1FI5A

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (TROPONIN C)
publication title Solution structures of the C-terminal domain of cardiac troponin C free and bound to the N-terminal domain of cardiac troponin I.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi5A00
1L7ZA 1ZUZA 4YGCB 1QIVA 1OMVA 1SR6C 5TNCA 4DS7A 3BXKA 2M9GA 4DRWA 1K9UA 2GGZA 2F2PA 3OP0A 1KFXS 2MBXA 1FI5A 1G8IA 1QLSA 2MA2A 1ODBA 2WCFA 1QXPA 2KHNA 2L2EA 1FBVA 2KYFA 3PALA 2OS8C 2WORA 2M1UA 2JT0A 3TZ1A 1D1OA 1S36A 1JBAA 3E3RA 5I2OA 1JFKA 3IQOA 3SG7A 1SYMA 4MZLA 1H8BA 1QLKA 1Y0VH 4IL1A 3CWGA 4N1GA 1NX3A 2JT3A 1NIWA 1QVIZ 4GFTA 2M49B 2KFGA 4XYNA 1BR4B 2LLSA 3VRRA 2MHHA 3O4YA 1RTP1 2LLUA 1SBJA 3VROA 1IG5A 1R6PA 2GGMA 2HQWA 4PALA 4USLA 1CDPA 2F33A 2KNEA 4ORAB 4ORCB 3CTNA 1OMRA 2HQ8A 2KFFA 3TS5B 2AUCA 3SJSA 4Q04A 1M46A 1QVIY 2R2IA 1N65A 3LLEA 5HKWA 2PMYA 2M1KB 1XO5A 4YI9A 3LK0A 1DMOA 2OTGB 1YRTB 1AVSA 1K96A 1RWYA 2MJWB 1MWNA 3DF0B 2M7NA 4C0KA 2M97A 4PHMA 1E8AA 4JWQA 1ZMZA 1K9KA 3BUOB 2JNXA 4PCWA 1AHRA 1F70A 3FS7A 2CNPA 2LMUA 1RECA 3EKJA 1Y1XA 2WCBA 3OB2B 4NDDA 3D10A 3FIAA 4YGAA 1C7VA 1K95A 4UPGA 1QX5B 4M2OA 5AFPA 1JSAA 1SR6B 1MUXA 4D1EA 1QS7A 1NX0A 2BKHB 2D8NA 3D0YA 4ORBB 4YGDB 1QATA 2M8UA 1DJYA 4I5LB 1TCFA 2LM5A 1EXRA 3NSIA 2MRDA 1KCYA 3SG3A 1BF5A 3GK1A 3BOWB 3SG4A 3NXAA 2JQ6A 2KI6D 1NWDA 4OR9B 2PALA 1PALA 3KF9A 4PHKA 1BODA 3DD4A 1RK9A 4AQJA 1TCOB 5I2LA 1SNLA 1S26D 1A75A 2ZFDA 5DKQA 5CSFA 1SKTA 4NDCA 3VRNA 2FCDA 2KBIA 5KTYA 1F4OA 2P6BB 1NX1A 1UP5A 1K8UA 3PN7C 1CM1A 1TTXA 4MVFA 1NUBA 1SL8A 1M31A 3VRQA 1H4BA 4MRYA 2LUCA 1B4CA 2KAVA 3JTDC 1DF0B 1QX7A 1SL7A 2G2BA 1TNWA 2NLNA 4HSZA 5FYXA 4ZCVA 3AAJA 5ER4X 2LCPA 2DOQA 3RLZA 3I5HC 3K21A 1L2OC 4AQIA 1K2HA 2K7OA 2MAZA 4GPLB 2LVIA 1KK7Z 4WQ2A 1XYDA 3EVUA 1W7IB 2PSRA 3I5FB 4WRIA 1KFUL 4GGNA 1DJHA 1NX2A 2COLB 2LE9B 4P5OE 1RFJA 1SCVA 4XJKB 1TNQA 2BCXA 1YVLA 2ZRSA 1CM4A 1XFZO 1AUIB 2LLTA 5AXIA 2OTGC 2LAPA 4R1EA 1F55A 1IH0A 1U5IB 2ZNEA 4C0LA 1A03A 1LA0A 3GK2A 2LHLA 3BUNB 1M39A 3TUYC 1BR1B 4FTGA 3HCMA 2H61A 3O6BA 5AERA 1KK7Y 2M29A 3I5GC 1WRZA 4GBAA 4MN0A 1AP4A 1XFWO 3BUMB 5CPVA 1KQVA 1WLMA 1YUUA 1XFVO 2F3ZA 2WNDA 4CFRA 5J3XA 3PSRA 3ICBA 2L4HA 4ETOA 3DF0A 4MLWA 1ZACA 1LVCD 1FF1A 1YUTA 1WLZA 3DVKA 2QPTA 3CZTX 3SIAA 2Y5IA 3CR4X 1F4QA 1WRKA 2K7DA 1UHNA 2EC6C 1JFJA 4BY4A 2JTZA 1KK8B 3NSOA 2M7LA 4JQ0D 1SCMB 1QV0A 2GV5A 1HT9A 1CDMA 3PN7B 4CFQA 2KSPA 1QTXA 1PSBA 3VRPA 2KBMA 1JC2A 2Q4UA 3JTDB 3JVTC 1PRWA 4PHNA 2ISDA 1C07A 1M45A 3BOWA 1WY9A 4CIDA 