5FYXA

Crystal structure of drosophila ncs-1 bound to penothiazine fd16
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
169
Chain Sequence
KLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords FREQUENIN 2
publication title Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 66
structure length 169
sequence length 179
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5fyxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5fyxA02
2MLEC 2K7BA 2MRDA 2JU0A 1TOPA 2O5GA 4PALA 1DJHA 2RGIA 5FYXA 1XFVO 1A75A 1HT9A 2CNPA 4ETOA 4JQ0D 2F3YA 2PALA 1RJVA 1TCFA 1K94A 1YUSA 3CR2A 5I2LA 1CMGA 1CFFA 1B8LA 3F45A 3SG4A 5HYDA 1K9KA 2WCFA 3PN7C 4NDBA 1UURA 5CSIA 4C0KA 1A2XA 3BUWB 1QV1A 1DGVA 4BY5A 2I94A 3JVTB 2JNXA 2OPOA 1DTLA 1IGVA 1XFWO 3I5IB 1KCYA 4MRYA 1SMGA 3CS1A 2JT0A 2NLNA 2M9GA 3VRNA 5K89A 2JRFA 1YRUB 4I5KA 1R2UA 2BE6A 2D8NA 4N5XA 2KGBC 3AAKA 2IS9A 1CLLA 2L2EA 1NPQA 4PE1A 1G33A 3I5FB 2BKIB 1WLZA 4OV2A 1DJWA 2ZN8A 1QX2A 3BOWB 3NXAA 4MRXA 5AEQA 4MBEA 1TTXA 2NXQA 2LVKA 2M8UA 2BCXA 1KFXL 1TRFA 1DJXA 5ER5A 4DIRA 1WRZA 1IWQA 2F8PA 1KK8C 2LVVA 5AERA 2MLFC 1XVJA 3KEVA 2LLUA 2R2IA 4PE4A 4AOMA 2K8MB 1SK6D 1R6PA 3HCMA 4YGEB 1EJ3A 1LVCD 3NSLA 5JJGA 1ALVA 1IJ5A 1PRWA 2JXCA 2KAXA 2BCBA 2L5XB 2LCPA 1MUXA 1OSAA 1QVIZ 2H61A 3EVRA 5AFPA 3D0YA 1SRAA 5PALA 3K21A 1K95A 3TS5C 2K61A 2L98A 1BMOA 2E30A 3VROA 2BBNA 1YX8A 1RWYA 5AANA 1K8UA 1N0YA 2LAPA 2EC6B 4C0LA 2I18A 2EHBA 1DVIA 4ORBB 2L0PA 2GGZA 1AK8A 2BL0C 1M31A 4CIDA 5HKYA 4NQGA 2MBXA 2JNFA 2LLSA 1B9AA 1UUSA 1EL4A 3BUXB 4HRHA 2KOTA 1CLMA 3DVJA 1SCMC 1UP5A 4YGAA 3RM1A 4YRUA 1JWDA 4CFRA 2KGRA 1K90D 2H61C 1OMRA 4QJ4B 1U5IB 4F0ZB 4MZJA 1NX2A 3CGAA 1N65A 4AQIA 1NCYA 1EXRA 1JFKA 2V53A 3FWCA 2MJWB 3H4SE 1CKKA 3CLNA 3I5GC 1ZUZA 1SCVA 2BE4A 1KSMA 4GGNA 3TDZA 5ER4X 1NUBA 2M3WA 1MHOA 1YRTB 2O60A 2B1UA 2KNEA 3EK8A 1JF2A 5KSZA 1G8IA 3IQQA 1XFYO 1PSBA 1Q80A 1S36A 2CXJA 1F8HA 3PN7B 1K9UA 1IQ5A 2KAYA 5D7FA 1F70A 4HREE 1QASA 3C1VA 4ZCVA 2KI6D 2BCAA 2OTGC 1F71A 2WNDA 3RLZA 1IKUA 1DGUA 1C7WA 2ZRTA 3NSOA 2KQ6A 3FIAA 4YGBB 1L7ZA 1A03A 1C7VA 1F55A 1CM4A 3WHUB 1H4BA 4WRIA 2K0JA 1A75B 1OZOA 3SG7A 3ZWHA 1SPYA 2JPTA 2LHIA 3PSRA 2F3ZA 1CMFA 4MN0A 2JXLA 2KDHA 2FCDA 1AVSA 2K2FA 1LA0A 1UHNA 2KFHA 4QJ5B 3SG3A 5JOLA 2JT3A 1UHIA 1CFCA 1BT6A 1ZOTB 2I7AA 5HLVA 1KK8B 1SBJA 3EK7A 1NIWA 3IQOA 1SY9A 4YI8A 2PMYA 1GJYA 1PVBA 2Y4QA 1KK7Z 3GK1A 1PSRA 1M63B 1XFXO 2L4HA 4HSZA 3EKHA 3OB2B 3TDUA 4GPLB 1NX1A 2LP3A 2LMUA 1KQMC 3CWGA 4N1FA 2K7CA 3VGOA 2KI4C 1JFJA 2WORA 3CR4X 1JUOA 4QJ3B 2JULA 3TS5B 4U8DA 2DOQA 3SG6A 1NCXA 1LKJA 3AKAA 3TUYC 1B7TZ 1GGWA 1J7QA 2SCPA 2WC8A 1M39A 1M45A 3QRXA 1QIWA 1K93D 2ZNDA 3ZNIA 1MXLC 2LC5A 3I5HC 4OVNF 1AJ5A 4DCKA 2BL0B 5I8NA 2PSRA 2KQYA 2M49B 3DD4A 4PCWA 4TNCA 4GFTA 1V1GA 1S6IA 3WNXB 3DVEA 1CTRA 1SCMB 1Y1XA 2P6BB 1LXFC 1A29A 1S5GY 3D0YB 5CSNA 2KSPA 3LK0A 3CR5X 4R1EA 2PASA 2JZIA 1NX3A 3I5GB 1PVAA 4PDZA 4PHNA 5B8IB 5HKWA 1DJGA 1L2OC 3OX6A 1N2DA 1YR5A 2KYCA 1FI6A 1JSAA 1B8CA 1VRKA 1KSOA 1XO5A 2AAOA 3GK2A 1F4QA 2LANA 1QLSA 4M2QA 1KWOC 1TCOB 2NCPA 1RECA 5HLOA 4A4BA 3O2PA 4Q04A 2SASA 5AXIA 5F6TA 4N1GA 3SIBA 1OMDA 1QS7A 2LVIA 2OTGB 3BUNB 2JOJA 4XJKA 3GOFA 1IRJA 1OE9B 1ALWA 2KBMA 4E68A 1NP8A 2QACA 1NX0A 2JQ6A 3O4YA 1K96A 4XYNA 4AQJA 4WQ2A 1TNXA 4YGCB 1F54A 1YUTA 2LUCA 3KF9A 4MZLA 4MZKA 3LLEA 2L50A 1ZMZA 5HKZA 4PHMA 2M7LA 1WLMA 4P5OE 1MWNA 2LVJA 1PALA 1X02A 2BECA 2K7DA 1BOCA 1YTZC 2BBMA 2ZFDA 2Q4UA 3EVVA 1PULA 1IH0A 1QJTA 2LHLA 1DF0B 1OZSA 1TIZA 2ZRSA 5G08A 2GV5A 3FWBA 1YURA 3SG2A 1E8AA 3D10A 3LL8B 1H8BA 1AUIB 3NSIA 1KQMB 3SG5A 1DF0A 1Y6WA 2KI4B 5I2QA 2HQWA 4ICBA 2F2OA 3KO0A 2CCMA 1CDPA 2JTZA 2MA2A 4FTGA 3TUYB 2CT9A 1M46A 1B1GA 3EKJA 5GQQC 1CDMA 1BLQA 1UHKA 2HPSA 1JBAA 3KPXA 3NSKA 3I5HB 3LK1A 1SKTA 3HX4A 1V1FA 3WXAA 2KBIA 5CSJA 1C07A 1CNPA 1FPWA 1DJIA 4JPZB 4ORCB 1EG4A 5CPVA 4DS7A 2K2AA 2LE9B 1A4PA 4GBAA 4DUQA 3DF0A 5BPJA 4M2OA 1B8RA 5CSFA 4ORAB 1S26D 1BU3A 1CB1A 2K7OA 1ZFSA 1QX7A 3A4UB 1CFDA 1ZACA 2NZ0A 3PALA 3OB1B 1WDCC 4YBHB 1KFUS 2M1UA 1SNLA 3VRQA 1GGZA 2MAZA 4OR9B 1MR8A 1IQ3A 4GGFA 3PLFB 2JWWA 1Y0VH 2LUXA 1MF8B 1WRKA 3PM8A 1AP4A 1S3PA 1L2OB 1BR1B 2PVBA 1NCZA 1MXEA 1EH2A 3KHEA 3WHTB 2OS8C 4JWQA 1OMVA 2L51A 2LNKA 4CLNA 2JT8A 2Y1NA 2CBLA 1KWOB 1TNQA 1QVIY 5DKQA 1J7RA 1J7PA 1QX5B 1RROA 2JC2A 2HQ8A 3M0WA 2G2BA 3VRRA 1D1OA 1S1EA 1CLBA 4MSPA 1CDNA 2CTNA 1GQMA 1SR6C 1J7OA 1YVLA 1J1DA 2COLB 2E6WA 3JTDC 1WRLA 4OKHA 1IG5A 1TN4A 2KAVA 2M0RA 4C0JA 1DJYA 4GNKB 3DVKA 1FBVA 4GGFC 4BY4A 1XFUO 3BUMB 3O6BA 1XK4A 2LV7A 5TNCA 4YGDB 1S6CA 2ZKMX 3DVMA 5J3XA 1FW4A 1TNPA 1XYDA 4A4CA 2WCBA 4OCIA 4L9MA 2KYFA 5KTYA 3TDIA 2F33A 2WOSA 1WY9A 2FOTA 2I2RE 3MSEB 3SJSA 1S6JA 1KQVA 2Y1MA 3O78A 1TNWA 4XJKB 2VRGA 2ZNEA 2LP2A 3BOWA 1G4YR 1KFXS 1UHJA 1K9PA 2FJUB 3ICBA 3OX5A 4GAOA 3GK4X 2LMVA 2MHHA 4IL1A 2M7NA 1PK0D 3CZTX 4I5JA 1SW8A 1UWOA 2ISDA 4HRGA 1SL7A 1XFZO 1XK4C 3JVTC 1RTP1 4M2PA 1JF0A 3AKBA 1QTXA 1JC2A 3I5IC 2M97A 1SYMA 1NYAA 2ZN9A 2BKHB 3LCPC 4I5NB 1BJFA 2L4IA 2PRUA 1Y1UA 1F4OA 1DT7B 2Y5IA 2FCEA 2LMTA 1MQ1A 1BR4B 4UPGA 1YVHA 5DKRA 1EG3A 1AJ4A 2JTTA 3OHMB 4MLWA 1IJ6A 4USLA 4ZCUA 1BODA 1CFPA 4I5LB 5I2OA 3I5FC 1SL9A 4NDDA 4WQ3A 3A8RA 4FQOA 2AMIA 1S5GZ 1DMOA 1B47A 1AHRA 1W7IB 2WCEA 4PE0A 1FF1A 1WDCB 1QXPA 1FI5A 2HF5A 4D1EA 3BQ3A 4CFQA 1J1EA 1OOJA 1HQVA 1B4CA 4CPVA 1UHHA 2KI6C 2A4JA 4NDCA 1KK7Y 3OP0A 1RFJA 5KU1A 1YUUA 3E3RA 2OS8B 4DRWA 3EVUA 1Y1AA 1LA3A 1OQPA 2QPTA 3PATA 1U5IA 4GUKA 1W7JB 2G9BA 5IBWA 2H2KA 5DKNA 3TZ1A 5D69A 1ODBA 4YI9A 1NWDA 2KFGA 2GGMA 2KFFA 4PE7A 3PFVA 3CTNA 3DF0B 2EC6C 2HETA 1CDLA 2KHNA 1B7TY 3BXKA 2TN4A 1RK9A 1K2HA 1J55A 1SR6B 1YX7A 1BF5A 2M29A 1QLKA 3SIAA 4PHKA 2F2PA 3JTDB 2AUCA 1DJZA 2LM5A 4PHJA 3BUOB 1CM1A 1KFUL 3BYAA 1XA5A 3EK4A 3FS7A 4P2YB 2EGDA 2LLTA 4MVFA 3VRPA 1QIVA 2NCOA 3IF7A 1QV0A 4MEWA 3AAJA 2Q91A 1BG1A 1SL8A 1LINA 1QATA 1NSHA 2M1KB
