A;  1IQ5 A;  1BJF A;  1UP5 A;  3I5F C;  5CSJ A;  4PDZ A;  4GNK B;  1XFZ O;  4ETO A;  1X02 A;  2COL B;  2L2E A;  2M7N A;  1WRL A;  1UUS A;  1MXE A;  1VRK A;  2KFH A;  1GGZ A;  5I2L A;  3O78 A;  1DF0 B;  1BU3 A;  2KI4 C;  1XFY O;  4D1E A;  1PRW A;  4I5L B;  5HKY A;  1PUL A;  5PAL A;  1W7I B;  1YRU B;  3KPX A;  1QLS A;  4ZCU A;  4XYN A;  4QJ4 B;  2LVI A;  1UHN A;  3KEV A;  1DTL A;  1UHI A;  2LHL A;  4ZCV A;  1JSA A;  4AOM A;  4DRW A;  1DGU A;  1M39 A;  3TS5 B;  1OMV A;  1NX1 A;  2K7B A;  4YI9 A;  1QTX A;  5J3X A;  1KFU L;  2K61 A;  2LAP A;  2R2I A;  4CID A;  4N1F A;  3RM1 A;  2JXL A;  4MRX A;  4GGF A;  2LVV A;  2EGD A;  2EC6 C;  1J7R A;  5AFP A;  4ORB B;  2LC5 A;  3F45 A;  2K2F A;  1K93 D;  3BUM B;  5IBW A;  1DMO A;  1K95 A;  3LCP C;  3AAJ A;  1SL8 A;  2K7O A;  1B9A A;  2KOT A;  4FQO A;  2I7A A;  5HLO A;  2M29 A;  1E8A A;  2OS8 C;  1D1O A;  4A4C A;  1S5G Y;  5JOL A;  4CFR A;  4WQ2 A;  4A4B A;  3FWB A;  1K96 A;  3PN7 B;  1MF8 B;  1B8R A;  1Y1A A;  3VRQ A;  3EVR A;  1QX2 A;  1ALW A;  2KNE A;  1FI6 A;  1N0Y A;  1RTP 1;  1WDC C;  3SG6 A;  2BCA A;  4HRG A;  1KK7 Y;  3C1V A;  1U5I B;  3KHE A;  2F2O A;  1R2U A;  2KSP A;  2P6B B;  3AKA A;  5HYD A;  2MLF C;  1J7Q A;  5ER5 A;  2WCB A;  3I5H B;  4CLN A;  1OE9 B;  1CM4 A;  4YGE B;  2BE6 A;  1SK6 D;  3I5F B;  1DJZ A;  2JOJ A;  1K9K A;  3PSR A;  4GBA A;  4GAO A;  4MSP A;  1FI5 A;  3A8R A;  2K2A A;  2KI6 C;  5AXI A;  1AK8 A;  2MHH A;  3CR4 X;  2KAY A;  1NUB A;  1G33 A;  1L7Z A;  3PLF B;  2KI4 B;  1SBJ A;  4F0Z B;  1YUS A;  2PMY A;  3K21 A;  5KSZ A;  2O5G A;  1GQM A;  2F2P A;  2MA2 A;  2ZND A;  3FWC A;  1PSB A;  4PHM A;  4UPG A;  1B1G A;  1CFF A;  4FTG A;  1QJT A;  1IH0 A;  2KQY A;  1G8I A;  3WNX B;  1RFJ A;  2QPT A;  4NDB A;  3MSE B;  2HQ8 A;  4MEW A;  1S3P A;  4I5N B;  4TNC A;  1K8U A;  2EHB A;  2WOS A;  3PAT A;  3HCM A;  3AKB A;  4MZK A;  3OX5 A;  3HX4 A;  2EC6 B;  2GV5 A;  1TNX A;  1ODB A;  1AUI B;  4XJK A;  1XFW O;  1CDP A;  1MXL C;  1LA0 A;  4YGA A;  2HET A;  2LLU A;  1J1D A;  1ZFS A;  4OV2 A;  3VRO A;  1FF1 A;  2OS8 B;  1F71 A;  1JWD A;  4MN0 A;  2LLT A;  1S1E A;  3TUY C;  1KQM C;  1A75 A;  2KFG A;  4PHJ A;  2KQ6 A;  1B7T Z;  3I5I C;  2CTN A;  3JTD C;  1MUX A;  2BCX A;  2LVK A;  3KO0 A;  4P5O E;  1BG1 A;  1WDC B;  2D8N A;  2PAL A;  1XK4 C;  4PE4 A;  2PSR A;  1K2H A;  5AEQ A;  1C07 A;  3BUO B;  4P2Y B;  4YGD B;  1B4C A;  2FCD A;  1YUT A;  4MLW A;  1A4P A;  1REC A;  3EVU A;  1UUR A;  2JC2 A;  1OQP A;  3SIB A;  1GGW A;  1SRA A;  3CR2 A;  1XA5 A;  2NZ0 A;  1CLB A;  1XO5 A;  1GJY A;  3EKJ A;  4AQI A;  4PAL A;  2KGR A;  3BUN B;  1JFK A;  5F6T A;  1AVS A;  3DVE A;  1CTR A;  1YUU A;  2PAS A;  2VRG A;  2LLS A;  1NP8 A;  1K90 D;  1ZUZ A;  3OHM B;  1MR8 A;  1QVI Z;  4YRU A;  2ZKM X;  4C0K A;  3NSK A;  2SAS A;  4DIR A;  1KFX S;  1YR5 A;  2AUC A;  1M45 A;  2KDH A;  2ZRT A;  1ZOT B;  3FIA A;  2FOT A;  1QIV A;  1H8B A;  3VGO A;  1XYD A;  3GK1 A;  1J1E A;  2L4H A;  4I5J A;  1SW8 A;  1QV1 A;  1TNW A;  3PFV A;  2KYC A;  1KWO C;  2Y4Q A;  1SPY A;  1UHH A;  4GFT A;  5B8I B;  5CSN A;  3IQQ A;  1S6I A;  2K7D A;  1NX2 A;  2WOR A;  1NWD A;  2JTT