3KPXA 2LNKA 3CR2A 4MBEA 1DGVA 3I5HB 1DJXA 5PALA 1J7QA 1L2OB 4PE0A 3IQQA 1RJVA 3C1VA 4I5KA 1PVAA 2LHIA 5HKYA 3TDIA 4OVNF 1TRFA 3EK4A 2BECA 1YURA 4MZJA 1J7RA 3EVVA 2MLEC 4HRGA 1XFUO 1F71A 3I5FC 1A29A 1A2XA 1Y6WA 1N2DA 2LVKA 1KWOC 1DGUA 2LP2A 2L4IA 1DF0A 1G4YR 1HQVA 4P2YB 1QV1A 2HETA 1NSHA 1DJGA 4PDZA 3TUYB 1ZFSA 1CMGA 2BBNA 5HLOA 4GGFC 2BE4A 4QJ3B 5KU1A 1TIZA 1B7TZ 2MLFC 3I5GB 2I2RE 1B9AA 1NP8A 1XFXO 3VGOA 3O78A 2LV7A 1IKUA 2NZ0A 2AAOA 1S5GZ 3BYAA 2BBMA 3TDZA 1Q80A 2E6WA 5D69A 4QJ5B 4HRHA 1S6CA 1XK4C 3DVMA 1BG1A 2O60A 2Y4QA 4BY5A 2QACA 4MEWA 1TNXA 2G9BA 3WNXB 1TN4A 1SRAA 1ZOTB 1QX2A 2K7CA 1U5IA 3DVJA 1IGVA 1OSAA 1CFPA 1B7TY 1OZSA 2K0JA 1AJ4A 1FW4A 1QASA 2EHBA 1IWQA 1PVBA 1S3PA 1S6IA 3PM8A 1F8HA 2EC6B 2L5XB 4GAOA 4M2PA 1S5GY 2BCBA 1JF2A 3LK1A 2F8PA 4GUKA 1KK8C 1K90D 3FWBA 2OPOA 1RROA 3KO0A 1SCMC 2ZRTA 1J55A 2F2OA 2PRUA 1DTLA 1TOPA 2RGIA 4DIRA 3WHTB 3A4UB 3CGAA 3JVTB 1K94A 2M0RA 1CDNA 4DCKA 2JXLA 4MSPA 3DVEA 4TNCA 1PK0D 1GJYA 1XA5A 5BPJA 1LKJA 1DT7B 5HLVA 1BT6A 3A8RA 1SL9A 2JXCA 1M63B 5DKRA 1F54A 3H4SE 1NPQA 1V1GA 1PSRA 5I8NA 4JPZB 3EK8A 1AJ5A 2FOTA 5JJGA 1J7PA 1G33A 1OOJA 2VRGA 2E30A 2JT8A 1CLLA 1TNPA 2SASA 1OMDA 1KWOB 2H2KA 1MR8A 3SG6A 2WOSA 1EH2A 2L50A 4I5NB 4OV2A 5GQQC 4YGEB 1OE9B 2L98A 3SIBA 1AK8A 2JNFA 1WDCC 1NCYA 2EGDA 1S6JA 1EG4A 1UUSA 4GNKB 3FWCA 1B8LA 1B1GA 2JU0A 2KYCA 2LANA 4NDBA 4ZCUA 2M3WA 2FJUB 1OZOA 3D0YB 3EK7A 3QRXA 5IBWA 2L0PA 1UHJA 2BL0C 2A4JA 3LCPC 1K9PA 1CFDA 3O2PA 2JTTA 2Q91A 2KGBC 3BUWB 3EKHA 2CXJA 1MQ1A 2JPTA 2ZNDA 4HREE 4QJ4B 3I5IC 2LC5A 1FPWA 2JOJA 2TN4A 2BE6A 4YI8A 3OHMB 1IQ5A 1MHOA 2Y1MA 2SCPA 1YX8A 4NQGA 1EG3A 1CTRA 2FCEA 1KFUS 1DJZA 4N5XA 5K89A 2KAXA 1B8RA 2I18A 2K61A 5DKNA 1Y1UA 1K93D 1DJIA 4PHJA 1KQMB 1YRUB 1MXEA 5D7FA 3IF7A 1CFFA 1ALWA 1J7OA 3PLFB 1GGZA 2WC8A 4C0JA 2KI6C 4MZKA 1UHHA 4A4CA 1NCZA 2KOTA 1CDLA 1CNPA 1W7JB 4MRXA 2BCAA 2ZN9A 2NCPA 5B8IB 1XFYO 1CMFA 2JULA 2HPSA 2CTNA 2Y1NA 3AKBA 1BJFA 3HX4A 1WDCB 1UWOA 1LINA 4WQ3A 1YR5A 5G08A 2JWWA 1JF0A 5I2QA 1XVJA 1UHIA 3KHEA 1SPYA 1B47A 2BKIB 4YRUA 2BL0B 2LVJA 3GOFA 2LP3A 3CLNA 3ZNIA 3WHUB 4FQOA 1JWDA 2IS9A 4XJKA 1QIWA 2KQYA 2JRFA 2PASA 1A4PA 2I94A 2K2FA 4AOMA 3I5IB 2F3YA 3BQ3A 2NXQA 2ZKMX 4GGFA 5AANA 2WCEA 2NCOA 1SMGA 1KSOA 2KI4C 3PFVA 4ICBA 1IQ3A 5CSJA 3CS1A 4YGBB 1KSMA 3AKAA 1XK4A 1BMOA 3OX6A 1YUSA 2K8MB 1GQMA 2AMIA 1DVIA 1IRJA 2B1UA 1YX7A 2KQ6A 4A4BA 1SW8A 2KAYA 1KQMC 3CR5X 4DUQA 2OS8B 1CKKA 1CFCA 1LA3A 3OB1B 2K2AA 1QJTA 3SG5A 1MXLC 1NCXA 2CCMA 4YBHB 5CSNA 3M0WA 3MSEB 3OX5A 5F6TA 3TDUA 4OKHA 3ZWHA 1WRLA 1V1FA 2JC2A 3SG2A 1ALVA 1OQPA 3NSKA 5KSZA 2ZN8A 2JZIA 2CT9A 2K7BA 2L51A 3LL8B 1NYAA 4CLNA 5ER5A 1KFXL 1VRKA 3EVRA 2LUXA 1IJ5A 1R2UA 1X02A 1IJ6A 3KEVA 1EL4A 4CPVA 1BLQA 1S1EA 1GGWA 1BU3A 3NSLA 3GK4X 1J1EA 1N0YA 2KFHA 2H61C 4PE7A 2V53A 3TS5C 4F0ZB 5HYDA 1BOCA 2LMVA 3WXAA 4U8DA 3AAKA 1CLBA 1UURA 4E68A 1CB1A 1MF8B 5JOLA 2KGRA 2LVVA 3PATA 4N1FA 4PE1A 1B8CA 1JUOA 2PVBA 5AEQA 1PULA 1YVHA 1J1DA 2O5GA 1SK6D 1Y1AA 1LXFC 5CSIA 4L9MA 4I5JA 2KDHA 1CLMA 2I7AA 4PE4A 3BUXB 1FI6A 1EJ3A 1SY9A 4OCIA 1DJWA 2KI4B 2LMTA 3RM1A 1A75B 1YTZC 3F45A 1C7WA 4M2QA 5HKZA 2CBLA 1UHKA 2HF5A
chains in the Genus database with same CATH superfamily
1L7ZA 1ZUZA 4YGCB 1GM0A 1QIVA 1OMVA 1T14A 1SR6C 5TNCA 4DS7A 3IVTA 3BXKA 2M9GA 4DRWA 1K9UA 2GGZA 2F2PA 3OP0A 1KFXS 2MBXA 1FI5A 1G8IA 1QLSA 2MA2A 1ODBA 2WCFA 1QXPA 1OOIX 2KHNA 2L2EA 4FQTA 1FBVA 2KYFA 3PALA 3D77A 2OS8C 2WORA 1DQEA 2M1UA 2K60A 2JT0A 3TZ1A 2QEHA 3K1EA 1S36A 1D1OA 1JBAA 3E3RA 5I2OA 1JFKA 3IQOA 3SG7A 1SYMA 4MZLA 1H8BA 1QLKA 1Y0VH 4IL1A 3CWGA 4N1GA 1NX3A 2JT3A 1NIWA 1QVIZ 4GFTA 2M49B 1OOHA 2KFGA 4XYNA 1BR4B 2LLSA 3VRRA 2MHHA 3O4YA 1RTP1 2LLUA 2JPOA 2WC6A 1SBJA 3VROA 1IG5A 1R6PA 2GGMA 2HQWA 3B6XA 4PALA 4USLA 1CDPA 2F33A 2KNEA 4ORAB 4ORCB 3CTNA 1OMRA 2HQ8A 2KFFA 1DELA 3TS5B 2AUCA 3D74A 3SJSA 4Q04A 1OOGA 1M46A 1QVIY 2R2IA 1N65A 3LLEA 5HKWA 3NHIA 2PMYA 3CZ2A 2M1KB 1XO5A 5FI2A 4YI9A 3LK0A 4KYNA 1DMOA 2OTGB 1YRTB 1AVSA 2L5YA 1K96A 1RWYA 2MJWB 1MWNA 3DF0B 2M7NA 4OZDA 4C0KA 2M97A 4PHMA 1E8AA 1C3YA 4JWQA 1ZMZA 1K9KA 3BUOB 2JNXA 4PCWA 1AHRA 3S0EA 1F70A 3FS7A 2CNPA 2LMUA 1RECA 3BFAA 1Y1XA 2WCBA 3EKJA 3OB2B 3D10A 3FIAA 3OBVA 4NDDA 1K95A 4YGAA 1C7VA 4UPGA 1QX5B 4M2OA 5AFPA 1JSAA 1SR6B 1MUXA 4D1EA 1QS7A 1NX0A 2BKHB 2D8NA 3D0YA 4ORBB 4YGDB 1QATA 2M8UA 1DJYA 4I5LB 1TCFA 2LM5A 3N7HA 1EXRA 3NSIA 2MRDA 1KCYA 3SG3A 2PYQA 1BF5A 3GK1A 3BOWB 3SG4A 3NXAA 2JQ6A 2KI6D 1NWDA 3L47A 4OR9B 2PALA 1PALA 3KF9A 4PHKA 5I94A 1BODA 3FE6A 3DD4A 1RK9A 1SSEB 4AQJA 1TCOB 5I2LA 1SNLA 1S26D 1A75A 2ZFDA 5DKQA 5CSFA 1SKTA 4NDCA 3VRNA 2FCDA 2KBIA 5KTYA 1F4OA 2P6BB 5D3OA 1NX1A 1UP5A 1K8UA 3PN7C 1CM1A 1TTXA 4MVFA 1NUBA 1SL8A 1M31A 3VRQA 1H4BA 4MRYA 2LUCA 1B4CA 2KAVA 3JTDC 1DF0B 1QX7A 1SL7A 2G2BA 1TNWA 1DEKA 2NLNA 4HSZA 5FYXA 2GTEA 4JKTA 4ZCVA 3AAJA 3S0GA 5ER4X 2LCPA 2DOQA 3DZTA 3RLZA 3I5HC 3K21A 1L2OC 4AQIA 1K2HA 2K7OA 2MAZA 4GPLB 4INWA 2LVIA 3SS3A 1KK7Z 4WQ2A 1XYDA 3EVUA 1W7IB 2PSRA 3I5FB 4WRIA 1KFUL 4GGNA 1DJHA 1NX2A 1TWOA 2COLB 2LE9B 4P5OE 