chains in the Genus database with same CATH superfamily
2MLEC 2BNXA 2K7BA 2MRDA 1C3ZA 1TOPA 2JU0A 2O5GA 4PALA 1DJHA 3B88A 2RGIA 5FYXA 1XFVO 1A75A 1HT9A 2CNPA 4ETOA 4JQ0D 3DY9A 2F3YA 3R1PA 2PALA 4JKTA 3PJIA 3RZSA 3NGVA 1RJVA 1TCFA 1K94A 1YUSA 3CR2A 5I2LA 1CMGA 1CFFA 1B8LA 3F45A 3SG4A 5HYDA 2K60A 1K9KA 2WCFA 3PN7C 4NDBA 1UURA 5CSIA 4C0KA 1A2XA 3BUWB 1QV1A 1DGVA 4BY5A 2I94A 3JVTB 2JNXA 2OPOA 4OZDA 1DTLA 1IGVA 1XFWO 3I5IB 1DC1A 1JC2A 1KCYA 4MRYA 1SMGA 3CS1A 3SS3A 2JT0A 2NLNA 2M9GA 3VRNA 5K89A 2JRFA 1YRUB 4I5KA 1R2UA 2BE6A 5D3OA 2D8NA 4N5XA 2KGBC 3AAKA 2IS9A 3N7HA 3NHIA 1CLLA 2L2EA 1NPQA 4PE1A 1G33A 3I5FB 2BKIB 1WLZA 4OV2A 1DJWA 2ZN8A 1QX2A 3BOWB 3NXAA 4MRXA 5AEQA 4MBEA 5I94A 1TTXA 2NXQA 2LVKA 2M8UA 2BCXA 1KFXL 1TRFA 1DJXA 5ER5A 4DIRA 1WRZA 3CZ0A 1IWQA 2F8PA 1KK8C 2LVVA 5FI7A 5AERA 2MLFC 1XVJA 3KEVA 2LLUA 2R2IA 4PE4A 2QEHA 4AOMA 2K8MB 1SK6D 1R6PA 3HCMA 4YGEB 1EJ3A 1LVCD 3NSLA 5JJGA 1ALVA 1IJ5A 1PRWA 2JXCA 2KAXA 2BCBA 2L5XB 2LCPA 1MUXA 1OSAA 1QVIZ 2H61A 3EVRA 3FE9A 5AFPA 3D0YA 1SRAA 5PALA 3K21A 1K95A 4INXA 3TS5C 2K61A 2L98A 1BMOA 2E30A 3VROA 2BBNA 3R72A 1YX8A 1RWYA 5AANA 1K8UA 1N0YA 2LAPA 2EC6B 2QDIA 4C0LA 2I18A 2EHBA 1DVIA 4ORBB 2L0PA 2FJYA 2GGZA 1AK8A 1DEKA 2BL0C 1M31A 2QEOA 2WCHA 4CIDA 5HKYA 4NQGA 3FE8A 2MBXA 2JNFA 2LLSA 2PYQA 1B9AA 1UUSA 1EL4A 3BUXB 4HRHA 2KOTA 1CLMA 3DVJA 1SCMC 1UP5A 4YGAA 3RM1A 4YRUA 1JWDA 4CFRA 2KGRA 1K90D 2H61C 1OMRA 4QJ4B 1U5IB 2H8VA 3CZ1A 4F0ZB 4MZJA 1NX2A 3CGAA 1LS8A 1N65A 4AQIA 4FQTA 1NCYA 3UNWA 1EXRA 5HL1A 1JFKA 2V53A 3DZTA 3FWCA 2MJWB 3H4SE 1CKKA 3CLNA 3I5GC 1Z2CB 3L47A 1ZUZA 1SCVA 2BE4A 1KSMA 4GGNA 3TDZA 5ER4X 1NUBA 2M3WA 1MHOA 1YRTB 2O60A 2B1UA 2KNEA 3EK8A 1JF2A 5KSZA 1G8IA 3IQQA 1XFYO 1PSBA 1Q80A 1S36A 2CXJA 1F8HA 3PN7B 3S0FA 1K9UA 1IQ5A 2KAYA 5D7FA 4KYNA 1F70A 4HREE 1QASA 2KPHA 3C1VA 4ZCVA 2KI6D 2BCAA 2OTGC 3CDNA 3OBVA 1F71A 2WNDA 3RLZA 1IKUA 1DGUA 1C7WA 2ZRTA 3NSOA 2KQ6A 3FIAA 3CABA 1L7ZA 4YGBB 3D78A 1A03A 1C7VA 1F55A 1CM4A 3WHUB 1H4BA 4WRIA 2K0JA 3V2LA 1A75B 1OZOA 3SG7A 3ZWHA 1SPYA 2JPTA 2LHIA 3PSRA 2F3ZA 1CMFA 1OOHA 4MN0A 2JXLA 2KDHA 2FCDA 1AVSA 2JPOA 2K2FA 2QEBA 1LA0A 1UHNA 2KFHA 4QJ5B 3SG3A 5JOLA 2JT3A 1UHIA 1CFCA 1BT6A 1ZOTB 2I7AA 4PT1A 5HLVA 1KK8B 1SBJA 3EK7A 1NIWA 3IQOA 1TUJA 1SY9A 2WC6A 4YI8A 2PMYA 1GJYA 1PVBA 2Y4QA 1KK7Z 3GK1A 1PSRA 1M63B 1XFXO 2L4HA 4HSZA 3EKHA 3OB2B 3TDUA 3Q8IA 1TUZA 3CZ2A 4GPLB 1NX1A 2LP3A 2LMUA 1KQMC 2WCLA 3CWGA 4N1FA 2K7CA 3VGOA 2KI4C 3DYEA 1JFJA 2WORA 3CR4X 1JUOA 3CYZA 3O4XA 4QJ3B 2JULA 3TS5B 4U8DA 3BFHA 2DOQA 3SG6A 1NCXA 1LKJA 1P28A 3AKAA 3TUYC 1B7TZ 1GGWA 1J7QA 2SCPA 2WC8A 1M39A 1M45A 3QRXA 1QIWA 1K93D 2ZNDA 1W9ZA 1MXLC 2LC5A 3B7AA 3ZNIA 3I5HC 4OVNF 1QWVA 3BJHA 1AJ5A 4DCKA 2BL0B 5I8NA 2PSRA 2KQYA 2M49B 3DD4A 4PCWA 4TNCA 4GFTA 1V1GA 1S6IA 3WNXB 3DVEA 1CTRA 1SCMB 1Y1XA 2P6BB 1LXFC 1A29A 1S5GY 3D0YB 3PM2A 5CSNA 3D75A 2KSPA 3LK0A 3CR5X 4R1EA 2PASA 2JZIA 3S0GA 3OGNA 1NX3A 3IVTA 3I5GB 1PVAA 4PDZA 4PHNA 5B8IB 5HKWA 3B86A 1DJGA 1L2OC 2P71A 3OX6A 1N2DA 1YR5A 2KYCA 1FI6A 1JSAA 1B8CA 1VRKA 1KSOA 1XO5A 2AAOA 3GK2A 1F4QA 2LANA 1QLSA 4M2QA 1KWOC 1TCOB 2NCPA 1RECA 5HLOA 4A4BA 3O2PA 4Q04A 2SASA 5AXIA 3UO9A 5F6TA 4N1GA 3SIBA 1OMDA 1QS7A 2LVIA 2OTGB 3BUNB 2JOJA 2QEVA 4XJKA 3GOFA 1IRJA 1OE9B 1ALWA 2KBMA 2KLEA 5FI6A 4E68A 1NP8A 2QACA 1NX0A 2JQ6A 3O4YA 1K96A 2BAPA 3B6XA 4XYNA 4AQJA 4WQ2A 1TNXA 4YGCB 1F54A 1YUTA 2LUCA 2L5YA 3KF9A 4MZLA 4MZKA 3LLEA 2L50A 1ZMZA 5HKZA 4PHMA 2M7LA 1WLMA 4P5OE 2L2CA 1MWNA 3K1EA 2LVJA 1PALA 3DXLA 3SS4A 1X02A 2BECA 2K7DA 1BOCA 1YTZC 3EG5B 2BBMA 2ZFDA 2Q4UA 3EVVA 1PULA 3D73A 1IH0A 1QJTA 3D74A 2LHLA 1DF0B 1OZSA 1TIZA 2ZRSA 5G08A 2GV5A 3FWBA 1YURA 2WCJA 3SG2A 5DICA 1E8AA 3D10A 3LL8B 1H8BA 1C3YA 1AUIB 3NSIA 1KQMB 2PQLA 3SG5A 1Y6WA 1DF0A 3S0AA 2KI4B 5I2QA 2HQWA 4ICBA 2WC5A 2F2OA 3S0EA 3KO0A 3S0DA 2CCMA 1CDPA 2JTZA 2MA2A 4FTGA 3TUYB 2CT9A 3R1VA 1M46A 3NHTA 1B1GA 3EKJA 5GQQC 1CDMA 3VB1A 1UHKA 2HPSA 1BLQA 1JBAA 3KPXA 3NSKA 3I5HB 3LK1A 1SKTA 3BFBA 3HX4A 1V1FA 3WXAA 2KBIA 5CSJA 1OOFA 1C07A 1CNPA 1FPWA 3QMEA 1DJIA 4JPZB 4ORCB 1EG4A 5CPVA 4DS7A 2K2AA 2LE9B 1A4PA 4GBAA 4DUQA 3DF0A 5BPJA 2ERBA 4M2OA 1B8RA 5CSFA 4ORAB 1S26D 1BU3A 1IIOA 1CB1A 2K7OA 1ZFSA 1QX7A 3A4UB 1CFDA 1ZACA 2NZ0A 3PALA 3OB1B 1WDCC 4YBHB 1KFUS 2M1UA 1SNLA 3VRQA 1GGZA 4JD9A 2MAZA 4OR9B 1MR8A 1IQ3A 4GGFA 3PLFB 2JWWA 1Y0VH 2LUXA 1MF8B 1WRKA 3PM8A 1AP4A 1S3PA 1L2OB 1BR1B 2PVBA 1NCZA 5FI2A 1MXEA 1EH2A 3KHEA 3WHTB 2OS8C 4JWQA 1OMVA 2L51A 2LNKA 4CLNA 2JT8A 3SS5A 2Y1NA 1KWOB 1TNQA 2CBLA 1QVIY 5DKQA 1J7RA 1J7PA 1QX5B 2KLDA 1T14A 2YGUA 3B87A 1RROA 2JC2A 2HQ8A 3M0WA 2G2BA 3VRRA 1D1OA 1S1EA 1CLBA 4MSPA 1CDNA 1DQEA 2CTNA 1GQMA 1SR6C 1J7OA 1YVLA 2GTEA 1J1DA 2COLB 2E6WA 3JTDC 1WRLA 4OKHA 1IG5A 1TN4A 2KAVA 2M0RA 4C0JA 1DJYA 4GNKB 3DVKA 1FBVA 4GGFC 4F7FA 4BY4A 1XFUO 1TWOA 3BUMB 3O6BA 1XK4A 2LV7A 5TNCA 4YGDB 3BFAA 1Z4HA 1S6CA 3S0BA 2ZKMX 3DVMA 5J3XA 1FW4A 1TNPA 1XYDA 4A4CA 2WCBA 4OCIA 4L9MA 2KYFA 5KTYA 3TDIA 2F33A 2WOSA 