2LVKA

Solution structure of ca-bound phl p 7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvkA00
2MA2A 1JF0A 1OMVA 2KAVA 4FQOA 1CB1A 5D7FA 4A4BA 1S6CA 1PULA 2L4HA 2ZNEA 1V1GA 3ICBA 1KWOB 2IS9A 3BOWA 1GGWA 1GQMA 2CTNA 1SW8A 4PE4A 2ZRSA 2KFFA 3LCPC 5DKQA 1SMGA 1YUTA 1NCXA 3TS5C 4A4CA 1KSMA 2O5GA 1J1DA 2LP2A 5AFPA 2LM5A 1FF1A 4XJKB 3VGOA 4MN0A 1NP8A 1QX7A 2M9GA 4MSPA 4HREE 2RGIA 1JFKA 3H4SE 3PN7B 4YRUA 1F8HA 1L7ZA 4U8DA 1NUBA 1SBJA 1N2DA 1A2XA 1CDPA 3CR2A 4ORBB 2F2OA 1YRTB 1IJ5A 2K7OA 1DJWA 3SG2A 1OMRA 2KGRA 1FBVA 4CPVA 1OQPA 2BCBA 3MSEB 1EG4A 1UUSA 2PVBA 1FI6A 3I5FB 3RM1A 4N1FA 1QX5B 4GGFA 1YVLA 4DRWA 1EL4A 2SASA 5D69A 3TUYB 4ORCB 1B7TY 5HYDA 1WLZA 1GJYA 1QIVA 2HF5A 2LVKA 3AAJA 1KK8C 4I5NB 1IQ3A 1J55A 1OSAA 1UWOA 4OVNF 2BKIB 4PHJA 3KHEA 1OE9B 3F45A 1SPYA 2I7AA 1KCYA 1QV1A 5B8IB 2BE4A 2HETA 1S5GY 5KTYA 1H4BA 1NCYA 1MUXA 1PALA 4GUKA 3OX5A 4YGEB 4MZJA 1S1EA 1A03A 4YI8A 4WRIA 5DKRA 1DVIA 1SK6D 1CKKA 3PALA 1VRKA 2NLNA 1NCZA 2NCPA 4YGDB 1TNPA 2LAPA 3GK4X 3VRPA 1CNPA 1ZMZA 2BECA 4GGFC 2LANA 1BR1B 5CSJA 2CT9A 1K9UA 2L5XB 1KQVA 4I5JA 1CTRA 1UURA 2I2RE 1IQ5A 1DF0A 3FWCA 1QXPA 2LV7A 2F8PA 1NPQA 5J3XA 1RTP1 1DT7B 2BL0C 2JRFA 1CM4A 1LKJA 1TCFA 4MRYA 2KAYA 1B8LA 4CFQA 1DJHA 1B9AA 5CSIA 1UHHA 1B1GA 1FPWA 1JFJA 2Y1MA 2F3YA 2LC5A 2KI6D 1PSBA 2JT0A 3WXAA 2K61A 3JTDB 3OP0A 5F6TA 2ZKMX 1OZOA 1ALWA 2VRGA 3CZTX 1KQMB 1JF2A 3JVTC 2KI6C 3KO0A 1UHJA 3E3RA 3PFVA 2PASA 3BUNB 4ICBA 4WQ3A 3VRRA 3IQQA 1R6PA 2WORA 1F4QA 1K9KA 4GFTA 1D1OA 3IF7A 1UHIA 2ZNDA 4NDDA 1SL7A 1FI5A 2AAOA 3I5HB 5ER4X 1CDMA 1J7OA 2PMYA 1C7VA 1DJGA 2WCEA 4BY4A 2WOSA 3KEVA 1DMOA 2MLFC 3CTNA 4ZCVA 1G8IA 4QJ3B 1SL8A 5K89A 2F2PA 4MEWA 1C7WA 1BU3A 1CM1A 3CGAA 2JTTA 4OCIA 3EKHA 1RFJA 3BUWB 1QLSA 3SG3A 3CS1A 5AERA 2PRUA 1RWYA 2LLUA 3OB2B 1AP4A 2KFGA 3TS5B 1EXRA 4YGAA 3AKBA 3FWBA 4AQJA 1NIWA 4DCKA 1KK7Z 2LMTA 5JJGA 1QASA 3DF0B 2OTGC 3SIAA 4QJ5B 2ZFDA 1SL9A 2E30A 1YUUA 3I5GC 2CXJA 2M7NA 1YX8A 3O4YA 4HRHA 1CFCA 2KI4C 1Y1AA 3AKAA 3EKJA 3EVVA 1K2HA 3BUOB 2DOQA 2HQWA 5G08A 2L0PA 4PE0A 1DGVA 2AMIA 1CLLA 1NSHA 4ETOA 3DVJA 2FJUB 5BPJA 1EH2A 3O78A 2CNPA 2LVVA 1DJXA 4TNCA 1B8RA 3EK8A 3LK0A 1NX2A 1G4YR 3TZ1A 4CFRA 2LHLA 1AK8A 4C0LA 3BOWB 1AUIB 1MWNA 1XFYO 1GGZA 3PM8A 1QATA 2R2IA 1KK8B 2FCDA 3SG5A 3A4UB 4N1GA 3FS7A 2QACA 4YBHB 1AHRA 2BBMA 2K2FA 1PRWA 2LLSA 1TNWA 2CCMA 2JQ6A 1QX2A 1JWDA 2KBMA 5HLVA 3TDIA 4NQGA 3BXKA 1SRAA 1LA0A 1K95A 1XO5A 1K96A 2V53A 1B7TZ 4CIDA 1QV0A 1WDCC 3GOFA 2JXLA 2KYCA 2JTZA 3CR4X 3WNXB 1S6JA 4CLNA 4D1EA 4GAOA 1SR6C 1U5IA 3HCMA 2LP3A 1KFUS 1CDLA 5ER5A 3A8RA 4Q04A 2COLB 3OX6A 1S5GZ 2D8NA 4MLWA 1CDNA 3SJSA 3ZWHA 1CMFA 2LE9B 4MVFA 2MLEC 1B8CA 2OS8C 2BL0B 2WCFA 5I2QA 1LXFC 4PHKA 3AAKA 1XFUO 1MHOA 3LK1A 4PE7A 2JNXA 1NYAA 5FYXA 1G33A 1CFDA 1QJTA 2JU0A 1IWQA 1AJ5A 2HQ8A 1S3PA 2L98A 2WC8A 1DJYA 3DVKA 5HLOA 1A75A 1H8BA 1L2OC 1B4CA 2L4IA 4PCWA 2G9BA 3D0YA 3FIAA 3JVTB 4JWQA 5PALA 2I94A 2ZN9A 1V1FA 1OZSA 1NX0A 3WHUB 1PSRA 2Y4QA 3VROA 1TIZA 2Q4UA 2KGBC 1RROA 2GV5A 1R2UA 1WRLA 4R1EA 4F0ZB 1IH0A 2KSPA 1DF0B 4XYNA 1RJVA 1MQ1A 1XK4A 1NX3A 3PATA 4QJ4B 3BUMB 3OHMB 2L2EA 2Q91A 4PDZA 1XFZO 1K93D 2HPSA 1OOJA 1Y0VH 1TN4A 1KFXS 1XFWO 2LNKA 3CLNA 1DTLA 2JPTA 2LHIA 4GGNA 1BJFA 2JZIA 3PSRA 2KOTA 2KQYA 3BQ3A 4AQIA 1F70A 2BE6A 2L51A 1IG5A 2FCEA 1LINA 1K8UA 2EC6C 1TNXA 4M2OA 2BCXA 2Y5IA 2A4JA 1WLMA 2OTGB 2JT8A 5KU1A 1YR5A 4JPZB 4N5XA 1QVIZ 1PVAA 3I5IC 1SYMA 3I5GB 3IQOA 1LVCD 4USLA 5GQQC 2KI4B 1N65A 3D10A 4E68A 1BOCA 3EVUA 4YGBB 4P5OE 3EVRA 1K90D 1KQMC 4OKHA 2K7BA 1BG1A 1XFVO 5JOLA 2WCBA 1BMOA 1XK4C 3GK1A 4DS7A 2MJWB 4YI9A 1YUSA 1UHNA 1SCMC 2FOTA 1IGVA 4XJKA 2NZ0A 1KK7Y 1BT6A 2KHNA 2JXCA 1YX7A 1AJ4A 1SCVA 1YRUB 2M1KB 1AVSA 3KF9A 5AEQA 5IBWA 1DGUA 1QTXA 4NDBA 1BODA 2P6BB 4OR9B 1CFPA 2L50A 4I5KA 3SG4A 4PALA 1SY9A 2B1UA 2LMUA 2NCOA 2LVIA 1TCOB 1KFUL 1CLMA 2I18A 4HRGA 5I8NA 1ODBA 1QS7A 1RK9A 2JULA 3DD4A 4ORAB 2K0JA 3O2PA 1WRKA 2ZRTA 3CWGA 1WY9A 2EHBA 1MR8A 1J1EA 1YURA 1KWOC 2PALA 3NXAA 4PE1A 4UPGA 3LL8B 2KBIA 1JC2A 1QIWA 2LCPA 3NSKA 1JBAA 4ZCUA 3C1VA 2LUXA 2GGZA 1WDCB 4IL1A 3O6BA 2M29A 3SG7A 1NWDA 2NXQA 1Y6WA 2TN4A 3BUXB 1PK0D 3PLFB 1SR6B 1J7RA 1M39A 3QRXA 1RECA 1E8AA 1M31A 1EG3A 3PN7C 1DJIA 1XA5A 2SCPA 3VRQA 1Y1UA 3ZNIA 4MZKA 4DUQA 3CR5X 2OS8B 1DJZA 1Q80A 2M7LA 2LUCA 1X02A 1JSAA 4FTGA 4I5LB 3DVMA 1QLKA 2LLTA 1HT9A 1M46A 5AANA 1XFXO 2MAZA 1W7IB 2LVJA 3DVEA 3I5FC 5CPVA 2CBLA 3K21A 2F33A 1ZACA 2H61A 1UP5A 1NX1A 3TUYC 2KFHA 3TDZA 1BR4B 1L2OB 3OB1B 2PSRA 2BKHB 1TNQA 1MXEA 3EK4A 2KAXA 1A4PA 2KYFA 1KFXL 4MRXA 1YVHA 1JUOA 2KNEA 4M2QA 2KDHA 2MHHA 4PHMA 1ZOTB 4JQ0D 5TNCA 1CMGA 2GGMA 1U5IB 2K2AA 4L9MA 5I2LA 4GPLB 2BCAA 2M49B 5DKNA 2M8UA 3NSIA 5HKWA 1UHKA 2JT3A 4MZLA 3NSOA 3BYAA 2ZN8A 1LA3A 1ALVA 5KSZA 4AOMA 1TTXA 2BBNA 1K94A 2JNFA 2K7DA 1S26D 3GK2A 4NDCA 1EJ3A 3NSLA 2M1UA 2O60A 1SNLA 2H61C 5CSNA 2OPOA 3SG6A 2M3WA 3LLEA 1OMDA 1A75B 1W7JB 4P2YB 2G2BA 2H2KA 2EC6B 1FW4A 2F3ZA 4GBAA 3D0YB 4C0JA 1MF8B 1F4OA 3TDUA 1SKTA 2AUCA 2K8MB 2ISDA 1ZFSA 1M45A 2JOJA 1Y1XA 3I5IB 4DIRA 1MXLC 4C0KA 1F71A 2Y1NA 1F55A 1IKUA 2EGDA 4OV2A 4PHNA 1A29A 2M97A 2K7CA 1YTZC 1KSOA 1TOPA 1CLBA 2JC2A 2QPTA 3EK7A 1S36A 1K9PA 1ZUZA 2LMVA 1XVJA 4M2PA 3VRNA 3JTDC 1SCMB 4MBEA 5AXIA 2MRDA 1BLQA 1F54A 2M0RA 1WRZA 1HQVA 2JWWA 2KQ6A 3DF0A 5CSFA 3M0WA 3WHTB 1J7QA 1J7PA 1IJ6A 1B47A 1QVIY 1C07A 4WQ2A 4HSZA 1M63B 3RLZA 1N0YA 5I2OA 5HKYA 3KPXA 4GNKB 3I5HC 2WNDA 1XYDA 2MBXA 1IRJA 3HX4A 1CFFA 1TRFA 2E6WA 4BY5A 1PVBA 4YGCB 3SIBA 1S6IA 1BF5A 5HKZA
