2LVKA

Solution structure of ca-bound phl p 7
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvkA00
1XFUO 2JT8A 1TN4A 5JOLA 2JNXA 1F70A 2JXLA 2KDHA 1LA3A 3VRPA 2LLUA 1PK0D 2K7OA 2KQ6A 3D0YA 1CNPA 1FI6A 4U8DA 1KQMB 1S5GY 1WRLA 2BCXA 3TUYB 3FWBA 3BOWB 4PHJA 1QVIZ 3M0WA 2CCMA 2OS8B 1CDMA 2MJWB 3BUXB 4WQ3A 1TRFA 1JFKA 3VRNA 5I2OA 1NP8A 1ALVA 2ZFDA 1YVHA 1U5IA 5HKYA 1CMFA 4PE1A 1YRUB 2G9BA 2JZIA 4I5NB 2Q91A 4D1EA 4GUKA 2ZRTA 2KGRA 1IRJA 2I94A 1D1OA 3PM8A 1ZOTB 3LCPC 3KHEA 3LLEA 1DVIA 1TNXA 1QV1A 1CLBA 2LLSA 2JTTA 1QXPA 3JTDB 4YBHB 1F4OA 2F8PA 1OE9B 2BECA 3PSRA 1CDPA 3OX5A 2KAYA 2MHHA 1IJ5A 1LKJA 2QPTA 2OTGB 3I5HB 3EKHA 3DVJA 5GQQC 1DJWA 1NCZA 1J7QA 1DJZA 1WY9A 1B1GA 5FYXA 1BODA 1SL8A 4GGFA 3DVMA 4PE7A 2MRDA 3I5IB 1TOPA 2F2OA 2ZNDA 3LL8B 5B8IB 2CXJA 3WXAA 3EK8A 5CSJA 2JC2A 3GK1A 3NSLA 4I5JA 3BQ3A 5HKWA 1CDLA 1A75B 1OMRA 2HETA 1A29A 1K2HA 4BY4A 2F2PA 2H61A 4XJKB 1SW8A 4YGEB 5ER4X 2K7DA 1TNPA 2PRUA 2LCPA 1JWDA 3PALA 3ZNIA 4XYNA 1YX8A 2KBIA 3HCMA 1M39A 1FPWA 1SRAA 2L4HA 2ZN8A 1TIZA 1ZFSA 1XFWO 2WCBA 2Q4UA 1UURA 1AJ4A 1NUBA 5HYDA 1KWOC 1QTXA 2KOTA 2KNEA 2OPOA 2WC8A 2Y1MA 3F45A 3ICBA 1DT7B 2KFFA 1SCMC 4DIRA 2LVVA 2M1UA 4HSZA 3EVRA 1J1EA 1AK8A 1BR4B 2BKIB 2HF5A 2ZRSA 2BCBA 3VRQA 2PMYA 2NLNA 1K94A 4CIDA 1A03A 3PN7B 3TDIA 2LMUA 1RK9A 4NDBA 1DMOA 3TDZA 2Y1NA 4ETOA 3BUWB 1PALA 2MLFC 3SG7A 2M7LA 1EG3A 3EKJA 1G33A 5AXIA 2JOJA 3CR4X 3SIAA 2PSRA 1KK8C 3DF0A 1EXRA 5AFPA 1F8HA 3IF7A 3RM1A 1CM1A 1J7RA 1WRZA 1AHRA 1S26D 3JVTB 1NX3A 3CWGA 1KQVA 2LHIA 1F71A 1AUIB 4C0JA 4MSPA 4C0LA 1R6PA 4P5OE 2GGMA 1DJXA 1JFJA 2LVKA 4YRUA 1HT9A 1KK7Z 5IBWA 2H2KA 2KBMA 1RTP1 4MRYA 2KHNA 4OVNF 3PATA 4GPLB 5I8NA 1B47A 3I5FB 2LE9B 2K0JA 1ODBA 1DF0B 1IGVA 1XVJA 1IQ5A 1YUTA 1NX2A 2L5XB 4GNKB 1IG5A 3GK4X 4Q04A 1BG1A 3I5HC 1KFXL 5K89A 2KI4B 4MEWA 5D7FA 1B8CA 2I7AA 5TNCA 1IQ3A 2BE6A 3E3RA 1RWYA 2LLTA 2NZ0A 5D69A 2I2RE 3O6BA 1SNLA 2M9GA 3O2PA 1F55A 2JNFA 1SCVA 2EC6C 1JBAA 1IH0A 2QACA 1BR1B 1OZSA 1NCXA 4N5XA 1MXEA 3BOWA 2LVJA 3AAKA 2M49B 4GGFC 1WDCB 1N2DA 2B1UA 3EVVA 1NX1A 1Y0VH 3BUNB 1G8IA 2BE4A 2BL0B 2KI6D 1M45A 3CR2A 3TDUA 1V1FA 1NYAA 1IJ6A 1B8LA 1OQPA 4USLA 1C7VA 1L7ZA 1LVCD 1QJTA 1YRTB 3KPXA 4PHMA 2L0PA 4HRHA 2H61C 1QATA 5PALA 1BU3A 2JT0A 1K95A 4CLNA 3AKBA 4DCKA 3FS7A 2LNKA 1F54A 3AAJA 5DKRA 1NIWA 2BKHB 1YTZC 1DGUA 1TNWA 2KFHA 2A4JA 1DJIA 5G08A 1C07A 1KSOA 4JWQA 4NDDA 1XFXO 3WNXB 1IKUA 1QVIY 1K9UA 2WOSA 3OB2B 3BUOB 3A4UB 4YGAA 1PSRA 1XO5A 1RFJA 1S6JA 4ICBA 1ZMZA 2VRGA 3GOFA 3NSOA 3SJSA 3BXKA 4GAOA 3SG4A 2F3ZA 2HQWA 1M46A 2FJUB 1MR8A 3MSEB 3I5GB 1UWOA 1OOJA 2KFGA 1UHKA 1PVAA 2PVBA 5I2QA 1YX7A 4WRIA 4XJKA 1MUXA 4N1FA 4CPVA 2G2BA 2WCFA 1ZACA 1MF8B 3DVKA 5HKZA 3NSIA 4DRWA 4P2YB 3TZ1A 1OMVA 1XFVO 1NCYA 3HX4A 4PE0A 4ORCB 3SG3A 2JWWA 2L98A 2LMTA 1L2OB 1OZOA 1QX7A 2PALA 2LHLA 1SYMA 4MZLA 3TS5B 2KYFA 2BBMA 2GV5A 1B4CA 2LUCA 1GQMA 3CS1A 4YI9A 4PCWA 1R2UA 1N0YA 1ZUZA 1XA5A 1B7TZ 1UP5A 2LUXA 1K96A 1Q80A 2WCEA 1KFXS 1SK6D 2M97A 2ZKMX 1BJFA 1F4QA 4CFRA 1SL9A 3FWCA 4ORBB 1DGVA 2JQ6A 3D10A 4UPGA 1K9PA 3OP0A 1DJGA 1G4YR 1CKKA 2NCOA 3EK4A 5J3XA 4E68A 4MZJA 4TNCA 1BMOA 1BF5A 1CDNA 1PSBA 1CFCA 1UUSA 3AKAA 1YUUA 1QS7A 3O78A 1B7TY 1KQMC 3TUYC 1CFDA 1SL7A 1QASA 4MRXA 1TTXA 2OS8C 1EL4A 1UHJA 4OV2A 1SR6B 4NQGA 3WHUB 2SASA 4AQIA 2EGDA 2SCPA 2KSPA 1RECA 3KF9A 2LV7A 1DF0A 1E8AA 1CM4A 3A8RA 2NCPA 2Y4QA 2AUCA 2M29A 4PALA 1CTRA 1X02A 5KTYA 2BBNA 3JTDC 2K2AA 4WQ2A 1CB1A 2FCDA 2TN4A 2OTGC 2CT9A 1XFZO 1MQ1A 4NDCA 4PHNA 2HQ8A 4N1GA 3NSKA 1QIVA 3CZTX 4CFQA 2LVIA 2M1KB 1CLMA 3C1VA 3DF0B 1DTLA 3I5IC 3PLFB 1JSAA 1KK7Y 2JRFA 2KQYA 3VGOA 2K7CA 4OCIA 5BPJA 2K2FA 2E30A 1KCYA 1SY9A 4L9MA 1JF2A 3K21A 1FI5A 1KFUL 1XYDA 1S5GZ 2WORA 1AJ5A 1CMGA 3OB1B 1XK4C 3TS5C 1JC2A 1W7IB 1UHNA 1QLSA 1TCOB 1OSAA 1Y1XA 2JULA 2L4IA 2LM5A 2V53A 1AP4A 2ISDA 4FTGA 1NX0A 3SG5A 5KU1A 1EG4A 1J7PA 4I5KA 2LC5A 1YVLA 1H4BA 1SKTA 4F0ZB 2F3YA 2JTZA 4FQOA 1HQVA 3SG2A 2GGZA 2ZN9A 2BCAA 1NSHA 4QJ5B 5JJGA 2EHBA 3PN7C 1SPYA 1KK8B 1MXLC 3BUMB 4JQ0D 1WLMA 2K8MB 3D0YB 1K93D 2AAOA 2E6WA 2JT3A 4M2QA 1Y1AA 1GJYA 4AQJA 2DOQA 4IL1A 3EVUA 4YGBB 4JPZB 1CLLA 1RROA 1A75A 2KI6C 5AEQA 1SR6C 1OMDA 1W7JB 1QX5B 3JVTC 3O4YA 1QV0A 3GK2A 2IS9A 1U5IB 2K7BA 2KYCA 2WNDA 3BYAA 1LINA 1XK4A 1J55A 1LA0A 1NWDA 4MLWA 2ZNEA 4M2PA 4YI8A 2LP2A 4I5LB 5KSZA 3IQQA 4PDZA 1EJ3A 3I5FC 2CNPA 4MN0A 3QRXA 4YGDB 1A4PA 3SIBA 4MZKA 4M2OA 1J7OA 1S3PA 1JUOA 2EC6B 5CSNA 2KI4C 3CR5X 4A4CA 3EK7A 4AOMA 3DD4A 1SBJA 1YUSA 2R2IA 1YURA 1KSMA 1S36A 1QLKA 5DKQA 1B9AA 3WHTB 3NXAA 4C0KA 3H4SE 2NXQA 1QIWA 3ZWHA 4OKHA 1AVSA 2JPTA 5CSIA 4BY5A 2JXCA 1PULA 2LAPA 2L50A 2M8UA 5ER5A 3DVEA 4MVFA 1FW4A 1Y6WA 4ORAB 4OR9B 1WDCC 2LANA 1K90D 1LXFC 1H8BA 2M7NA 1M31A 1NPQA 1C7WA 1PRWA 2BL0C 1RJVA 3OHMB 2KAVA 3IQOA 1BLQA 2MLEC 1KFUS 2O60A 1K9KA 4R1EA 1UHIA 3VROA 4HRGA 5I2LA 3KEVA 4GGNA 1QX2A 2M0RA 2RGIA 1CFFA 2L2EA 1GGZA 3SG6A 4ZCVA 3CLNA 1S6IA 2MA2A 5DKNA 1A2XA 1BOCA 2I18A 1VRKA 2COLB 4GBAA 2L51A 1M63B 4PE4A 1PVBA 1UHHA 1K8UA 2K61A 1DJHA 1MWNA 5HLOA 3CTNA 4A4BA 1V1GA 3FIAA 1XFYO 4PHKA 5F6TA 1Y1UA 2HPSA 4ZCUA 3LK1A 2FCEA 2KGBC 5HLVA 3OX6A 3CGAA 1N65A 1B8RA 1MHOA 1JF0A 4HREE 1TNQA 2MBXA 4GFTA 4QJ4B 1IWQA 1YR5A 3I5GC 3LK0A 2AMIA 4MBEA 1WRKA 5CPVA 4YGCB 4QJ3B 1TCFA 4DS7A 2CBLA 2D8NA 2P6BB 3PFVA 2CTNA 2KAXA 5CSFA 4DUQA 2LMVA 2LP3A 2PASA 3KO0A 1ALWA 1FF1A 5AERA 1FBVA 5AANA 1DJYA 2JU0A 2M3WA 2F33A 2Y5IA 1WLZA 2FOTA 1L2OC 2O5GA 1CFPA 1J1DA 2MAZA 1KWOB 1SMGA 1S1EA 1BT6A 3VRRA 3RLZA 1SCMB 1EH2A 1S6CA 1GGWA