1WY9A 2FOTA 2I2RE 3MSEB 1GM0A 3SJSA 1S6JA 1KQVA 2Y1MA 3O78A 1TNWA 4XJKB 2VRGA 2ZNEA 2LP2A 3BOWA 2WCKA 1G4YR 1KFXS 1UHJA 1K9PA 1OW4A 2FJUB 3ICBA 3OX5A 3GK4X 4GAOA 2LMVA 2MHHA 4IL1A 2M7NA 1PK0D 2P70A 3CZTX 4I5JA 1SW8A 1UWOA 2ISDA 4HRGA 1SL7A 1XFZO 1XK4C 3JVTC 1RTP1 4M2PA 1JF0A 3AKBA 1QTXA 3FE6A 3I5IC 2M97A 3R1OA 1SYMA 1NYAA 2ZN9A 2BKHB 2WCMA 3LCPC 4I5NB 1BJFA 2L4IA 2PRUA 1Y1UA 1F4OA 3L4AA 2Y5IA 2FCEA 2LMTA 5EL2A 1DT7B 1MQ1A 1BR4B 4UPGA 1YVHA 5DKRA 1EG3A 1AJ4A 2JTTA 3OHMB 4MLWA 1IJ6A 4USLA 4ZCUA 1BODA 3L4LA 1OOIX 4I5LB 5I2OA 1CFPA 3I5FC 1SL9A 4NDDA 4WQ3A 3A8RA 4FQOA 2AMIA 1S5GZ 1DMOA 1B47A 1AHRA 1W7IB 2WCEA 4PE0A 1FF1A 1WDCB 1QXPA 1FI5A 2HF5A 4D1EA 3BQ3A 4CFQA 1J1EA 1OOJA 1HQVA 1B4CA 4CPVA 1ORGA 1UHHA 1OOGA 2A4JA 2KI6C 4NDCA 4IJ7A 1KK7Y 3OP0A 1RFJA 5KU1A 1YUUA 3D76A 2OS8B 3E3RA 4DRWA 3EVUA 1Y1AA 1LA3A 1OQPA 2QPTA 3PATA 1U5IA 4GUKA 1W7JB 2G9BA 4INWA 5IBWA 2H2KA 1SSEB 5DKNA 3TZ1A 5D69A 1XFRA 1ODBA 4YI9A 1NWDA 2KFGA 2GGMA 2KFFA 4PE7A 3PFVA 3CTNA 3DF0B 2EC6C 2HETA 1CDLA 2KHNA 1B7TY 3BXKA 2TN4A 1DELA 1RK9A 1K2HA 1J55A 1SR6B 1YX7A 1BF5A 2M29A 1QLKA 3SIAA 3D77A 4PHKA 2F2PA 3JTDB 2AUCA 1DJZA 2LM5A 4PHJA 3BUOB 1CM1A 1KFUL 3BYAA 1XA5A 3EK4A 3FS7A 4P2YB 2EGDA 2LLTA 4MVFA 3VRPA 1QIVA 2NCOA 3IF7A 1QV0A 4MEWA 3AAJA 2Q91A 1BG1A 1SL8A 1LINA 1QATA 1NSHA 2M1KB
chains in the Genus database with same CATH topology
2MLEC 2K7BA 2MRDA 2JU0A 1TOPA 2O5GA 4PALA 1DJHA 2RGIA 5FYXA 1XFVO 1A75A 1HT9A 2CNPA 4ETOA 4JQ0D 2F3YA 2PALA 1RJVA 1TCFA 1K94A 1YUSA 3CR2A 5I2LA 1CMGA 1CFFA 1B8LA 3F45A 3SG4A 5HYDA 1K9KA 2WCFA 3PN7C 4NDBA 1UURA 5CSIA 4C0KA 1A2XA 3BUWB 1QV1A 1DGVA 4BY5A 2I94A 3JVTB 2JNXA 2OPOA 1DTLA 1IGVA 1XFWO 3I5IB 1KCYA 4MRYA 1SMGA 3CS1A 2JT0A 2NLNA 2M9GA 3VRNA 5K89A 2JRFA 1YRUB 4I5KA 1R2UA 2BE6A 2D8NA 4N5XA 2KGBC 3AAKA 2IS9A 1CLLA 2L2EA 1NPQA 4PE1A 1G33A 3I5FB 2BKIB 1WLZA 4OV2A 1DJWA 2ZN8A 1QX2A 3BOWB 3NXAA 4MRXA 5AEQA 4MBEA 1TTXA 2NXQA 2LVKA 2M8UA 2BCXA 1KFXL 1TRFA 1DJXA 5ER5A 4DIRA 1WRZA 1IWQA 2F8PA 1KK8C 2LVVA 5AERA 2MLFC 1XVJA 3KEVA 2LLUA 2R2IA 4PE4A 4AOMA 2K8MB 1SK6D 1R6PA 3HCMA 4YGEB 1EJ3A 1LVCD 3NSLA 5JJGA 1ALVA 1IJ5A 1PRWA 2JXCA 2KAXA 2BCBA 2L5XB 2LCPA 1MUXA 1OSAA 1QVIZ 2H61A 3EVRA 5AFPA 3D0YA 1SRAA 5PALA 3K21A 1K95A 3TS5C 2K61A 2L98A 1BMOA 2E30A 3VROA 2BBNA 1YX8A 1RWYA 5AANA 1K8UA 1N0YA 2LAPA 2EC6B 4C0LA 2I18A 2EHBA 1DVIA 4ORBB 2L0PA 2GGZA 1AK8A 2BL0C 1M31A 4CIDA 5HKYA 4NQGA 2MBXA 2JNFA 2LLSA 1B9AA 1UUSA 1EL4A 3BUXB 4HRHA 2KOTA 1CLMA 3DVJA 1SCMC 1UP5A 4YGAA 3RM1A 4YRUA 1JWDA 4CFRA 2KGRA 1K90D 2H61C 1OMRA 4QJ4B 1U5IB 4F0ZB 4MZJA 1NX2A 3CGAA 1N65A 4AQIA 1NCYA 1EXRA 1JFKA 2V53A 3FWCA 2MJWB 3H4SE 1CKKA 3CLNA 3I5GC 1ZUZA 1SCVA 2BE4A 1KSMA 4GGNA 3TDZA 5ER4X 1NUBA 2M3WA 1MHOA 1YRTB 2O60A 2B1UA 2KNEA 3EK8A 1JF2A 5KSZA 1G8IA 3IQQA 1XFYO 1PSBA 1Q80A 1S36A 2CXJA 1F8HA 3PN7B 1K9UA 1IQ5A 2KAYA 5D7FA 1F70A 4HREE 1QASA 3C1VA 4ZCVA 2KI6D 2BCAA 2OTGC 1F71A 2WNDA 3RLZA 1IKUA 1DGUA 1C7WA 2ZRTA 3NSOA 2KQ6A 3FIAA 4YGBB 1L7ZA 1A03A 1C7VA 1F55A 1CM4A 3WHUB 1H4BA 4WRIA 2K0JA 1A75B 1OZOA 3SG7A 3ZWHA 1SPYA 2JPTA 2LHIA 3PSRA 2F3ZA 1CMFA 4MN0A 2JXLA 2KDHA 2FCDA 1AVSA 2K2FA 1LA0A 1UHNA 2KFHA 4QJ5B 3SG3A 5JOLA 2JT3A 1UHIA 1CFCA 1BT6A 1ZOTB 2I7AA 5HLVA 1KK8B 1SBJA 3EK7A 1NIWA 3IQOA 1SY9A 4YI8A 2PMYA 1GJYA 1PVBA 2Y4QA 1KK7Z 3GK1A 1PSRA 1M63B 1XFXO 2L4HA 4HSZA 3EKHA 3OB2B 3TDUA 4GPLB 1NX1A 2LP3A 2LMUA 1KQMC 3CWGA 4N1FA 2K7CA 3VGOA 2KI4C 1JFJA 2WORA 3CR4X 1JUOA 4QJ3B 2JULA 3TS5B 4U8DA 2DOQA 3SG6A 1NCXA 1LKJA 3AKAA 3TUYC 1B7TZ 1GGWA 1J7QA 2SCPA 2WC8A 1M39A 1M45A 3QRXA 1QIWA 1K93D 2ZNDA 3ZNIA 1MXLC 2LC5A 3I5HC 4OVNF 1AJ5A 4DCKA 2BL0B 5I8NA 2PSRA 2KQYA 2M49B 3DD4A 4PCWA 4TNCA 4GFTA 1V1GA 1S6IA 3WNXB 3DVEA 1CTRA 1SCMB 1Y1XA 2P6BB 1LXFC 1A29A 1S5GY 3D0YB 5CSNA 2KSPA 3LK0A 3CR5X 4R1EA 2PASA 2JZIA 1NX3A 3I5GB 1PVAA 4PDZA 4PHNA 5B8IB 5HKWA 1DJGA 1L2OC 3OX6A 1N2DA 1YR5A 2KYCA 1FI6A 1JSAA 1B8CA 1VRKA 1KSOA 1XO5A 2AAOA 3GK2A 1F4QA 2LANA 1QLSA 4M2QA 1KWOC 1TCOB 2NCPA 1RECA 5HLOA 4A4BA 3O2PA 4Q04A 2SASA 5AXIA 5F6TA 4N1GA 3SIBA 1OMDA 1QS7A 2LVIA 2OTGB 3BUNB 2JOJA 4XJKA 3GOFA 1IRJA 1OE9B 1ALWA 2KBMA 4E68A 1NP8A 2QACA 1NX0A 2JQ6A 3O4YA 1K96A 4XYNA 4AQJA 4WQ2A 1TNXA 4YGCB 1F54A 1YUTA 2LUCA 3KF9A 4MZLA 4MZKA 3LLEA 2L50A 1ZMZA 5HKZA 4PHMA 2M7LA 1WLMA 4P5OE 1MWNA 2LVJA 1PALA 1X02A 2BECA 2K7DA 1BOCA 1YTZC 2BBMA 2ZFDA 2Q4UA 3EVVA 1PULA 1IH0A 1QJTA 2LHLA 1DF0B 1OZSA 1TIZA 2ZRSA 5G08A 2GV5A 3FWBA 1YURA 3SG2A 1E8AA 3D10A 3LL8B 1H8BA 1AUIB 3NSIA 1KQMB 3SG5A 1DF0A 1Y6WA 2KI4B 5I2QA 2HQWA 4ICBA 2F2OA 3KO0A 2CCMA 1CDPA 2JTZA 2MA2A 4FTGA 3TUYB 2CT9A 1M46A 1B1GA 3EKJA 5GQQC 1CDMA 1BLQA 1UHKA 2HPSA 1JBAA 3KPXA 3NSKA 3I5HB 3LK1A 1SKTA 3HX4A 1V1FA 3WXAA 2KBIA 5CSJA 1C07A 1CNPA 1FPWA 1DJIA 4JPZB 4ORCB 1EG4A 5CPVA 4DS7A 2K2AA 2LE9B 1A4PA 4GBAA 4DUQA 3DF0A 5BPJA 4M2OA 1B8RA 5CSFA 4ORAB 1S26D 1BU3A 1CB1A 2K7OA 1ZFSA 1QX7A 3A4UB 1CFDA 1ZACA 2NZ0A 3PALA 3OB1B 1WDCC 4YBHB 1KFUS 2M1UA 1SNLA 3VRQA 1GGZA 2MAZA 4OR9B 1MR8A 1IQ3A 4GGFA 3PLFB 2JWWA 1Y0VH 2LUXA 1MF8B 1WRKA 3PM8A 1AP4A 1S3PA 1L2OB 1BR1B 2PVBA 1NCZA 1MXEA 1EH2A 3KHEA 3WHTB 2OS8C 4JWQA 1OMVA 2L51A 2LNKA 4CLNA 2JT8A 2Y1NA 2CBLA 1KWOB 1TNQA 1QVIY 5DKQA 1J7RA 1J7PA 1QX5B 1RROA 2JC2A 2HQ8A 3M0WA 2G2BA 3VRRA 1D1OA 1S1EA 1CLBA 4MSPA 1CDNA 2CTNA 1GQMA 1SR6C 1J7OA 1YVLA 1J1DA 2COLB 2E6WA 3JTDC 1WRLA 4OKHA 1IG5A 1TN4A 2KAVA 2M0RA 4C0JA 1DJYA 4GNKB 3DVKA 1FBVA 4GGFC 4BY4A 1XFUO 