1RFJA 1SCVA 4XJKB 1TNQA 2BCXA 1YVLA 2ZRSA 1CM4A 1XFZO 1AUIB 2LLTA 5AXIA 2OTGC 2LAPA 4R1EA 1F55A 1IH0A 1U5IB 2ZNEA 4C0LA 1A03A 1LA0A 3D73A 2LHLA 3BUNB 1M39A 3GK2A 3UO9A 3TUYC 1BR1B 4FTGA 3HCMA 2H61A 3O6BA 5AERA 1KK7Y 2M29A 3EG5B 3I5GC 1WRZA 4GBAA 3O4XA 4MN0A 1AP4A 1XFWO 3BUMB 5CPVA 1KQVA 1WLMA 3PJIA 1YUUA 1XFVO 2F3ZA 2WNDA 4CFRA 2P71A 5J3XA 3PSRA 3ICBA 2L4HA 3SS5A 1IIOA 4ETOA 3DF0A 4MLWA 1ZACA 1LVCD 1FF1A 1YUTA 1WLZA 2KPHA 3DVKA 2QPTA 3CZTX 3SIAA 2WCKA 2Y5IA 3CR4X 1F4QA 1WRKA 2K7DA 1UHNA 3UNWA 2EC6C 2KLEA 1JFJA 3VB1A 4BY4A 2JTZA 1KK8B 3NSOA 2M7LA 4JQ0D 1SCMB 1QV0A 2P70A 2GV5A 1HT9A 1CDMA 3PN7B 4CFQA 1OOFA 2KSPA 1QTXA 1PSBA 3VRPA 2KBMA 1JC2A 2Q4UA 3NGVA 3JTDB 3JVTC 1PRWA 4PHNA 2ISDA 1C07A 4INXA 1M45A 3BOWA 1WY9A 4CIDA 3KPXA 2LNKA 3CR2A 2BAPA 4MBEA 1DGVA 3I5HB 1DJXA 5PALA 3S0DA 1L2OB 4PE0A 1J7QA 3IQQA 1RJVA 3C1VA 4I5KA 1PVAA 2LHIA 3CABA 5HKYA 1XFRA 3TDIA 4OVNF 1TRFA 3EK4A 2BECA 1YURA 4MZJA 1J7RA 2PQLA 3EVVA 2MLEC 4IJ7A 4HRGA 1XFUO 1F71A 3I5FC 1A29A 1A2XA 1TUJA 1Y6WA 1N2DA 2LVKA 1KWOC 1DGUA 2LP2A 2L4IA 1DF0A 3D75A 1G4YR 3NHTA 1HQVA 4P2YB 1QV1A 2HETA 1NSHA 1DJGA 4PDZA 3TUYB 1ZFSA 3S0FA 2BBNA 1CMGA 5HLOA 4GGFC 2BE4A 4QJ3B 5KU1A 1TIZA 1B7TZ 2ERBA 2MLFC 3SS4A 3I5GB 2I2RE 1B9AA 1NP8A 1XFXO 3VGOA 3O78A 2LV7A 1IKUA 2NZ0A 3DYEA 2AAOA 1S5GZ 3V2LA 3BYAA 1TUZA 2BBMA 3TDZA 1Q80A 2E6WA 5D69A 4QJ5B 4HRHA 1S6CA 1XK4C 3DVMA 4F7FA 1BG1A 2O60A 2Y4QA 1Z2CB 4BY5A 2QACA 4MEWA 1TNXA 2G9BA 3WNXB 1TN4A 1SRAA 1ZOTB 1QX2A 2K7CA 1U5IA 3DVJA 1IGVA 1OSAA 1CFPA 1B7TY 1OZSA 2K0JA 1AJ4A 1FW4A 1QASA 2EHBA 1IWQA 1PVBA 1S3PA 1S6IA 3PM8A 1F8HA 2EC6B 2L5XB 4GAOA 3R1PA 1S5GY 4M2PA 2BCBA 5FI7A 1JF2A 3LK1A 2F8PA 2QDIA 4GUKA 1KK8C 1K90D 3FWBA 2OPOA 1RROA 3KO0A 1SCMC 2ZRTA 1J55A 2F2OA 2PRUA 1DTLA 1TOPA 2RGIA 4DIRA 3WHTB 3A4UB 3CGAA 3JVTB 1K94A 2M0RA 1CDNA 4DCKA 2JXLA 1ORGA 4MSPA 3DVEA 4TNCA 3B86A 1PK0D 1GJYA 1XA5A 3L4LA 5BPJA 1LKJA 1DT7B 5HLVA 1BT6A 3A8RA 1SL9A 2JXCA 1M63B 5DKRA 1F54A 3H4SE 1NPQA 1V1GA 1PSRA 5I8NA 4JPZB 3EK8A 1AJ5A 2FOTA 3S0BA 5JJGA 1J7PA 1G33A 1OOJA 1OW4A 2VRGA 2E30A 2JT8A 1CLLA 1TNPA 2SASA 1OMDA 1KWOB 3R72A 2H2KA 1MR8A 3SG6A 2WOSA 1EH2A 2FJYA 2L50A 4I5NB 4OV2A 4YGEB 1OE9B 2L98A 3B88A 5GQQC 3SIBA 1AK8A 2JNFA 1WDCC 1NCYA 2EGDA 1S6JA 1EG4A 1C3ZA 1UUSA 3B87A 4GNKB 3FWCA 1B8LA 1B1GA 2JU0A 2KYCA 2LANA 4NDBA 3FE9A 4ZCUA 2M3WA 2FJUB 1OZOA 3D0YB 3EK7A 3QRXA 5IBWA 2L0PA 1UHJA 2BL0C 2A4JA 3LCPC 3D76A 1K9PA 3CZ0A 1CFDA 3O2PA 2JTTA 2Q91A 2KGBC 3BUWB 3EKHA 2CXJA 1MQ1A 2JPTA 2WC5A 2ZNDA 