chains in the Genus database with same CATH superfamily
1XFUO 2JT8A 1TN4A 3B86A 5JOLA 2JNXA 1F70A 2JXLA 2KDHA 1LA3A 3VRPA 2LLUA 1PK0D 2K7OA 2KQ6A 3D0YA 1CNPA 1FI6A 4U8DA 2KPHA 1KQMB 1S5GY 1WRLA 2BCXA 3TUYB 3FWBA 3BOWB 4PHJA 1QVIZ 3M0WA 2CCMA 2OS8B 1CDMA 2MJWB 3BUXB 3L47A 1TRFA 4WQ3A 1JFKA 3VRNA 5I2OA 1NP8A 1ALVA 2ZFDA 1YVHA 1U5IA 5HKYA 3FE9A 1CMFA 5FI2A 4PE1A 1YRUB 2G9BA 2JZIA 4I5NB 2L5YA 2Q91A 4D1EA 4GUKA 2ZRTA 3VB1A 2KGRA 1IRJA 2I94A 3D76A 1D1OA 3PM8A 1W9ZA 1ZOTB 3LCPC 3NHTA 3KHEA 3LLEA 1C3ZA 1DVIA 1QV1A 1TNXA 2LLSA 2JTTA 1CLBA 1QXPA 3JTDB 4YBHB 1F4OA 1OOIX 4JD9A 2F8PA 1OE9B 2BECA 3PSRA 1CDPA 2PYQA 2KAYA 3OX5A 2MHHA 1IJ5A 1LKJA 2QPTA 2OTGB 3I5HB 3EKHA 3DVJA 2KLDA 5GQQC 1DJWA 3DY9A 1NCZA 3CDNA 1J7QA 1DJZA 5D3OA 1WY9A 1B1GA 5FYXA 1BODA 1SL8A 4GGFA 3DVMA 4PE7A 3EG5B 2MRDA 3I5IB 3PJIA 2BNXA 1TOPA 2F2OA 2ZNDA 3B87A 3LL8B 5B8IB 1SSEB 2CXJA 3WXAA 3EK8A 5CSJA 2JC2A 1DC1A 3GK1A 3NSLA 2QDIA 3BQ3A 4I5JA 5HKWA 1CDLA 1A75B 1OMRA 2HETA 1A29A 1K2HA 4BY4A 2F2PA 3S0FA 2H61A 4XJKB 1SW8A 4YGEB 1DEKA 5ER4X 2K7DA 1TNPA 2PRUA 2LCPA 1JWDA 3PALA 3ZNIA 4XYNA 1YX8A 2KBIA 3HCMA 1M39A 1FPWA 1SRAA 2L4HA 2ZN8A 1TIZA 1ZFSA 1TUZA 3K1EA 1XFWO 2WCBA 2Q4UA 1UURA 1AJ4A 1NUBA 5HYDA 1KWOC 1QTXA 2KOTA 2KNEA 2OPOA 2WC8A 2Y1MA 3F45A 3ICBA 1DT7B 2KFFA 1SCMC 4DIRA 2LVVA 2M1UA 3FE8A 3EVRA 1J1EA 4HSZA 1AK8A 1BR4B 2BKIB 2HF5A 2ZRSA 2BCBA 3VRQA 2PMYA 2NLNA 1K94A 4CIDA 1A03A 3PN7B 3TDIA 2LMUA 2YGUA 4INXA 1RK9A 3D77A 4NDBA 2P70A 1DMOA 3TDZA 2Y1NA 4ETOA 3BUWB 1PALA 2MLFC 3D78A 3BFAA 2M7LA 1EG3A 1DELA 1Z2CB 3EKJA 1G33A 5AXIA 3UO9A 2JOJA 3CR4X 3SIAA 2PSRA 1KK8C 3DF0A 1EXRA 5AFPA 1F8HA 3IF7A 3RM1A 1CM1A 1J7RA 1WRZA 1AHRA 1S26D 3JVTB 1NX3A 3CWGA 1GM0A 1KQVA 2LHIA 1F71A 1AUIB 4C0JA 4MSPA 4C0LA 2WC5A 1R6PA 4P5OE 2GGMA 1DJXA 1JFJA 2LVKA 4YRUA 1HT9A 1KK7Z 5IBWA 2QEVA 2H2KA 2KBMA 1RTP1 4MRYA 2KHNA 4OVNF 3PATA 4GPLB 5I8NA 1B47A 3I5FB 2LE9B 2K0JA 1ODBA 1DF0B 1IGVA 1XVJA 1IQ5A 1YUTA 1NX2A 1T14A 2L5XB 4GNKB 1IG5A 1C3YA 3GK4X 4Q04A 1BG1A 3I5HC 1KFXL 3R1VA 5K89A 2KI4B 4MEWA 5D7FA 1B8CA 2I7AA 5TNCA 1IQ3A 2BE6A 3E3RA 1RWYA 2LLTA 2NZ0A 5D69A 2I2RE 3O6BA 1SNLA 2M9GA 3O2PA 1F55A 2JNFA 1SCVA 2EC6C 1JBAA 1IH0A 2QACA 5DICA 1BR1B 1OZSA 1NCXA 4N5XA 1MXEA 3BOWA 2LVJA 3AAKA 2M49B 3BJHA 4GGFC 1WDCB 1N2DA 2B1UA 3EVVA 1NX1A 1Y0VH 3BUNB 5EL2A 1G8IA 2BE4A 2ERBA 2BL0B 2KI6D 1M45A 3CR2A 1ORGA 3TDUA 1V1FA 1NYAA 1IJ6A 1B8LA 1OQPA 4USLA 1C7VA 1L7ZA 1TWOA 1LVCD 1QJTA 1YRTB 3KPXA 4PHMA 2L0PA 2WCHA 4HRHA 2H61C 1QATA 5PALA 1BU3A 2JT0A 1K95A 4CLNA 3AKBA 4DCKA 3FS7A 2LNKA 1F54A 3AAJA 5DKRA 1NIWA 3R1OA 4JKTA 2BKHB 1YTZC 2JPOA 1DGUA 1TNWA 2KFHA 2A4JA 1DJIA 5G08A 1C07A 1KSOA 4JWQA 4NDDA 1XFXO 3WNXB 1IKUA 1QVIY 1K9UA 2WOSA 3OB2B 3BUOB 3A4UB 4YGAA 1PSRA 1XO5A 1RFJA 1S6JA 4ICBA 1ZMZA 2VRGA 3GOFA 3NSOA 3SJSA 3BXKA 4GAOA 3SG4A 2F3ZA 2HQWA 1M46A 2FJUB 1MR8A 3MSEB 3I5GB 1UWOA 1OOJA 2KFGA 1UHKA 1PVAA 2PVBA 5FI7A 1YX7A 4WRIA 4XJKA 1MUXA 4N1FA 5I2QA 4CPVA 2G2BA 2WCFA 1ZACA 1MF8B 3DVKA 5HKZA 3NSIA 4DRWA 4P2YB 3TZ1A 1OMVA 1XFVO 2WCKA 1NCYA 3HX4A 4PE0A 4F7FA 4ORCB 3SG3A 2JWWA 2L98A 2LMTA 1L2OB 3D74A 3S0AA 1OZOA 1QX7A 2PALA 3OBVA 3SS4A 2LHLA 1SYMA 4MZLA 3TS5B 2KYFA 2BBMA 2GV5A 3B7AA 2LUCA 1GQMA 3CS1A 4YI9A 1OW4A 4PCWA 1B4CA 1R2UA 1N0YA 1ZUZA 1XA5A 1B7TZ 1UP5A 2LUXA 1K96A 1Q80A 2WCEA 1KFXS 1SK6D 2M97A 2ZKMX 1BJFA 3D75A 1F4QA 4CFRA 1SL9A 3FWCA 4ORBB 1DGVA 2JQ6A 2WCLA 3D10A 4UPGA 1K9PA 3OP0A 1DJGA 1G4YR 1CKKA 2NCOA 1QWVA 3EK4A 4INWA 5J3XA 4MZJA 4TNCA 4E68A 1BMOA 1BF5A 1CDNA 1PSBA 1CFCA 1UUSA 3AKAA 1YUUA 1QS7A 3O78A 1B7TY 1KQMC 3TUYC 1CFDA 1SL7A 1QASA 4MRXA 1TTXA 2OS8C 1EL4A 1UHJA 4OV2A 1SR6B 4NQGA 3WHUB 2SASA 4AQIA 2EGDA 2SCPA 2KSPA 1RECA 3KF9A 4FQTA 3UNWA 2LV7A 3BFBA 2L2CA 1DF0A 1E8AA 1CM4A 2WCJA 3A8RA 2NCPA 3SG7A 2Y4QA 3RZSA 2AUCA 2M29A 4PALA 1XFRA 1CTRA 1X02A 5KTYA 2BBNA 2WC6A 3JTDC 3BFHA 2K2AA 4WQ2A 2QEHA 3D73A 1CB1A 2FCDA 2TN4A 2OTGC 2CT9A 1XFZO 1MQ1A 4NDCA 3CZ2A 4PHNA 1OOHA 2HQ8A 3L4LA 4N1GA 3NSKA 1QIVA 3CZTX 4CFQA 2LVIA 2M1KB 1CLMA 3C1VA 3DF0B 1DTLA 3I5IC 3PLFB 1JSAA 1KK7Y 2JRFA 2KQYA 3VGOA 2K7CA 4OCIA 5BPJA 4OZDA 2K2FA 2E30A 1KCYA 1SY9A 4L9MA 3DXLA 1JF2A 3V2LA 4KYNA 3K21A 3S0GA 1FI5A 1KFUL 1XYDA 1S5GZ 2WORA 2KLEA 1AJ5A 1CMGA 3OB1B 1XK4C 2P71A 1Z4HA 3L4AA 3TS5C 1JC2A 1W7IB 3NHIA 1UHNA 1QLSA 1TCOB 1OSAA 1Y1XA 2JULA 2L4IA 2LM5A 2V53A 3PM2A 1AP4A 2ISDA 4FTGA 1NX0A 3SG5A 5KU1A 1EG4A 3SS5A 1J7PA 4I5KA 2LC5A 1YVLA 1H4BA 1SKTA 4F0ZB 2F3YA 2JTZA 4FQOA 3IVTA 1HQVA 3SG2A 2GGZA 3O4XA 2ZN9A 5I94A 2BCAA 3B88A 1NSHA 4QJ5B 5JJGA 2PQLA 2EHBA 3QMEA 3PN7C 1SPYA 1KK8B 1MXLC 3BUMB 4JQ0D 2QEBA 1WLMA 2K8MB 1LS8A 3D0YB 1K93D 2AAOA 2E6WA 2JT3A 4M2QA 1Y1AA 3R72A 1GJYA 3DYEA 4AQJA 2DOQA 4IL1A 2K60A 3EVUA 4YGBB 3FE6A 4JPZB 1CLLA 1RROA 1A75A 2KI6C 5AEQA 3DZTA 3N7HA 1SR6C 1OMDA 1W7JB 1QX5B 3JVTC 3O4YA 1DQEA 1QV0A 3GK2A 2IS9A 1U5IB 2K7BA 2KYCA 2WNDA 3BYAA 1LINA 1XK4A 1J55A 1LA0A 1NWDA 4MLWA 3S0BA 2ZNEA 4M2PA 4YI8A 2QEOA 2LP2A 3Q8IA 4I5LB 1P28A 5KSZA 3IQQA 5FI6A 4PDZA 1EJ3A 3I5FC 3CZ0A 3S0EA 2CNPA 4MN0A 3QRXA 4YGDB 1A4PA 3SIBA 4MZKA 4M2OA 1J7OA 1S3PA 1JUOA 2EC6B 5CSNA 2KI4C 3CR5X 4IJ7A 3EK7A 4A4CA 4AOMA 3DD4A 1SBJA 1YUSA 2R2IA 1YURA 1KSMA 1S36A 1QLKA 5DKQA 1B9AA 3WHTB 3NXAA 4C0KA 3H4SE 2NXQA 1QIWA 3B6XA 3ZWHA 