3BUMB 3O6BA 1XK4A 2LV7A 5TNCA 4YGDB 1S6CA 2ZKMX 3DVMA 5J3XA 1FW4A 1TNPA 1XYDA 4A4CA 2WCBA 4OCIA 4L9MA 2KYFA 5KTYA 3TDIA 2F33A 2WOSA 1WY9A 2FOTA 2I2RE 3MSEB 3SJSA 1S6JA 1KQVA 2Y1MA 3O78A 1TNWA 4XJKB 2VRGA 2ZNEA 2LP2A 3BOWA 1G4YR 1KFXS 1UHJA 1K9PA 2FJUB 3ICBA 3OX5A 4GAOA 3GK4X 2LMVA 2MHHA 4IL1A 2M7NA 1PK0D 3CZTX 4I5JA 1SW8A 1UWOA 2ISDA 4HRGA 1SL7A 1XFZO 1XK4C 3JVTC 1RTP1 4M2PA 1JF0A 3AKBA 1QTXA 1JC2A 3I5IC 2M97A 1SYMA 1NYAA 2ZN9A 2BKHB 3LCPC 4I5NB 1BJFA 2L4IA 2PRUA 1Y1UA 1F4OA 1DT7B 2Y5IA 2FCEA 2LMTA 1MQ1A 1BR4B 4UPGA 1YVHA 5DKRA 1EG3A 1AJ4A 2JTTA 3OHMB 4MLWA 1IJ6A 4USLA 4ZCUA 1BODA 1CFPA 4I5LB 5I2OA 3I5FC 1SL9A 4NDDA 4WQ3A 3A8RA 4FQOA 2AMIA 1S5GZ 1DMOA 1B47A 1AHRA 1W7IB 2WCEA 4PE0A 1FF1A 1WDCB 1QXPA 1FI5A 2HF5A 4D1EA 3BQ3A 4CFQA 1J1EA 1OOJA 1HQVA 1B4CA 4CPVA 1UHHA 2KI6C 2A4JA 4NDCA 1KK7Y 3OP0A 1RFJA 5KU1A 1YUUA 3E3RA 2OS8B 4DRWA 3EVUA 1Y1AA 1LA3A 1OQPA 2QPTA 3PATA 1U5IA 4GUKA 1W7JB 2G9BA 5IBWA 2H2KA 5DKNA 3TZ1A 5D69A 1ODBA 4YI9A 1NWDA 2KFGA 2GGMA 2KFFA 4PE7A 3PFVA 3CTNA 3DF0B 2EC6C 2HETA 1CDLA 2KHNA 1B7TY 3BXKA 2TN4A 1RK9A 1K2HA 1J55A 1SR6B 1YX7A 1BF5A 2M29A 1QLKA 3SIAA 4PHKA 2F2PA 3JTDB 2AUCA 1DJZA 2LM5A 4PHJA 3BUOB 1CM1A 1KFUL 3BYAA 1XA5A 3EK4A 3FS7A 4P2YB 2EGDA 2LLTA 4MVFA 3VRPA 1QIVA 2NCOA 3IF7A 1QV0A 4MEWA 3AAJA 2Q91A 1BG1A 1SL8A 1LINA 1QATA 1NSHA 2M1KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLE C;  2K7B A;  2MRD A;  2JU0 A;  1TOP A;  2O5G A;  4PAL A;  1DJH A;  2RGI A;  5FYX A;  1XFV O;  1A75 A;  1HT9 A;  2CNP A;  4ETO A;  4JQ0 D;  2F3Y A;  2PAL A;  1RJV A;  1TCF A;  1K94 A;  1YUS A;  3CR2 A;  5I2L A;  1CMG A;  1CFF A;  1B8L A;  3F45 A;  3SG4 A;  5HYD A;  1K9K A;  2WCF A;  3PN7 C;  4NDB A;  1UUR A;  5CSI A;  4C0K A;  1A2X A;  3BUW B;  1QV1 A;  1DGV A;  4BY5 A;  2I94 A;  3JVT B;  2JNX A;  2OPO A;  1DTL A;  1IGV A;  1XFW O;  3I5I B;  1KCY A;  4MRY A;  1SMG A;  3CS1 A;  2JT0 A;  2NLN A;  2M9G A;  3VRN A;  5K89 A;  2JRF A;  1YRU B;  4I5K A;  1R2U A;  2BE6 A;  2D8N A;  4N5X A;  2KGB C;  3AAK A;  2IS9 A;  1CLL A;  2L2E A;  1NPQ A;  4PE1 A;  1G33 A;  3I5F B;  2BKI B;  1WLZ A;  4OV2 A;  1DJW A;  2ZN8 A;  1QX2 A;  3BOW B;  3NXA A;  4MRX A;  5AEQ A;  4MBE A;  1TTX A;  2NXQ A;  2LVK A;  2M8U A;  2BCX A;  1KFX L;  1TRF A;  1DJX A;  5ER5 A;  4DIR A;  1WRZ A;  1IWQ A;  2F8P A;  1KK8 C;  2LVV A;  5AER A;  2MLF C;  1XVJ A;  3KEV A;  2LLU A;  2R2I A;  4PE4 A;  4AOM A;  2K8M B;  1SK6 D;  1R6P A;  3HCM A;  4YGE B;  1EJ3 A;  1LVC D;  3NSL A;  5JJG A;  1ALV A;  1IJ5 A;  1PRW A;  2JXC A;  2KAX A;  2BCB A;  2L5X B;  2LCP A;  1MUX A;  1OSA A;  1QVI Z;  2H61 A;  3EVR A;  5AFP A;  3D0Y A;  1SRA A;  5PAL A;  3K21 A;  1K95 A;  3TS5 C;  2K61 A;  2L98 A;  1BMO A;  2E30 A;  3VRO A;  2BBN A;  1YX8 A;  1RWY A;  5AAN A;  1K8U A;  1N0Y A;  2LAP A;  2EC6 B;  4C0L A;  2I18 A;  2EHB A;  1DVI A;  4ORB B;  2L0P A;  2GGZ A;  1AK8 A;  2BL0 C;  1M31 A;  4CID A;  5HKY A;  4NQG A;  2MBX A;  2JNF A;  2LLS A;  1B9A A;  1UUS A;  1EL4 A;  3BUX B;  4HRH A;  2KOT A;  1CLM A;  3DVJ A;  1SCM C;  1UP5 A;  4YGA A;  3RM1 A;  4YRU A;  1JWD A;  4CFR A;  2KGR A;  1K90 D;  2H61 C;  1OMR A;  4QJ4 B;  1U5I B;  4F0Z B;  4MZJ A;  1NX2 A;  3CGA A;  1N65 A;  4AQI A;  1NCY A;  1EXR A;  1JFK A;  2V53 A;  3FWC A;  2MJW B;  3H4S E;  1CKK A;  3CLN A;  3I5G C;  1ZUZ A;  1SCV A;  2BE4 A;  1KSM A;  4GGN A;  3TDZ A;  5ER4 X;  1NUB A;  2M3W A;  1MHO A;  1YRT B;  2O60 A;  2B1U A;  2KNE A;  3EK8 A;  1JF2 A;  5KSZ A;  1G8I A;  3IQQ A;  1XFY O;  1PSB A;  1Q80 A;  1S36 A;  2CXJ A;  1F8H A;  3PN7 B;  1K9U A;  1IQ5 A;  2KAY A;  5D7F A;  1F70 A;  4HRE E;  1QAS A;  3C1V A;  4ZCV A;  2KI6 D;  2BCA A;  2OTG C;  1F71 A;  2WND A;  3RLZ A;  1IKU A;  1DGU A;  1C7W A;  2ZRT A;  3NSO A;  2KQ6 A;  3FIA A;  4YGB B;  1L7Z A;  1A03 A;  1C7V A;  1F55 A;  1CM4 A;  3WHU B;  1H4B A;  4WRI A;  2K0J A;  1A75 B;  1OZO A;  3SG7 A;  3ZWH A;  1SPY A;  2JPT A;  2LHI A;  3PSR A;  2F3Z A;  1CMF A;  4MN0 A;  2JXL A;  2KDH A;  2FCD A;  1AVS A;  2K2F A;  1LA0 A;  1UHN A;  2KFH A;  4QJ5 B;  3SG3 A;  5JOL A;  2JT3 A;  1UHI A;  1CFC A;  1BT6 A;  1ZOT B;  2I7A A;  5HLV A;  1KK8 B;  1SBJ A;  3EK7 A;  1NIW A;  3IQO A;  1SY9 A;  4YI8 A;  2PMY A;  1GJY A;  1PVB A;  2Y4Q A;  1KK7 Z;  3GK1 A;  1PSR A;  1M63 B;  1XFX O;  2L4H A;  4HSZ A;  3EKH A;  3OB2 B;  3TDU A;  4GPL B;  1NX1 A;  2LP3 A;  2LMU A;  1KQM C;  3CWG A;  4N1F A;  2K7C A;  3VGO A;  2KI4 C;  1JFJ A;  2WOR A;  3CR4 X;  1JUO A;  4QJ3 B;  2JUL A;  3TS5 B;  4U8D A;  2DOQ A;  3SG6 A;  1NCX A;  1LKJ A;  3AKA A;  3TUY C;  1B7T Z;  1GGW A;  1J7Q A;  2SCP A;  2WC8 A;  1M39 A;  1M45 A;  3QRX A;  1QIW A;  1K93 D;  2ZND A;  3ZNI A;  1MXL C;  2LC5 A;  3I5H C;  4OVN F;  1AJ5 A;  4DCK A;  2BL0 B;  5I8N A;  2PSR A;  2KQY A;  2M49 B;  3DD4 A;  4PCW A;  4TNC A;  4GFT A;  1V1G A;  1S6I A;  3WNX B;  3DVE A;  1CTR A;  1SCM B;  1Y1X A;  2P6B B;  1LXF C;  1A29 A;  1S5G Y;  3D0Y B;  5CSN A;  2KSP A;  3LK0 A;  3CR5 X;  4R1E A;  2PAS A;  2JZI A;  1NX3 A;  3I5G B;  1PVA A;  4PDZ A;  4PHN A;  5B8I B;  5HKW A;  1DJG A;  1L2O C;  3OX6 A;  1N2D A;  1YR5 A;  2KYC A;  1FI6 A;  1JSA A;  1B8C A;  1VRK A;  1KSO A;  1XO5 A;  2AAO A;  3GK2 A;  1F4Q A;  2LAN A;  1QLS A;  4M2Q A;  1KWO C;  1TCO B;  2NCP A;  1REC A;  5HLO A;  4A4B A;  3O2P A;  4Q04 A;  2SAS A;  5AXI A;  5F6T A;  4N1G A;  3SIB A;  1OMD A;  1QS7 A;  2LVI