chains in the Genus database with same CATH superfamily
2MA2A 1JF0A 1OMVA 2KAVA 4FQOA 1CB1A 5D7FA 4A4BA 1S6CA 2WCLA 1PULA 2L4HA 2ZNEA 1V1GA 3ICBA 3S0FA 1KWOB 2IS9A 3BOWA 1GGWA 5FI7A 1GQMA 2CTNA 1SW8A 4PE4A 3O4XA 2ZRSA 2KFFA 3LCPC 5DKQA 1SMGA 1YUTA 1NCXA 3D73A 3TS5C 4A4CA 2BNXA 1KSMA 2O5GA 1J1DA 2LP2A 5AFPA 2LM5A 1FF1A 4XJKB 3VGOA 3IVTA 1W9ZA 4MN0A 1NP8A 1QX7A 2M9GA 4MSPA 4HREE 3D74A 2RGIA 3CYZA 3CZ2A 1JFKA 3H4SE 3PN7B 4YRUA 1F8HA 1L7ZA 4U8DA 1NUBA 1SBJA 4JD9A 1N2DA 1A2XA 1CDPA 3CR2A 4ORBB 2F2OA 1YRTB 1IJ5A 2K7OA 1DJWA 3SG2A 1OMRA 2KGRA 1FBVA 4CPVA 1OQPA 5HL1A 2BCBA 3OBVA 3MSEB 1EG4A 1UUSA 1TUZA 2PVBA 1FI6A 3I5FB 3RM1A 1OOHA 4N1FA 1QX5B 4GGFA 1YVLA 4FQTA 1EL4A 2SASA 4DRWA 2P71A 5D69A 3TUYB 4ORCB 1B7TY 5HYDA 1WLZA 1GJYA 1QIVA 2HF5A 2LVKA 3AAJA 1DC1A 2KPHA 4INWA 1KK8C 4I5NB 1IQ3A 1J55A 1LS8A 1OSAA 1UWOA 4OVNF 2BKIB 4PHJA 3KHEA 1OE9B 3F45A 1SPYA 2I7AA 1KCYA 5DICA 1QV1A 5FI2A 3SS4A 2BE4A 2HETA 1S5GY 5B8IB 5KTYA 1H4BA 1NCYA 1MUXA 1PALA 4GUKA 3OX5A 4YGEB 4MZJA 1S1EA 1A03A 4YI8A 4WRIA 5DKRA 1DVIA 1SK6D 1CKKA 3PALA 1VRKA 2NLNA 5D3OA 1NCZA 2NCPA 3R1VA 3D76A 4OZDA 4YGDB 1TNPA 2LAPA 3GK4X 3VRPA 1CNPA 1ZMZA 2BECA 4GGFC 1BF5A 2LANA 1BR1B 5CSJA 2CT9A 1K9UA 2L5XB 1KQVA 4I5JA 1CTRA 1UURA 3QMEA 2I2RE 1IQ5A 1DF0A 3FWCA 1QXPA 2LV7A 2F8PA 1NPQA 5J3XA 1RTP1 1DT7B 2BL0C 2JRFA 1P28A 3CZ1A 1CM4A 1LKJA 1TCFA 4MRYA 2KAYA 1B8LA 4CFQA 1DJHA 2WCHA 1B9AA 5CSIA 4IJ7A 1UHHA 1B1GA 1FPWA 1JFJA 2PYQA 2Y1MA 2F3YA 3N7HA 2LC5A 2KI6D 1PSBA 2JT0A 3WXAA 2K61A 3JTDB 3OP0A 5F6TA 2ZKMX 1OZOA 2WC6A 1ALWA 2VRGA 3CZTX 1KQMB 1JF2A 3JVTC 2KI6C 3KO0A 3L4AA 3S0BA 1UHJA 3E3RA 3PFVA 2PASA 3B87A 3BUNB 4ICBA 4WQ3A 3VRRA 3IQQA 1R6PA 2WORA 1F4QA 1K9KA 4GFTA 1D1OA 3IF7A 1UHIA 2ZNDA 4NDDA 1SL7A 1FI5A 2AAOA 3I5HB 5ER4X 1CDMA 1J7OA 2JPOA 2PMYA 1C7VA 1DJGA 2WCEA 4BY4A 2WOSA 3KEVA 1DMOA 1QWVA 2MLFC 3CTNA 4ZCVA 1G8IA 2FJYA 4QJ3B 1SL8A 5K89A 1OOFA 3S0DA 2F2PA 4MEWA 1C7WA 1BU3A 1CM1A 3CGAA 2JTTA 4OCIA 3S0GA 3EKHA 1RFJA 3BUWB 1QLSA 2H8VA 3PJIA 3SG3A 3CS1A 5AERA 2PRUA 1RWYA 2LLUA 3OB2B 1AP4A 2KFGA 3TS5B 1EXRA 4YGAA 3AKBA 4JKTA 1GM0A 3FWBA 4AQJA 1NIWA 4DCKA 1KK7Z 1TUJA 2LMTA 5JJGA 1QASA 3DF0B 2OTGC 3SIAA 2PQLA 4QJ5B 3B88A 2ZFDA 1SL9A 2E30A 1YUUA 3I5GC 2CXJA 2QEBA 2M7NA 1YX8A 3O4YA 4HRHA 1CFCA 2KI4C 1Y1AA 3AKAA 3EKJA 3EVVA 1K2HA 3BUOB 2DOQA 2HQWA 5G08A 2L0PA 2KLEA 3Q8IA 4PE0A 1DGVA 2AMIA 1CLLA 1NSHA 4ETOA 2L5YA 3DVJA 3UO9A 2FJUB 5BPJA 1EH2A 3O78A 2CNPA 2LVVA 1DJXA 4TNCA 1B8RA 3EK8A 3LK0A 1NX2A 1G4YR 3TZ1A 4CFRA 2LHLA 1AK8A 2BAPA 3BOWB 3R72A 1AUIB 1MWNA 1XFYO 1GGZA 3PM8A 4C0LA 1QATA 2R2IA 1KK8B 2ERBA 2FCDA 3SG5A 1IIOA 3A4UB 4N1GA 3FS7A 2QACA 4YBHB 1AHRA 2BBMA 1ORGA 1PRWA 2K2FA 2LLSA 1TNWA 4KYNA 1Z2CB 2CCMA 2JQ6A 1QX2A 1JWDA 2KBMA 5HLVA 3TDIA 4NQGA 2QEOA 1SRAA 3BXKA 1LA0A 3BJHA 1K95A 1XO5A 1K96A 2QEVA 2V53A 1B7TZ 3CABA 3NGVA 4CIDA 1QV0A 1WDCC 3GOFA 2JXLA 2KYCA 3D77A 2JTZA 3CR4X 3WNXB 1T14A 1S6JA 2P70A 3V2LA 4CLNA 4D1EA 4GAOA 1SR6C 1U5IA 3HCMA 4INXA 2LP3A 1KFUS 1CDLA 3DXLA 5ER5A 3L4LA 3A8RA 4Q04A 2COLB 2WCMA 3OX6A 1S5GZ 2D8NA 4MLWA 1CDNA 3SJSA 3ZWHA 1CMFA 2LE9B 4MVFA 2MLEC 1B8CA 2OS8C 2BL0B 2WCFA 5I2QA 1LXFC 4PHKA 3AAKA 1XFUO 1MHOA 2WC5A 3LK1A 4PE7A 2JNXA 1NYAA 5EL2A 1G33A 1CFDA 1QJTA 2JU0A 5FYXA 1IWQA 1AJ5A 2HQ8A 1S3PA 2L98A 2WC8A 1DJYA 3DVKA 3K1EA 5HLOA 1A75A 1H8BA 1L2OC 1B4CA 2L4IA 4PCWA 2G9BA 3D0YA 3FIAA 3JVTB 4JWQA 5PALA 2I94A 2ZN9A 1V1FA 1OZSA 1NX0A 3WHUB 1PSRA 2QEHA 2Y4QA 3VROA 1TIZA 2Q4UA 2KGBC 1RROA 2GV5A 1R2UA 1WRLA 4R1EA 4F0ZB 1IH0A 2KSPA 1DF0B 4XYNA 1RJVA 1MQ1A 1XK4A 1NX3A 3PATA 4QJ4B 3BUMB 3OHMB 2L2EA 2Q91A 4PDZA 1XFZO 1K93D 2HPSA 1OOJA 1Y0VH 3PM2A 5I94A 1TN4A 1KFXS 1XFWO 2LNKA 3CLNA 1DTLA 2JPTA 2LHIA 3FE9A 4GGNA 1BJFA 2JZIA 3PSRA 3BFBA 2KOTA 2KQYA 3BQ3A 3DZTA 4AQIA 2BE6A 2L51A 1IG5A 2FCEA 1F70A 1LINA 1K8UA 2EC6C 1TNXA 4M2OA 2BCXA 2Y5IA 2A4JA 1WLMA 2OTGB 2JT8A 5KU1A 1YR5A 4JPZB 4N5XA 1QVIZ 1PVAA 3I5IC 1SYMA 3I5GB 3IQOA 1LVCD 3EG5B 4USLA 5GQQC 1OW4A 2KI4B 1N65A 3D10A 4E68A 1BOCA 3EVUA 4YGBB 4P5OE 3EVRA 1K90D 1KQMC 4OKHA 2K7BA 1BG1A 1XFVO 5JOLA 2WCBA 1BMOA 1XK4C 3GK1A 4DS7A 2MJWB 4YI9A 1YUSA 3DYEA 4PT1A 1UHNA 1SCMC 2FOTA 1IGVA 2YGUA 4XJKA 2NZ0A 1KK7Y 3CDNA 1BT6A 3NHTA 2KHNA 2JXCA 1YX7A 1AJ4A 1SCVA 1YRUB 2M1KB 1AVSA 3KF9A 5AEQA 5IBWA 1DGUA 1QTXA 4NDBA 1C3ZA 1BODA 2P6BB 4OR9B 1CFPA 2L50A 4I5KA 3SG4A 3BFAA 1DELA 4PALA 1SY9A 2B1UA 2LMUA 2NCOA 2LVIA 1TCOB 1KFUL 1CLMA 2I18A 4HRGA 5I8NA 1ODBA 1QS7A 1RK9A 2JULA 3DD4A 4ORAB 2K0JA 3O2PA 1WRKA 2ZRTA 3CWGA 1WY9A 2EHBA 1MR8A 1J1EA 1YURA 1KWOC 2PALA 3NXAA 4PE1A 4UPGA 3LL8B 2KBIA 1JC2A 1QIWA 2LCPA 3NSKA 1JBAA 4ZCUA 3C1VA 2LUXA 2GGZA 1WDCB 4IL1A 3O6BA 2M29A 3SG7A 1NWDA 2NXQA 3UNWA 1Y6WA 2TN4A 3BUXB 1PK0D 3FE8A 3PLFB 1SR6B 1J7RA 1M39A 2QDIA 3QRXA 1RECA 1E8AA 1M31A 1EG3A 3PN7C 1DJIA 1XA5A 2SCPA 3VRQA 1Y1UA 3ZNIA 4MZKA 4DUQA 3CR5X 2KLDA 2OS8B 1DJZA 1Q80A 2M7LA 3D78A 2LUCA 1X02A 3B6XA 1JSAA 3R1PA 4FTGA 4I5LB 3DVMA 3B7AA 1QLKA 2LLTA 1HT9A 1M46A 3FE6A 1XFXO 2MAZA 1W7IB 2LVJA 3DVEA 3I5FC 5CPVA 2CBLA 5AANA 3VB1A 3K21A 2F33A 3BFHA 1ZACA 2H61A 1UP5A 1NX1A 2WCJA 1TWOA 3TUYC 2KFHA 3TDZA 1BR4B 1L2OB 3OB1B 2PSRA 2BKHB 1TNQA 1MXEA 3EK4A 2KAXA 1A4PA 2KYFA 1KFXL 4MRXA 1YVHA 1JUOA 2KNEA 4M2QA 3NHIA 2KDHA 2MHHA 4PHMA 1ZOTB 