4OKHA 1AVSA 5HL1A 2JPTA 5CSIA 4BY5A 2JXCA 1PULA 2LAPA 2L50A 2M8UA 5ER5A 3DVEA 4MVFA 1FW4A 1Y6WA 4ORAB 2GTEA 4OR9B 3CYZA 2WCMA 1WDCC 2LANA 1K90D 1LXFC 2BAPA 1H8BA 2M7NA 1M31A 1NPQA 1C7WA 1PRWA 2BL0C 1RJVA 3OGNA 2KAVA 3IQOA 3OHMB 1OOFA 1BLQA 2MLEC 1KFUS 2O60A 1K9KA 4R1EA 1UHIA 3VROA 4HRGA 5I2LA 3KEVA 4GGNA 3R1PA 1QX2A 2M0RA 2RGIA 1CFFA 2L2EA 3SS3A 1GGZA 3SG6A 4ZCVA 3CLNA 4PT1A 1S6IA 2MA2A 5DKNA 1A2XA 1BOCA 2I18A 1VRKA 2COLB 4GBAA 2L51A 1M63B 4PE4A 1PVBA 1UHHA 1K8UA 2K61A 3CZ1A 1DJHA 1MWNA 5HLOA 3CTNA 4A4BA 3NGVA 1V1GA 3FIAA 1IIOA 1XFYO 4PHKA 2FJYA 5F6TA 1Y1UA 2HPSA 4ZCUA 3LK1A 2FCEA 2KGBC 3CABA 5HLVA 3OX6A 3CGAA 1N65A 1B8RA 1MHOA 1JF0A 4HREE 1TNQA 2MBXA 4GFTA 4QJ4B 1IWQA 1YR5A 3I5GC 3LK0A 2AMIA 2H8VA 1WRKA 4MBEA 5CPVA 4YGCB 4QJ3B 1TCFA 4DS7A 2CBLA 2D8NA 2P6BB 3PFVA 2CTNA 2KAXA 5CSFA 4DUQA 2LMVA 2LP3A 2PASA 1TUJA 3KO0A 1ALWA 1FF1A 5AERA 1FBVA 5AANA 1DJYA 2JU0A 2M3WA 2F33A 2Y5IA 1WLZA 2FOTA 1L2OC 2O5GA 1CFPA 1J1DA 2MAZA 1KWOB 1SMGA 1S1EA 3S0DA 1BT6A 3VRRA 3RLZA 1SCMB 1EH2A 1OOGA 1S6CA 1GGWA
chains in the Genus database with same CATH topology
1XFUO 2JT8A 1TN4A 5JOLA 2JNXA 1F70A 2JXLA 2KDHA 1LA3A 3VRPA 2LLUA 1PK0D 2K7OA 2KQ6A 3D0YA 1CNPA 1FI6A 4U8DA 1KQMB 1S5GY 1WRLA 2BCXA 3TUYB 3FWBA 3BOWB 4PHJA 1QVIZ 3M0WA 2CCMA 2OS8B 1CDMA 2MJWB 3BUXB 4WQ3A 1TRFA 1JFKA 3VRNA 5I2OA 1NP8A 1ALVA 2ZFDA 1YVHA 1U5IA 5HKYA 1CMFA 4PE1A 1YRUB 2G9BA 2JZIA 4I5NB 2Q91A 4D1EA 4GUKA 2ZRTA 2KGRA 1IRJA 2I94A 1D1OA 3PM8A 1ZOTB 3LCPC 3KHEA 3LLEA 1DVIA 1TNXA 1QV1A 1CLBA 2LLSA 2JTTA 1QXPA 3JTDB 4YBHB 1F4OA 2F8PA 1OE9B 2BECA 3PSRA 1CDPA 3OX5A 2KAYA 2MHHA 1IJ5A 1LKJA 2QPTA 2OTGB 3I5HB 3EKHA 3DVJA 5GQQC 1DJWA 1NCZA 1J7QA 1DJZA 1WY9A 1B1GA 5FYXA 1BODA 1SL8A 4GGFA 3DVMA 4PE7A 2MRDA 3I5IB 1TOPA 2F2OA 2ZNDA 3LL8B 5B8IB 2CXJA 3WXAA 3EK8A 5CSJA 2JC2A 3GK1A 3NSLA 4I5JA 3BQ3A 5HKWA 1CDLA 1A75B 1OMRA 2HETA 1A29A 1K2HA 4BY4A 2F2PA 2H61A 4XJKB 1SW8A 4YGEB 5ER4X 2K7DA 1TNPA 2PRUA 2LCPA 1JWDA 3PALA 3ZNIA 4XYNA 1YX8A 2KBIA 3HCMA 1M39A 1FPWA 1SRAA 2L4HA 2ZN8A 1TIZA 1ZFSA 1XFWO 2WCBA 2Q4UA 1UURA 1AJ4A 1NUBA 5HYDA 1KWOC 1QTXA 2KOTA 2KNEA 2OPOA 2WC8A 2Y1MA 3F45A 3ICBA 1DT7B 2KFFA 1SCMC 4DIRA 2LVVA 2M1UA 4HSZA 3EVRA 1J1EA 1AK8A 1BR4B 2BKIB 2HF5A 2ZRSA 2BCBA 3VRQA 2PMYA 2NLNA 1K94A 4CIDA 1A03A 3PN7B 3TDIA 2LMUA 1RK9A 4NDBA 1DMOA 3TDZA 2Y1NA 4ETOA 3BUWB 1PALA 2MLFC 3SG7A 2M7LA 1EG3A 3EKJA 1G33A 5AXIA 2JOJA 3CR4X 3SIAA 2PSRA 1KK8C 3DF0A 1EXRA 5AFPA 1F8HA 3IF7A 3RM1A 1CM1A 1J7RA 1WRZA 1AHRA 1S26D 3JVTB 1NX3A 3CWGA 1KQVA 2LHIA 1F71A 1AUIB 4C0JA 4MSPA 4C0LA 1R6PA 4P5OE 2GGMA 1DJXA 1JFJA 2LVKA 4YRUA 1HT9A 1KK7Z 5IBWA 2H2KA 2KBMA 1RTP1 4MRYA 2KHNA 4OVNF 3PATA 4GPLB 5I8NA 1B47A 3I5FB 2LE9B 2K0JA 1ODBA 1DF0B 1IGVA 1XVJA 1IQ5A 1YUTA 1NX2A 2L5XB 4GNKB 1IG5A 3GK4X 4Q04A 1BG1A 3I5HC 1KFXL 5K89A 2KI4B 4MEWA 5D7FA 1B8CA 2I7AA 5TNCA 1IQ3A 2BE6A 3E3RA 1RWYA 2LLTA 2NZ0A 5D69A 2I2RE 3O6BA 1SNLA 2M9GA 3O2PA 1F55A 2JNFA 1SCVA 2EC6C 1JBAA 1IH0A 2QACA 1BR1B 1OZSA 1NCXA 4N5XA 1MXEA 3BOWA 2LVJA 3AAKA 2M49B 4GGFC 1WDCB 1N2DA 2B1UA 3EVVA 1NX1A 1Y0VH 3BUNB 1G8IA 2BE4A 2BL0B 2KI6D 1M45A 3CR2A 3TDUA 1V1FA 1NYAA 1IJ6A 1B8LA 1OQPA 4USLA 1C7VA 1L7ZA 1LVCD 1QJTA 1YRTB 3KPXA 4PHMA 2L0PA 4HRHA 2H61C 1QATA 5PALA 1BU3A 2JT0A 1K95A 4CLNA 3AKBA 4DCKA 3FS7A 2LNKA 1F54A 3AAJA 5DKRA 1NIWA 2BKHB 1YTZC 1DGUA 1TNWA 2KFHA 2A4JA 1DJIA 5G08A 1C07A 1KSOA 4JWQA 4NDDA 1XFXO 3WNXB 1IKUA 1QVIY 1K9UA 2WOSA 3OB2B 3BUOB 3A4UB 4YGAA 1PSRA 1XO5A 1RFJA 1S6JA 4ICBA 1ZMZA 2VRGA 3GOFA 3NSOA 3SJSA 3BXKA 4GAOA 3SG4A 2F3ZA 2HQWA 1M46A 2FJUB 1MR8A 3MSEB 3I5GB 1UWOA 1OOJA 2KFGA 1UHKA 1PVAA 2PVBA 5I2QA 1YX7A 4WRIA 4XJKA 1MUXA 4N1FA 4CPVA 2G2BA 2WCFA 1ZACA 1MF8B 3DVKA 5HKZA 3NSIA 4DRWA 4P2YB 3TZ1A 1OMVA 1XFVO 1NCYA 3HX4A 4PE0A 4ORCB 3SG3A 2JWWA 2L98A 2LMTA 1L2OB 1OZOA 1QX7A 2PALA 2LHLA 1SYMA 4MZLA 3TS5B 2KYFA 2BBMA 2GV5A 1B4CA 2LUCA 1GQMA 3CS1A 4YI9A 4PCWA 1R2UA 1N0YA 1ZUZA 1XA5A 1B7TZ 1UP5A 2LUXA 1K96A 1Q80A 2WCEA 1KFXS 1SK6D 2M97A 2ZKMX 1BJFA 1F4QA 4CFRA 1SL9A 3FWCA 4ORBB 1DGVA 2JQ6A 3D10A 4UPGA 1K9PA 3OP0A 1DJGA 1G4YR 1CKKA 2NCOA 3EK4A 5J3XA 4E68A 4MZJA 4TNCA 1BMOA 1BF5A 1CDNA 1PSBA 1CFCA 1UUSA 3AKAA 1YUUA 1QS7A 3O78A 1B7TY 1KQMC 3TUYC 1CFDA 1SL7A 1QASA 4MRXA 1TTXA 2OS8C 1EL4A 1UHJA 4OV2A 1SR6B 4NQGA 3WHUB 2SASA 4AQIA 2EGDA 2SCPA 2KSPA 1RECA 3KF9A 2LV7A 1DF0A 1E8AA 1CM4A 3A8RA 2NCPA 2Y4QA 2AUCA 2M29A 4PALA 1CTRA 1X02A 5KTYA 2BBNA 3JTDC 2K2AA 4WQ2A 1CB1A 2FCDA 2TN4A 2OTGC 2CT9A 1XFZO 1MQ1A 4NDCA 4PHNA 2HQ8A 4N1GA 3NSKA 1QIVA 3CZTX 4CFQA 2LVIA 2M1KB 1CLMA 3C1VA 3DF0B 1DTLA 3I5IC 3PLFB 1JSAA 1KK7Y 2JRFA 2KQYA 3VGOA 2K7CA 4OCIA 5BPJA 2K2FA 2E30A 1KCYA 1SY9A 4L9MA 1JF2A 3K21A 1FI5A 1KFUL 1XYDA 1S5GZ 2WORA 1AJ5A 1CMGA 3OB1B 1XK4C 3TS5C 1JC2A 1W7IB 1UHNA 1QLSA 1TCOB 1OSAA 1Y1XA 2JULA 2L4IA 2LM5A 2V53A 1AP4A 2ISDA 4FTGA 1NX0A 3SG5A 5KU1A 1EG4A 1J7PA 4I5KA 2LC5A 1YVLA 1H4BA 1SKTA 4F0ZB 2F3YA 2JTZA 4FQOA 1HQVA 3SG2A 2GGZA 2ZN9A 2BCAA 1NSHA 4QJ5B 5JJGA 2EHBA 3PN7C 1SPYA 1KK8B 1MXLC 3BUMB 4JQ0D 1WLMA 2K8MB 3D0YB 1K93D 2AAOA 2E6WA 2JT3A 4M2QA 1Y1AA 1GJYA 4AQJA 2DOQA 4IL1A 3EVUA 4YGBB 4JPZB 1CLLA 1RROA 1A75A 2KI6C 5AEQA 1SR6C 1OMDA 1W7JB 1QX5B 3JVTC 3O4YA 1QV0A 3GK2A 2IS9A 1U5IB 2K7BA 2KYCA 2WNDA 3BYAA 1LINA 1XK4A 1J55A 1LA0A 1NWDA 4MLWA 2ZNEA 4M2PA 4YI8A 2LP2A 4I5LB 5KSZA 3IQQA 4PDZA 1EJ3A 3I5FC 2CNPA 4MN0A 3QRXA 4YGDB 1A4PA 3SIBA 