A;  1DF0 A;  3NXA A;  1BR1 B;  2GGM A;  4PHN A;  3VRP A;  5ER4 X;  3SJS A;  1Q80 A;  3AAK A;  3BOW B;  4DCK A;  3JVT C;  2CBL A;  4MZL A;  2LE9 B;  3WHT B;  2BE4 A;  1IQ3 A;  1IG5 A;  2ZRS A;  3TUY B;  1IJ5 A;  3LK1 A;  3PM8 A;  2PRU A;  4CPV A;  3KF9 A;  1WLZ A;  1KQM B;  2TN4 A;  4BY4 A;  1JFJ A;  4N5X A;  3I5I B;  1CLL A;  1V1F A;  3EVV A;  3JTD B;  3CLN A;  1KQV A;  4GGN A;  4C0L A;  2JNX A;  4E68 A;  3OB2 B;  1OOJ A;  4U8D A;  1CLM A;  1TN4 A;  4MRY A;  2I18 A;  3FS7 A;  1TRF A;  4QJ5 B;  1BF5 A;  1A03 A;  3H4S E;  5BPJ A;  3CWG A;  1DJI A;  4M2Q A;  1L2O C;  5DKQ A;  3EKH A;  2K0J A;  3IQO A;  3CGA A;  3DVK A;  1G4Y R;  1PK0 D;  4OR9 B;  2LUC A;  2O60 A;  2BEC A;  2WCF A;  1KCY A;  1RRO A;  2NCO A;  3TDI A;  3VRR A;  1K9P A;  2JWW A;  1JBA A;  5CSI A;  3IF7 A;  4M2O A;  4JWQ A;  2JUL A;  1SR6 C;  1QX5 B;  3TDZ A;  5I8N A;  1KSO A;  3CR5 X;  1RK9 A;  4IL1 A;  3SG7 A;  1MWN A;  3NSO A;  1CFD A;  4Q04 A;  3D10 A;  4PCW A;  1IRJ A;  3EK4 A;  4GGF C;  5KTY A;  1LA3 A;  1CMG A;  1NSH A;  2QAC A;  1CMF A;  1BOD A;  1U5I A;  3OB1 B;  1A2X A;  1QAS A;  2E6W A;  1WRZ A;  3LLE A;  1R6P A;  1FPW A;  2LMU A;  2KYF A;  1KK8 C;  1OMD A;  1M63 B;  2M0R A;  3DVJ A;  5DKR A;  4HRE E;  2LP2 A;  1LKJ A;  1EG4 A;  1KWO B;  2FCE A;  1EG3 A;  1IGV A;  3OX6 A;  2M97 A;  1TIZ A;  2H61 C;  3GK4 X;  1OMR A;  2KI6 D;  2LMT A;  1NX0 A;  2KFF A;  2L51 A;  1F55 A;  1RWY A;  3M0W A;  1JUO A;  2M1K B;  2LNK A;  2L0P A;  1HQV A;  2KGB C;  3JVT B;  1BR4 B;  3O4Y A;  2L98 A;  3BQ3 A;  2CNP A;  1PVB A;  2BKI B;  3CTN A;  4MBE A;  1M31 A;  1NYA A;  1SMG A;  2K7C A;  1LVC D;  3D0Y B;  1EH2 A;  4HSZ A;  1WLM A;  3GK2 A;  4OCI A;  5TNC A;  4AQJ A;  2MRD A;  2V53 A;  1BLQ A;  4JPZ B;  2JPT A;  1QV0 A;  1YRT B;  5KU1 A;  1CFP A;  2ZN8 A;  2JXC A;  1HT9 A;  1AJ5 A;  1QIW A;  1Y1U A;  2OTG C;  4ICB A;  4MVF A;  1YUR A;  3I5G C;  4WRI A;  1C7V A;  1QLK A;  1L2O B;  2MAZ A;  1A29 A;  3VRN A;  1YVL A;  1CFC A;  4M2P A;  1LIN A;  2WCE A;  4DS7 A;  1WRK A;  3GOF A;  3ZWH A;  3BXK A;  1EXR A;  2M7L A;  2JU0 A;  2FJU B;  2LVJ A;  1S5G Z;  5AAN A;  3TDU A;  1N65 A;  1SR6 B;  1DJH A;  2F8P A;  1J7O A;  1DT7 B;  1SL9 A;  2NLN A;  2Y1M A;  3SG4 A;  1S36 A;  2F3Y A;  1SY9 A;  2L4I A;  4L9M A;  4JQ0 D;  1KK7 Z;  3D0Y A;  3ICB A;  4BY5 A;  1YX8 A;  2ZNE A;  2I2R E;  1V1G A;  2M49 B;  4CFQ A;  1NCZ A;  1NX3 A;  1CNP A;  1W7J B;  1SYM A;  4I5K A;  1IJ6 A;  1DJW A;  3DD4 A;  4PE1 A;  2JRF A;  1TCO B;  2BL0 C;  2M3W A;  5I2Q A;  1FBV A;  1KK8 B;  1OZS A;  2I94 A;  1PVA A;  1KFX L;  2PVB A;  3LK0 A;  1SCM C;  1KFU S;  2LMV A;  4GPL B;  1QX7 A;  1F70 A;  1QXP A;  3NSI A;  1J55 A;  2M9G A;  1UWO A;  4YGC B;  1H4B A;  1M46 A;  5FYX A;  1B7T Y;  3E3R A;  3SG5 A;  3DVM A;  2WC8 A;  2Y1N A;  4YI8 A;  5HKW A;  2LCP A;  3CS1 A;  1SNL A;  2M1U A;  4OVN F;  1CM1 A;  2NCP A;  1J7P A;  1YTZ C;  5D69 A;  3A4U B;  1Y1X A;  5HLV A;  2ZFD A;  2JTZ A;  1BT6 A;  1DJY A;  2JQ6 A;  3SG3 A;  1UHJ A;  2JT3 A;  5K89 A;  5AER A;  1YVH A;  1XVJ A;  2HF5 A;  3BYA A;  1OSA A;  2E30 A;  1B8C A;  2F3Z A;  4NDC A;  1FW4 A;  2MJW B;  1S26 D;  4GUK