4JQ0D 5TNCA 1CMGA 2GGMA 1U5IB 2K2AA 4L9MA 5I2LA 4GPLB 2BCAA 2M49B 5DKNA 2M8UA 3NSIA 5HKWA 1UHKA 2JT3A 2K60A 4MZLA 3NSOA 3BYAA 3L47A 2ZN8A 3DY9A 1LA3A 1ALVA 5KSZA 4AOMA 1TTXA 2BBNA 1K94A 2JNFA 2K7DA 1S26D 3B86A 3GK2A 3OGNA 4NDCA 1EJ3A 1C3YA 3NSLA 2M1UA 2O60A 3S0EA 1SNLA 2GTEA 2H61C 5CSNA 2OPOA 3SG6A 1OOGA 2M3WA 1OMDA 1A75B 1W7JB 3LLEA 4P2YB 2G2BA 2H2KA 3RZSA 2EC6B 1FW4A 2F3ZA 4GBAA 3CZ0A 3D0YB 4C0JA 1MF8B 1F4OA 3TDUA 1SKTA 2AUCA 2K8MB 2ISDA 1ZFSA 1M45A 2JOJA 1Y1XA 3I5IB 4DIRA 1MXLC 4C0KA 1F71A 2Y1NA 1F55A 1IKUA 2EGDA 4OV2A 4PHNA 1A29A 2M97A 2K7CA 1YTZC 3S0AA 1KSOA 1TOPA 1CLBA 2JC2A 4F7FA 2QPTA 3EK7A 1OOIX 1S36A 1K9PA 1ZUZA 2LMVA 1XVJA 4M2PA 3SS5A 3VRNA 3JTDC 1SCMB 4MBEA 5FI6A 2MRDA 5AXIA 1BLQA 2M0RA 1WRZA 1HQVA 3R1OA 1F54A 2JWWA 2KQ6A 1Z4HA 3DF0A 5CSFA 3M0WA 3WHTB 2WCKA 1J7QA 1J7PA 1IJ6A 1B47A 1QVIY 1C07A 2L2CA 4WQ2A 4HSZA 1M63B 1SSEB 3RLZA 1N0YA 5I2OA 5HKYA 3KPXA 1XFRA 4GNKB 3I5HC 2WNDA 1XYDA 2MBXA 1IRJA 3D75A 3HX4A 1CFFA 1TRFA 1DQEA 1DEKA 2E6WA 1PVBA 4YGCB 3SIBA 1S6IA 3SS3A 4BY5A 5HKZA
chains in the Genus database with same CATH topology
2MA2A 1JF0A 1OMVA 2KAVA 4FQOA 1CB1A 5D7FA 4A4BA 1S6CA 1PULA 2L4HA 2ZNEA 1V1GA 3ICBA 1KWOB 2IS9A 3BOWA 1GGWA 1GQMA 2CTNA 1SW8A 4PE4A 2ZRSA 2KFFA 3LCPC 5DKQA 1SMGA 1YUTA 1NCXA 3TS5C 4A4CA 1KSMA 2O5GA 1J1DA 2LP2A 5AFPA 2LM5A 1FF1A 4XJKB 3VGOA 4MN0A 1NP8A 1QX7A 2M9GA 4MSPA 4HREE 2RGIA 1JFKA 3H4SE 3PN7B 4YRUA 1F8HA 1L7ZA 4U8DA 1NUBA 1SBJA 1N2DA 1A2XA 1CDPA 3CR2A 4ORBB 2F2OA 1YRTB 1IJ5A 2K7OA 1DJWA 3SG2A 1OMRA 2KGRA 1FBVA 4CPVA 1OQPA 2BCBA 3MSEB 1EG4A 1UUSA 2PVBA 1FI6A 3I5FB 3RM1A 4N1FA 1QX5B 4GGFA 1YVLA 4DRWA 1EL4A 2SASA 5D69A 3TUYB 4ORCB 1B7TY 5HYDA 1WLZA 1GJYA 1QIVA 2HF5A 2LVKA 3AAJA 1KK8C 4I5NB 1IQ3A 1J55A 1OSAA 1UWOA 4OVNF 2BKIB 4PHJA 3KHEA 1OE9B 3F45A 1SPYA 2I7AA 1KCYA 1QV1A 5B8IB 2BE4A 2HETA 1S5GY 5KTYA 1H4BA 1NCYA 1MUXA 1PALA 4GUKA 3OX5A 4YGEB 4MZJA 1S1EA 1A03A 4YI8A 4WRIA 5DKRA 1DVIA 1SK6D 1CKKA 3PALA 1VRKA 2NLNA 1NCZA 2NCPA 4YGDB 1TNPA 2LAPA 3GK4X 3VRPA 1CNPA 1ZMZA 2BECA 4GGFC 2LANA 1BR1B 5CSJA 2CT9A 1K9UA 2L5XB 1KQVA 4I5JA 1CTRA 1UURA 2I2RE 1IQ5A 1DF0A 3FWCA 1QXPA 2LV7A 2F8PA 1NPQA 5J3XA 1RTP1 1DT7B 2BL0C 2JRFA 1CM4A 1LKJA 1TCFA 4MRYA 2KAYA 1B8LA 4CFQA 1DJHA 1B9AA 5CSIA 1UHHA 1B1GA 1FPWA 1JFJA 2Y1MA 2F3YA 2LC5A 2KI6D 1PSBA 2JT0A 3WXAA 2K61A 3JTDB 3OP0A 5F6TA 2ZKMX 1OZOA 1ALWA 2VRGA 3CZTX 1KQMB 1JF2A 3JVTC 2KI6C 3KO0A 1UHJA 3E3RA 3PFVA 2PASA 3BUNB 4ICBA 4WQ3A 3VRRA 3IQQA 1R6PA 2WORA 1F4QA 1K9KA 4GFTA 1D1OA 3IF7A 1UHIA 2ZNDA 4NDDA 1SL7A 1FI5A 2AAOA 3I5HB 5ER4X 1CDMA 1J7OA 2PMYA 1C7VA 1DJGA 2WCEA 4BY4A 2WOSA 3KEVA 1DMOA 2MLFC 3CTNA 4ZCVA 1G8IA 4QJ3B 1SL8A 5K89A 2F2PA 4MEWA 1C7WA 1BU3A 1CM1A 3CGAA 2JTTA 4OCIA 3EKHA 1RFJA 3BUWB 1QLSA 3SG3A 3CS1A 5AERA 2PRUA 1RWYA 2LLUA 3OB2B 1AP4A 2KFGA 3TS5B 1EXRA 4YGAA 3AKBA 3FWBA 4AQJA 1NIWA 4DCKA 1KK7Z 2LMTA 5JJGA 1QASA 3DF0B 2OTGC 3SIAA 4QJ5B 2ZFDA 1SL9A 2E30A 1YUUA 3I5GC 2CXJA 2M7NA 1YX8A 3O4YA 4HRHA 1CFCA 2KI4C 1Y1AA 3AKAA 3EKJA 3EVVA 1K2HA 3BUOB 2DOQA 2HQWA 5G08A 2L0PA 4PE0A 1DGVA 2AMIA 1CLLA 1NSHA 4ETOA 3DVJA 2FJUB 5BPJA 1EH2A 3O78A 2CNPA 2LVVA 1DJXA 4TNCA 1B8RA 3EK8A 3LK0A 1NX2A 1G4YR 3TZ1A 4CFRA 2LHLA 1AK8A 4C0LA 3BOWB 1AUIB 1MWNA 1XFYO 1GGZA 3PM8A 1QATA 2R2IA 1KK8B 2FCDA 3SG5A 3A4UB 4N1GA 3FS7A 2QACA 4YBHB 1AHRA 2BBMA 2K2FA 1PRWA 2LLSA 1TNWA 2CCMA 2JQ6A 1QX2A 1JWDA 2KBMA 5HLVA 3TDIA 4NQGA 3BXKA 1SRAA 1LA0A 1K95A 1XO5A 1K96A 2V53A 1B7TZ 4CIDA 1QV0A 1WDCC 3GOFA 2JXLA 2KYCA 2JTZA 3CR4X 3WNXB 1S6JA 4CLNA 4D1EA 4GAOA 1SR6C 1U5IA 3HCMA 2LP3A 1KFUS 1CDLA 5ER5A 3A8RA 4Q04A 2COLB 3OX6A 1S5GZ 2D8NA 4MLWA 1CDNA 3SJSA 3ZWHA 1CMFA 2LE9B 4MVFA 2MLEC 1B8CA 2OS8C 2BL0B 2WCFA 5I2QA 1LXFC 4PHKA 3AAKA 1XFUO 1MHOA 3LK1A 4PE7A 2JNXA 1NYAA 5FYXA 1G33A 1CFDA 1QJTA 2JU0A 1IWQA 1AJ5A 2HQ8A 1S3PA 2L98A 2WC8A 1DJYA 3DVKA 5HLOA 1A75A 1H8BA 1L2OC 1B4CA 2L4IA 4PCWA 2G9BA 3D0YA 3FIAA 3JVTB 4JWQA 5PALA 2I94A 2ZN9A 1V1FA 1OZSA 1NX0A 3WHUB 1PSRA 2Y4QA 3VROA 1TIZA 2Q4UA 2KGBC 1RROA 2GV5A 1R2UA 1WRLA 4R1EA 4F0ZB 1IH0A 2KSPA 1DF0B 4XYNA 1RJVA 1MQ1A 1XK4A 1NX3A 3PATA 4QJ4B 3BUMB 3OHMB 2L2EA 2Q91A 4PDZA 1XFZO 1K93D 2HPSA 1OOJA 1Y0VH 1TN4A 1KFXS 1XFWO 2LNKA 3CLNA 1DTLA 2JPTA 2LHIA 4GGNA 1BJFA 2JZIA 3PSRA 2KOTA 2KQYA 3BQ3A 4AQIA 1F70A 2BE6A 2L51A 1IG5A 2FCEA 1LINA 1K8UA 2EC6C 1TNXA 4M2OA 2BCXA 2Y5IA 2A4JA 1WLMA 2OTGB 2JT8A 5KU1A 1YR5A 4JPZB 4N5XA 1QVIZ 1PVAA 3I5IC 1SYMA 3I5GB 3IQOA 1LVCD 4USLA 5GQQC 2KI4B 1N65A 3D10A 4E68A 1BOCA 3EVUA 4YGBB 4P5OE 3EVRA 1K90D 1KQMC 4OKHA 2K7BA 1BG1A 1XFVO 5JOLA 2WCBA 1BMOA 1XK4C 3GK1A 4DS7A 2MJWB 4YI9A 1YUSA 1UHNA 1SCMC 2FOTA 1IGVA 4XJKA 2NZ0A 1KK7Y 1BT6A 2KHNA 2JXCA 1YX7A 1AJ4A 1SCVA 1YRUB 2M1KB 1AVSA 3KF9A 5AEQA 5IBWA 1DGUA 1QTXA 4NDBA 1BODA 2P6BB 4OR9B 1CFPA 2L50A 4I5KA 3SG4A 4PALA 1SY9A 2B1UA 2LMUA 2NCOA 2LVIA 1TCOB 1KFUL 1CLMA 2I18A 4HRGA 5I8NA 1ODBA 1QS7A 1RK9A 2JULA 3DD4A 4ORAB 2K0JA 3O2PA 1WRKA 2ZRTA 3CWGA 1WY9A 2EHBA 1MR8A 1J1EA 1YURA 1KWOC 2PALA 3NXAA 4PE1A 4UPGA 3LL8B 2KBIA 1JC2A 1QIWA 2LCPA 3NSKA 1JBAA 4ZCUA 3C1VA 2LUXA 2GGZA 1WDCB 4IL1A 3O6BA 2M29A 3SG7A 1NWDA 2NXQA 1Y6WA 2TN4A 3BUXB 1PK0D 3PLFB 1SR6B 1J7RA 1M39A 3QRXA 1RECA 1E8AA 1M31A 1EG3A 3PN7C 1DJIA 1XA5A 2SCPA 3VRQA 1Y1UA 3ZNIA 4MZKA 4DUQA 3CR5X 2OS8B 1DJZA 1Q80A 2M7LA 2LUCA 1X02A 1JSAA 4FTGA 4I5LB 3DVMA 1QLKA 2LLTA 1HT9A 1M46A 5AANA 1XFXO 2MAZA 1W7IB 