4MZKA 4M2OA 1J7OA 1S3PA 1JUOA 2EC6B 5CSNA 2KI4C 3CR5X 4A4CA 3EK7A 4AOMA 3DD4A 1SBJA 1YUSA 2R2IA 1YURA 1KSMA 1S36A 1QLKA 5DKQA 1B9AA 3WHTB 3NXAA 4C0KA 3H4SE 2NXQA 1QIWA 3ZWHA 4OKHA 1AVSA 2JPTA 5CSIA 4BY5A 2JXCA 1PULA 2LAPA 2L50A 2M8UA 5ER5A 3DVEA 4MVFA 1FW4A 1Y6WA 4ORAB 4OR9B 1WDCC 2LANA 1K90D 1LXFC 1H8BA 2M7NA 1M31A 1NPQA 1C7WA 1PRWA 2BL0C 1RJVA 3OHMB 2KAVA 3IQOA 1BLQA 2MLEC 1KFUS 2O60A 1K9KA 4R1EA 1UHIA 3VROA 4HRGA 5I2LA 3KEVA 4GGNA 1QX2A 2M0RA 2RGIA 1CFFA 2L2EA 1GGZA 3SG6A 4ZCVA 3CLNA 1S6IA 2MA2A 5DKNA 1A2XA 1BOCA 2I18A 1VRKA 2COLB 4GBAA 2L51A 1M63B 4PE4A 1PVBA 1UHHA 1K8UA 2K61A 1DJHA 1MWNA 5HLOA 3CTNA 4A4BA 1V1GA 3FIAA 1XFYO 4PHKA 5F6TA 1Y1UA 2HPSA 4ZCUA 3LK1A 2FCEA 2KGBC 5HLVA 3OX6A 3CGAA 1N65A 1B8RA 1MHOA 1JF0A 4HREE 1TNQA 2MBXA 4GFTA 4QJ4B 1IWQA 1YR5A 3I5GC 3LK0A 2AMIA 4MBEA 1WRKA 5CPVA 4YGCB 4QJ3B 1TCFA 4DS7A 2CBLA 2D8NA 2P6BB 3PFVA 2CTNA 2KAXA 5CSFA 4DUQA 2LMVA 2LP3A 2PASA 3KO0A 1ALWA 1FF1A 5AERA 1FBVA 5AANA 1DJYA 2JU0A 2M3WA 2F33A 2Y5IA 1WLZA 2FOTA 1L2OC 2O5GA 1CFPA 1J1DA 2MAZA 1KWOB 1SMGA 1S1EA 1BT6A 3VRRA 3RLZA 1SCMB 1EH2A 1S6CA 1GGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFU O;  2JT8 A;  1TN4 A;  5JOL A;  2JNX A;  1F70 A;  2JXL A;  2KDH A;  1LA3 A;  3VRP A;  2LLU A;  1PK0 D;  2K7O A;  2KQ6 A;  3D0Y A;  1CNP A;  1FI6 A;  4U8D A;  1KQM B;  1S5G Y;  1WRL A;  2BCX A;  3TUY B;  3FWB A;  3BOW B;  4PHJ A;  1QVI Z;  3M0W A;  2CCM A;  2OS8 B;  1CDM A;  2MJW B;  3BUX B;  4WQ3 A;  1TRF A;  1JFK A;  3VRN A;  5I2O A;  1NP8 A;  1ALV A;  2ZFD A;  1YVH A;  1U5I A;  5HKY A;  1CMF A;  4PE1 A;  1YRU B;  2G9B A;  2JZI A;  4I5N B;  2Q91 A;  4D1E A;  4GUK A;  2ZRT A;  2KGR A;  1IRJ A;  2I94 A;  1D1O A;  3PM8 A;  1ZOT B;  3LCP C;  3KHE A;  3LLE A;  1DVI A;  1TNX A;  1QV1 A;  1CLB A;  2LLS A;  2JTT A;  1QXP A;  3JTD B;  4YBH B;  1F4O A;  2F8P A;  1OE9 B;  2BEC A;  3PSR A;  1CDP A;  3OX5 A;  2KAY A;  2MHH A;  1IJ5 A;  1LKJ A;  2QPT A;  2OTG B;  3I5H B;  3EKH A;  3DVJ A;  5GQQ C;  1DJW A;  1NCZ A;  1J7Q A;  1DJZ A;  1WY9 A;  1B1G A;  5FYX A;  1BOD A;  1SL8 A;  4GGF A;  3DVM A;  4PE7 A;  2MRD A;  3I5I B;  1TOP A;  2F2O A;  2ZND A;  3LL8 B;  5B8I B;  2CXJ A;  3WXA A;  3EK8 A;  5CSJ A;  2JC2 A;  3GK1 A;  3NSL A;  4I5J A;  3BQ3 A;  5HKW A;  1CDL A;  1A75 B;  1OMR A;  2HET A;  1A29 A;  1K2H A;  4BY4 A;  2F2P A;  2H61 A;  4XJK B;  1SW8 A;  4YGE B;  5ER4 X;  2K7D A;  1TNP A;  2PRU A;  2LCP A;  1JWD A;  3PAL A;  3ZNI A;  4XYN A;  1YX8 A;  2KBI A;  3HCM A;  1M39 A;  1FPW A;  1SRA A;  2L4H A;  2ZN8 A;  1TIZ A;  1ZFS A;  1XFW O;  2WCB A;  2Q4U A;  1UUR A;  1AJ4 A;  1NUB A;  5HYD A;  1KWO C;  1QTX A;  2KOT A;  2KNE A;  2OPO A;  2WC8 A;  2Y1M A;  3F45 A;  3ICB A;  1DT7 B;  2KFF A;  1SCM C;  4DIR A;  2LVV A;  2M1U A;  4HSZ A;  3EVR A;  1J1E A;  1AK8 A;  1BR4 B;  2BKI B;  2HF5 A;  2ZRS A;  2BCB A;  3VRQ A;  2PMY A;  2NLN A;  1K94 A;  4CID A;  1A03 A;  3PN7 B;  3TDI A;  2LMU A;  1RK9 A;  4NDB A;  1DMO A;  3TDZ A;  2Y1N A;  4ETO A;  3BUW B;  1PAL A;  2MLF C;  3SG7 A;  2M7L A;  1EG3 A;  3EKJ A;  1G33 A;  5AXI A;  2JOJ A;  3CR4 X;  3SIA A;  2PSR A;  1KK8 C;  3DF0 A;  1EXR A;  5AFP A;  1F8H A;  3IF7 A;  3RM1 A;  1CM1 A;  1J7R A;  1WRZ A;  1AHR A;  1S26 D;  3JVT B;  1NX3 A;  3CWG A;  1KQV A;  2LHI A;  1F71 A;  1AUI B;  4C0J A;  4MSP A;  4C0L A;  1R6P A;  4P5O E;  2GGM A;  1DJX A;  1JFJ A;  2LVK A;  4YRU A;  1HT9 A;  1KK7 Z;  5IBW A;  2H2K A;  2KBM A;  1RTP 1;  4MRY A;  2KHN A;  4OVN F;  3PAT A;  4GPL B;  5I8N A;  1B47 A;  3I5F B;  2LE9 B;  2K0J A;  1ODB A;  1DF0 B;  1IGV A;  1XVJ A;  1IQ5 A;  1YUT A;  1NX2 A;  2L5X B;  4GNK B;  1IG5 A;  3GK4 X;  4Q04 A;  1BG1 A;  3I5H C;  1KFX L;  5K89 A;  2KI4 B;  4MEW A;  5D7F A;  1B8C A;  2I7A A;  5TNC A;  1IQ3 A;  2BE6 A;  3E3R A;  1RWY A;  2LLT A;  2NZ0 A;  5D69 A;  2I2R E;  3O6B A;  1SNL A;  2M9G A;  3O2P A;  1F55 A;  2JNF A;  1SCV A;  2EC6 C;  1JBA A;  1IH0 A;  2QAC A;  1BR1 B;  1OZS A;  1NCX A;  4N5X A;  1MXE A;  3BOW A;  2LVJ A;  3AAK A;  2M49 B;  4GGF C;  1WDC B;  1N2D A;  2B1U A;  3EVV A;  1NX1 A;  1Y0V H;  3BUN B;  1G8I A;  2BE4 A;  2BL0 B;  2KI6 D;  1M45 A;  3CR2 A;  3TDU A;  1V1F A;  1NYA A;  1IJ6 A;  1B8L A;  1OQP A;  4USL A;  1C7V A;  1L7Z A;  1LVC D;  1QJT A;  1YRT B;  3KPX A;  4PHM A;  2L0P A;  4HRH A;  2H61 C;  1QAT A;  5PAL A;  1BU3 A;  2JT0 A;  1K95 A;  4CLN A;  3AKB A;  4DCK A;  3FS7 A;  2LNK A;  1F54 A;  3AAJ A;  5DKR A;  1NIW A;  2BKH B;  1YTZ C;  1DGU A;  1TNW A;  2KFH A;  2A4J A;  1DJI A;  5G08 A;  1C07 A;  1KSO A;  4JWQ A;  4NDD A;  1XFX O;  3WNX B;  1IKU A;  1QVI Y;  1K9U A;  2WOS A;  3OB2 B;  3BUO B;  3A4U B;  4YGA A;  1PSR A;  1XO5 A;  1RFJ A;  1S6J A;  4ICB A;  1ZMZ A;  2VRG A;  3GOF A;  3NSO A;  3SJS A;  3BXK A;  4GAO A;  3SG4 A;  2F3Z A;  2HQW A;  1M46 A;  2FJU B;  1MR8 A;  3MSE B;  3I5G B;  1UWO A;  1OOJ A;  2KFG A;  1UHK A;  1PVA A;  2PVB A;  5I2Q A;  1YX7 A;  4WRI A;  4XJK A;  1MUX A;  4N1F A;  4CPV A;  2G2B A;  2WCF A;  1ZAC A;  1MF8 B;  3DVK A;  5HKZ A;  3NSI A;  4DRW A;  4P2Y B;  3TZ1 A;  1OMV A;  1XFV O;  1NCY A;  3HX4 A;  4PE0 A;  4ORC B;  3SG3 A;  2JWW A;  2L98 A;  2LMT A;  1L2O B;  1OZO A;  1QX7 A;  2PAL A;  2LHL A;  1SYM A;  4MZL A;  3TS5 B;  2KYF A;  2BBM A;  2GV5 A;  1B4C A;  2LUC A;  1GQM A;  3CS1 A;  4YI9 A;  4PCW A;  1R2U A;  1N0Y