A;  2WND A;  3OP0 A;  1AHR A;  2BKH B;  2KBM A;  3WHU B;  2OTG B;  5DKN A;  1CDN A;  1BOC A;  3I5G B;  1JF2 A;  2MBX A;  2HQW A;  5JJG A;  1AP4 A;  1B47 A;  1IWQ A;  1DJG A;  1QS7 A;  1K94 A;  5GQQ C;  5HKZ A;  1XFU O;  1TNQ A;  2H61 A;  2SCP A;  1QVI Y;  2M8U A;  2Q4U A;  4C0J A;  4NQG A;  4YBH B;  1CKK A;  4PHK A;  3BOW A;  2GGZ A;  2KBI A;  1KSM A;  1YX7 A;  2LV7 A;  2CT9 A;  1NCX A;  2G9B A;  2LM5 A;  3DF0 B;  1C7W A;  1DVI A;  1TOP A;  4R1E A;  3BUX B;  4WQ3 A;  3LL8 B;  2LP3 A;  2L5X B;  4PE7 A;  1SL7 A;  1F8H A;  1Y0V H;  2ZN9 A;  1F4O A;  2AMI A;  2BBN A;  2Q91 A;  4USL A;  1DJX A;  4NDD A;  1IKU A;  1LXF C;  1XK4 A;  1K9U A;  3PAL A;  1Y6W A;  2A4J A;  4XJK B;  1QAT A;  2ISD A;  1TTX A;  2JNF A;  2LHI A;  1MHO A;  3NSL A;  1OZO A;  1WY9 A;  2BL0 B;  3SG2 A;  1SKT A;  4HRH A;  1TCF A;  1TNP A;  2Y5I A;  1SCM B;  2KAX A;  2MLE C;  1ZAC A;  2HPS A;  1ZMZ A;  2H2K A;  2K8M B;  1PSR A;  3TZ1 A;  1A75 B;  1RJV A;  3EK7 A;  2L50 A;  1B8L A;  3RLZ A;  3O2P A;  1S6C A;  4MZJ A;  1S6J A;  4OKH A;  3TS5 C;  2AAO A;  2BBM A;  2CCM A;  3DF0 A;  5D7F A;  1CB1 A;  2LUX A;  4DUQ A;  1F4Q A;  3ZNI A;  3EK8 A;  1CDM A;  1EL4 A;  1ALV A;  2KHN A;  1CDL A;  3WXA A;  1EJ3 A;  1NIW A;  4QJ3 B;  2JT8 A;  1AJ4 A;  1UHK A;  1XFX O;  4N1G A;  2JZI A;  1NCY A;  1XFV O;  2CXJ A;  1JF0 A;  1F54 A;  5G08 A;  2IS9 A;  2RGI A;  1SCV A;  3QRX A;  3PN7 C;  1PAL A;  2NXQ A;  1N2D A;  4PE0 A;  4ORC B;  3CZT X;  4ORA B;  1NPQ A; 
#chains in the Genus database with same CATH topology
 3D75 A;  5CSF A;  3O6B A;  1BMO A;  2JT0 A;  3BUW B;  5I2O A;  1DGV A;  2G2B A;  2KAV A;  2LAN A;  3I5H C;  1JC2 A;  3SIA A;  2B1U A;  2BCB A;  1MQ1 A;  2F33 A;  5CPV A;  4YGB B;  2OPO A;  2DOQ A;  1IQ5 A;  1BJF A;  1UP5 A;  3I5F C;  5CSJ A;  4PDZ A;  4GNK B;  1XFZ O;  1OOI X;  4ETO A;  1X02 A;  2COL B;  2L2E A;  2M7N A;  1WRL A;  1UUS A;  1MXE A;  1VRK A;  4PT1 A;  2KLD A;  2KFH A;  1GGZ A;  5I2L A;  3O78 A;  1DF0 B;  4JD9 A;  1BU3 A;  2KI4 C;  1XFY O;  3S0B A;  4D1E A;  1PRW A;  1DEK A;  4I5L B;  5HKY A;  2PQL A;  1PUL A;  5PAL A;  1C3Y A;  1W7I B;  1YRU B;  3KPX A;  1QLS A;  4ZCU A;  4XYN A;  4QJ4 B;  2LVI A;  1UHN A;  3Q8I A;  3KEV A;  3B87 A;  1DTL A;  1UHI A;  2LHL A;  4ZCV A;  1JSA A;  4AOM A;  4DRW A;  1DGU A;  1M39 A;  3SS3 A;  3TS5 B;  1OMV A;  1NX1 A;  2K7B A;  4YI9 A;  1QTX A;  5J3X A;  1KFU L;  2K61 A;  2LAP A;  2R2I A;  4CID A;  4N1F A;  3RM1 A;  2JXL A;  4MRX A;  4GGF A;  2LVV A;  2EGD A;  3S0A A;  3B86 A;  2EC6 C;  1J7R A;  5AFP A;  4ORB B;  3PM2 A;  2LC5 A;  3F45 A;  2K2F A;  1K93 D;  3BUM B;  5IBW A;  1DMO A;  1K95 A;  3LCP C;  3AAJ A;  1SL8 A;  2K7O A;  1B9A A;  2KOT A;  3FE9 A;  4FQO A;  2I7A A;  5HLO A;  1GM0 A;  2M29 A;  1E8A A;  2OS8 C;  1D1O A;  4A4C A;  1S5G Y;  5JOL A;  4CFR A;  4WQ2 A;  2BAP A;  4A4B A;  3FWB A;  1K96 A;  3PN7 B;  3CAB A;  2JPO A;  4INW A;  1MF8 B;  1B8R A;  1Y1A A;  3VRQ A;  3EVR A;  1QX2 A;  1ALW A;  1OOH A;  2KNE A;  1N0Y A;  1RTP 1;  1WDC C;  3SG6 A;  2BNX A;  1FI6 A;  2BCA A;  4HRG A;  3BFH A;  1KK7 Y;  3C1V A;  1U5I B;  3S0D A;  3KHE A;  2F2O A;  1R2U A;  2KSP