A;  2OTG B;  3BUN B;  2JOJ A;  4XJK A;  3GOF A;  1IRJ A;  1OE9 B;  1ALW A;  2KBM A;  4E68 A;  1NP8 A;  2QAC A;  1NX0 A;  2JQ6 A;  3O4Y A;  1K96 A;  4XYN A;  4AQJ A;  4WQ2 A;  1TNX A;  4YGC B;  1F54 A;  1YUT A;  2LUC A;  3KF9 A;  4MZL A;  4MZK A;  3LLE A;  2L50 A;  1ZMZ A;  5HKZ A;  4PHM A;  2M7L A;  1WLM A;  4P5O E;  1MWN A;  2LVJ A;  1PAL A;  1X02 A;  2BEC A;  2K7D A;  1BOC A;  1YTZ C;  2BBM A;  2ZFD A;  2Q4U A;  3EVV A;  1PUL A;  1IH0 A;  1QJT A;  2LHL A;  1DF0 B;  1OZS A;  1TIZ A;  2ZRS A;  5G08 A;  2GV5 A;  3FWB A;  1YUR A;  3SG2 A;  1E8A A;  3D10 A;  3LL8 B;  1H8B A;  1AUI B;  3NSI A;  1KQM B;  3SG5 A;  1DF0 A;  1Y6W A;  2KI4 B;  5I2Q A;  2HQW A;  4ICB A;  2F2O A;  3KO0 A;  2CCM A;  1CDP A;  2JTZ A;  2MA2 A;  4FTG A;  3TUY B;  2CT9 A;  1M46 A;  1B1G A;  3EKJ A;  5GQQ C;  1CDM A;  1BLQ A;  1UHK A;  2HPS A;  1JBA A;  3KPX A;  3NSK A;  3I5H B;  3LK1 A;  1SKT A;  3HX4 A;  1V1F A;  3WXA A;  2KBI A;  5CSJ A;  1C07 A;  1CNP A;  1FPW A;  1DJI A;  4JPZ B;  4ORC B;  1EG4 A;  5CPV A;  4DS7 A;  2K2A A;  2LE9 B;  1A4P A;  4GBA A;  4DUQ A;  3DF0 A;  5BPJ A;  4M2O A;  1B8R A;  5CSF A;  4ORA B;  1S26 D;  1BU3 A;  1CB1 A;  2K7O A;  1ZFS A;  1QX7 A;  3A4U B;  1CFD A;  1ZAC A;  2NZ0 A;  3PAL A;  3OB1 B;  1WDC C;  4YBH B;  1KFU S;  2M1U A;  1SNL A;  3VRQ A;  1GGZ A;  2MAZ A;  4OR9 B;  1MR8 A;  1IQ3 A;  4GGF A;  3PLF B;  2JWW A;  1Y0V H;  2LUX A;  1MF8 B;  1WRK A;  3PM8 A;  1AP4 A;  1S3P A;  1L2O B;  1BR1 B;  2PVB A;  1NCZ A;  1MXE A;  1EH2 A;  3KHE A;  3WHT B;  2OS8 C;  4JWQ A;  1OMV A;  2L51 A;  2LNK A;  4CLN A;  2JT8 A;  2Y1N A;  2CBL A;  1KWO B;  1TNQ A;  1QVI Y;  5DKQ A;  1J7R A;  1J7P A;  1QX5 B;  1RRO A;  2JC2 A;  2HQ8 A;  3M0W A;  2G2B A;  3VRR A;  1D1O A;  1S1E A;  1CLB A;  4MSP A;  1CDN A;  2CTN A;  1GQM A;  1SR6 C;  1J7O A;  1YVL A;  1J1D A;  2COL B;  2E6W A;  3JTD C;  1WRL A;  4OKH A;  1IG5 A;  1TN4 A;  2KAV A;  2M0R A;  4C0J A;  1DJY A;  4GNK B;  3DVK A;  1FBV A;  4GGF C;  4BY4 A;  1XFU O;  3BUM B;  3O6B A;  1XK4 A;  2LV7 A;  5TNC A;  4YGD B;  1S6C A;  2ZKM X;  3DVM A;  5J3X A;  1FW4 A;  1TNP A;  1XYD A;  4A4C A;  2WCB A;  4OCI A;  4L9M A;  2KYF A;  5KTY A;  3TDI A;  2F33 A;  2WOS A;  1WY9 A;  2FOT A;  2I2R E;  3MSE B;  3SJS A;  1S6J A;  1KQV A;  2Y1M A;  3O78 A;  1TNW A;  4XJK B;  2VRG A;  2ZNE A;  2LP2 A;  3BOW A;  1G4Y R;  1KFX S;  1UHJ A;  1K9P A;  2FJU B;  3ICB A;  3OX5 A;  4GAO A;  3GK4 X;  2LMV A;  2MHH A;  4IL1 A;  2M7N A;  1PK0 D;  3CZT X;  4I5J A;  1SW8 A;  1UWO A;  2ISD A;  4HRG A;  1SL7 A;  1XFZ O;  1XK4 C;  3JVT C;  1RTP 1;  4M2P A;  1JF0 A;  3AKB A;  1QTX A;  1JC2 A;  3I5I C;  2M97 A;  1SYM A;  1NYA A;  2ZN9 A;  2BKH B;  3LCP C;  4I5N B;  1BJF A;  2L4I A;  2PRU A;  1Y1U A;  1F4O A;  1DT7 B;  2Y5I A;  2FCE A;  2LMT A;  1MQ1 A;  1BR4 B;  4UPG A;  1YVH A;  5DKR A;  1EG3 A;  1AJ4 A;  2JTT A;  3OHM B;  4MLW A;  1IJ6 A;  4USL A;  4ZCU A;  1BOD A;  1CFP A;  4I5L B;  5I2O A;  3I5F C;  1SL9 A;  4NDD A;  4WQ3 A;  3A8R A;  4FQO A;  2AMI A;  1S5G Z;  1DMO A;  1B47 A;  1AHR A;  1W7I B;  2WCE A;  4PE0 A;  1FF1 A;  1WDC B;  1QXP A;  1FI5 A;  2HF5 A;  4D1E A;  3BQ3 A;  4CFQ A;  1J1E A;  1OOJ A;  1HQV A;  1B4C A;  4CPV A;  1UHH A;  2KI6 C;  2A4J A;  4NDC A;  1KK7 Y;  3OP0 A;  1RFJ A;  5KU1 A;  1YUU A;  3E3R A;  2OS8 B;  4DRW A;  3EVU A;  1Y1A A;  1LA3 A;  1OQP A;  2QPT A;  3PAT A;  1U5I A;  4GUK A;  1W7J B;  2G9B A;  5IBW A;  2H2K A;  5DKN A;  3TZ1 A;  5D69 A;  1ODB A;  4YI9 A;  1NWD A;  2KFG A;  2GGM A;  2KFF A;  4PE7 A;  3PFV A;  3CTN A;  3DF0 B;  2EC6 C;  2HET A;  1CDL A;  2KHN A;  1B7T Y;  3BXK A;  2TN4 A;  1RK9 A;  1K2H A;  1J55 A;  1SR6 B;  1YX7 A;  1BF5 A;  2M29 A;  1QLK A;  3SIA A;  4PHK A;  2F2P A;  3JTD B;  2AUC A;  1DJZ A;  2LM5 A;  4PHJ A;  3BUO B;  1CM1 A;  1KFU L;  3BYA A;  1XA5 A;  3EK4 A;  3FS7 A;  4P2Y B;  2EGD A;  2LLT A;  4MVF A;  3VRP A;  1QIV A;  2NCO A;  3IF7 A;  1QV0 A;  4MEW A;  3AAJ A;  2Q91 A;  1BG1 A;  1SL8 A;  1LIN A;  1QAT A;  1NSH A;  2M1K B; 
#chains in the Genus database with same CATH topology
 2MLE C;  2BNX A;  2K7B A;  2MRD A;  1C3Z A;  1TOP A;  2JU0 A;  2O5G A;  4PAL A;  1DJH A;  3B88 A;  2RGI A;  5FYX A;  1XFV O;  1A75 A;  1HT9 A;  2CNP A;  4ETO A;  4JQ0 D;  3DY9 A;  2F3Y A;  3R1P A;  2PAL A;  4JKT A;  3PJI A;  3RZS A;  3NGV A;  1RJV A;  1TCF A;  1K94 A;  1YUS A;  3CR2 A;  5I2L A;  1CMG A;  1CFF A;  1B8L A;  3F45 A;  3SG4 A;  5HYD A;  2K60 A;  1K9K A;  2WCF A;  3PN7 C;  4NDB A;  1UUR A;  5CSI A;  4C0K A;  1A2X A;  3BUW B;  1QV1 A;  1DGV A;  4BY5 A;  2I94 A;  3JVT B;  2JNX A;  2OPO A;  4OZD A;  1DTL A;  1IGV A;  1XFW O;  3I5I B;  1DC1 A;  1JC2 A;  1KCY A;  4MRY A;  1SMG A;  3CS1 A;  3SS3 A;  2JT0 A;  2NLN A;  2M9G A;  3VRN A;  5K89 A;  2JRF A;  1YRU B;  4I5K A;  1R2U A;  2BE6 A;  5D3O A;  2D8N A;  4N5X A;  2KGB C;  3AAK A;  2IS9 A;  3N7H A;  3NHI A;  1CLL A;  2L2E A;  1NPQ A;  4PE1 A;  1G33 A;  3I5F B;  2BKI B;  1WLZ A;  4OV2 A;  1DJW A;  2ZN8 A;  1QX2 A;  3BOW B;  3NXA A;  4MRX A;  5AEQ A;  4MBE A;  5I94 A;  1TTX A;  2NXQ A;  2LVK A;  2M8U A;  2BCX A;  1KFX L;  1TRF A;  1DJX A;  5ER5 A;  4DIR A;  1WRZ A;  3CZ0 A;  1IWQ A;  2F8P A;  1KK8 C;  2LVV A;  5FI7 A;  5AER A;  2MLF C;  1XVJ A;  3KEV A;  2LLU A;  2R2I A;  4PE4 A;  2QEH A;  4AOM A;  2K8M B;  1SK6 D;  1R6P A;  3HCM A;  4YGE B;  1EJ3 A;  1LVC D;  