A;  1ZUZ A;  1XA5 A;  1B7T Z;  1UP5 A;  2LUX A;  1K96 A;  1Q80 A;  2WCE A;  1KFX S;  1SK6 D;  2M97 A;  2ZKM X;  1BJF A;  1F4Q A;  4CFR A;  1SL9 A;  3FWC A;  4ORB B;  1DGV A;  2JQ6 A;  3D10 A;  4UPG A;  1K9P A;  3OP0 A;  1DJG A;  1G4Y R;  1CKK A;  2NCO A;  3EK4 A;  5J3X A;  4E68 A;  4MZJ A;  4TNC A;  1BMO A;  1BF5 A;  1CDN A;  1PSB A;  1CFC A;  1UUS A;  3AKA A;  1YUU A;  1QS7 A;  3O78 A;  1B7T Y;  1KQM C;  3TUY C;  1CFD A;  1SL7 A;  1QAS A;  4MRX A;  1TTX A;  2OS8 C;  1EL4 A;  1UHJ A;  4OV2 A;  1SR6 B;  4NQG A;  3WHU B;  2SAS A;  4AQI A;  2EGD A;  2SCP A;  2KSP A;  1REC A;  3KF9 A;  2LV7 A;  1DF0 A;  1E8A A;  1CM4 A;  3A8R A;  2NCP A;  2Y4Q A;  2AUC A;  2M29 A;  4PAL A;  1CTR A;  1X02 A;  5KTY A;  2BBN A;  3JTD C;  2K2A A;  4WQ2 A;  1CB1 A;  2FCD A;  2TN4 A;  2OTG C;  2CT9 A;  1XFZ O;  1MQ1 A;  4NDC A;  4PHN A;  2HQ8 A;  4N1G A;  3NSK A;  1QIV A;  3CZT X;  4CFQ A;  2LVI A;  2M1K B;  1CLM A;  3C1V A;  3DF0 B;  1DTL A;  3I5I C;  3PLF B;  1JSA A;  1KK7 Y;  2JRF A;  2KQY A;  3VGO A;  2K7C A;  4OCI A;  5BPJ A;  2K2F A;  2E30 A;  1KCY A;  1SY9 A;  4L9M A;  1JF2 A;  3K21 A;  1FI5 A;  1KFU L;  1XYD A;  1S5G Z;  2WOR A;  1AJ5 A;  1CMG A;  3OB1 B;  1XK4 C;  3TS5 C;  1JC2 A;  1W7I B;  1UHN A;  1QLS A;  1TCO B;  1OSA A;  1Y1X A;  2JUL A;  2L4I A;  2LM5 A;  2V53 A;  1AP4 A;  2ISD A;  4FTG A;  1NX0 A;  3SG5 A;  5KU1 A;  1EG4 A;  1J7P A;  4I5K A;  2LC5 A;  1YVL A;  1H4B A;  1SKT A;  4F0Z B;  2F3Y A;  2JTZ A;  4FQO A;  1HQV A;  3SG2 A;  2GGZ A;  2ZN9 A;  2BCA A;  1NSH A;  4QJ5 B;  5JJG A;  2EHB A;  3PN7 C;  1SPY A;  1KK8 B;  1MXL C;  3BUM B;  4JQ0 D;  1WLM A;  2K8M B;  3D0Y B;  1K93 D;  2AAO A;  2E6W A;  2JT3 A;  4M2Q A;  1Y1A A;  1GJY A;  4AQJ A;  2DOQ A;  4IL1 A;  3EVU A;  4YGB B;  4JPZ B;  1CLL A;  1RRO A;  1A75 A;  2KI6 C;  5AEQ A;  1SR6 C;  1OMD A;  1W7J B;  1QX5 B;  3JVT C;  3O4Y A;  1QV0 A;  3GK2 A;  2IS9 A;  1U5I B;  2K7B A;  2KYC A;  2WND A;  3BYA A;  1LIN A;  1XK4 A;  1J55 A;  1LA0 A;  1NWD A;  4MLW A;  2ZNE A;  4M2P A;  4YI8 A;  2LP2 A;  4I5L B;  5KSZ A;  3IQQ A;  4PDZ A;  1EJ3 A;  3I5F C;  2CNP A;  4MN0 A;  3QRX A;  4YGD B;  1A4P A;  3SIB A;  4MZK A;  4M2O A;  1J7O A;  1S3P A;  1JUO A;  2EC6 B;  5CSN A;  2KI4 C;  3CR5 X;  4A4C A;  3EK7 A;  4AOM A;  3DD4 A;  1SBJ A;  1YUS A;  2R2I A;  1YUR A;  1KSM A;  1S36 A;  1QLK A;  5DKQ A;  1B9A A;  3WHT B;  3NXA A;  4C0K A;  3H4S E;  2NXQ A;  1QIW A;  3ZWH A;  4OKH A;  1AVS A;  2JPT A;  5CSI A;  4BY5 A;  2JXC A;  1PUL A;  2LAP A;  2L50 A;  2M8U A;  5ER5 A;  3DVE A;  4MVF A;  1FW4 A;  1Y6W A;  4ORA B;  4OR9 B;  1WDC C;  2LAN A;  1K90 D;  1LXF C;  1H8B A;  2M7N A;  1M31 A;  1NPQ A;  1C7W A;  1PRW A;  2BL0 C;  1RJV A;  3OHM B;  2KAV A;  3IQO A;  1BLQ A;  2MLE C;  1KFU S;  2O60 A;  1K9K A;  4R1E A;  1UHI A;  3VRO A;  4HRG A;  5I2L A;  3KEV A;  4GGN A;  1QX2 A;  2M0R A;  2RGI A;  1CFF A;  2L2E A;  1GGZ A;  3SG6 A;  4ZCV A;  3CLN A;  1S6I A;  2MA2 A;  5DKN A;  1A2X A;  1BOC A;  2I18 A;  1VRK A;  2COL B;  4GBA A;  2L51 A;  1M63 B;  4PE4 A;  1PVB A;  1UHH A;  1K8U A;  2K61 A;  1DJH A;  1MWN A;  5HLO A;  3CTN A;  4A4B A;  1V1G A;  3FIA A;  1XFY O;  4PHK A;  5F6T A;  1Y1U A;  2HPS A;  4ZCU A;  3LK1 A;  2FCE A;  2KGB C;  5HLV A;  3OX6 A;  3CGA A;  1N65 A;  1B8R A;  1MHO A;  1JF0 A;  4HRE E;  1TNQ A;  2MBX A;  4GFT A;  4QJ4 B;  1IWQ A;  1YR5 A;  3I5G C;  3LK0 A;  2AMI A;  4MBE A;  1WRK A;  5CPV A;  4YGC B;  4QJ3 B;  1TCF A;  4DS7 A;  2CBL A;  2D8N A;  2P6B B;  3PFV A;  2CTN A;  2KAX A;  5CSF A;  4DUQ A;  2LMV A;  2LP3 A;  2PAS A;  3KO0 A;  1ALW A;  1FF1 A;  5AER A;  1FBV A;  5AAN A;  1DJY A;  2JU0 A;  2M3W A;  2F33 A;  2Y5I A;  1WLZ A;  2FOT A;  1L2O C;  2O5G A;  1CFP A;  1J1D A;  2MAZ A;  1KWO B;  1SMG A;  1S1E A;  1BT6 A;  3VRR A;  3RLZ A;  1SCM B;  1EH2 A;  1S6C A;  1GGW A; 
#chains in the Genus database with same CATH topology
 1XFU O;  2JT8 A;  1TN4 A;  3B86 A;  5JOL A;  2JNX A;  1F70 A;  2JXL A;  2KDH A;  1LA3 A;  3VRP A;  2LLU A;  1PK0 D;  2K7O A;  2KQ6 A;  3D0Y A;  1CNP A;  1FI6 A;  4U8D A;  2KPH A;  1KQM B;  1S5G Y;  1WRL A;  2BCX A;  3TUY B;  3FWB A;  3BOW B;  4PHJ A;  1QVI Z;  3M0W A;  2CCM A;  2OS8 B;  1CDM A;  2MJW B;  3BUX B;  3L47 A;  1TRF A;  4WQ3 A;  1JFK A;  3VRN A;  5I2O A;  1NP8 A;  1ALV A;  2ZFD A;  1YVH A;  1U5I A;  5HKY A;  3FE9 A;  1CMF A;  5FI2 A;  4PE1 A;  1YRU B;  2G9B A;  2JZI A;  4I5N B;  2L5Y A;  2Q91 A;  4D1E A;  4GUK A;  2ZRT A;  3VB1 A;  2KGR A;  1IRJ A;  2I94 A;  3D76 A;  1D1O A;  3PM8 A;  1W9Z A;  1ZOT B;  3LCP C;  3NHT A;  3KHE A;  3LLE A;  1C3Z A;  1DVI A;  1QV1 A;  1TNX A;  2LLS A;  2JTT A;  1CLB A;  1QXP A;  3JTD B;  4YBH B;  1F4O A;  1OOI X;  4JD9 A;  2F8P A;  1OE9 B;  2BEC A;  3PSR A;  1CDP A;  2PYQ A;  2KAY A;  3OX5 A;  2MHH A;  1IJ5 A;  1LKJ A;  2QPT A;  2OTG B;  3I5H B;  3EKH A;  3DVJ A;  2KLD A;  5GQQ C;  1DJW A;  3DY9 A;  1NCZ A;  3CDN A;  1J7Q A;  1DJZ A;  5D3O A;  1WY9 A;  1B1G A;  5FYX A;  1BOD A;  1SL8 A;  4GGF A;  3DVM A;  4PE7 A;  3EG5 B;  2MRD A;  3I5I B;  3PJI A;  2BNX A;  1TOP A;  2F2O A;  2ZND A;  3B87 A;  3LL8 B;  5B8I B;  1SSE B;  2CXJ A;  3WXA A;  3EK8 A;  5CSJ A;  2JC2 A;  1DC1 A;  3GK1 A;  3NSL A;  2QDI A;  3BQ3 A;  4I5J A;  5HKW A;  1CDL A;  1A75 B;  1OMR A;  2HET A;  1A29 A;  1K2H A;  4BY4 A;  2F2P A;  3S0F