A;  2P6B B;  3AKA A;  5HYD A;  2MLF C;  1J7Q A;  5ER5 A;  2WCB A;  3I5H B;  3B6X A;  1OE9 B;  4CLN A;  1CM4 A;  3RZS A;  4YGE B;  2BE6 A;  1SK6 D;  3I5F B;  3OGN A;  2P71 A;  1DJZ A;  2JOJ A;  1K9K A;  3PSR A;  4GBA A;  4GAO A;  4MSP A;  1FI5 A;  3A8R A;  3O4X A;  2K2A A;  2KI6 C;  5AXI A;  1AK8 A;  2MHH A;  3CR4 X;  2KAY A;  1NUB A;  1G33 A;  1L7Z A;  3PLF B;  2KI4 B;  1SBJ A;  4F0Z B;  1YUS A;  2PMY A;  3K21 A;  2K60 A;  5KSZ A;  2O5G A;  1GQM A;  2F2P A;  2MA2 A;  2ZND A;  3FWC A;  3NHI A;  1Z2C B;  1PSB A;  4PHM A;  4UPG A;  1B1G A;  1CFF A;  4FTG A;  1QJT A;  1IH0 A;  2KQY A;  1G8I A;  3WNX B;  1RFJ A;  2QPT A;  4NDB A;  3MSE B;  3PJI A;  2HQ8 A;  4MEW A;  1S3P A;  4I5N B;  4TNC A;  1K8U A;  2EHB A;  2WOS A;  3PAT A;  3HCM A;  3AKB A;  4MZK A;  3OX5 A;  5FI7 A;  3HX4 A;  5FI6 A;  2EC6 B;  2GV5 A;  1TNX A;  1ODB A;  1AUI B;  2QEO A;  4XJK A;  1XFW O;  3UO9 A;  1CDP A;  1MXL C;  1LA0 A;  4YGA A;  2HET A;  2LLU A;  1J1D A;  1ZFS A;  3R1V A;  4OV2 A;  3VRO A;  1FF1 A;  2OS8 B;  3EG5 B;  1F71 A;  1JWD A;  4MN0 A;  2LLT A;  1OW4 A;  1S1E A;  4OZD A;  3TUY C;  1KQM C;  1A75 A;  2KFG A;  4PHJ A;  2KQ6 A;  1B7T Z;  3I5I C;  2CTN A;  3JTD C;  1MUX A;  2BCX A;  2LVK A;  3KO0 A;  4P5O E;  1BG1 A;  3CZ1 A;  1WDC B;  2D8N A;  2PAL A;  1OOF A;  1XK4 C;  4PE4 A;  1XFR A;  2PSR A;  1K2H A;  5AEQ A;  1C07 A;  3BUO B;  4P2Y B;  4YGD B;  1B4C A;  2FCD A;  1YUT A;  4MLW A;  3BFA A;  1DC1 A;  1A4P A;  1REC A;  3EVU A;  1UUR A;  2JC2 A;  2PYQ A;  1OQP A;  3SIB A;  1GGW A;  1SRA A;  3CR2 A;  1XA5 A;  2NZ0 A;  1CLB A;  1XO5 A;  1GJY A;  3EKJ A;  4AQI A;  4PAL A;  2KGR A;  3BUN B;  1JFK A;  5F6T A;  3B88 A;  1AVS A;  3DVE A;  3CZ2 A;  1CTR A;  1YUU A;  2PAS A;  2VRG A;  2LLS A;  1NP8 A;  1K90 D;  1TUZ A;  1ZUZ A;  3OHM B;  1MR8 A;  1QVI Z;  4YRU A;  2ZKM X;  4C0K A;  3NSK A;  2SAS A;  4DIR A;  1KFX S;  1YR5 A;  2AUC A;  1M45 A;  2KDH A;  2ZRT A;  1ZOT B;  3FIA A;  2FOT A;  1QIV A;  1H8B A;  3VGO A;  1XYD A;  3GK1 A;  1J1E A;  2L4H A;  4I5J A;  1SW8 A;  1QV1 A;  1TNW A;  3PFV A;  2KYC A;  1KWO C;  2Y4Q A;  1SPY A;  1UHH A;  4GFT A;  5B8I B;  5CSN A;  3DXL A;  3IQQ A;  1S6I A;  2K7D A;  1NX2 A;  2WOR A;  1NWD A;  2JTT A;  1DF0 A;  3NXA A;  1BR1 B;  2GGM A;  4PHN A;  3VRP A;  5ER4 X;  3SJS A;  1Q80 A;  3AAK A;  3BOW B;  4DCK A;  3JVT C;  2CBL A;  4MZL A;  2H8V A;  1T14 A;  2LE9 B;  3SS4 A;  3WHT B;  2BE4 A;  1IQ3 A;  1IG5 A;  2ZRS A;  3TUY B;  1IJ5 A;  3LK1 A;  3NGV A;  2PRU A;  3PM8 A;  4CPV A;  3KF9 A;  1WLZ A;  1KQM B;  2TN4 A;  4BY4 A;  1JFJ A;  4N5X A;  3I5I B;  1CLL A;  1V1F A;  3EVV A;  3QME A;  3JTD B;  3DYE A;  3CLN A;  1KQV A;  4GGN A;  4C0L A;  2JNX A;  4E68 A;  3OB2 B;  1OOJ A;  4U8D A;  1CLM A;  1P28 A;  2GTE A;  1TN4 A;  3BJH A;  2I18 A;  3FS7 A;  1TRF A;  4MRY A;  4QJ5 B;  1BF5 A;  1A03 A;  2ERB A;  3H4S E;  5BPJ A;  3CWG A;  1DJI A;  3N7H A;  4M2Q A;  1L2O C;  1ORG A;  5DKQ A;  3CYZ A;  3EKH A;  2L2C A;  2K0J A;  3IQO A;  1W9Z A;  2KPH A;  3CGA A;  4JKT A;  3DVK A;  1G4Y R;  1PK0 D;  4OR9 B;  2LUC A;  2O60 A;  2BEC A;  2WCF A;  1KCY A;  1RRO A;  2NCO A;  3TDI A;  3VRR