2LVJA 3DVEA 3I5FC 5CPVA 2CBLA 3K21A 2F33A 1ZACA 2H61A 1UP5A 1NX1A 3TUYC 2KFHA 3TDZA 1BR4B 1L2OB 3OB1B 2PSRA 2BKHB 1TNQA 1MXEA 3EK4A 2KAXA 1A4PA 2KYFA 1KFXL 4MRXA 1YVHA 1JUOA 2KNEA 4M2QA 2KDHA 2MHHA 4PHMA 1ZOTB 4JQ0D 5TNCA 1CMGA 2GGMA 1U5IB 2K2AA 4L9MA 5I2LA 4GPLB 2BCAA 2M49B 5DKNA 2M8UA 3NSIA 5HKWA 1UHKA 2JT3A 4MZLA 3NSOA 3BYAA 2ZN8A 1LA3A 1ALVA 5KSZA 4AOMA 1TTXA 2BBNA 1K94A 2JNFA 2K7DA 1S26D 3GK2A 4NDCA 1EJ3A 3NSLA 2M1UA 2O60A 1SNLA 2H61C 5CSNA 2OPOA 3SG6A 2M3WA 3LLEA 1OMDA 1A75B 1W7JB 4P2YB 2G2BA 2H2KA 2EC6B 1FW4A 2F3ZA 4GBAA 3D0YB 4C0JA 1MF8B 1F4OA 3TDUA 1SKTA 2AUCA 2K8MB 2ISDA 1ZFSA 1M45A 2JOJA 1Y1XA 3I5IB 4DIRA 1MXLC 4C0KA 1F71A 2Y1NA 1F55A 1IKUA 2EGDA 4OV2A 4PHNA 1A29A 2M97A 2K7CA 1YTZC 1KSOA 1TOPA 1CLBA 2JC2A 2QPTA 3EK7A 1S36A 1K9PA 1ZUZA 2LMVA 1XVJA 4M2PA 3VRNA 3JTDC 1SCMB 4MBEA 5AXIA 2MRDA 1BLQA 1F54A 2M0RA 1WRZA 1HQVA 2JWWA 2KQ6A 3DF0A 5CSFA 3M0WA 3WHTB 1J7QA 1J7PA 1IJ6A 1B47A 1QVIY 1C07A 4WQ2A 4HSZA 1M63B 3RLZA 1N0YA 5I2OA 5HKYA 3KPXA 4GNKB 3I5HC 2WNDA 1XYDA 2MBXA 1IRJA 3HX4A 1CFFA 1TRFA 2E6WA 4BY5A 1PVBA 4YGCB 3SIBA 1S6IA 1BF5A 5HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA2 A;  1JF0 A;  1OMV A;  2KAV A;  4FQO A;  1CB1 A;  5D7F A;  4A4B A;  1S6C A;  1PUL A;  2L4H A;  2ZNE A;  1V1G A;  3ICB A;  1KWO B;  2IS9 A;  3BOW A;  1GGW A;  1GQM A;  2CTN A;  1SW8 A;  4PE4 A;  2ZRS A;  2KFF A;  3LCP C;  5DKQ A;  1SMG A;  1YUT A;  1NCX A;  3TS5 C;  4A4C A;  1KSM A;  2O5G A;  1J1D A;  2LP2 A;  5AFP A;  2LM5 A;  1FF1 A;  4XJK B;  3VGO A;  4MN0 A;  1NP8 A;  1QX7 A;  2M9G A;  4MSP A;  4HRE E;  2RGI A;  1JFK A;  3H4S E;  3PN7 B;  4YRU A;  1F8H A;  1L7Z A;  4U8D A;  1NUB A;  1SBJ A;  1N2D A;  1A2X A;  1CDP A;  3CR2 A;  4ORB B;  2F2O A;  1YRT B;  1IJ5 A;  2K7O A;  1DJW A;  3SG2 A;  1OMR A;  2KGR A;  1FBV A;  4CPV A;  1OQP A;  2BCB A;  3MSE B;  1EG4 A;  1UUS A;  2PVB A;  1FI6 A;  3I5F B;  3RM1 A;  4N1F A;  1QX5 B;  4GGF A;  1YVL A;  4DRW A;  1EL4 A;  2SAS A;  5D69 A;  3TUY B;  4ORC B;  1B7T Y;  5HYD A;  1WLZ A;  1GJY A;  1QIV A;  2HF5 A;  2LVK A;  3AAJ A;  1KK8 C;  4I5N B;  1IQ3 A;  1J55 A;  1OSA A;  1UWO A;  4OVN F;  2BKI B;  4PHJ A;  3KHE A;  1OE9 B;  3F45 A;  1SPY A;  2I7A A;  1KCY A;  1QV1 A;  5B8I B;  2BE4 A;  2HET A;  1S5G Y;  5KTY A;  1H4B A;  1NCY A;  1MUX A;  1PAL A;  4GUK A;  3OX5 A;  4YGE B;  4MZJ A;  1S1E A;  1A03 A;  4YI8 A;  4WRI A;  5DKR A;  1DVI A;  1SK6 D;  1CKK A;  3PAL A;  1VRK A;  2NLN A;  1NCZ A;  2NCP A;  4YGD B;  1TNP A;  2LAP A;  3GK4 X;  3VRP A;  1CNP A;  1ZMZ A;  2BEC A;  4GGF C;  2LAN A;  1BR1 B;  5CSJ A;  2CT9 A;  1K9U A;  2L5X B;  1KQV A;  4I5J A;  1CTR A;  1UUR A;  2I2R E;  1IQ5 A;  1DF0 A;  3FWC A;  1QXP A;  2LV7 A;  2F8P A;  1NPQ A;  5J3X A;  1RTP 1;  1DT7 B;  2BL0 C;  2JRF A;  1CM4 A;  1LKJ A;  1TCF A;  4MRY A;  2KAY A;  1B8L A;  4CFQ A;  1DJH A;  1B9A A;  5CSI A;  1UHH A;  1B1G A;  1FPW A;  1JFJ A;  2Y1M A;  2F3Y A;  2LC5 A;  2KI6 D;  1PSB A;  2JT0 A;  3WXA A;  2K61 A;  3JTD B;  3OP0 A;  5F6T A;  2ZKM X;  1OZO A;  1ALW A;  2VRG A;  3CZT X;  1KQM B;  1JF2 A;  3JVT C;  2KI6 C;  3KO0 A;  1UHJ A;  3E3R A;  3PFV A;  2PAS A;  3BUN B;  4ICB A;  4WQ3 A;  3VRR A;  3IQQ A;  1R6P A;  2WOR A;  1F4Q A;  1K9K A;  4GFT A;  1D1O A;  3IF7 A;  1UHI A;  2ZND A;  4NDD A;  1SL7 A;  1FI5 A;  2AAO A;  3I5H B;  5ER4 X;  1CDM A;  1J7O A;  2PMY A;  1C7V A;  1DJG A;  2WCE A;  4BY4 A;  2WOS A;  3KEV A;  1DMO A;  2MLF C;  3CTN A;  4ZCV A;  1G8I A;  4QJ3 B;  1SL8 A;  5K89 A;  2F2P A;  4MEW A;  1C7W A;  1BU3 A;  1CM1 A;  3CGA A;  2JTT A;  4OCI A;  3EKH A;  1RFJ A;  3BUW B;  1QLS A;  3SG3 A;  3CS1 A;  5AER A;  2PRU A;  1RWY A;  2LLU A;  3OB2 B;  1AP4 A;  2KFG A;  3TS5 B;  1EXR A;  4YGA A;  3AKB A;  3FWB A;  4AQJ A;  1NIW A;  4DCK A;  1KK7 Z;  2LMT A;  5JJG A;  1QAS A;  3DF0 B;  2OTG C;  3SIA A;  4QJ5 B;  2ZFD A;  1SL9 A;  2E30 A;  1YUU A;  3I5G C;  2CXJ A;  2M7N A;  1YX8 A;  3O4Y A;  4HRH A;  1CFC A;  2KI4 C;  1Y1A A;  3AKA A;  3EKJ A;  3EVV A;  1K2H A;  3BUO B;  2DOQ A;  2HQW A;  5G08 A;  2L0P A;  4PE0 A;  1DGV A;  2AMI A;  1CLL A;  1NSH A;  4ETO A;  3DVJ A;  2FJU B;  5BPJ A;  1EH2 A;  3O78 A;  2CNP A;  2LVV A;  1DJX A;  4TNC A;  1B8R A;  3EK8 A;  3LK0 A;  1NX2 A;  1G4Y R;  3TZ1 A;  4CFR A;  2LHL A;  1AK8 A;  4C0L A;  3BOW B;  1AUI B;  1MWN A;  1XFY O;  1GGZ A;  3PM8 A;  1QAT A;  2R2I A;  1KK8 B;  2FCD A;  3SG5 A;  3A4U B;  4N1G A;  3FS7 A;  2QAC A;  4YBH B;  1AHR A;  2BBM A;  2K2F A;  1PRW A;  2LLS A;  1TNW A;  2CCM A;  2JQ6 A;  1QX2 A;  1JWD A;  2KBM A;  5HLV A;  3TDI A;  4NQG A;  3BXK A;  1SRA A;  1LA0 A;  1K95 A;  1XO5 A;  1K96 A;  2V53 A;  1B7T Z;  4CID A;  1QV0 A;  1WDC C;  3GOF A;  2JXL A;  2KYC A;  2JTZ A;  3CR4 X;  3WNX B;  1S6J A;  4CLN A;  4D1E A;  4GAO A;  1SR6 C;  1U5I A;  3HCM A;  2LP3 A;  1KFU S;  1CDL A;  5ER5 A;  3A8R A;  4Q04 A;  2COL B;  3OX6 A;  1S5G Z;  2D8N A;  4MLW A;  1CDN A;  3SJS A;  3ZWH A;  1CMF A;  2LE9 B;  4MVF A;  2MLE C;  1B8C A;  2OS8 C;  2BL0 B;  2WCF A;  5I2Q A;  1LXF C;  4PHK A;  3AAK A;  1XFU O;  1MHO A;  3LK1 A;  4PE7 A;  2JNX A;  1NYA A;  5FYX A;  1G33 A;  1CFD A;  1QJT A;  2JU0 A;  1IWQ A;  1AJ5 A;  2HQ8 A;  1S3P A;  2L98 A;  2WC8 A;  1DJY A;  3DVK A;  5HLO A;  1A75 A;  1H8B A;  1L2O C;  1B4C A;  2L4I A;  4PCW A;  2G9B A;  3D0Y A;  3FIA A;  3JVT