4HREE 4QJ4B 3I5IC 5EL2A 3Q8IA 2LC5A 1FPWA 2JOJA 2TN4A 2BE6A 4JD9A 2WCJA 4YI8A 3OHMB 1IQ5A 1MHOA 2Y1MA 2SCPA 1YX8A 4NQGA 1EG3A 1CTRA 2FCEA 2WCLA 1KFUS 1DJZA 4N5XA 3CYZA 3R1OA 5K89A 2KAXA 1B8RA 2I18A 2K61A 5FI6A 5DKNA 1Y1UA 1K93D 1DJIA 4PHJA 1KQMB 3CDNA 3FE8A 1YRUB 1MXEA 5D7FA 3PM2A 3IF7A 1CFFA 1ALWA 1J7OA 3D78A 3PLFB 2YGUA 1GGZA 2WC8A 2KLDA 4C0JA 1DC1A 2KI6C 2QEBA 3BFBA 4MZKA 1UHHA 4A4CA 1NCZA 2KOTA 1CDLA 1CNPA 1W7JB 4MRXA 2BCAA 2ZN9A 2NCPA 5B8IB 1XFYO 1CMFA 3DY9A 2JULA 2HPSA 2CTNA 2Y1NA 3RZSA 3AKBA 1BJFA 3HX4A 1WDCB 2WCHA 1UWOA 3BJHA 1LINA 3CZ1A 4WQ3A 1YR5A 5G08A 5HL1A 2JWWA 1JF0A 5I2QA 1XVJA 1UHIA 3KHEA 1SPYA 3DXLA 1B47A 2BKIB 2H8VA 4YRUA 2BL0B 2LVJA 3GOFA 2LP3A 3CLNA 3ZNIA 3WHUB 4FQOA 1JWDA 2IS9A 4XJKA 2L2CA 1QIWA 3B7AA 3R1VA 2KQYA 2JRFA 2PASA 1A4PA 2I94A 2K2FA 4AOMA 3I5IB 2F3YA 3OGNA 3BQ3A 2NXQA 2QEOA 1LS8A 2ZKMX 4GGFA 5AANA 2WCEA 2NCOA 1SMGA 3QMEA 1KSOA 2KI4C 3PFVA 4ICBA 1IQ3A 5CSJA 3CS1A 4YGBB 1KSMA 3AKAA 1XK4A 1BMOA 3OX6A 1YUSA 2K8MB 1GQMA 2AMIA 1DVIA 2WCMA 1IRJA 2B1UA 1YX7A 2KQ6A 4A4BA 1QWVA 1SW8A 2KAYA 1KQMC 3CR5X 4DUQA 2OS8B 3S0AA 1CKKA 1CFCA 2BNXA 1LA3A 3OB1B 2K2AA 1W9ZA 1QJTA 3SG5A 1MXLC 1NCXA 2CCMA 4YBHB 5CSNA 3M0WA 3MSEB 1Z4HA 3OX5A 5F6TA 3TDUA 4OKHA 3ZWHA 1WRLA 1V1FA 2JC2A 3SG2A 1ALVA 1OQPA 3NSKA 5KSZA 2ZN8A 2JZIA 2CT9A 2K7BA 2L51A 3LL8B 1NYAA 4CLNA 5ER5A 1KFXL 1VRKA 3EVRA 2LUXA 1IJ5A 1R2UA 1X02A 1IJ6A 3KEVA 1EL4A 4CPVA 5DICA 1BLQA 1S1EA 1GGWA 1BU3A 3NSLA 3GK4X 1J1EA 3L4AA 1N0YA 2KFHA 2H61C 3BFHA 2V53A 4PE7A 3TS5C 4F0ZB 5HYDA 2LMVA 1BOCA 3WXAA 4U8DA 3AAKA 1CLBA 1UURA 4E68A 1CB1A 1MF8B 5JOLA 2KGRA 2LVVA 3PATA 4N1FA 4PE1A 1B8CA 1JUOA 2PVBA 5AEQA 1PULA 1YVHA 1P28A 1J1DA 2O5GA 1SK6D 1Y1AA 1LXFC 5CSIA 4L9MA 4I5JA 2KDHA 1CLMA 2I7AA 4PE4A 3BUXB 1FI6A 1EJ3A 1SY9A 4OCIA 1DJWA 2KI4B 2LMTA 4PT1A 3RM1A 1A75B 1YTZC 3F45A 1C7WA 4M2QA 2QEVA 2CBLA 5HKZA 1UHKA 2HF5A
chains in the Genus database with same CATH topology
1L7ZA 1ZUZA 4YGCB 1QIVA 1OMVA 1SR6C 5TNCA 4DS7A 3BXKA 2M9GA 4DRWA 1K9UA 2GGZA 2F2PA 3OP0A 1KFXS 2MBXA 1FI5A 1G8IA 1QLSA 2MA2A 1ODBA 2WCFA 1QXPA 2KHNA 2L2EA 1FBVA 2KYFA 3PALA 2OS8C 2WORA 2M1UA 2JT0A 3TZ1A 1D1OA 1S36A 1JBAA 3E3RA 5I2OA 1JFKA 3IQOA 3SG7A 1SYMA 4MZLA 1H8BA 1QLKA 1Y0VH 4IL1A 3CWGA 4N1GA 1NX3A 2JT3A 1NIWA 1QVIZ 4GFTA 2M49B 2KFGA 4XYNA 1BR4B 2LLSA 3VRRA 2MHHA 3O4YA 1RTP1 2LLUA 1SBJA 3VROA 1IG5A 1R6PA 2GGMA 2HQWA 4PALA 4USLA 1CDPA 2F33A 2KNEA 4ORAB 4ORCB 3CTNA 1OMRA 2HQ8A 2KFFA 3TS5B 2AUCA 3SJSA 4Q04A 1M46A 1QVIY 2R2IA 1N65A 