A;  1K9P A;  2JWW A;  2WCJ A;  1JBA A;  5CSI A;  3IF7 A;  4M2O A;  4JWQ A;  2JUL A;  1SR6 C;  1QX5 B;  2WCK A;  3TDZ A;  5I8N A;  1KSO A;  3CR5 X;  1RK9 A;  4IL1 A;  2WCH A;  3SG7 A;  1MWN A;  3NSO A;  1CFD A;  4Q04 A;  3D10 A;  4IJ7 A;  4PCW A;  1IRJ A;  3EK4 A;  4GGF C;  5KTY A;  1LA3 A;  1CMG A;  1NSH A;  2QAC A;  1CMF A;  1BOD A;  1U5I A;  3FE6 A;  3OB1 B;  1A2X A;  1QAS A;  2E6W A;  1WRZ A;  3LLE A;  3V2L A;  1R6P A;  3BFB A;  1FPW A;  2LMU A;  2KYF A;  1KK8 C;  1OMD A;  1M63 B;  2M0R A;  3DVJ A;  5DKR A;  4HRE E;  2LP2 A;  1LKJ A;  1EG4 A;  1KWO B;  2FCE A;  1EG3 A;  1IGV A;  3OX6 A;  2M97 A;  1TIZ A;  2H61 C;  3GK4 X;  1OMR A;  2KI6 D;  2LMT A;  1NX0 A;  5FI2 A;  2KFF A;  2L51 A;  1F55 A;  1RWY A;  3M0W A;  1JUO A;  2M1K B;  2LNK A;  2WCM A;  2L0P A;  1HQV A;  1OOG A;  2KGB C;  3JVT B;  1BR4 B;  3O4Y A;  2L98 A;  2WC6 A;  3BQ3 A;  3D78 A;  2CNP A;  1PVB A;  3D77 A;  2BKI B;  2QEH A;  3CTN A;  4MBE A;  1M31 A;  1NYA A;  1SMG A;  2K7C A;  2KLE A;  1LVC D;  3D0Y B;  1EH2 A;  3R1P A;  4FQT A;  4HSZ A;  1WLM A;  3GK2 A;  4OCI A;  5TNC A;  4AQJ A;  2MRD A;  2V53 A;  3UNW A;  1BLQ A;  4JPZ B;  2JPT A;  1QV0 A;  1YRT B;  5KU1 A;  1CFP A;  2ZN8 A;  2JXC A;  1HT9 A;  1AJ5 A;  1QIW A;  1Y1U A;  2OTG C;  4ICB A;  4MVF A;  1YUR A;  3I5G C;  4WRI A;  1C7V A;  1QLK A;  1TUJ A;  1L2O B;  2MAZ A;  1A29 A;  3VRN A;  1YVL A;  1CFC A;  4M2P A;  1LIN A;  2WCE A;  4DS7 A;  2QEB A;  1WRK A;  3GOF A;  3ZWH A;  3BXK A;  1EXR A;  2M7L A;  2JU0 A;  4F7F A;  2FJU B;  2LVJ A;  3S0E A;  1S5G Z;  3NHT A;  5AAN A;  3TDU A;  1N65 A;  1SR6 B;  1DJH A;  1Z4H A;  2F8P A;  1J7O A;  1DT7 B;  1SL9 A;  2NLN A;  2Y1M A;  3SG4 A;  1S36 A;  2F3Y A;  1SY9 A;  2L4I A;  4L9M A;  5HL1 A;  4JQ0 D;  1KK7 Z;  3D0Y A;  3ICB A;  3IVT A;  4BY5 A;  1YX8 A;  2ZNE A;  2I2R E;  3L4A A;  2WCL A;  1V1G A;  2M49 B;  4CFQ A;  1NCZ A;  1NX3 A;  1SSE B;  1CNP A;  3L47 A;  1W7J B;  1SYM A;  4I5K A;  1IJ6 A;  1DJW A;  3DD4 A;  4PE1 A;  2JRF A;  1TCO B;  2BL0 C;  2M3W A;  5I2Q A;  3D76 A;  1FBV A;  1KK8 B;  1OZS A;  2I94 A;  1PVA A;  1KFX L;  1DQE A;  2PVB A;  3LK0 A;  1SCM C;  1KFU S;  2LMV A;  4GPL B;  1QX7 A;  1F70 A;  1QXP A;  3NSI A;  1J55 A;  2M9G A;  2QEV A;  1UWO A;  4YGC B;  3OBV A;  1H4B A;  1M46 A;  5FYX A;  1B7T Y;  3E3R A;  3SG5 A;  3DVM A;  2WC8 A;  4KYN A;  2Y1N A;  4YI8 A;  5HKW A;  2LCP A;  3CS1 A;  1SNL A;  2M1U A;  3VB1 A;  4OVN F;  1CM1 A;  2NCP A;  1J7P A;  1YTZ C;  5D69 A;  3A4U B;  1Y1X A;  5HLV A;  2ZFD A;  2JTZ A;  1BT6 A;  1DJY A;  2JQ6 A;  3SG3 A;  1UHJ A;  2JT3 A;  5K89 A;  5AER A;  1YVH A;  1XVJ A;  2HF5 A;  3BYA A;  1OSA A;  2E30 A;  1B8C A;  2F3Z A;  4NDC A;  1FW4 A;  2MJW B;  1S26 D;  5EL2 A;  4GUK A;  2WND A;  3OP0 A;  1AHR A;  2BKH B;  2KBM A;  3WHU B;  2OTG B;  5DKN A;  1CDN A;  1BOC A;  3I5G B;  1JF2 A;  3S0F A;  2MBX A;  2HQW A;  5DIC A;  5JJG A;  1AP4 A;  1B47 A;  1IWQ A;  1DJG A;  1QS7 A;  1K94 A;  1C3Z A;  4INX A;  1XFU O;  5GQQ C;  5HKZ A;  1TNQ A;  2H61 A;  2SCP A;  1QVI Y;  2M8U A;  2Q4U A;  4C0J A;  4NQG A;  4YBH B;  1CKK A;  4PHK A;  1LS8 A;  3BOW A;  2GGZ A;  2KBI A;  1KSM A;  