3NSL A;  5JJG A;  1ALV A;  1IJ5 A;  1PRW A;  2JXC A;  2KAX A;  2BCB A;  2L5X B;  2LCP A;  1MUX A;  1OSA A;  1QVI Z;  2H61 A;  3EVR A;  3FE9 A;  5AFP A;  3D0Y A;  1SRA A;  5PAL A;  3K21 A;  1K95 A;  4INX A;  3TS5 C;  2K61 A;  2L98 A;  1BMO A;  2E30 A;  3VRO A;  2BBN A;  3R72 A;  1YX8 A;  1RWY A;  5AAN A;  1K8U A;  1N0Y A;  2LAP A;  2EC6 B;  2QDI A;  4C0L A;  2I18 A;  2EHB A;  1DVI A;  4ORB B;  2L0P A;  2FJY A;  2GGZ A;  1AK8 A;  1DEK A;  2BL0 C;  1M31 A;  2QEO A;  2WCH A;  4CID A;  5HKY A;  4NQG A;  3FE8 A;  2MBX A;  2JNF A;  2LLS A;  2PYQ A;  1B9A A;  1UUS A;  1EL4 A;  3BUX B;  4HRH A;  2KOT A;  1CLM A;  3DVJ A;  1SCM C;  1UP5 A;  4YGA A;  3RM1 A;  4YRU A;  1JWD A;  4CFR A;  2KGR A;  1K90 D;  2H61 C;  1OMR A;  4QJ4 B;  1U5I B;  2H8V A;  3CZ1 A;  4F0Z B;  4MZJ A;  1NX2 A;  3CGA A;  1LS8 A;  1N65 A;  4AQI A;  4FQT A;  1NCY A;  3UNW A;  1EXR A;  5HL1 A;  1JFK A;  2V53 A;  3DZT A;  3FWC A;  2MJW B;  3H4S E;  1CKK A;  3CLN A;  3I5G C;  1Z2C B;  3L47 A;  1ZUZ A;  1SCV A;  2BE4 A;  1KSM A;  4GGN A;  3TDZ A;  5ER4 X;  1NUB A;  2M3W A;  1MHO A;  1YRT B;  2O60 A;  2B1U A;  2KNE A;  3EK8 A;  1JF2 A;  5KSZ A;  1G8I A;  3IQQ A;  1XFY O;  1PSB A;  1Q80 A;  1S36 A;  2CXJ A;  1F8H A;  3PN7 B;  3S0F A;  1K9U A;  1IQ5 A;  2KAY A;  5D7F A;  4KYN A;  1F70 A;  4HRE E;  1QAS A;  2KPH A;  3C1V A;  4ZCV A;  2KI6 D;  2BCA A;  2OTG C;  3CDN A;  3OBV A;  1F71 A;  2WND A;  3RLZ A;  1IKU A;  1DGU A;  1C7W A;  2ZRT A;  3NSO A;  2KQ6 A;  3FIA A;  3CAB A;  1L7Z A;  4YGB B;  3D78 A;  1A03 A;  1C7V A;  1F55 A;  1CM4 A;  3WHU B;  1H4B A;  4WRI A;  2K0J A;  3V2L A;  1A75 B;  1OZO A;  3SG7 A;  3ZWH A;  1SPY A;  2JPT A;  2LHI A;  3PSR A;  2F3Z A;  1CMF A;  1OOH A;  4MN0 A;  2JXL A;  2KDH A;  2FCD A;  1AVS A;  2JPO A;  2K2F A;  2QEB A;  1LA0 A;  1UHN A;  2KFH A;  4QJ5 B;  3SG3 A;  5JOL A;  2JT3 A;  1UHI A;  1CFC A;  1BT6 A;  1ZOT B;  2I7A A;  4PT1 A;  5HLV A;  1KK8 B;  1SBJ A;  3EK7 A;  1NIW A;  3IQO A;  1TUJ A;  1SY9 A;  2WC6 A;  4YI8 A;  2PMY A;  1GJY A;  1PVB A;  2Y4Q A;  1KK7 Z;  3GK1 A;  1PSR A;  1M63 B;  1XFX O;  2L4H A;  4HSZ A;  3EKH A;  3OB2 B;  3TDU A;  3Q8I A;  1TUZ A;  3CZ2 A;  4GPL B;  1NX1 A;  2LP3 A;  2LMU A;  1KQM C;  2WCL A;  3CWG A;  4N1F A;  2K7C A;  3VGO A;  2KI4 C;  3DYE A;  1JFJ A;  2WOR A;  3CR4 X;  1JUO A;  3CYZ A;  3O4X A;  4QJ3 B;  2JUL A;  3TS5 B;  4U8D A;  3BFH A;  2DOQ A;  3SG6 A;  1NCX A;  1LKJ A;  1P28 A;  3AKA A;  3TUY C;  1B7T Z;  1GGW A;  1J7Q A;  2SCP A;  2WC8 A;  1M39 A;  1M45 A;  3QRX A;  1QIW A;  1K93 D;  2ZND A;  1W9Z A;  1MXL C;  2LC5 A;  3B7A A;  3ZNI A;  3I5H C;  4OVN F;  1QWV A;  3BJH A;  1AJ5 A;  4DCK A;  2BL0 B;  5I8N A;  2PSR A;  2KQY A;  2M49 B;  3DD4 A;  4PCW A;  4TNC A;  4GFT A;  1V1G A;  1S6I A;  3WNX B;  3DVE A;  1CTR A;  1SCM B;  1Y1X A;  2P6B B;  1LXF C;  1A29 A;  1S5G Y;  3D0Y B;  3PM2 A;  5CSN A;  3D75 A;  2KSP A;  3LK0 A;  3CR5 X;  4R1E A;  2PAS A;  2JZI A;  3S0G A;  3OGN A;  1NX3 A;  3IVT A;  3I5G B;  1PVA A;  4PDZ A;  4PHN A;  5B8I B;  5HKW A;  3B86 A;  1DJG A;  1L2O C;  2P71 A;  3OX6 A;  1N2D A;  1YR5 A;  2KYC A;  1FI6 A;  1JSA A;  1B8C A;  1VRK A;  1KSO A;  1XO5 A;  2AAO A;  3GK2 A;  1F4Q A;  2LAN A;  1QLS A;  4M2Q A;  1KWO C;  1TCO B;  2NCP A;  1REC A;  5HLO A;  4A4B A;  3O2P A;  4Q04 A;  2SAS A;  5AXI A;  3UO9 A;  5F6T A;  4N1G A;  3SIB A;  1OMD A;  1QS7 A;  2LVI A;  2OTG B;  3BUN B;  2JOJ A;  2QEV A;  4XJK A;  3GOF A;  1IRJ A;  1OE9 B;  1ALW A;  2KBM A;  2KLE A;  5FI6 A;  4E68 A;  1NP8 A;  2QAC A;  1NX0 A;  2JQ6 A;  3O4Y A;  1K96 A;  2BAP A;  3B6X A;  4XYN A;  4AQJ A;  4WQ2 A;  1TNX A;  4YGC B;  1F54 A;  1YUT A;  2LUC A;  2L5Y A;  3KF9 A;  4MZL A;  4MZK A;  3LLE A;  2L50 A;  1ZMZ A;  5HKZ A;  4PHM A;  2M7L A;  1WLM A;  4P5O E;  2L2C A;  1MWN A;  3K1E A;  2LVJ A;  1PAL A;  3DXL A;  3SS4 A;  1X02 A;  2BEC A;  2K7D A;  1BOC A;  1YTZ C;  3EG5 B;  2BBM A;  2ZFD A;  2Q4U A;  3EVV A;  1PUL A;  3D73 A;  1IH0 A;  1QJT A;  3D74 A;  2LHL A;  1DF0 B;  1OZS A;  1TIZ A;  2ZRS A;  5G08 A;  2GV5 A;  3FWB A;  1YUR A;  2WCJ A;  3SG2 A;  5DIC A;  1E8A A;  3D10 A;  3LL8 B;  1H8B A;  1C3Y A;  1AUI B;  3NSI A;  1KQM B;  2PQL A;  3SG5 A;  1Y6W A;  1DF0 A;  3S0A A;  2KI4 B;  5I2Q A;  2HQW A;  4ICB A;  2WC5 A;  2F2O A;  3S0E A;  3KO0 A;  3S0D A;  2CCM A;  1CDP A;  2JTZ A;  2MA2 A;  4FTG A;  3TUY B;  2CT9 A;  3R1V A;  1M46 A;  3NHT A;  1B1G A;  3EKJ A;  5GQQ C;  1CDM A;  3VB1 A;  1UHK A;  2HPS A;  1BLQ A;  1JBA A;  3KPX A;  3NSK A;  3I5H B;  3LK1 A;  1SKT A;  3BFB A;  3HX4 A;  1V1F A;  3WXA A;  2KBI A;  5CSJ A;  1OOF A;  1C07 A;  1CNP A;  1FPW A;  3QME A;  1DJI A;  4JPZ B;  4ORC B;  1EG4 A;  5CPV A;  4DS7 A;  2K2A A;  2LE9 B;  1A4P A;  4GBA A;  4DUQ A;  3DF0 A;  5BPJ A;  2ERB A;  4M2O A;  1B8R A;  5CSF A;  4ORA B;  1S26 D;  1BU3 A;  1IIO A;  1CB1 A;  2K7O A;  1ZFS A;  1QX7 A;  3A4U B;  1CFD A;  1ZAC A;  2NZ0 A;  3PAL A;  3OB1 B;  1WDC C;  4YBH B;  1KFU S;  2M1U A;  1SNL A;  3VRQ A;  1GGZ A;  4JD9 A;  2MAZ A;  4OR9 B;  1MR8 A;  1IQ3 A;  4GGF A;  3PLF B;  2JWW A;  1Y0V H;  2LUX A;  1MF8 B;  1WRK A;  3PM8 A;  1AP4 A;  1S3P A;  1L2O B;  1BR1 B;  2PVB A;  1NCZ A;  5FI2 A;  1MXE A;  1EH2 A;  3KHE A;  3WHT B;  2OS8 C;  4JWQ A;  1OMV A;  2L51 A;  2LNK A;  4CLN A;  2JT8 A;  3SS5 A;  2Y1N A;  1KWO B;  1TNQ A;  2CBL A;  1QVI Y;  5DKQ A;  1J7R A;  