B;  4JWQ A;  5PAL A;  2I94 A;  2ZN9 A;  1V1F A;  1OZS A;  1NX0 A;  3WHU B;  1PSR A;  2Y4Q A;  3VRO A;  1TIZ A;  2Q4U A;  2KGB C;  1RRO A;  2GV5 A;  1R2U A;  1WRL A;  4R1E A;  4F0Z B;  1IH0 A;  2KSP A;  1DF0 B;  4XYN A;  1RJV A;  1MQ1 A;  1XK4 A;  1NX3 A;  3PAT A;  4QJ4 B;  3BUM B;  3OHM B;  2L2E A;  2Q91 A;  4PDZ A;  1XFZ O;  1K93 D;  2HPS A;  1OOJ A;  1Y0V H;  1TN4 A;  1KFX S;  1XFW O;  2LNK A;  3CLN A;  1DTL A;  2JPT A;  2LHI A;  4GGN A;  1BJF A;  2JZI A;  3PSR A;  2KOT A;  2KQY A;  3BQ3 A;  4AQI A;  1F70 A;  2BE6 A;  2L51 A;  1IG5 A;  2FCE A;  1LIN A;  1K8U A;  2EC6 C;  1TNX A;  4M2O A;  2BCX A;  2Y5I A;  2A4J A;  1WLM A;  2OTG B;  2JT8 A;  5KU1 A;  1YR5 A;  4JPZ B;  4N5X A;  1QVI Z;  1PVA A;  3I5I C;  1SYM A;  3I5G B;  3IQO A;  1LVC D;  4USL A;  5GQQ C;  2KI4 B;  1N65 A;  3D10 A;  4E68 A;  1BOC A;  3EVU A;  4YGB B;  4P5O E;  3EVR A;  1K90 D;  1KQM C;  4OKH A;  2K7B A;  1BG1 A;  1XFV O;  5JOL A;  2WCB A;  1BMO A;  1XK4 C;  3GK1 A;  4DS7 A;  2MJW B;  4YI9 A;  1YUS A;  1UHN A;  1SCM C;  2FOT A;  1IGV A;  4XJK A;  2NZ0 A;  1KK7 Y;  1BT6 A;  2KHN A;  2JXC A;  1YX7 A;  1AJ4 A;  1SCV A;  1YRU B;  2M1K B;  1AVS A;  3KF9 A;  5AEQ A;  5IBW A;  1DGU A;  1QTX A;  4NDB A;  1BOD A;  2P6B B;  4OR9 B;  1CFP A;  2L50 A;  4I5K A;  3SG4 A;  4PAL A;  1SY9 A;  2B1U A;  2LMU A;  2NCO A;  2LVI A;  1TCO B;  1KFU L;  1CLM A;  2I18 A;  4HRG A;  5I8N A;  1ODB A;  1QS7 A;  1RK9 A;  2JUL A;  3DD4 A;  4ORA B;  2K0J A;  3O2P A;  1WRK A;  2ZRT A;  3CWG A;  1WY9 A;  2EHB A;  1MR8 A;  1J1E A;  1YUR A;  1KWO C;  2PAL A;  3NXA A;  4PE1 A;  4UPG A;  3LL8 B;  2KBI A;  1JC2 A;  1QIW A;  2LCP A;  3NSK A;  1JBA A;  4ZCU A;  3C1V A;  2LUX A;  2GGZ A;  1WDC B;  4IL1 A;  3O6B A;  2M29 A;  3SG7 A;  1NWD A;  2NXQ A;  1Y6W A;  2TN4 A;  3BUX B;  1PK0 D;  3PLF B;  1SR6 B;  1J7R A;  1M39 A;  3QRX A;  1REC A;  1E8A A;  1M31 A;  1EG3 A;  3PN7 C;  1DJI A;  1XA5 A;  2SCP A;  3VRQ A;  1Y1U A;  3ZNI A;  4MZK A;  4DUQ A;  3CR5 X;  2OS8 B;  1DJZ A;  1Q80 A;  2M7L A;  2LUC A;  1X02 A;  1JSA A;  4FTG A;  4I5L B;  3DVM A;  1QLK A;  2LLT A;  1HT9 A;  1M46 A;  5AAN A;  1XFX O;  2MAZ A;  1W7I B;  2LVJ A;  3DVE A;  3I5F C;  5CPV A;  2CBL A;  3K21 A;  2F33 A;  1ZAC A;  2H61 A;  1UP5 A;  1NX1 A;  3TUY C;  2KFH A;  3TDZ A;  1BR4 B;  1L2O B;  3OB1 B;  2PSR A;  2BKH B;  1TNQ A;  1MXE A;  3EK4 A;  2KAX A;  1A4P A;  2KYF A;  1KFX L;  4MRX A;  1YVH A;  1JUO A;  2KNE A;  4M2Q A;  2KDH A;  2MHH A;  4PHM A;  1ZOT B;  4JQ0 D;  5TNC A;  1CMG A;  2GGM A;  1U5I B;  2K2A A;  4L9M A;  5I2L A;  4GPL B;  2BCA A;  2M49 B;  5DKN A;  2M8U A;  3NSI A;  5HKW A;  1UHK A;  2JT3 A;  4MZL A;  3NSO A;  3BYA A;  2ZN8 A;  1LA3 A;  1ALV A;  5KSZ A;  4AOM A;  1TTX A;  2BBN A;  1K94 A;  2JNF A;  2K7D A;  1S26 D;  3GK2 A;  4NDC A;  1EJ3 A;  3NSL A;  2M1U A;  2O60 A;  1SNL A;  2H61 C;  5CSN A;  2OPO A;  3SG6 A;  2M3W A;  3LLE A;  1OMD A;  1A75 B;  1W7J B;  4P2Y B;  2G2B A;  2H2K A;  2EC6 B;  1FW4 A;  2F3Z A;  4GBA A;  3D0Y B;  4C0J A;  1MF8 B;  1F4O A;  3TDU A;  1SKT A;  2AUC A;  2K8M B;  2ISD A;  1ZFS A;  1M45 A;  2JOJ A;  1Y1X A;  3I5I B;  4DIR A;  1MXL C;  4C0K A;  1F71 A;  2Y1N A;  1F55 A;  1IKU A;  2EGD A;  4OV2 A;  4PHN A;  1A29 A;  2M97 A;  2K7C A;  1YTZ C;  1KSO A;  1TOP A;  1CLB A;  2JC2 A;  2QPT A;  3EK7 A;  1S36 A;  1K9P A;  1ZUZ A;  2LMV A;  1XVJ A;  4M2P A;  3VRN A;  3JTD C;  1SCM B;  4MBE A;  5AXI A;  2MRD A;  1BLQ A;  1F54 A;  2M0R A;  1WRZ A;  1HQV A;  2JWW A;  2KQ6 A;  3DF0 A;  5CSF A;  3M0W A;  3WHT B;  1J7Q A;  1J7P A;  1IJ6 A;  1B47 A;  1QVI Y;  1C07 A;  4WQ2 A;  4HSZ A;  1M63 B;  3RLZ A;  1N0Y A;  5I2O A;  5HKY A;  3KPX A;  4GNK B;  3I5H C;  2WND A;  1XYD A;  2MBX A;  1IRJ A;  3HX4 A;  1CFF A;  1TRF A;  2E6W A;  4BY5 A;  1PVB A;  4YGC B;  3SIB A;  1S6I A;  1BF5 A;  5HKZ A; 
#chains in the Genus database with same CATH topology
 2MA2 A;  1JF0 A;  1OMV A;  2KAV A;  4FQO A;  1CB1 A;  5D7F A;  4A4B A;  1S6C A;  2WCL A;  1PUL A;  2L4H A;  2ZNE A;  1V1G A;  3ICB A;  3S0F A;  1KWO B;  2IS9 A;  3BOW A;  1GGW A;  5FI7 A;  1GQM A;  2CTN A;  1SW8 A;  4PE4 A;  3O4X A;  2ZRS A;  2KFF A;  3LCP C;  5DKQ A;  1SMG A;  1YUT A;  1NCX A;  3D73 A;  3TS5 C;  4A4C A;  2BNX A;  1KSM A;  2O5G A;  1J1D A;  2LP2 A;  5AFP A;  2LM5 A;  1FF1 A;  4XJK B;  3VGO A;  3IVT A;  1W9Z A;  4MN0 A;  1NP8 A;  1QX7 A;  2M9G A;  4MSP A;  4HRE E;  3D74 A;  2RGI A;  3CYZ A;  3CZ2 A;  1JFK A;  3H4S E;  3PN7 B;  4YRU A;  1F8H A;  1L7Z A;  4U8D A;  1NUB A;  1SBJ A;  4JD9 A;  1N2D A;  1A2X A;  1CDP A;  3CR2 A;  4ORB B;  2F2O A;  1YRT B;  1IJ5 A;  2K7O A;  1DJW A;  3SG2 A;  1OMR A;  2KGR A;  1FBV A;  4CPV A;  1OQP A;  5HL1 A;  2BCB A;  3OBV A;  3MSE B;  1EG4 A;  1UUS A;  1TUZ A;  2PVB A;  1FI6 A;  3I5F B;  3RM1 A;  1OOH A;  4N1F A;  1QX5 B;  4GGF A;  1YVL A;  4FQT A;  1EL4 A;  2SAS A;  4DRW A;  2P71 A;  5D69 A;  3TUY B;  4ORC B;  1B7T Y;  5HYD A;  1WLZ A;  1GJY A;  1QIV A;  2HF5 A;  2LVK A;  3AAJ A;  1DC1 A;  2KPH A;  4INW A;  1KK8 C;  4I5N B;  1IQ3 A;  1J55 A;  1LS8 A;  1OSA A;  1UWO A;  4OVN F;  2BKI B;  4PHJ A;  3KHE A;  1OE9 B;  3F45 A;  1SPY A;  2I7A A;  1KCY A;  5DIC A;  1QV1 A;  5FI2 A;  3SS4 A;  2BE4 A;  2HET A;  1S5G Y;  5B8I B;  5KTY A;  1H4B A;  1NCY A;  1MUX A;  1PAL A;  4GUK A;  3OX5 A;  4YGE B;  4MZJ A;  1S1E A;  1A03 A;  4YI8 A;  4WRI A;  5DKR A;  1DVI A;  1SK6 D;  1CKK A;  3PAL A;  1VRK A;  2NLN A;  5D3O A;  1NCZ A;  2NCP A;  3R1V A;  3D76 A;  4OZD A;  4YGD B;  1TNP A;  2LAP A;  3GK4 X;  3VRP A;  1CNP A;  1ZMZ A;  2BEC A;  4GGF C;  1BF5 A;  2LAN A;  1BR1 B;  5CSJ A;  2CT9 A;  1K9U A;  2L5X B;  1KQV A;  4I5J A;  1CTR A;  1UUR A;  3QME A;  2I2R E;  1IQ5 A;  1DF0 A;  3FWC A;  1QXP A;  2LV7 A;  2F8P A;  1NPQ A;  5J3X A;  1RTP 1;  1DT7 B;  2BL0 C;  2JRF A;  1P28 A;  3CZ1 A;  1CM4 A;  1LKJ A;  1TCF A;  4MRY A;  2KAY A;  1B8L A;  4CFQ A;  1DJH A;  2WCH A;  1B9A A;  5CSI A;  4IJ7 A;  1UHH A;  1B1G A;  1FPW A;  1JFJ A;  2PYQ A;  2Y1M A;  2F3Y A;  3N7H A;  2LC5 A;  2KI6 D;  1PSB A;  2JT0 A;  3WXA A;  2K61 A;  3JTD B;  3OP0 A;  5F6T A;  2ZKM X;  1OZO A;  2WC6 A;  1ALW A;  2VRG A;  3CZT X;  1KQM B;  1JF2 A;  3JVT C;  2KI6 C;  3KO0 A;  3L4A A;  3S0B A;  1UHJ A;  3E3R A;  3PFV A;  2PAS A;  3B87 A;  3BUN B;  4ICB A;  4WQ3 A;  3VRR A;  3IQQ A;  1R6P A;  2WOR A;  1F4Q A;  1K9K A;  4GFT A;  1D1O A;  3IF7 A;  1UHI A;  2ZND A;  4NDD A;  1SL7 A;  1FI5 A;  2AAO A;  3I5H B;  5ER4 X;  1CDM A;  1J7O A;  2JPO A;  2PMY A;  1C7V A;  1DJG A;  2WCE A;  4BY4 A;  2WOS A;  3KEV A;  1DMO A;  1QWV A;  2MLF C;  3CTN A;  4ZCV A;  1G8I A;  2FJY A;  4QJ3 B;  1SL8 A;  5K89 A;  1OOF A;  3S0D A;  2F2P A;  4MEW A;  1C7W A;  1BU3 A;  1CM1 A;  3CGA A;  2JTT A;  4OCI A;  3S0G A;  3EKH A;  1RFJ A;  3BUW B;  1QLS A;  2H8V A;  3PJI A;  3SG3 A;  3CS1 A;  5AER A;  2PRU A;  1RWY A;  2LLU A;  3OB2 B;  1AP4 A;  2KFG A;  3TS5 B;  1EXR A;  4YGA A;  3AKB A;  4JKT A;  1GM0 A;  3FWB A;  4AQJ A;  1NIW A;  4DCK A;  1KK7 Z;  1TUJ A;  2LMT A;  5JJG A;  1QAS A;  3DF0 B;  2OTG C;  3SIA A;  2PQL A;  4QJ5 B;  3B88 A;  2ZFD A;  1SL9 A;  2E30 A;  1YUU A;  3I5G C;  2CXJ A;  2QEB A;  2M7N A;  1YX8 A;  3O4Y A;  4HRH A;  1CFC A;  2KI4 C;  1Y1A A;  3AKA A;  3EKJ A;  3EVV A;  1K2H A;  3BUO B;  2DOQ A;  2HQW A;  5G08 A;  2L0P A;  2KLE A;  3Q8I A;  4PE0 A;  1DGV A;  2AMI A;  1CLL A;  1NSH A;  4ETO A;  2L5Y A;  3DVJ A;  3UO9 A;  2FJU B;  5BPJ A;  1EH2 A;  3O78 A;  2CNP A;  2LVV A;  1DJX A;  4TNC A;  1B8R A;  3EK8 A;  3LK0 A;  1NX2 A;  1G4Y R;  3TZ1 A;  4CFR A;  2LHL A;  1AK8 A;  2BAP A;  3BOW B;  3R72 A;  1AUI B;  1MWN A;  1XFY O;  1GGZ A;  3PM8 A;  4C0L A;  1QAT A;  2R2I A;  1KK8 B;  2ERB A;  2FCD A;  3SG5 A;  1IIO A;  3A4U B;  4N1G A;  3FS7 A;  2QAC A;  4YBH B;  1AHR A;  2BBM A;  1ORG A;  1PRW A;  2K2F A;  2LLS A;  1TNW A;  4KYN A;  1Z2C B;  2CCM A;  2JQ6 A;  1QX2 A;  1JWD A;  2KBM A;  5HLV A;  3TDI A;  4NQG A;  2QEO A;  1SRA A;  3BXK A;  1LA0 A;  3BJH A;  1K95 A;  1XO5 A;  1K96 A;  2QEV A;  2V53 A;  1B7T Z;  3CAB A;  3NGV A;  4CID A;  1QV0 A;  1WDC C;  3GOF A;  2JXL A;  2KYC A;  3D77 A;  2JTZ A;  3CR4 X;  3WNX B;  1T14 A;  1S6J A;  2P70 A;  3V2L A;  4CLN A;  4D1E A;  4GAO A;  1SR6 C;  1U5I A;  3HCM A;  4INX A;  2LP3 A;  1KFU S;  1CDL A;  3DXL A;  5ER5 A;  3L4L A;  3A8R A;  4Q04 A;  2COL B;  2WCM A;  3OX6 A;  1S5G Z;  2D8N A;  4MLW A;  1CDN A;  3SJS A;  3ZWH A;  1CMF A;  2LE9 B;  4MVF A;  2MLE C;  1B8C A;  2OS8 C;  2BL0 B;  2WCF A;  5I2Q A;  1LXF C;  4PHK A;  3AAK A;  1XFU O;  1MHO A;  2WC5 A;  3LK1 A;  4PE7 A;  2JNX A;  1NYA A;  5EL2 A;  1G33 A;  1CFD A;  1QJT A;  2JU0 A;  5FYX A;  1IWQ A;  1AJ5 A;  2HQ8 A;  1S3P A;  2L98 A;  2WC8 A;  1DJY A;  3DVK A;  3K1E A;  5HLO A;  1A75 A;  1H8B A;  1L2O C;  1B4C A;  2L4I A;  4PCW A;  2G9B A;  3D0Y A;  3FIA A;  3JVT B;  4JWQ A;  5PAL A;  2I94 A;  2ZN9 A;  1V1F A;  1OZS A;  1NX0 A;  3WHU B;  1PSR A;  2QEH A;  2Y4Q A;  3VRO A;  1TIZ A;  2Q4U A;  2KGB C;  1RRO A;  2GV5 A;  1R2U A;  1WRL A;  4R1E A;  4F0Z B;  1IH0 A;  2KSP A;  1DF0 B;  4XYN A;  1RJV A;  1MQ1 A;  1XK4 A;  1NX3 A;  3PAT A;  4QJ4 B;  3BUM B;  3OHM B;  2L2E A;  2Q91 A;  4PDZ A;  1XFZ O;  1K93 D;  2HPS A;  1OOJ A;  1Y0V H;  3PM2 A;  5I94 A;  1TN4 A;  1KFX S;  1XFW O;  2LNK A;  3CLN A;  1DTL A;  2JPT A;  2LHI A;  3FE9 A;  4GGN A;  1BJF A;  2JZI A;  3PSR A;  3BFB A;  2KOT A;  2KQY A;  3BQ3 A;  3DZT A;  4AQI A;  2BE6 A;  2L51 A;  1IG5 A;  2FCE A;  1F70 A;  1LIN A;  1K8U A;  2EC6 C;  1TNX A;  4M2O A;  2BCX A;  2Y5I A;  2A4J A;  1WLM A;  2OTG B;  2JT8 A;  5KU1 A;  1YR5 A;  4JPZ B;  4N5X A;  1QVI Z;  1PVA A;  3I5I C;  1SYM A;  3I5G B;  3IQO A;  1LVC D;  3EG5 B;  4USL A;  5GQQ C;  1OW4 A;  2KI4 B;  1N65 A;  3D10 A;  4E68 A;  1BOC A;  3EVU A;  4YGB B;  4P5O E;  3EVR A;  1K90 D;  1KQM C;  4OKH A;  2K7B A;  1BG1 A;  1XFV O;  5JOL A;  2WCB A;  1BMO A;  1XK4 C;  3GK1 A;  4DS7 A;  2MJW B;  4YI9 A;  1YUS A;  3DYE A;  4PT1 A;  1UHN A;  1SCM C;  2FOT A;  1IGV A;  2YGU A;  4XJK A;  2NZ0 A;  1KK7 Y;  3CDN A;  1BT6 A;  3NHT A;  2KHN A;  2JXC A;  1YX7 A;  1AJ4 A;  1SCV A;  1YRU B;  2M1K B;  1AVS A;  3KF9 A;  5AEQ A;  5IBW A;  1DGU A;  1QTX A;  4NDB A;  1C3Z A;  1BOD A;  2P6B B;  4OR9 B;  1CFP A;  2L50 A;  4I5K A;  3SG4 A;  3BFA A;  1DEL A;  4PAL A;  1SY9 A;  2B1U A;  2LMU A;  2NCO A;  2LVI A;  1TCO B;  1KFU L;  1CLM A;  2I18 A;  4HRG A;  5I8N A;  1ODB A;  1QS7 A;  1RK9 A;  2JUL A;  3DD4 A;  4ORA B;  2K0J A;  3O2P A;  1WRK A;  2ZRT A;  3CWG A;  1WY9 A;  2EHB A;  1MR8 A;  1J1E A;  1YUR A;  1KWO C;  2PAL A;  3NXA A;  4PE1 A;  4UPG A;  3LL8 B;  2KBI A;  1JC2 A;  1QIW A;  2LCP A;  3NSK