5I94 A;  1YX7 A;  2LV7 A;  2CT9 A;  1NCX A;  2G9B A;  2LM5 A;  3DF0 B;  1C7W A;  1DVI A;  1TOP A;  4R1E A;  3BUX B;  4WQ3 A;  3LL8 B;  2LP3 A;  2L5X B;  3D73 A;  2WC5 A;  3FE8 A;  4PE7 A;  1SL7 A;  1F8H A;  1Y0V H;  1QWV A;  2ZN9 A;  1F4O A;  2AMI A;  2BBN A;  2FJY A;  2Q91 A;  4USL A;  1DJX A;  4NDD A;  1IKU A;  2P70 A;  1LXF C;  3DY9 A;  1XK4 A;  1K9U A;  3PAL A;  1Y6W A;  2A4J A;  3DZT A;  4XJK B;  1DEL A;  1QAT A;  2ISD A;  3R1O A;  1TTX A;  2JNF A;  2LHI A;  1MHO A;  2YGU A;  3NSL A;  1OZO A;  1WY9 A;  2BL0 B;  3SG2 A;  3CDN A;  1SKT A;  3CZ0 A;  4HRH A;  1TCF A;  1TNP A;  2Y5I A;  1SCM B;  2KAX A;  2MLE C;  1ZAC A;  2HPS A;  1IIO A;  1ZMZ A;  2H2K A;  3R72 A;  2K8M B;  1PSR A;  3TZ1 A;  1A75 B;  1RJV A;  3EK7 A;  2L50 A;  1B8L A;  3RLZ A;  3O2P A;  1S6C A;  4MZJ A;  1S6J A;  4OKH A;  3TS5 C;  2AAO A;  2BBM A;  3D74 A;  2CCM A;  3DF0 A;  3SS5 A;  5D7F A;  1CB1 A;  1TWO A;  3L4L A;  2LUX A;  3B7A A;  4DUQ A;  1F4Q A;  3ZNI A;  3EK8 A;  1CDM A;  1EL4 A;  5D3O A;  1ALV A;  2KHN A;  1CDL A;  3K1E A;  3WXA A;  1EJ3 A;  1NIW A;  4QJ3 B;  2JT8 A;  1AJ4 A;  1UHK A;  1XFX O;  4N1G A;  2JZI A;  1NCY A;  1XFV O;  3S0G A;  2CXJ A;  1JF0 A;  1F54 A;  5G08 A;  2IS9 A;  2RGI A;  1SCV A;  3QRX A;  3PN7 C;  1PAL A;  2L5Y A;  2NXQ A;  1N2D A;  4PE0 A;  4ORC B;  3CZT X;  4ORA B;  1NPQ A;  2QDI A; 
#chains in the Genus database with same CATH homology
 5CSF A;  3O6B A;  1BMO A;  2JT0 A;  3BUW B;  5I2O A;  1DGV A;  2G2B A;  2KAV A;  2LAN A;  3I5H C;  1JC2 A;  3SIA A;  2B1U A;  2BCB A;  1MQ1 A;  2F33 A;  5CPV A;  4YGB B;  2OPO A;  2DOQ A;  1IQ5 A;  1BJF A;  1UP5 A;  3I5F C;  5CSJ A;  4PDZ A;  4GNK B;  1XFZ O;  4ETO A;  1X02 A;  2COL B;  2L2E A;  2M7N A;  1WRL A;  1UUS A;  1MXE A;  1VRK A;  2KFH A;  1GGZ A;  5I2L A;  3O78 A;  1DF0 B;  1BU3 A;  2KI4 C;  1XFY O;  4D1E A;  1PRW A;  4I5L B;  5HKY A;  1PUL A;  5PAL A;  1W7I B;  1YRU B;  3KPX A;  1QLS A;  4ZCU A;  4XYN A;  4QJ4 B;  2LVI A;  1UHN A;  3KEV A;  1DTL A;  1UHI A;  2LHL A;  4ZCV A;  1JSA A;  4AOM A;  4DRW A;  1DGU A;  1M39 A;  3TS5 B;  1OMV A;  1NX1 A;  2K7B A;  4YI9 A;  1QTX A;  5J3X A;  1KFU L;  2K61 A;  2LAP A;  2R2I A;  4CID A;  4N1F A;  3RM1 A;  2JXL A;  4MRX A;  4GGF A;  2LVV A;  2EGD A;  2EC6 C;  1J7R A;  5AFP A;  4ORB B;  2LC5 A;  3F45 A;  2K2F A;  1K93 D;  3BUM B;  5IBW A;  1DMO A;  1K95 A;  3LCP C;  3AAJ A;  1SL8 A;  2K7O A;  1B9A A;  2KOT A;  4FQO A;  2I7A A;  5HLO A;  2M29 A;  1E8A A;  2OS8 C;  1D1O A;  4A4C A;  1S5G Y;  5JOL A;  4CFR A;  4WQ2 A;  4A4B A;  3FWB A;  1K96 A;  3PN7 B;  1MF8 B;  1B8R A;  1Y1A A;  3VRQ A;  3EVR A;  1QX2 A;  1ALW A;  2KNE A;  1FI6 A;  1N0Y A;  1RTP 1;  1WDC C;  3SG6 A;  2BCA A;  4HRG A;  1KK7 Y;  3C1V A;  1U5I B;  3KHE A;  2F2O A;  1R2U A;  2KSP A;  2P6B B;  3AKA A;  5HYD A;  2MLF C;  1J7Q A;  5ER5 A;  2WCB A;  3I5H B;  4CLN A;  1OE9 B;  1CM4 A;  4YGE B;  2BE6 A;  1SK6 D;  3I5F B;  1DJZ A;  2JOJ A;  1K9K A;  3PSR A;  4GBA A;  4GAO A;  4MSP A;  1FI5 A;  3A8R A;  2K2A A;  2KI6 C;  5AXI A;  1AK8 A;  2MHH A;  3CR4 X;  2KAY A;  1NUB A;  1G33 A;  1L7Z A;  3PLF B;  2KI4 B;  1SBJ A;  4F0Z B;  