A;  2H61 A;  4XJK B;  1SW8 A;  4YGE B;  1DEK A;  5ER4 X;  2K7D A;  1TNP A;  2PRU A;  2LCP A;  1JWD A;  3PAL A;  3ZNI A;  4XYN A;  1YX8 A;  2KBI A;  3HCM A;  1M39 A;  1FPW A;  1SRA A;  2L4H A;  2ZN8 A;  1TIZ A;  1ZFS A;  1TUZ A;  3K1E A;  1XFW O;  2WCB A;  2Q4U A;  1UUR A;  1AJ4 A;  1NUB A;  5HYD A;  1KWO C;  1QTX A;  2KOT A;  2KNE A;  2OPO A;  2WC8 A;  2Y1M A;  3F45 A;  3ICB A;  1DT7 B;  2KFF A;  1SCM C;  4DIR A;  2LVV A;  2M1U A;  3FE8 A;  3EVR A;  1J1E A;  4HSZ A;  1AK8 A;  1BR4 B;  2BKI B;  2HF5 A;  2ZRS A;  2BCB A;  3VRQ A;  2PMY A;  2NLN A;  1K94 A;  4CID A;  1A03 A;  3PN7 B;  3TDI A;  2LMU A;  2YGU A;  4INX A;  1RK9 A;  3D77 A;  4NDB A;  2P70 A;  1DMO A;  3TDZ A;  2Y1N A;  4ETO A;  3BUW B;  1PAL A;  2MLF C;  3D78 A;  3BFA A;  2M7L A;  1EG3 A;  1DEL A;  1Z2C B;  3EKJ A;  1G33 A;  5AXI A;  3UO9 A;  2JOJ A;  3CR4 X;  3SIA A;  2PSR A;  1KK8 C;  3DF0 A;  1EXR A;  5AFP A;  1F8H A;  3IF7 A;  3RM1 A;  1CM1 A;  1J7R A;  1WRZ A;  1AHR A;  1S26 D;  3JVT B;  1NX3 A;  3CWG A;  1GM0 A;  1KQV A;  2LHI A;  1F71 A;  1AUI B;  4C0J A;  4MSP A;  4C0L A;  2WC5 A;  1R6P A;  4P5O E;  2GGM A;  1DJX A;  1JFJ A;  2LVK A;  4YRU A;  1HT9 A;  1KK7 Z;  5IBW A;  2QEV A;  2H2K A;  2KBM A;  1RTP 1;  4MRY A;  2KHN A;  4OVN F;  3PAT A;  4GPL B;  5I8N A;  1B47 A;  3I5F B;  2LE9 B;  2K0J A;  1ODB A;  1DF0 B;  1IGV A;  1XVJ A;  1IQ5 A;  1YUT A;  1NX2 A;  1T14 A;  2L5X B;  4GNK B;  1IG5 A;  1C3Y A;  3GK4 X;  4Q04 A;  1BG1 A;  3I5H C;  1KFX L;  3R1V A;  5K89 A;  2KI4 B;  4MEW A;  5D7F A;  1B8C A;  2I7A A;  5TNC A;  1IQ3 A;  2BE6 A;  3E3R A;  1RWY A;  2LLT A;  2NZ0 A;  5D69 A;  2I2R E;  3O6B A;  1SNL A;  2M9G A;  3O2P A;  1F55 A;  2JNF A;  1SCV A;  2EC6 C;  1JBA A;  1IH0 A;  2QAC A;  5DIC A;  1BR1 B;  1OZS A;  1NCX A;  4N5X A;  1MXE A;  3BOW A;  2LVJ A;  3AAK A;  2M49 B;  3BJH A;  4GGF C;  1WDC B;  1N2D A;  2B1U A;  3EVV A;  1NX1 A;  1Y0V H;  3BUN B;  5EL2 A;  1G8I A;  2BE4 A;  2ERB A;  2BL0 B;  2KI6 D;  1M45 A;  3CR2 A;  1ORG A;  3TDU A;  1V1F A;  1NYA A;  1IJ6 A;  1B8L A;  1OQP A;  4USL A;  1C7V A;  1L7Z A;  1TWO A;  1LVC D;  1QJT A;  1YRT B;  3KPX A;  4PHM A;  2L0P A;  2WCH A;  4HRH A;  2H61 C;  1QAT A;  5PAL A;  1BU3 A;  2JT0 A;  1K95 A;  4CLN A;  3AKB A;  4DCK A;  3FS7 A;  2LNK A;  1F54 A;  3AAJ A;  5DKR A;  1NIW A;  3R1O A;  4JKT A;  2BKH B;  1YTZ C;  2JPO A;  1DGU A;  1TNW A;  2KFH A;  2A4J A;  1DJI A;  5G08 A;  1C07 A;  1KSO A;  4JWQ A;  4NDD A;  1XFX O;  3WNX B;  1IKU A;  1QVI Y;  1K9U A;  2WOS A;  3OB2 B;  3BUO B;  3A4U B;  4YGA A;  1PSR A;  1XO5 A;  1RFJ A;  1S6J A;  4ICB A;  1ZMZ A;  2VRG A;  3GOF A;  3NSO A;  3SJS A;  3BXK A;  4GAO A;  3SG4 A;  2F3Z A;  2HQW A;  1M46 A;  2FJU B;  1MR8 A;  3MSE B;  3I5G B;  1UWO A;  1OOJ A;  2KFG A;  1UHK A;  1PVA A;  2PVB A;  5FI7 A;  1YX7 A;  4WRI A;  4XJK A;  1MUX A;  4N1F A;  5I2Q A;  4CPV A;  2G2B A;  2WCF A;  1ZAC A;  1MF8 B;  3DVK A;  5HKZ A;  3NSI A;  4DRW A;  4P2Y B;  3TZ1 A;  1OMV A;  1XFV O;  2WCK A;  1NCY A;  3HX4 A;  4PE0 A;  4F7F A;  4ORC B;  3SG3 A;  2JWW A;  2L98 A;  2LMT A;  1L2O B;  3D74 A;  3S0A A;  1OZO A;  1QX7 A;  2PAL A;  3OBV A;  3SS4 A;  2LHL A;  1SYM A;  4MZL A;  3TS5 B;  2KYF A;  2BBM A;  2GV5 A;  3B7A A;  2LUC A;  1GQM A;  3CS1 A;  4YI9 A;  1OW4 A;  4PCW A;  1B4C A;  1R2U A;  1N0Y A;  1ZUZ A;  1XA5 A;  1B7T Z;  1UP5 A;  2LUX A;  1K96 A;  1Q80 A;  2WCE A;  1KFX S;  1SK6 D;  2M97 A;  2ZKM X;  1BJF A;  3D75 A;  1F4Q A;  4CFR A;  1SL9 A;  3FWC A;  4ORB B;  1DGV A;  2JQ6 A;  2WCL A;  3D10 A;  4UPG A;  1K9P A;  3OP0 A;  1DJG A;  1G4Y R;  1CKK A;  2NCO A;  1QWV A;  3EK4 A;  4INW A;  5J3X A;  4MZJ A;  4TNC A;  4E68 A;  1BMO A;  1BF5 A;  1CDN A;  1PSB A;  1CFC A;  1UUS A;  3AKA A;  1YUU A;  1QS7 A;  3O78 A;  1B7T Y;  1KQM C;  3TUY C;  1CFD A;  1SL7 A;  1QAS A;  4MRX A;  1TTX A;  2OS8 C;  1EL4 A;  1UHJ A;  4OV2 A;  1SR6 B;  4NQG A;  3WHU B;  2SAS A;  4AQI A;  2EGD A;  2SCP A;  2KSP A;  1REC A;  3KF9 A;  4FQT A;  3UNW A;  2LV7 A;  3BFB A;  2L2C A;  1DF0 A;  1E8A A;  1CM4 A;  2WCJ A;  3A8R A;  2NCP A;  3SG7 A;  2Y4Q A;  3RZS A;  2AUC A;  2M29 A;  4PAL A;  1XFR A;  1CTR A;  1X02 A;  5KTY A;  2BBN A;  2WC6 A;  3JTD C;  3BFH A;  2K2A A;  4WQ2 A;  2QEH A;  3D73 A;  1CB1 A;  2FCD A;  2TN4 A;  2OTG C;  2CT9 A;  1XFZ O;  1MQ1 A;  4NDC A;  3CZ2 A;  4PHN A;  1OOH A;  2HQ8 A;  3L4L A;  4N1G A;  3NSK A;  1QIV A;  3CZT X;  4CFQ A;  2LVI A;  2M1K B;  1CLM A;  3C1V A;  3DF0 B;  1DTL A;  3I5I C;  3PLF B;  1JSA A;  1KK7 Y;  2JRF A;  2KQY A;  3VGO A;  2K7C A;  4OCI A;  5BPJ A;  4OZD A;  2K2F A;  2E30 A;  1KCY A;  1SY9 A;  4L9M A;  3DXL A;  1JF2 A;  3V2L A;  4KYN A;  3K21 A;  3S0G A;  1FI5 A;  1KFU L;  1XYD A;  1S5G Z;  2WOR A;  2KLE A;  1AJ5 A;  1CMG A;  3OB1 B;  1XK4 C;  2P71 A;  1Z4H A;  3L4A A;  3TS5 C;  1JC2 A;  1W7I B;  3NHI A;  1UHN A;  1QLS A;  1TCO B;  1OSA A;  1Y1X A;  2JUL A;  2L4I A;  2LM5 A;  2V53 A;  3PM2 A;  1AP4 A;  2ISD A;  4FTG A;  1NX0 A;  3SG5 A;  5KU1 A;  1EG4 A;  3SS5 A;  1J7P A;  4I5K A;  2LC5 A;  1YVL A;  1H4B A;  1SKT A;  4F0Z B;  2F3Y A;  2JTZ A;  4FQO A;  3IVT A;  1HQV A;  3SG2 A;  2GGZ A;  3O4X A;  2ZN9 A;  5I94 A;  2BCA A;  3B88 A;  1NSH A;  4QJ5 B;  5JJG A;  2PQL A;  2EHB A;  3QME A;  3PN7 C;  1SPY A;  1KK8 B;  1MXL C;  3BUM B;  4JQ0 D;  2QEB A;  1WLM