1J7P A;  1QX5 B;  2KLD A;  1T14 A;  2YGU A;  3B87 A;  1RRO A;  2JC2 A;  2HQ8 A;  3M0W A;  2G2B A;  3VRR A;  1D1O A;  1S1E A;  1CLB A;  4MSP A;  1CDN A;  1DQE A;  2CTN A;  1GQM A;  1SR6 C;  1J7O A;  1YVL A;  2GTE A;  1J1D A;  2COL B;  2E6W A;  3JTD C;  1WRL A;  4OKH A;  1IG5 A;  1TN4 A;  2KAV A;  2M0R A;  4C0J A;  1DJY A;  4GNK B;  3DVK A;  1FBV A;  4GGF C;  4F7F A;  4BY4 A;  1XFU O;  1TWO A;  3BUM B;  3O6B A;  1XK4 A;  2LV7 A;  5TNC A;  4YGD B;  3BFA A;  1Z4H A;  1S6C A;  3S0B A;  2ZKM X;  3DVM A;  5J3X A;  1FW4 A;  1TNP A;  1XYD A;  4A4C A;  2WCB A;  4OCI A;  4L9M A;  2KYF A;  5KTY A;  3TDI A;  2F33 A;  2WOS A;  1WY9 A;  2FOT A;  2I2R E;  3MSE B;  1GM0 A;  3SJS A;  1S6J A;  1KQV A;  2Y1M A;  3O78 A;  1TNW A;  4XJK B;  2VRG A;  2ZNE A;  2LP2 A;  3BOW A;  2WCK A;  1G4Y R;  1KFX S;  1UHJ A;  1K9P A;  1OW4 A;  2FJU B;  3ICB A;  3OX5 A;  3GK4 X;  4GAO A;  2LMV A;  2MHH A;  4IL1 A;  2M7N A;  1PK0 D;  2P70 A;  3CZT X;  4I5J A;  1SW8 A;  1UWO A;  2ISD A;  4HRG A;  1SL7 A;  1XFZ O;  1XK4 C;  3JVT C;  1RTP 1;  4M2P A;  1JF0 A;  3AKB A;  1QTX A;  3FE6 A;  3I5I C;  2M97 A;  3R1O A;  1SYM A;  1NYA A;  2ZN9 A;  2BKH B;  2WCM A;  3LCP C;  4I5N B;  1BJF A;  2L4I A;  2PRU A;  1Y1U A;  1F4O A;  3L4A A;  2Y5I A;  2FCE A;  2LMT A;  5EL2 A;  1DT7 B;  1MQ1 A;  1BR4 B;  4UPG A;  1YVH A;  5DKR A;  1EG3 A;  1AJ4 A;  2JTT A;  3OHM B;  4MLW A;  1IJ6 A;  4USL A;  4ZCU A;  1BOD A;  3L4L A;  1OOI X;  4I5L B;  5I2O A;  1CFP A;  3I5F C;  1SL9 A;  4NDD A;  4WQ3 A;  3A8R A;  4FQO A;  2AMI A;  1S5G Z;  1DMO A;  1B47 A;  1AHR A;  1W7I B;  2WCE A;  4PE0 A;  1FF1 A;  1WDC B;  1QXP A;  1FI5 A;  2HF5 A;  4D1E A;  3BQ3 A;  4CFQ A;  1J1E A;  1OOJ A;  1HQV A;  1B4C A;  4CPV A;  1ORG A;  1UHH A;  1OOG A;  2A4J A;  2KI6 C;  4NDC A;  4IJ7 A;  1KK7 Y;  3OP0 A;  1RFJ A;  5KU1 A;  1YUU A;  3D76 A;  2OS8 B;  3E3R A;  4DRW A;  3EVU A;  1Y1A A;  1LA3 A;  1OQP A;  2QPT A;  3PAT A;  1U5I A;  4GUK A;  1W7J B;  2G9B A;  4INW A;  5IBW A;  2H2K A;  1SSE B;  5DKN A;  3TZ1 A;  5D69 A;  1XFR A;  1ODB A;  4YI9 A;  1NWD A;  2KFG A;  2GGM A;  2KFF A;  4PE7 A;  3PFV A;  3CTN A;  3DF0 B;  2EC6 C;  2HET A;  1CDL A;  2KHN A;  1B7T Y;  3BXK A;  2TN4 A;  1DEL A;  1RK9 A;  1K2H A;  1J55 A;  1SR6 B;  1YX7 A;  1BF5 A;  2M29 A;  1QLK A;  3SIA A;  3D77 A;  4PHK A;  2F2P A;  3JTD B;  2AUC A;  1DJZ A;  2LM5 A;  4PHJ A;  3BUO B;  1CM1 A;  1KFU L;  3BYA A;  1XA5 A;  3EK4 A;  3FS7 A;  4P2Y B;  2EGD A;  2LLT A;  4MVF A;  3VRP A;  1QIV A;  2NCO A;  3IF7 A;  1QV0 A;  4MEW A;  3AAJ A;  2Q91 A;  1BG1 A;  1SL8 A;  1LIN A;  1QAT A;  1NSH A;  2M1K B; 
#chains in the Genus database with same CATH homology
 2MLE C;  2K7B A;  2MRD A;  2JU0 A;  1TOP A;  2O5G A;  4PAL A;  1DJH A;  2RGI A;  5FYX A;  1XFV O;  1A75 A;  1HT9 A;  2CNP A;  4ETO A;  4JQ0 D;  2F3Y A;  2PAL A;  1RJV A;  1TCF A;  1K94 A;  1YUS A;  3CR2 A;  5I2L A;  1CMG A;  1CFF A;  1B8L A;  3F45 A;  3SG4 A;  5HYD A;  1K9K A;  2WCF A;  3PN7 C;  4NDB A;  1UUR A;  5CSI A;  4C0K A;  1A2X A;  3BUW B;  1QV1 A;  1DGV A;  4BY5 A;  2I94 A;  3JVT B;  2JNX A;  2OPO A;  1DTL A;  1IGV A;  1XFW O;  3I5I B;  1KCY A;  4MRY A;  1SMG A;  3CS1 A;  2JT0 A;  2NLN A;  2M9G A;  3VRN A;  5K89 A;  2JRF A;  1YRU B;  4I5K A;  1R2U A;  2BE6 A;  2D8N A;  4N5X A;  2KGB C;  3AAK A;  2IS9 A;  1CLL A;  2L2E A;  1NPQ A;  4PE1 A;  1G33 A;  3I5F B;  2BKI B;  1WLZ A;  4OV2 A;  1DJW A;  2ZN8 A;  1QX2 A;  3BOW B;  3NXA A;  4MRX A;  5AEQ A;  4MBE A;  1TTX A;  2NXQ A;  2LVK A;  2M8U A;  2BCX A;  1KFX L;  1TRF A;  1DJX A;  5ER5 A;  4DIR A;  1WRZ A;  1IWQ A;  2F8P A;  1KK8 C;  2LVV A;  5AER A;  2MLF C;  1XVJ A;  3KEV A;  2LLU A;  2R2I A;  4PE4 A;  4AOM A;  2K8M B;  1SK6 D;  1R6P A;  3HCM A;  4YGE B;  1EJ3 A;  1LVC D;  3NSL A;  5JJG A;  1ALV A;  1IJ5 A;  1PRW A;  2JXC A;  2KAX A;  2BCB A;  2L5X B;  2LCP A;  1MUX A;  1OSA A;  1QVI Z;  2H61 A;  3EVR A;  5AFP A;  3D0Y A;  1SRA A;  5PAL A;  3K21 A;  1K95 A;  3TS5 C;  2K61 A;  2L98 A;  1BMO A;  2E30 A;  3VRO A;  2BBN A;  1YX8 A;  1RWY A;  5AAN A;  1K8U A;  1N0Y A;  2LAP A;  2EC6 B;  4C0L A;  2I18 A;  2EHB A;  1DVI A;  4ORB B;  2L0P A;  2GGZ A;  1AK8 A;  2BL0 C;  1M31 A;  4CID A;  5HKY A;  4NQG A;  2MBX A;  2JNF A;  2LLS A;  1B9A A;  1UUS A;  1EL4 A;  3BUX B;  4HRH A;  2KOT A;  1CLM A;  3DVJ A;  1SCM C;  1UP5 A;  4YGA A;  3RM1 A;  4YRU A;  1JWD A;  4CFR A;  2KGR A;  1K90 D;  2H61 C;  1OMR A;  4QJ4 B;  1U5I B;  4F0Z B;  4MZJ A;  1NX2 A;  3CGA A;  1N65 A;  4AQI A;  1NCY A;  1EXR A;  1JFK A;  2V53 A;  3FWC A;  2MJW B;  3H4S E;  1CKK A;  3CLN A;  3I5G C;  1ZUZ A;  1SCV A;  2BE4 A;  1KSM A;  4GGN A;  3TDZ A;  5ER4 X;  1NUB A;  2M3W A;  1MHO A;  1YRT B;  2O60 A;  2B1U A;  2KNE A;  3EK8 A;  1JF2 A;  5KSZ A;  1G8I A;  3IQQ A;  1XFY O;  1PSB A;  1Q80 A;  1S36 A;  2CXJ A;  1F8H A;  3PN7 B;  1K9U A;  1IQ5 A;  2KAY A;  5D7F A;  1F70 A;  4HRE E;  1QAS A;  3C1V A;  4ZCV A;  2KI6 D;  2BCA A;  2OTG C;  1F71 A;  2WND A;  3RLZ A;  1IKU A;  1DGU A;  1C7W A;  2ZRT A;  3NSO A;  2KQ6 A;  3FIA A;  4YGB B;  1L7Z A;  1A03 A;  1C7V A;  1F55 A;  1CM4 A;  3WHU B;  1H4B A;  4WRI A;  2K0J A;  1A75 B;  1OZO A;  3SG7 A;  3ZWH A;  1SPY A;  2JPT A;  2LHI A;  3PSR A;  2F3Z A;  1CMF A;  4MN0 A;  2JXL A;  2KDH A;  2FCD A;  1AVS A;  2K2F A;  1LA0 A;  1UHN A;  2KFH A;  4QJ5 B;  3SG3 A;  5JOL A;  2JT3 A;  