3LLEA 5HKWA 2PMYA 2M1KB 1XO5A 4YI9A 3LK0A 1DMOA 2OTGB 1YRTB 1AVSA 1K96A 1RWYA 2MJWB 1MWNA 3DF0B 2M7NA 4C0KA 2M97A 4PHMA 1E8AA 4JWQA 1ZMZA 1K9KA 3BUOB 2JNXA 4PCWA 1AHRA 1F70A 3FS7A 2CNPA 2LMUA 1RECA 3EKJA 1Y1XA 2WCBA 3OB2B 4NDDA 3D10A 3FIAA 4YGAA 1C7VA 1K95A 4UPGA 1QX5B 4M2OA 5AFPA 1JSAA 1SR6B 1MUXA 4D1EA 1QS7A 1NX0A 2BKHB 2D8NA 3D0YA 4ORBB 4YGDB 1QATA 2M8UA 1DJYA 4I5LB 1TCFA 2LM5A 1EXRA 3NSIA 2MRDA 1KCYA 3SG3A 1BF5A 3GK1A 3BOWB 3SG4A 3NXAA 2JQ6A 2KI6D 1NWDA 4OR9B 2PALA 1PALA 3KF9A 4PHKA 1BODA 3DD4A 1RK9A 4AQJA 1TCOB 5I2LA 1SNLA 1S26D 1A75A 2ZFDA 5DKQA 5CSFA 1SKTA 4NDCA 3VRNA 2FCDA 2KBIA 5KTYA 1F4OA 2P6BB 1NX1A 1UP5A 1K8UA 3PN7C 1CM1A 1TTXA 4MVFA 1NUBA 1SL8A 1M31A 3VRQA 1H4BA 4MRYA 2LUCA 1B4CA 2KAVA 3JTDC 1DF0B 1QX7A 1SL7A 2G2BA 1TNWA 2NLNA 4HSZA 5FYXA 4ZCVA 3AAJA 5ER4X 2LCPA 2DOQA 3RLZA 3I5HC 3K21A 1L2OC 4AQIA 1K2HA 2K7OA 2MAZA 4GPLB 2LVIA 1KK7Z 4WQ2A 1XYDA 3EVUA 1W7IB 2PSRA 3I5FB 4WRIA 1KFUL 4GGNA 1DJHA 1NX2A 2COLB 2LE9B 4P5OE 1RFJA 1SCVA 4XJKB 1TNQA 2BCXA 1YVLA 2ZRSA 1CM4A 1XFZO 1AUIB 2LLTA 5AXIA 2OTGC 2LAPA 4R1EA 1F55A 1IH0A 1U5IB 2ZNEA 4C0LA 1A03A 1LA0A 3GK2A 2LHLA 3BUNB 1M39A 3TUYC 1BR1B 4FTGA 3HCMA 2H61A 3O6BA 5AERA 1KK7Y 2M29A 3I5GC 1WRZA 4GBAA 4MN0A 1AP4A 1XFWO 3BUMB 5CPVA 1KQVA 1WLMA 1YUUA 1XFVO 2F3ZA 2WNDA 4CFRA 5J3XA 3PSRA 3ICBA 2L4HA 4ETOA 3DF0A 4MLWA 1ZACA 1LVCD 1FF1A 1YUTA 1WLZA 3DVKA 2QPTA 3CZTX 3SIAA 2Y5IA 3CR4X 1F4QA 1WRKA 2K7DA 1UHNA 2EC6C 1JFJA 4BY4A 2JTZA 1KK8B 3NSOA 2M7LA 4JQ0D 1SCMB 1QV0A 2GV5A 1HT9A 1CDMA 3PN7B 4CFQA 2KSPA 1QTXA 1PSBA 3VRPA 2KBMA 1JC2A 2Q4UA 3JTDB 3JVTC 1PRWA 4PHNA 2ISDA 1C07A 1M45A 3BOWA 1WY9A 4CIDA 3KPXA 2LNKA 3CR2A 4MBEA 1DGVA 3I5HB 1DJXA 5PALA 1J7QA 1L2OB 4PE0A 3IQQA 1RJVA 3C1VA 4I5KA 1PVAA 2LHIA 5HKYA 3TDIA 4OVNF 1TRFA 3EK4A 2BECA 1YURA 4MZJA 1J7RA 3EVVA 2MLEC 4HRGA 1XFUO 1F71A 3I5FC 1A29A 1A2XA 1Y6WA 1N2DA 2LVKA 1KWOC 1DGUA 2LP2A 2L4IA 1DF0A 1G4YR 1HQVA 4P2YB 1QV1A 2HETA 1NSHA 1DJGA 4PDZA 3TUYB 1ZFSA 1CMGA 2BBNA 5HLOA 4GGFC 2BE4A 4QJ3B 5KU1A 1TIZA 1B7TZ 2MLFC 3I5GB 2I2RE 1B9AA 1NP8A 1XFXO 3VGOA 3O78A 2LV7A 1IKUA 2NZ0A 2AAOA 1S5GZ 3BYAA 2BBMA 3TDZA 1Q80A 2E6WA 5D69A 4QJ5B 4HRHA 1S6CA 1XK4C 3DVMA 1BG1A 2O60A 2Y4QA 4BY5A 2QACA 4MEWA 1TNXA 2G9BA 3WNXB 1TN4A 1SRAA 1ZOTB 1QX2A 2K7CA 1U5IA 3DVJA 1IGVA 1OSAA 1CFPA 1B7TY 1OZSA 2K0JA 1AJ4A 1FW4A 1QASA 2EHBA 1IWQA 1PVBA 1S3PA 1S6IA 3PM8A 1F8HA 2EC6B 2L5XB 4GAOA 4M2PA 1S5GY 2BCBA 1JF2A 3LK1A 2F8PA 4GUKA 1KK8C 1K90D 3FWBA 2OPOA 1RROA 3KO0A 1SCMC 2ZRTA 1J55A 2F2OA 