1YUS A;  2PMY A;  3K21 A;  5KSZ A;  2O5G A;  1GQM A;  2F2P A;  2MA2 A;  2ZND A;  3FWC A;  1PSB A;  4PHM A;  4UPG A;  1B1G A;  1CFF A;  4FTG A;  1QJT A;  1IH0 A;  2KQY A;  1G8I A;  3WNX B;  1RFJ A;  2QPT A;  4NDB A;  3MSE B;  2HQ8 A;  4MEW A;  1S3P A;  4I5N B;  4TNC A;  1K8U A;  2EHB A;  2WOS A;  3PAT A;  3HCM A;  3AKB A;  4MZK A;  3OX5 A;  3HX4 A;  2EC6 B;  2GV5 A;  1TNX A;  1ODB A;  1AUI B;  4XJK A;  1XFW O;  1CDP A;  1MXL C;  1LA0 A;  4YGA A;  2HET A;  2LLU A;  1J1D A;  1ZFS A;  4OV2 A;  3VRO A;  1FF1 A;  2OS8 B;  1F71 A;  1JWD A;  4MN0 A;  2LLT A;  1S1E A;  3TUY C;  1KQM C;  1A75 A;  2KFG A;  4PHJ A;  2KQ6 A;  1B7T Z;  3I5I C;  2CTN A;  3JTD C;  1MUX A;  2BCX A;  2LVK A;  3KO0 A;  4P5O E;  1BG1 A;  1WDC B;  2D8N A;  2PAL A;  1XK4 C;  4PE4 A;  2PSR A;  1K2H A;  5AEQ A;  1C07 A;  3BUO B;  4P2Y B;  4YGD B;  1B4C A;  2FCD A;  1YUT A;  4MLW A;  1A4P A;  1REC A;  3EVU A;  1UUR A;  2JC2 A;  1OQP A;  3SIB A;  1GGW A;  1SRA A;  3CR2 A;  1XA5 A;  2NZ0 A;  1CLB A;  1XO5 A;  1GJY A;  3EKJ A;  4AQI A;  4PAL A;  2KGR A;  3BUN B;  1JFK A;  5F6T A;  1AVS A;  3DVE A;  1CTR A;  1YUU A;  2PAS A;  2VRG A;  2LLS A;  1NP8 A;  1K90 D;  1ZUZ A;  3OHM B;  1MR8 A;  1QVI Z;  4YRU A;  2ZKM X;  4C0K A;  3NSK A;  2SAS A;  4DIR A;  1KFX S;  1YR5 A;  2AUC A;  1M45 A;  2KDH A;  2ZRT A;  1ZOT B;  3FIA A;  2FOT A;  1QIV A;  1H8B A;  3VGO A;  1XYD A;  3GK1 A;  1J1E A;  2L4H A;  4I5J A;  1SW8 A;  1QV1 A;  1TNW A;  3PFV A;  2KYC A;  1KWO C;  2Y4Q A;  1SPY A;  1UHH A;  4GFT A;  5B8I B;  5CSN A;  3IQQ A;  1S6I A;  2K7D A;  1NX2 A;  2WOR A;  1NWD A;  2JTT A;  1DF0 A;  3NXA A;  1BR1 B;  2GGM A;  4PHN A;  3VRP A;  5ER4 X;  3SJS A;  1Q80 A;  3AAK A;  3BOW B;  4DCK A;  3JVT C;  2CBL A;  4MZL A;  2LE9 B;  3WHT B;  2BE4 A;  1IQ3 A;  1IG5 A;  2ZRS A;  3TUY B;  1IJ5 A;  3LK1 A;  3PM8 A;  2PRU A;  4CPV A;  3KF9 A;  1WLZ A;  1KQM B;  2TN4 A;  4BY4 A;  1JFJ A;  4N5X A;  3I5I B;  1CLL A;  1V1F A;  3EVV A;  3JTD B;  3CLN A;  1KQV A;  4GGN A;  4C0L A;  2JNX A;  4E68 A;  3OB2 B;  1OOJ A;  4U8D A;  1CLM A;  1TN4 A;  4MRY A;  2I18 A;  3FS7 A;  1TRF A;  4QJ5 B;  1BF5 A;  1A03 A;  3H4S E;  5BPJ A;  3CWG A;  1DJI A;  4M2Q A;  1L2O C;  5DKQ A;  3EKH A;  2K0J A;  3IQO A;  3CGA A;  3DVK A;  1G4Y R;  1PK0 D;  4OR9 B;  2LUC A;  2O60 A;  2BEC A;  2WCF A;  1KCY A;  1RRO A;  2NCO A;  3TDI A;  3VRR A;  1K9P A;  2JWW A;  1JBA A;  5CSI A;  3IF7 A;  4M2O A;  4JWQ A;  2JUL A;  1SR6 C;  1QX5 B;  3TDZ A;  5I8N A;  1KSO A;  3CR5 X;  1RK9 A;  4IL1 A;  3SG7 A;  1MWN A;  3NSO A;  1CFD A;  4Q04 A;  3D10 A;  4PCW A;  1IRJ A;  3EK4 A;  4GGF C;  5KTY A;  1LA3 A;  1CMG A;  1NSH A;  2QAC A;  1CMF A;  1BOD A;  1U5I A;  3OB1 B;  1A2X A;  1QAS A;  2E6W A;  1WRZ A;  3LLE A;  1R6P A;  1FPW A;  2LMU A;  2KYF A;  1KK8 C;  1OMD A;  1M63 B;  2M0R A;  3DVJ A;  5DKR A;  4HRE E;  2LP2 A;  1LKJ A;  1EG4 A;  1KWO B;  2FCE A;  1EG3 A;  1IGV A;  3OX6 A;  2M97 A;  1TIZ A;  2H61 C;  3GK4 X;  1OMR A;  2KI6 D;  2LMT A;  1NX0 A;  2KFF A;  2L51 A;  1F55 A;  1RWY A;  3M0W A;  1JUO A;  2M1K B;  2LNK A;  2L0P A;  1HQV A;  2KGB C;  3JVT B;  1BR4 B;  3O4Y A;  2L98 A;  