A;  2K8M B;  1LS8 A;  3D0Y B;  1K93 D;  2AAO A;  2E6W A;  2JT3 A;  4M2Q A;  1Y1A A;  3R72 A;  1GJY A;  3DYE A;  4AQJ A;  2DOQ A;  4IL1 A;  2K60 A;  3EVU A;  4YGB B;  3FE6 A;  4JPZ B;  1CLL A;  1RRO A;  1A75 A;  2KI6 C;  5AEQ A;  3DZT A;  3N7H A;  1SR6 C;  1OMD A;  1W7J B;  1QX5 B;  3JVT C;  3O4Y A;  1DQE A;  1QV0 A;  3GK2 A;  2IS9 A;  1U5I B;  2K7B A;  2KYC A;  2WND A;  3BYA A;  1LIN A;  1XK4 A;  1J55 A;  1LA0 A;  1NWD A;  4MLW A;  3S0B A;  2ZNE A;  4M2P A;  4YI8 A;  2QEO A;  2LP2 A;  3Q8I A;  4I5L B;  1P28 A;  5KSZ A;  3IQQ A;  5FI6 A;  4PDZ A;  1EJ3 A;  3I5F C;  3CZ0 A;  3S0E A;  2CNP A;  4MN0 A;  3QRX A;  4YGD B;  1A4P A;  3SIB A;  4MZK A;  4M2O A;  1J7O A;  1S3P A;  1JUO A;  2EC6 B;  5CSN A;  2KI4 C;  3CR5 X;  4IJ7 A;  3EK7 A;  4A4C A;  4AOM A;  3DD4 A;  1SBJ A;  1YUS A;  2R2I A;  1YUR A;  1KSM A;  1S36 A;  1QLK A;  5DKQ A;  1B9A A;  3WHT B;  3NXA A;  4C0K A;  3H4S E;  2NXQ A;  1QIW A;  3B6X A;  3ZWH A;  4OKH A;  1AVS A;  5HL1 A;  2JPT A;  5CSI A;  4BY5 A;  2JXC A;  1PUL A;  2LAP A;  2L50 A;  2M8U A;  5ER5 A;  3DVE A;  4MVF A;  1FW4 A;  1Y6W A;  4ORA B;  2GTE A;  4OR9 B;  3CYZ A;  2WCM A;  1WDC C;  2LAN A;  1K90 D;  1LXF C;  2BAP A;  1H8B A;  2M7N A;  1M31 A;  1NPQ A;  1C7W A;  1PRW A;  2BL0 C;  1RJV A;  3OGN A;  2KAV A;  3IQO A;  3OHM B;  1OOF A;  1BLQ A;  2MLE C;  1KFU S;  2O60 A;  1K9K A;  4R1E A;  1UHI A;  3VRO A;  4HRG A;  5I2L A;  3KEV A;  4GGN A;  3R1P A;  1QX2 A;  2M0R A;  2RGI A;  1CFF A;  2L2E A;  3SS3 A;  1GGZ A;  3SG6 A;  4ZCV A;  3CLN A;  4PT1 A;  1S6I A;  2MA2 A;  5DKN A;  1A2X A;  1BOC A;  2I18 A;  1VRK A;  2COL B;  4GBA A;  2L51 A;  1M63 B;  4PE4 A;  1PVB A;  1UHH A;  1K8U A;  2K61 A;  3CZ1 A;  1DJH A;  1MWN A;  5HLO A;  3CTN A;  4A4B A;  3NGV A;  1V1G A;  3FIA A;  1IIO A;  1XFY O;  4PHK A;  2FJY A;  5F6T A;  1Y1U A;  2HPS A;  4ZCU A;  3LK1 A;  2FCE A;  2KGB C;  3CAB A;  5HLV A;  3OX6 A;  3CGA A;  1N65 A;  1B8R A;  1MHO A;  1JF0 A;  4HRE E;  1TNQ A;  2MBX A;  4GFT A;  4QJ4 B;  1IWQ A;  1YR5 A;  3I5G C;  3LK0 A;  2AMI A;  2H8V A;  1WRK A;  4MBE A;  5CPV A;  4YGC B;  4QJ3 B;  1TCF A;  4DS7 A;  2CBL A;  2D8N A;  2P6B B;  3PFV A;  2CTN A;  2KAX A;  5CSF A;  4DUQ A;  2LMV A;  2LP3 A;  2PAS A;  1TUJ A;  3KO0 A;  1ALW A;  1FF1 A;  5AER A;  1FBV A;  5AAN A;  1DJY A;  2JU0 A;  2M3W A;  2F33 A;  2Y5I A;  1WLZ A;  2FOT A;  1L2O C;  2O5G A;  1CFP A;  1J1D A;  2MAZ A;  1KWO B;  1SMG A;  1S1E A;  3S0D A;  1BT6 A;  3VRR A;  3RLZ A;  1SCM B;  1EH2 A;  1OOG A;  1S6C A;  1GGW A; 
#chains in the Genus database with same CATH homology
 1XFU O;  2JT8 A;  1TN4 A;  5JOL A;  2JNX A;  1F70 A;  2JXL A;  2KDH A;  1LA3 A;  3VRP A;  2LLU A;  1PK0 D;  2K7O A;  2KQ6 A;  3D0Y A;  1CNP A;  1FI6 A;  4U8D A;  1KQM B;  1S5G Y;  1WRL A;  2BCX A;  3TUY B;  3FWB A;  3BOW B;  4PHJ A;  1QVI Z;  3M0W A;  2CCM A;  2OS8 B;  1CDM A;  2MJW B;  3BUX B;  4WQ3 A;  1TRF A;  1JFK A;  3VRN A;  5I2O A;  1NP8 A;  1ALV A;  2ZFD A;  1YVH A;  1U5I A;  5HKY A;  1CMF A;  4PE1 A;  1YRU B;  2G9B A;  2JZI A;  4I5N B;  2Q91 A;  4D1E A;  4GUK A;  2ZRT A;  2KGR A;  1IRJ A;  2I94 A;  1D1O A;  3PM8 A;  1ZOT B;  3LCP C;  3KHE A;  3LLE A;  1DVI A;  1TNX A;  1QV1 A;  1CLB A;  2LLS A;  2JTT A;  1QXP A;  3JTD B;  4YBH B;  1F4O A;  2F8P A;  1OE9 B;  2BEC A;  3PSR A;  1CDP A;  3OX5 A;  2KAY A;  2MHH A;  1IJ5 A;  1LKJ A;  2QPT A;  2OTG B;  3I5H B;  3EKH A;  3DVJ A;  5GQQ C;  1DJW A;  1NCZ A;  1J7Q A;  1DJZ A;  1WY9 A;  1B1G A;  5FYX A;  1BOD A;  1SL8 A;  4GGF A;  3DVM A;  4PE7 A;  2MRD A;  3I5I B;  1TOP A;  2F2O A;  2ZND A;  3LL8 B;  5B8I B;  2CXJ A;  3WXA A;  3EK8 A;  5CSJ A;  2JC2 A;  3GK1 A;  3NSL A;  4I5J A;  3BQ3 A;  5HKW A;  1CDL A;  1A75 B;  1OMR A;  2HET A;  1A29 A;  1K2H A;  4BY4 A;  2F2P A;  2H61 A;  4XJK B;  1SW8 A;  4YGE B;  5ER4 X;  2K7D A;  1TNP A;  2PRU A;  2LCP A;  1JWD A;  3PAL A;  3ZNI A;  4XYN A;  1YX8 A;  2KBI A;  3HCM A;  1M39 A;  1FPW A;  1SRA A;  2L4H A;  2ZN8 A;  1TIZ A;  1ZFS A;  1XFW O;  2WCB A;  2Q4U A;  1UUR A;  1AJ4 A;  1NUB A;  5HYD A;  1KWO C;  1QTX A;  2KOT A;  2KNE A;  2OPO A;  2WC8 A;  2Y1M A;  3F45 A;  3ICB A;  1DT7 B;  2KFF A;  1SCM C;  4DIR A;  2LVV A;  2M1U A;  4HSZ A;  3EVR A;  1J1E A;  1AK8 A;  1BR4 B;  2BKI B;  2HF5 A;  2ZRS A;  2BCB A;  3VRQ A;  2PMY A;  2NLN A;  1K94 A;  4CID A;  1A03 A;  3PN7 B;  3TDI A;  2LMU A;  1RK9 A;  4NDB A;  1DMO A;  3TDZ A;  2Y1N A;  4ETO A;  3BUW B;  1PAL A;  2MLF C;  3SG7 A;  2M7L A;  1EG3 A;  3EKJ A;  1G33 A;  5AXI A;  2JOJ A;  3CR4 X;  3SIA A;  2PSR A;  1KK8 C;  3DF0 A;  1EXR A;  5AFP A;  1F8H A;  3IF7 A;  3RM1 A;  1CM1 A;  1J7R A;  1WRZ A;  1AHR A;  1S26 D;  3JVT B;  1NX3 A;  3CWG A;  1KQV A;  2LHI A;  1F71 A;  1AUI B;  4C0J A;  4MSP A;  4C0L A;  1R6P A;  4P5O E;  2GGM A;  1DJX A;  1JFJ A;  2LVK A;  4YRU A;  1HT9 A;  1KK7 Z;  5IBW A;  2H2K A;  2KBM A;  1RTP 1;  4MRY A;  2KHN A;  4OVN F;  3PAT A;  4GPL B;  5I8N A;  1B47 A;  3I5F B;  2LE9 B;  2K0J A;  1ODB A;  1DF0 B;  1IGV A;  1XVJ A;  1IQ5 A;  1YUT A;  1NX2 A;  2L5X B;  4GNK B;  1IG5 A;  3GK4 X;  4Q04 A;  1BG1 A;  3I5H C;  1KFX L;  5K89 A;  2KI4 B;  4MEW A;  5D7F A;  1B8C A;  2I7A A;  5TNC A;  1IQ3 A;  2BE6 A;  3E3R A;  1RWY A;  2LLT A;  2NZ0 A;  5D69 A;  2I2R E;  3O6B A;  1SNL A;  2M9G A;  3O2P A;  1F55 A;  2JNF A;  1SCV