A;  1JBA A;  4ZCU A;  3C1V A;  2LUX A;  2GGZ A;  1WDC B;  4IL1 A;  3O6B A;  2M29 A;  3SG7 A;  1NWD A;  2NXQ A;  3UNW A;  1Y6W A;  2TN4 A;  3BUX B;  1PK0 D;  3FE8 A;  3PLF B;  1SR6 B;  1J7R A;  1M39 A;  2QDI A;  3QRX A;  1REC A;  1E8A A;  1M31 A;  1EG3 A;  3PN7 C;  1DJI A;  1XA5 A;  2SCP A;  3VRQ A;  1Y1U A;  3ZNI A;  4MZK A;  4DUQ A;  3CR5 X;  2KLD A;  2OS8 B;  1DJZ A;  1Q80 A;  2M7L A;  3D78 A;  2LUC A;  1X02 A;  3B6X A;  1JSA A;  3R1P A;  4FTG A;  4I5L B;  3DVM A;  3B7A A;  1QLK A;  2LLT A;  1HT9 A;  1M46 A;  3FE6 A;  1XFX O;  2MAZ A;  1W7I B;  2LVJ A;  3DVE A;  3I5F C;  5CPV A;  2CBL A;  5AAN A;  3VB1 A;  3K21 A;  2F33 A;  3BFH A;  1ZAC A;  2H61 A;  1UP5 A;  1NX1 A;  2WCJ A;  1TWO A;  3TUY C;  2KFH A;  3TDZ A;  1BR4 B;  1L2O B;  3OB1 B;  2PSR A;  2BKH B;  1TNQ A;  1MXE A;  3EK4 A;  2KAX A;  1A4P A;  2KYF A;  1KFX L;  4MRX A;  1YVH A;  1JUO A;  2KNE A;  4M2Q A;  3NHI A;  2KDH A;  2MHH A;  4PHM A;  1ZOT B;  4JQ0 D;  5TNC A;  1CMG A;  2GGM A;  1U5I B;  2K2A A;  4L9M A;  5I2L A;  4GPL B;  2BCA A;  2M49 B;  5DKN A;  2M8U A;  3NSI A;  5HKW A;  1UHK A;  2JT3 A;  2K60 A;  4MZL A;  3NSO A;  3BYA A;  3L47 A;  2ZN8 A;  3DY9 A;  1LA3 A;  1ALV A;  5KSZ A;  4AOM A;  1TTX A;  2BBN A;  1K94 A;  2JNF A;  2K7D A;  1S26 D;  3B86 A;  3GK2 A;  3OGN A;  4NDC A;  1EJ3 A;  1C3Y A;  3NSL A;  2M1U A;  2O60 A;  3S0E A;  1SNL A;  2GTE A;  2H61 C;  5CSN A;  2OPO A;  3SG6 A;  1OOG A;  2M3W A;  1OMD A;  1A75 B;  1W7J B;  3LLE A;  4P2Y B;  2G2B A;  2H2K A;  3RZS A;  2EC6 B;  1FW4 A;  2F3Z A;  4GBA A;  3CZ0 A;  3D0Y B;  4C0J A;  1MF8 B;  1F4O A;  3TDU A;  1SKT A;  2AUC A;  2K8M B;  2ISD A;  1ZFS A;  1M45 A;  2JOJ A;  1Y1X A;  3I5I B;  4DIR A;  1MXL C;  4C0K A;  1F71 A;  2Y1N A;  1F55 A;  1IKU A;  2EGD A;  4OV2 A;  4PHN A;  1A29 A;  2M97 A;  2K7C A;  1YTZ C;  3S0A A;  1KSO A;  1TOP A;  1CLB A;  2JC2 A;  4F7F A;  2QPT A;  3EK7 A;  1OOI X;  1S36 A;  1K9P A;  1ZUZ A;  2LMV A;  1XVJ A;  4M2P A;  3SS5 A;  3VRN A;  3JTD C;  1SCM B;  4MBE A;  5FI6 A;  2MRD A;  5AXI A;  1BLQ A;  2M0R A;  1WRZ A;  1HQV A;  3R1O A;  1F54 A;  2JWW A;  2KQ6 A;  1Z4H A;  3DF0 A;  5CSF A;  3M0W A;  3WHT B;  2WCK A;  1J7Q A;  1J7P A;  1IJ6 A;  1B47 A;  1QVI Y;  1C07 A;  2L2C A;  4WQ2 A;  4HSZ A;  1M63 B;  1SSE B;  3RLZ A;  1N0Y A;  5I2O A;  5HKY A;  3KPX A;  1XFR A;  4GNK B;  3I5H C;  2WND A;  1XYD A;  2MBX A;  1IRJ A;  3D75 A;  3HX4 A;  1CFF A;  1TRF A;  1DQE A;  1DEK A;  2E6W A;  1PVB A;  4YGC B;  3SIB A;  1S6I A;  3SS3 A;  4BY5 A;  5HKZ A; 
#chains in the Genus database with same CATH homology
 2MA2 A;  1JF0 A;  1OMV A;  2KAV A;  4FQO A;  1CB1 A;  5D7F A;  4A4B A;  1S6C A;  1PUL A;  2L4H A;  2ZNE A;  1V1G A;  3ICB A;  1KWO B;  2IS9 A;  3BOW A;  1GGW A;  1GQM A;  2CTN A;  1SW8 A;  4PE4 A;  2ZRS A;  2KFF A;  3LCP C;  5DKQ A;  1SMG A;  1YUT A;  1NCX A;  3TS5 C;  4A4C A;  1KSM A;  2O5G A;  1J1D A;  2LP2 A;  5AFP A;  2LM5 A;  1FF1 A;  4XJK B;  3VGO A;  4MN0 A;  1NP8 A;  1QX7 A;  2M9G A;  4MSP A;  4HRE E;  2RGI A;  1JFK A;  3H4S E;  3PN7 B;  4YRU A;  1F8H A;  1L7Z A;  4U8D A;  1NUB A;  1SBJ A;  1N2D A;  1A2X A;  1CDP A;  3CR2 A;  4ORB B;  2F2O A;  1YRT B;  1IJ5 A;  2K7O A;  1DJW A;  3SG2 A;  1OMR A;  2KGR A;  1FBV A;  4CPV A;  1OQP A;  2BCB A;  3MSE B;  1EG4 A;  1UUS A;  2PVB A;  1FI6 A;  3I5F B;  3RM1 A;  4N1F A;  1QX5 B;  4GGF A;  1YVL A;  4DRW A;  1EL4 A;  2SAS A;  5D69 A;  3TUY B;  4ORC B;  1B7T Y;  5HYD A;  1WLZ A;  1GJY A;  1QIV A;  2HF5 A;  2LVK A;  3AAJ A;  1KK8 C;  4I5N B;  1IQ3 A;  1J55 A;  1OSA A;  1UWO A;  4OVN F;  2BKI B;  4PHJ A;  3KHE A;  1OE9 B;  3F45 A;  1SPY A;  2I7A A;  1KCY A;  1QV1 A;  5B8I B;  2BE4 A;  2HET A;  1S5G Y;  5KTY A;  1H4B A;  1NCY A;  1MUX A;  1PAL A;  4GUK A;  3OX5 A;  4YGE B;  4MZJ A;  1S1E A;  1A03 A;  4YI8 A;  4WRI A;  5DKR A;  1DVI A;  1SK6 D;  1CKK A;  3PAL A;  1VRK A;  2NLN A;  1NCZ A;  2NCP A;  4YGD B;  1TNP A;  2LAP A;  3GK4 X;  3VRP A;  1CNP A;  1ZMZ A;  2BEC A;  4GGF C;  2LAN A;  1BR1 B;  5CSJ A;  2CT9 A;  1K9U A;  2L5X B;  1KQV A;  4I5J A;  1CTR A;  1UUR A;  2I2R E;  1IQ5 A;  1DF0 A;  3FWC A;  1QXP A;  2LV7 A;  2F8P A;  1NPQ A;  5J3X A;  1RTP 1;  1DT7 B;  2BL0 C;  2JRF A;  1CM4 A;  1LKJ A;  1TCF A;  4MRY A;  2KAY A;  1B8L A;  4CFQ A;  1DJH A;  1B9A A;  5CSI A;  1UHH A;  1B1G A;  1FPW A;  1JFJ A;  2Y1M A;  2F3Y A;  2LC5 A;  2KI6 D;  1PSB A;  2JT0 A;  3WXA A;  2K61 A;  3JTD B;  3OP0 A;  5F6T A;  2ZKM X;  1OZO A;  1ALW A;  2VRG A;  3CZT X;  1KQM B;  1JF2 A;  3JVT C;  2KI6 C;  3KO0 A;  1UHJ A;  3E3R A;  3PFV A;  2PAS A;  3BUN B;  4ICB A;  4WQ3 A;  3VRR A;  3IQQ A;  1R6P A;  2WOR A;  1F4Q A;  1K9K A;  4GFT A;  1D1O A;  3IF7 A;  1UHI A;  2ZND A;  4NDD A;  1SL7 A;  1FI5 A;  2AAO A;  3I5H B;  5ER4 X;  1CDM A;  1J7O A;  2PMY A;  1C7V A;  1DJG A;  2WCE A;  4BY4 A;  2WOS A;  3KEV A;  1DMO A;  2MLF C;  3CTN A;  4ZCV A;  1G8I A;  4QJ3 B;  1SL8 A;  5K89 A;  2F2P A;  4MEW A;  1C7W A;  1BU3 A;  1CM1 A;  3CGA A;  2JTT A;  4OCI A;  3EKH A;  1RFJ A;  3BUW B;  1QLS A;  3SG3 A;  3CS1 A;  5AER A;  2PRU A;  1RWY A;  2LLU A;  3OB2 B;  1AP4 A;  2KFG A;  3TS5 B;  1EXR A;  4YGA A;  3AKB A;  3FWB A;  4AQJ A;  1NIW A;  4DCK A;  1KK7 Z;  2LMT A;  5JJG A;  1QAS A;  3DF0 B;  2OTG C;  3SIA A;  4QJ5 B;  2ZFD A;  1SL9 A;  2E30 A;  1YUU A;  3I5G