2PRUA 1DTLA 1TOPA 2RGIA 4DIRA 3WHTB 3A4UB 3CGAA 3JVTB 1K94A 2M0RA 1CDNA 4DCKA 2JXLA 4MSPA 3DVEA 4TNCA 1PK0D 1GJYA 1XA5A 5BPJA 1LKJA 1DT7B 5HLVA 1BT6A 3A8RA 1SL9A 2JXCA 1M63B 5DKRA 1F54A 3H4SE 1NPQA 1V1GA 1PSRA 5I8NA 4JPZB 3EK8A 1AJ5A 2FOTA 5JJGA 1J7PA 1G33A 1OOJA 2VRGA 2E30A 2JT8A 1CLLA 1TNPA 2SASA 1OMDA 1KWOB 2H2KA 1MR8A 3SG6A 2WOSA 1EH2A 2L50A 4I5NB 4OV2A 5GQQC 4YGEB 1OE9B 2L98A 3SIBA 1AK8A 2JNFA 1WDCC 1NCYA 2EGDA 1S6JA 1EG4A 1UUSA 4GNKB 3FWCA 1B8LA 1B1GA 2JU0A 2KYCA 2LANA 4NDBA 4ZCUA 2M3WA 2FJUB 1OZOA 3D0YB 3EK7A 3QRXA 5IBWA 2L0PA 1UHJA 2BL0C 2A4JA 3LCPC 1K9PA 1CFDA 3O2PA 2JTTA 2Q91A 2KGBC 3BUWB 3EKHA 2CXJA 1MQ1A 2JPTA 2ZNDA 4HREE 4QJ4B 3I5IC 2LC5A 1FPWA 2JOJA 2TN4A 2BE6A 4YI8A 3OHMB 1IQ5A 1MHOA 2Y1MA 2SCPA 1YX8A 4NQGA 1EG3A 1CTRA 2FCEA 1KFUS 1DJZA 4N5XA 5K89A 2KAXA 1B8RA 2I18A 2K61A 5DKNA 1Y1UA 1K93D 1DJIA 4PHJA 1KQMB 1YRUB 1MXEA 5D7FA 3IF7A 1CFFA 1ALWA 1J7OA 3PLFB 1GGZA 2WC8A 4C0JA 2KI6C 4MZKA 1UHHA 4A4CA 1NCZA 2KOTA 1CDLA 1CNPA 1W7JB 4MRXA 2BCAA 2ZN9A 2NCPA 5B8IB 1XFYO 1CMFA 2JULA 2HPSA 2CTNA 2Y1NA 3AKBA 1BJFA 3HX4A 1WDCB 1UWOA 1LINA 4WQ3A 1YR5A 5G08A 2JWWA 1JF0A 5I2QA 1XVJA 1UHIA 3KHEA 1SPYA 1B47A 2BKIB 4YRUA 2BL0B 2LVJA 3GOFA 2LP3A 3CLNA 3ZNIA 3WHUB 4FQOA 1JWDA 2IS9A 4XJKA 1QIWA 2KQYA 2JRFA 2PASA 1A4PA 2I94A 2K2FA 4AOMA 3I5IB 2F3YA 3BQ3A 2NXQA 2ZKMX 4GGFA 5AANA 2WCEA 2NCOA 1SMGA 1KSOA 2KI4C 3PFVA 4ICBA 1IQ3A 5CSJA 3CS1A 4YGBB 1KSMA 3AKAA 1XK4A 1BMOA 3OX6A 1YUSA 2K8MB 1GQMA 2AMIA 1DVIA 1IRJA 2B1UA 1YX7A 2KQ6A 4A4BA 1SW8A 2KAYA 1KQMC 3CR5X 4DUQA 2OS8B 1CKKA 1CFCA 1LA3A 3OB1B 2K2AA 1QJTA 3SG5A 1MXLC 1NCXA 2CCMA 4YBHB 5CSNA 3M0WA 3MSEB 3OX5A 5F6TA 3TDUA 4OKHA 3ZWHA 1WRLA 1V1FA 2JC2A 3SG2A 1ALVA 1OQPA 3NSKA 5KSZA 2ZN8A 2JZIA 2CT9A 2K7BA 2L51A 3LL8B 1NYAA 4CLNA 5ER5A 1KFXL 1VRKA 3EVRA 2LUXA 1IJ5A 1R2UA 1X02A 1IJ6A 3KEVA 1EL4A 4CPVA 1BLQA 1S1EA 1GGWA 1BU3A 3NSLA 3GK4X 1J1EA 1N0YA 2KFHA 2H61C 4PE7A 2V53A 3TS5C 4F0ZB 5HYDA 1BOCA 2LMVA 3WXAA 4U8DA 3AAKA 1CLBA 1UURA 4E68A 1CB1A 1MF8B 5JOLA 2KGRA 2LVVA 3PATA 4N1FA 4PE1A 1B8CA 1JUOA 2PVBA 5AEQA 1PULA 1YVHA 1J1DA 2O5GA 1SK6D 1Y1AA 1LXFC 5CSIA 4L9MA 4I5JA 2KDHA 1CLMA 2I7AA 4PE4A 3BUXB 1FI6A 1EJ3A 1SY9A 4OCIA 1DJWA 2KI4B 2LMTA 3RM1A 1A75B 1YTZC 3F45A 1C7WA 4M2QA 5HKZA 2CBLA 1UHKA 2HF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7Z A;  1ZUZ A;  4YGC B;  1QIV A;  1OMV A;  1SR6 C;  5TNC A;  4DS7 A;  3BXK A;  2M9G A;  4DRW A;  1K9U A;  2GGZ A;  2F2P A;  3OP0 A;  1KFX S;  2MBX A;  1FI5 A;  1G8I A;  1QLS