A;  2EC6 C;  1JBA A;  1IH0 A;  2QAC A;  1BR1 B;  1OZS A;  1NCX A;  4N5X A;  1MXE A;  3BOW A;  2LVJ A;  3AAK A;  2M49 B;  4GGF C;  1WDC B;  1N2D A;  2B1U A;  3EVV A;  1NX1 A;  1Y0V H;  3BUN B;  1G8I A;  2BE4 A;  2BL0 B;  2KI6 D;  1M45 A;  3CR2 A;  3TDU A;  1V1F A;  1NYA A;  1IJ6 A;  1B8L A;  1OQP A;  4USL A;  1C7V A;  1L7Z A;  1LVC D;  1QJT A;  1YRT B;  3KPX A;  4PHM A;  2L0P A;  4HRH A;  2H61 C;  1QAT A;  5PAL A;  1BU3 A;  2JT0 A;  1K95 A;  4CLN A;  3AKB A;  4DCK A;  3FS7 A;  2LNK A;  1F54 A;  3AAJ A;  5DKR A;  1NIW A;  2BKH B;  1YTZ C;  1DGU A;  1TNW A;  2KFH A;  2A4J A;  1DJI A;  5G08 A;  1C07 A;  1KSO A;  4JWQ A;  4NDD A;  1XFX O;  3WNX B;  1IKU A;  1QVI Y;  1K9U A;  2WOS A;  3OB2 B;  3BUO B;  3A4U B;  4YGA A;  1PSR A;  1XO5 A;  1RFJ A;  1S6J A;  4ICB A;  1ZMZ A;  2VRG A;  3GOF A;  3NSO A;  3SJS A;  3BXK A;  4GAO A;  3SG4 A;  2F3Z A;  2HQW A;  1M46 A;  2FJU B;  1MR8 A;  3MSE B;  3I5G B;  1UWO A;  1OOJ A;  2KFG A;  1UHK A;  1PVA A;  2PVB A;  5I2Q A;  1YX7 A;  4WRI A;  4XJK A;  1MUX A;  4N1F A;  4CPV A;  2G2B A;  2WCF A;  1ZAC A;  1MF8 B;  3DVK A;  5HKZ A;  3NSI A;  4DRW A;  4P2Y B;  3TZ1 A;  1OMV A;  1XFV O;  1NCY A;  3HX4 A;  4PE0 A;  4ORC B;  3SG3 A;  2JWW A;  2L98 A;  2LMT A;  1L2O B;  1OZO A;  1QX7 A;  2PAL A;  2LHL A;  1SYM A;  4MZL A;  3TS5 B;  2KYF A;  2BBM A;  2GV5 A;  1B4C A;  2LUC A;  1GQM A;  3CS1 A;  4YI9 A;  4PCW A;  1R2U A;  1N0Y A;  1ZUZ A;  1XA5 A;  1B7T Z;  1UP5 A;  2LUX A;  1K96 A;  1Q80 A;  2WCE A;  1KFX S;  1SK6 D;  2M97 A;  2ZKM X;  1BJF A;  1F4Q A;  4CFR A;  1SL9 A;  3FWC A;  4ORB B;  1DGV A;  2JQ6 A;  3D10 A;  4UPG A;  1K9P A;  3OP0 A;  1DJG A;  1G4Y R;  1CKK A;  2NCO A;  3EK4 A;  5J3X A;  4E68 A;  4MZJ A;  4TNC A;  1BMO A;  1BF5 A;  1CDN A;  1PSB A;  1CFC A;  1UUS A;  3AKA A;  1YUU A;  1QS7 A;  3O78 A;  1B7T Y;  1KQM C;  3TUY C;  1CFD A;  1SL7 A;  1QAS A;  4MRX A;  1TTX A;  2OS8 C;  1EL4 A;  1UHJ A;  4OV2 A;  1SR6 B;  4NQG A;  3WHU B;  2SAS A;  4AQI A;  2EGD A;  2SCP A;  2KSP A;  1REC A;  3KF9 A;  2LV7 A;  1DF0 A;  1E8A A;  1CM4 A;  3A8R A;  2NCP A;  2Y4Q A;  2AUC A;  2M29 A;  4PAL A;  1CTR A;  1X02 A;  5KTY A;  2BBN A;  3JTD C;  2K2A A;  4WQ2 A;  1CB1 A;  2FCD A;  2TN4 A;  2OTG C;  2CT9 A;  1XFZ O;  1MQ1 A;  4NDC A;  4PHN A;  2HQ8 A;  4N1G A;  3NSK A;  1QIV A;  3CZT X;  4CFQ A;  2LVI A;  2M1K B;  1CLM A;  3C1V A;  3DF0 B;  1DTL A;  3I5I C;  3PLF B;  1JSA A;  1KK7 Y;  2JRF A;  2KQY A;  3VGO A;  2K7C A;  4OCI A;  5BPJ A;  2K2F A;  2E30 A;  1KCY A;  1SY9 A;  4L9M A;  1JF2 A;  3K21 A;  1FI5 A;  1KFU L;  1XYD A;  1S5G Z;  2WOR A;  1AJ5 A;  1CMG A;  3OB1 B;  1XK4 C;  3TS5 C;  1JC2 A;  1W7I B;  1UHN A;  1QLS A;  1TCO B;  1OSA A;  1Y1X A;  2JUL A;  2L4I A;  2LM5 A;  2V53 A;  1AP4 A;  2ISD A;  4FTG A;  1NX0 A;  3SG5 A;  5KU1 A;  1EG4 A;  1J7P A;  4I5K A;  2LC5 A;  1YVL A;  1H4B A;  1SKT A;  4F0Z B;  2F3Y A;  2JTZ A;  4FQO A;  1HQV A;  3SG2 A;  2GGZ A;  2ZN9 A;  2BCA A;  1NSH A;  4QJ5 B;  5JJG A;  2EHB A;  3PN7 C;  1SPY A;  1KK8 B;  1MXL C;  3BUM B;  4JQ0 D;  1WLM A;  2K8M B;  3D0Y B;  1K93 D;  2AAO A;  2E6W A;  2JT3 A;  4M2Q A;  1Y1A A;  1GJY A;  4AQJ A;  2DOQ A;  4IL1 A;  3EVU A;  4YGB B;  4JPZ B;  1CLL A;  1RRO A;  1A75 A;  2KI6 C;  5AEQ A;  1SR6 C;  1OMD A;  1W7J B;  1QX5 B;  3JVT C;  3O4Y A;  1QV0 A;  3GK2 A;  2IS9 A;  1U5I B;  2K7B A;  2KYC A;  2WND A;  3BYA A;  1LIN A;  1XK4 A;  1J55 A;  1LA0 A;  1NWD A;  4MLW A;  2ZNE A;  4M2P A;  4YI8 A;  2LP2 A;  4I5L B;  5KSZ A;  3IQQ A;  4PDZ A;  1EJ3 A;  3I5F C;  2CNP A;  4MN0 A;  3QRX A;  4YGD B;  1A4P A;  3SIB A;  4MZK A;  4M2O A;  1J7O A;  1S3P A;  1JUO A;  2EC6 B;  5CSN A;  2KI4 C;  3CR5 X;  4A4C A;  3EK7 A;  4AOM A;  3DD4 A;  1SBJ A;  1YUS A;  2R2I A;  1YUR A;  1KSM A;  1S36 A;  1QLK A;  5DKQ A;  1B9A A;  3WHT B;  3NXA A;  4C0K A;  3H4S E;  2NXQ A;  1QIW A;  3ZWH A;  4OKH A;  1AVS A;  2JPT A;  5CSI A;  4BY5 A;  2JXC A;  1PUL A;  2LAP A;  2L50 A;  2M8U A;  5ER5 A;  3DVE A;  4MVF A;  1FW4 A;  1Y6W A;  4ORA B;  4OR9 B;  1WDC C;  2LAN A;  1K90 D;  1LXF C;  1H8B A;  2M7N A;  1M31 A;  1NPQ A;  1C7W A;  1PRW A;  2BL0 C;  1RJV A;  3OHM B;  2KAV A;  3IQO A;  1BLQ A;  2MLE C;  1KFU S;  2O60 A;  1K9K A;  4R1E A;  1UHI A;  3VRO A;  4HRG A;  5I2L A;  3KEV A;  4GGN A;  1QX2 A;  2M0R A;  2RGI A;  1CFF A;  2L2E A;  1GGZ A;  3SG6 A;  4ZCV A;  3CLN A;  1S6I A;  2MA2 A;  5DKN A;  1A2X A;  1BOC A;  2I18 A;  1VRK A;  2COL B;  4GBA A;  2L51 A;  1M63 B;  4PE4 A;  1PVB A;  1UHH A;  1K8U A;  2K61 A;  1DJH A;  1MWN A;  5HLO A;  3CTN A;  4A4B A;  1V1G A;  3FIA A;  1XFY O;  4PHK A;  5F6T A;  1Y1U A;  2HPS A;  4ZCU A;  3LK1 A;  2FCE A;  2KGB C;  5HLV A;  3OX6 A;  3CGA A;  1N65 A;  1B8R A;  1MHO A;  1JF0 A;  4HRE E;  1TNQ A;  2MBX A;  4GFT A;  4QJ4 B;  1IWQ A;  1YR5 A;  3I5G C;  3LK0 A;  2AMI A;  4MBE A;  1WRK A;  5CPV A;  4YGC B;  4QJ3 B;  1TCF A;  4DS7 A;  2CBL A;  2D8N A;  2P6B B;  3PFV A;  2CTN A;  2KAX A;  5CSF A;  4DUQ A;  2LMV A;  2LP3 A;  2PAS A;  3KO0 A;  1ALW A;  1FF1 A;  5AER A;  1FBV A;  5AAN A;  1DJY A;  2JU0 A;  2M3W A;  2F33 A;  2Y5I A;  1WLZ A;  2FOT A;  1L2O C;  2O5G A;  1CFP A;  1J1D A;  2MAZ A;  1KWO B;  1SMG A;  1S1E A;  1BT6 A;  3VRR A;  3RLZ A;  1SCM B;  1EH2 A;  1S6C A;  1GGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...