C;  2CXJ A;  2M7N A;  1YX8 A;  3O4Y A;  4HRH A;  1CFC A;  2KI4 C;  1Y1A A;  3AKA A;  3EKJ A;  3EVV A;  1K2H A;  3BUO B;  2DOQ A;  2HQW A;  5G08 A;  2L0P A;  4PE0 A;  1DGV A;  2AMI A;  1CLL A;  1NSH A;  4ETO A;  3DVJ A;  2FJU B;  5BPJ A;  1EH2 A;  3O78 A;  2CNP A;  2LVV A;  1DJX A;  4TNC A;  1B8R A;  3EK8 A;  3LK0 A;  1NX2 A;  1G4Y R;  3TZ1 A;  4CFR A;  2LHL A;  1AK8 A;  4C0L A;  3BOW B;  1AUI B;  1MWN A;  1XFY O;  1GGZ A;  3PM8 A;  1QAT A;  2R2I A;  1KK8 B;  2FCD A;  3SG5 A;  3A4U B;  4N1G A;  3FS7 A;  2QAC A;  4YBH B;  1AHR A;  2BBM A;  2K2F A;  1PRW A;  2LLS A;  1TNW A;  2CCM A;  2JQ6 A;  1QX2 A;  1JWD A;  2KBM A;  5HLV A;  3TDI A;  4NQG A;  3BXK A;  1SRA A;  1LA0 A;  1K95 A;  1XO5 A;  1K96 A;  2V53 A;  1B7T Z;  4CID A;  1QV0 A;  1WDC C;  3GOF A;  2JXL A;  2KYC A;  2JTZ A;  3CR4 X;  3WNX B;  1S6J A;  4CLN A;  4D1E A;  4GAO A;  1SR6 C;  1U5I A;  3HCM A;  2LP3 A;  1KFU S;  1CDL A;  5ER5 A;  3A8R A;  4Q04 A;  2COL B;  3OX6 A;  1S5G Z;  2D8N A;  4MLW A;  1CDN A;  3SJS A;  3ZWH A;  1CMF A;  2LE9 B;  4MVF A;  2MLE C;  1B8C A;  2OS8 C;  2BL0 B;  2WCF A;  5I2Q A;  1LXF C;  4PHK A;  3AAK A;  1XFU O;  1MHO A;  3LK1 A;  4PE7 A;  2JNX A;  1NYA A;  5FYX A;  1G33 A;  1CFD A;  1QJT A;  2JU0 A;  1IWQ A;  1AJ5 A;  2HQ8 A;  1S3P A;  2L98 A;  2WC8 A;  1DJY A;  3DVK A;  5HLO A;  1A75 A;  1H8B A;  1L2O C;  1B4C A;  2L4I A;  4PCW A;  2G9B A;  3D0Y A;  3FIA A;  3JVT B;  4JWQ A;  5PAL A;  2I94 A;  2ZN9 A;  1V1F A;  1OZS A;  1NX0 A;  3WHU B;  1PSR A;  2Y4Q A;  3VRO A;  1TIZ A;  2Q4U A;  2KGB C;  1RRO A;  2GV5 A;  1R2U A;  1WRL A;  4R1E A;  4F0Z B;  1IH0 A;  2KSP A;  1DF0 B;  4XYN A;  1RJV A;  1MQ1 A;  1XK4 A;  1NX3 A;  3PAT A;  4QJ4 B;  3BUM B;  3OHM B;  2L2E A;  2Q91 A;  4PDZ A;  1XFZ O;  1K93 D;  2HPS A;  1OOJ A;  1Y0V H;  1TN4 A;  1KFX S;  1XFW O;  2LNK A;  3CLN A;  1DTL A;  2JPT A;  2LHI A;  4GGN A;  1BJF A;  2JZI A;  3PSR A;  2KOT A;  2KQY A;  3BQ3 A;  4AQI A;  1F70 A;  2BE6 A;  2L51 A;  1IG5 A;  2FCE A;  1LIN A;  1K8U A;  2EC6 C;  1TNX A;  4M2O A;  2BCX A;  2Y5I A;  2A4J A;  1WLM A;  2OTG B;  2JT8 A;  5KU1 A;  1YR5 A;  4JPZ B;  4N5X A;  1QVI Z;  1PVA A;  3I5I C;  1SYM A;  3I5G B;  3IQO A;  1LVC D;  4USL A;  5GQQ C;  2KI4 B;  1N65 A;  3D10 A;  4E68 A;  1BOC A;  3EVU A;  4YGB B;  4P5O E;  3EVR A;  1K90 D;  1KQM C;  4OKH A;  2K7B A;  1BG1 A;  1XFV O;  5JOL A;  2WCB A;  1BMO A;  1XK4 C;  3GK1 A;  4DS7 A;  2MJW B;  4YI9 A;  1YUS A;  1UHN A;  1SCM C;  2FOT A;  1IGV A;  4XJK A;  2NZ0 A;  1KK7 Y;  1BT6 A;  2KHN A;  2JXC A;  1YX7 A;  1AJ4 A;  1SCV A;  1YRU B;  2M1K B;  1AVS A;  3KF9 A;  5AEQ A;  5IBW A;  1DGU A;  1QTX A;  4NDB A;  1BOD A;  2P6B B;  4OR9 B;  1CFP A;  2L50 A;  4I5K A;  3SG4 A;  4PAL A;  1SY9 A;  2B1U A;  2LMU A;  2NCO A;  2LVI A;  1TCO B;  1KFU L;  1CLM A;  2I18 A;  4HRG A;  5I8N A;  1ODB A;  1QS7 A;  1RK9 A;  2JUL A;  3DD4 A;  4ORA B;  2K0J A;  3O2P A;  1WRK A;  2ZRT A;  3CWG A;  1WY9 A;  2EHB A;  1MR8 A;  1J1E A;  1YUR A;  1KWO C;  2PAL A;  3NXA A;  4PE1 A;  4UPG A;  3LL8 B;  2KBI A;  1JC2 A;  1QIW A;  2LCP A;  3NSK A;  1JBA A;  4ZCU A;  3C1V A;  2LUX A;  2GGZ A;  1WDC B;  4IL1 A;  3O6B A;  2M29 A;  3SG7 A;  1NWD A;  2NXQ A;  1Y6W A;  2TN4 A;  3BUX B;  1PK0 D;  3PLF B;  1SR6 B;  1J7R A;  1M39 A;  3QRX A;  1REC A;  1E8A A;  1M31 A;  1EG3 A;  3PN7 C;  1DJI A;  1XA5 A;  2SCP A;  3VRQ A;  1Y1U A;  3ZNI A;  4MZK A;  4DUQ A;  3CR5 X;  2OS8 B;  1DJZ A;  1Q80 A;  2M7L A;  2LUC A;  1X02 A;  1JSA A;  4FTG A;  4I5L B;  3DVM A;  1QLK A;  2LLT A;  1HT9 A;  1M46 A;  5AAN A;  1XFX O;  2MAZ A;  1W7I B;  2LVJ A;  3DVE A;  3I5F C;  5CPV A;  2CBL A;  3K21 A;  2F33 A;  1ZAC A;  2H61 A;  1UP5 A;  1NX1 A;  3TUY C;  2KFH A;  3TDZ A;  1BR4 B;  1L2O B;  3OB1 B;  2PSR A;  2BKH B;  1TNQ A;  1MXE A;  3EK4 A;  2KAX A;  1A4P A;  2KYF A;  1KFX L;  4MRX A;  1YVH A;  1JUO A;  2KNE A;  4M2Q A;  2KDH A;  2MHH A;  4PHM A;  1ZOT B;  4JQ0 D;  5TNC A;  1CMG A;  2GGM A;  1U5I B;  2K2A A;  4L9M A;  5I2L A;  4GPL B;  2BCA A;  2M49 B;  5DKN A;  2M8U A;  3NSI A;  5HKW A;  1UHK A;  2JT3 A;  4MZL A;  3NSO A;  3BYA A;  2ZN8 A;  1LA3 A;  1ALV A;  5KSZ A;  4AOM A;  1TTX A;  2BBN A;  1K94 A;  2JNF A;  2K7D A;  1S26 D;  3GK2 A;  4NDC A;  1EJ3 A;  3NSL A;  2M1U A;  2O60 A;  1SNL A;  2H61 C;  5CSN A;  2OPO A;  3SG6 A;  2M3W A;  3LLE A;  1OMD A;  1A75 B;  1W7J B;  4P2Y B;  2G2B A;  2H2K A;  2EC6 B;  1FW4 A;  2F3Z A;  4GBA A;  3D0Y B;  4C0J A;  1MF8 B;  1F4O A;  3TDU A;  1SKT A;  2AUC A;  2K8M B;  2ISD A;  1ZFS A;  1M45 A;  2JOJ A;  1Y1X A;  3I5I B;  4DIR A;  1MXL C;  4C0K A;  1F71 A;  2Y1N A;  1F55 A;  1IKU A;  2EGD A;  4OV2 A;  4PHN A;  1A29 A;  2M97 A;  2K7C A;  1YTZ C;  1KSO A;  1TOP A;  1CLB A;  2JC2 A;  2QPT A;  3EK7 A;  1S36 A;  1K9P A;  1ZUZ A;  2LMV A;  1XVJ A;  4M2P A;  3VRN A;  3JTD C;  1SCM B;  4MBE A;  5AXI A;  2MRD A;  1BLQ A;  1F54 A;  2M0R A;  1WRZ A;  1HQV A;  2JWW A;  2KQ6 A;  3DF0 A;  5CSF A;  3M0W A;  3WHT B;  1J7Q A;  1J7P A;  1IJ6 A;  1B47 A;  1QVI Y;  1C07 A;  4WQ2 A;  4HSZ A;  1M63 B;  3RLZ A;  1N0Y A;  5I2O A;  5HKY A;  3KPX A;  4GNK B;  3I5H C;  2WND A;  1XYD A;  2MBX A;  1IRJ A;  3HX4 A;  1CFF A;  1TRF A;  2E6W A;  4BY5 A;  1PVB A;  4YGC B;  3SIB A;  1S6I A;  1BF5 A;  5HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...