1UHI A;  1CFC A;  1BT6 A;  1ZOT B;  2I7A A;  5HLV A;  1KK8 B;  1SBJ A;  3EK7 A;  1NIW A;  3IQO A;  1SY9 A;  4YI8 A;  2PMY A;  1GJY A;  1PVB A;  2Y4Q A;  1KK7 Z;  3GK1 A;  1PSR A;  1M63 B;  1XFX O;  2L4H A;  4HSZ A;  3EKH A;  3OB2 B;  3TDU A;  4GPL B;  1NX1 A;  2LP3 A;  2LMU A;  1KQM C;  3CWG A;  4N1F A;  2K7C A;  3VGO A;  2KI4 C;  1JFJ A;  2WOR A;  3CR4 X;  1JUO A;  4QJ3 B;  2JUL A;  3TS5 B;  4U8D A;  2DOQ A;  3SG6 A;  1NCX A;  1LKJ A;  3AKA A;  3TUY C;  1B7T Z;  1GGW A;  1J7Q A;  2SCP A;  2WC8 A;  1M39 A;  1M45 A;  3QRX A;  1QIW A;  1K93 D;  2ZND A;  3ZNI A;  1MXL C;  2LC5 A;  3I5H C;  4OVN F;  1AJ5 A;  4DCK A;  2BL0 B;  5I8N A;  2PSR A;  2KQY A;  2M49 B;  3DD4 A;  4PCW A;  4TNC A;  4GFT A;  1V1G A;  1S6I A;  3WNX B;  3DVE A;  1CTR A;  1SCM B;  1Y1X A;  2P6B B;  1LXF C;  1A29 A;  1S5G Y;  3D0Y B;  5CSN A;  2KSP A;  3LK0 A;  3CR5 X;  4R1E A;  2PAS A;  2JZI A;  1NX3 A;  3I5G B;  1PVA A;  4PDZ A;  4PHN A;  5B8I B;  5HKW A;  1DJG A;  1L2O C;  3OX6 A;  1N2D A;  1YR5 A;  2KYC A;  1FI6 A;  1JSA A;  1B8C A;  1VRK A;  1KSO A;  1XO5 A;  2AAO A;  3GK2 A;  1F4Q A;  2LAN A;  1QLS A;  4M2Q A;  1KWO C;  1TCO B;  2NCP A;  1REC A;  5HLO A;  4A4B A;  3O2P A;  4Q04 A;  2SAS A;  5AXI A;  5F6T A;  4N1G A;  3SIB A;  1OMD A;  1QS7 A;  2LVI A;  2OTG B;  3BUN B;  2JOJ A;  4XJK A;  3GOF A;  1IRJ A;  1OE9 B;  1ALW A;  2KBM A;  4E68 A;  1NP8 A;  2QAC A;  1NX0 A;  2JQ6 A;  3O4Y A;  1K96 A;  4XYN A;  4AQJ A;  4WQ2 A;  1TNX A;  4YGC B;  1F54 A;  1YUT A;  2LUC A;  3KF9 A;  4MZL A;  4MZK A;  3LLE A;  2L50 A;  1ZMZ A;  5HKZ A;  4PHM A;  2M7L A;  1WLM A;  4P5O E;  1MWN A;  2LVJ A;  1PAL A;  1X02 A;  2BEC A;  2K7D A;  1BOC A;  1YTZ C;  2BBM A;  2ZFD A;  2Q4U A;  3EVV A;  1PUL A;  1IH0 A;  1QJT A;  2LHL A;  1DF0 B;  1OZS A;  1TIZ A;  2ZRS A;  5G08 A;  2GV5 A;  3FWB A;  1YUR A;  3SG2 A;  1E8A A;  3D10 A;  3LL8 B;  1H8B A;  1AUI B;  3NSI A;  1KQM B;  3SG5 A;  1DF0 A;  1Y6W A;  2KI4 B;  5I2Q A;  2HQW A;  4ICB A;  2F2O A;  3KO0 A;  2CCM A;  1CDP A;  2JTZ A;  2MA2 A;  4FTG A;  3TUY B;  2CT9 A;  1M46 A;  1B1G A;  3EKJ A;  5GQQ C;  1CDM A;  1BLQ A;  1UHK A;  2HPS A;  1JBA A;  3KPX A;  3NSK A;  3I5H B;  3LK1 A;  1SKT A;  3HX4 A;  1V1F A;  3WXA A;  2KBI A;  5CSJ A;  1C07 A;  1CNP A;  1FPW A;  1DJI A;  4JPZ B;  4ORC B;  1EG4 A;  5CPV A;  4DS7 A;  2K2A A;  2LE9 B;  1A4P A;  4GBA A;  4DUQ A;  3DF0 A;  5BPJ A;  4M2O A;  1B8R A;  5CSF A;  4ORA B;  1S26 D;  1BU3 A;  1CB1 A;  2K7O A;  1ZFS A;  1QX7 A;  3A4U B;  1CFD A;  1ZAC A;  2NZ0 A;  3PAL A;  3OB1 B;  1WDC C;  4YBH B;  1KFU S;  2M1U A;  1SNL A;  3VRQ A;  1GGZ A;  2MAZ A;  4OR9 B;  1MR8 A;  1IQ3 A;  4GGF A;  3PLF B;  2JWW A;  1Y0V H;  2LUX A;  1MF8 B;  1WRK A;  3PM8 A;  1AP4 A;  1S3P A;  1L2O B;  1BR1 B;  2PVB A;  1NCZ A;  1MXE A;  1EH2 A;  3KHE A;  3WHT B;  2OS8 C;  4JWQ A;  1OMV A;  2L51 A;  2LNK A;  4CLN A;  2JT8 A;  2Y1N A;  2CBL A;  1KWO B;  1TNQ A;  1QVI Y;  5DKQ A;  1J7R A;  1J7P A;  1QX5 B;  1RRO A;  2JC2 A;  2HQ8 A;  3M0W A;  2G2B A;  3VRR A;  1D1O A;  1S1E A;  1CLB A;  4MSP A;  1CDN A;  2CTN A;  1GQM A;  1SR6 C;  1J7O A;  1YVL A;  1J1D A;  2COL B;  2E6W A;  3JTD C;  1WRL A;  4OKH A;  1IG5 A;  1TN4 A;  2KAV A;  2M0R A;  4C0J A;  1DJY A;  4GNK B;  3DVK A;  1FBV A;  4GGF C;  4BY4 A;  1XFU O;  3BUM B;  3O6B A;  1XK4 A;  2LV7 A;  5TNC A;  4YGD B;  1S6C A;  2ZKM X;  3DVM A;  5J3X A;  1FW4 A;  1TNP A;  1XYD A;  4A4C A;  2WCB A;  4OCI A;  4L9M A;  2KYF A;  5KTY A;  3TDI A;  2F33 A;  2WOS A;  1WY9 A;  2FOT A;  2I2R E;  3MSE B;  3SJS A;  1S6J A;  1KQV A;  2Y1M A;  3O78 A;  1TNW A;  4XJK B;  2VRG A;  2ZNE A;  2LP2 A;  3BOW A;  1G4Y R;  1KFX S;  1UHJ A;  1K9P A;  2FJU B;  3ICB A;  3OX5 A;  4GAO A;  3GK4 X;  2LMV A;  2MHH A;  4IL1 A;  2M7N A;  1PK0 D;  3CZT X;  4I5J A;  1SW8 A;  1UWO A;  2ISD A;  4HRG A;  1SL7 A;  1XFZ O;  1XK4 C;  3JVT C;  1RTP 1;  4M2P A;  1JF0 A;  3AKB A;  1QTX A;  1JC2 A;  3I5I C;  2M97 A;  1SYM A;  1NYA A;  2ZN9 A;  2BKH B;  3LCP C;  4I5N B;  1BJF A;  2L4I A;  2PRU A;  1Y1U A;  1F4O A;  1DT7 B;  2Y5I A;  2FCE A;  2LMT A;  1MQ1 A;  1BR4 B;  4UPG A;  1YVH A;  5DKR A;  1EG3 A;  1AJ4 A;  2JTT A;  3OHM B;  4MLW A;  1IJ6 A;  4USL A;  4ZCU A;  1BOD A;  1CFP A;  4I5L B;  5I2O A;  3I5F C;  1SL9 A;  4NDD A;  4WQ3 A;  3A8R A;  4FQO A;  2AMI A;  1S5G Z;  1DMO A;  1B47 A;  1AHR A;  1W7I B;  2WCE A;  4PE0 A;  1FF1 A;  1WDC B;  1QXP A;  1FI5 A;  2HF5 A;  4D1E A;  3BQ3 A;  4CFQ A;  1J1E A;  1OOJ A;  1HQV A;  1B4C A;  4CPV A;  1UHH A;  2KI6 C;  2A4J A;  4NDC A;  1KK7 Y;  3OP0 A;  1RFJ A;  5KU1 A;  1YUU A;  3E3R A;  2OS8 B;  4DRW A;  3EVU A;  1Y1A A;  1LA3 A;  1OQP A;  2QPT A;  3PAT A;  1U5I A;  4GUK A;  1W7J B;  2G9B A;  5IBW A;  2H2K A;  5DKN A;  3TZ1 A;  5D69 A;  1ODB A;  4YI9 A;  1NWD A;  2KFG A;  2GGM A;  2KFF A;  4PE7 A;  3PFV A;  3CTN A;  3DF0 B;  2EC6 C;  2HET A;  1CDL A;  2KHN A;  1B7T Y;  3BXK A;  2TN4 A;  1RK9 A;  1K2H A;  1J55 A;  1SR6 B;  1YX7 A;  1BF5 A;  2M29 A;  1QLK A;  3SIA A;  4PHK A;  2F2P A;  3JTD B;  2AUC A;  1DJZ A;  2LM5 A;  4PHJ A;  3BUO B;  1CM1 A;  1KFU L;  3BYA A;  1XA5 A;  3EK4 A;  3FS7 A;  4P2Y B;  2EGD A;  2LLT A;  4MVF A;  3VRP A;  1QIV A;  2NCO A;  3IF7 A;  1QV0 A;  4MEW A;  3AAJ A;  2Q91 A;  1BG1 A;  1SL8 A;  1LIN A;  1QAT A;  1NSH A;  2M1K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...