3BQ3 A;  2CNP A;  1PVB A;  2BKI B;  3CTN A;  4MBE A;  1M31 A;  1NYA A;  1SMG A;  2K7C A;  1LVC D;  3D0Y B;  1EH2 A;  4HSZ A;  1WLM A;  3GK2 A;  4OCI A;  5TNC A;  4AQJ A;  2MRD A;  2V53 A;  1BLQ A;  4JPZ B;  2JPT A;  1QV0 A;  1YRT B;  5KU1 A;  1CFP A;  2ZN8 A;  2JXC A;  1HT9 A;  1AJ5 A;  1QIW A;  1Y1U A;  2OTG C;  4ICB A;  4MVF A;  1YUR A;  3I5G C;  4WRI A;  1C7V A;  1QLK A;  1L2O B;  2MAZ A;  1A29 A;  3VRN A;  1YVL A;  1CFC A;  4M2P A;  1LIN A;  2WCE A;  4DS7 A;  1WRK A;  3GOF A;  3ZWH A;  3BXK A;  1EXR A;  2M7L A;  2JU0 A;  2FJU B;  2LVJ A;  1S5G Z;  5AAN A;  3TDU A;  1N65 A;  1SR6 B;  1DJH A;  2F8P A;  1J7O A;  1DT7 B;  1SL9 A;  2NLN A;  2Y1M A;  3SG4 A;  1S36 A;  2F3Y A;  1SY9 A;  2L4I A;  4L9M A;  4JQ0 D;  1KK7 Z;  3D0Y A;  3ICB A;  4BY5 A;  1YX8 A;  2ZNE A;  2I2R E;  1V1G A;  2M49 B;  4CFQ A;  1NCZ A;  1NX3 A;  1CNP A;  1W7J B;  1SYM A;  4I5K A;  1IJ6 A;  1DJW A;  3DD4 A;  4PE1 A;  2JRF A;  1TCO B;  2BL0 C;  2M3W A;  5I2Q A;  1FBV A;  1KK8 B;  1OZS A;  2I94 A;  1PVA A;  1KFX L;  2PVB A;  3LK0 A;  1SCM C;  1KFU S;  2LMV A;  4GPL B;  1QX7 A;  1F70 A;  1QXP A;  3NSI A;  1J55 A;  2M9G A;  1UWO A;  4YGC B;  1H4B A;  1M46 A;  5FYX A;  1B7T Y;  3E3R A;  3SG5 A;  3DVM A;  2WC8 A;  2Y1N A;  4YI8 A;  5HKW A;  2LCP A;  3CS1 A;  1SNL A;  2M1U A;  4OVN F;  1CM1 A;  2NCP A;  1J7P A;  1YTZ C;  5D69 A;  3A4U B;  1Y1X A;  5HLV A;  2ZFD A;  2JTZ A;  1BT6 A;  1DJY A;  2JQ6 A;  3SG3 A;  1UHJ A;  2JT3 A;  5K89 A;  5AER A;  1YVH A;  1XVJ A;  2HF5 A;  3BYA A;  1OSA A;  2E30 A;  1B8C A;  2F3Z A;  4NDC A;  1FW4 A;  2MJW B;  1S26 D;  4GUK A;  2WND A;  3OP0 A;  1AHR A;  2BKH B;  2KBM A;  3WHU B;  2OTG B;  5DKN A;  1CDN A;  1BOC A;  3I5G B;  1JF2 A;  2MBX A;  2HQW A;  5JJG A;  1AP4 A;  1B47 A;  1IWQ A;  1DJG A;  1QS7 A;  1K94 A;  5GQQ C;  5HKZ A;  1XFU O;  1TNQ A;  2H61 A;  2SCP A;  1QVI Y;  2M8U A;  2Q4U A;  4C0J A;  4NQG A;  4YBH B;  1CKK A;  4PHK A;  3BOW A;  2GGZ A;  2KBI A;  1KSM A;  1YX7 A;  2LV7 A;  2CT9 A;  1NCX A;  2G9B A;  2LM5 A;  3DF0 B;  1C7W A;  1DVI A;  1TOP A;  4R1E A;  3BUX B;  4WQ3 A;  3LL8 B;  2LP3 A;  2L5X B;  4PE7 A;  1SL7 A;  1F8H A;  1Y0V H;  2ZN9 A;  1F4O A;  2AMI A;  2BBN A;  2Q91 A;  4USL A;  1DJX A;  4NDD A;  1IKU A;  1LXF C;  1XK4 A;  1K9U A;  3PAL A;  1Y6W A;  2A4J A;  4XJK B;  1QAT A;  2ISD A;  1TTX A;  2JNF A;  2LHI A;  1MHO A;  3NSL A;  1OZO A;  1WY9 A;  2BL0 B;  3SG2 A;  1SKT A;  4HRH A;  1TCF A;  1TNP A;  2Y5I A;  1SCM B;  2KAX A;  2MLE C;  1ZAC A;  2HPS A;  1ZMZ A;  2H2K A;  2K8M B;  1PSR A;  3TZ1 A;  1A75 B;  1RJV A;  3EK7 A;  2L50 A;  1B8L A;  3RLZ A;  3O2P A;  1S6C A;  4MZJ A;  1S6J A;  4OKH A;  3TS5 C;  2AAO A;  2BBM A;  2CCM A;  3DF0 A;  5D7F A;  1CB1 A;  2LUX A;  4DUQ A;  1F4Q A;  3ZNI A;  3EK8 A;  1CDM A;  1EL4 A;  1ALV A;  2KHN A;  1CDL A;  3WXA A;  1EJ3 A;  1NIW A;  4QJ3 B;  2JT8 A;  1AJ4 A;  1UHK A;  1XFX O;  4N1G A;  2JZI A;  1NCY A;  1XFV O;  2CXJ A;  1JF0 A;  1F54 A;  5G08 A;  2IS9 A;  2RGI A;  1SCV A;  3QRX A;  3PN7 C;  1PAL A;  2NXQ A;  1N2D A;  4PE0 A;  4ORC B;  3CZT X;  4ORA B;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...