A;  2MA2 A;  1ODB A;  2WCF A;  1QXP A;  2KHN A;  2L2E A;  1FBV A;  2KYF A;  3PAL A;  2OS8 C;  2WOR A;  2M1U A;  2JT0 A;  3TZ1 A;  1D1O A;  1S36 A;  1JBA A;  3E3R A;  5I2O A;  1JFK A;  3IQO A;  3SG7 A;  1SYM A;  4MZL A;  1H8B A;  1QLK A;  1Y0V H;  4IL1 A;  3CWG A;  4N1G A;  1NX3 A;  2JT3 A;  1NIW A;  1QVI Z;  4GFT A;  2M49 B;  2KFG A;  4XYN A;  1BR4 B;  2LLS A;  3VRR A;  2MHH A;  3O4Y A;  1RTP 1;  2LLU A;  1SBJ A;  3VRO A;  1IG5 A;  1R6P A;  2GGM A;  2HQW A;  4PAL A;  4USL A;  1CDP A;  2F33 A;  2KNE A;  4ORA B;  4ORC B;  3CTN A;  1OMR A;  2HQ8 A;  2KFF A;  3TS5 B;  2AUC A;  3SJS A;  4Q04 A;  1M46 A;  1QVI Y;  2R2I A;  1N65 A;  3LLE A;  5HKW A;  2PMY A;  2M1K B;  1XO5 A;  4YI9 A;  3LK0 A;  1DMO A;  2OTG B;  1YRT B;  1AVS A;  1K96 A;  1RWY A;  2MJW B;  1MWN A;  3DF0 B;  2M7N A;  4C0K A;  2M97 A;  4PHM A;  1E8A A;  4JWQ A;  1ZMZ A;  1K9K A;  3BUO B;  2JNX A;  4PCW A;  1AHR A;  1F70 A;  3FS7 A;  2CNP A;  2LMU A;  1REC A;  3EKJ A;  1Y1X A;  2WCB A;  3OB2 B;  4NDD A;  3D10 A;  3FIA A;  4YGA A;  1C7V A;  1K95 A;  4UPG A;  1QX5 B;  4M2O A;  5AFP A;  1JSA A;  1SR6 B;  1MUX A;  4D1E A;  1QS7 A;  1NX0 A;  2BKH B;  2D8N A;  3D0Y A;  4ORB B;  4YGD B;  1QAT A;  2M8U A;  1DJY A;  4I5L B;  1TCF A;  2LM5 A;  1EXR A;  3NSI A;  2MRD A;  1KCY A;  3SG3 A;  1BF5 A;  3GK1 A;  3BOW B;  3SG4 A;  3NXA A;  2JQ6 A;  2KI6 D;  1NWD A;  4OR9 B;  2PAL A;  1PAL A;  3KF9 A;  4PHK A;  1BOD A;  3DD4 A;  1RK9 A;  4AQJ A;  1TCO B;  5I2L A;  1SNL A;  1S26 D;  1A75 A;  2ZFD A;  5DKQ A;  5CSF A;  1SKT A;  4NDC A;  3VRN A;  2FCD A;  2KBI A;  5KTY A;  1F4O A;  2P6B B;  1NX1 A;  1UP5 A;  1K8U A;  3PN7 C;  1CM1 A;  1TTX A;  4MVF A;  1NUB A;  1SL8 A;  1M31 A;  3VRQ A;  1H4B A;  4MRY A;  2LUC A;  1B4C A;  2KAV A;  3JTD C;  1DF0 B;  1QX7 A;  1SL7 A;  2G2B A;  1TNW A;  2NLN A;  4HSZ A;  5FYX A;  4ZCV A;  3AAJ A;  5ER4 X;  2LCP A;  2DOQ A;  3RLZ A;  3I5H C;  3K21 A;  1L2O C;  4AQI A;  1K2H A;  2K7O A;  2MAZ A;  4GPL B;  2LVI A;  1KK7 Z;  4WQ2 A;  1XYD A;  3EVU A;  1W7I B;  2PSR A;  3I5F B;  4WRI A;  1KFU L;  4GGN A;  1DJH A;  1NX2 A;  2COL B;  2LE9 B;  4P5O E;  1RFJ A;  1SCV A;  4XJK B;  1TNQ A;  2BCX A;  1YVL A;  2ZRS A;  1CM4 A;  1XFZ O;  1AUI B;  2LLT A;  5AXI A;  2OTG C;  2LAP A;  4R1E A;  1F55 A;  1IH0 A;  1U5I B;  2ZNE A;  4C0L A;  1A03 A;  1LA0 A;  3GK2 A;  2LHL A;  3BUN B;  1M39 A;  3TUY C;  1BR1 B;  4FTG A;  3HCM A;  2H61 A;  3O6B A;  5AER A;  1KK7 Y;  2M29 A;  3I5G C;  1WRZ A;  4GBA A;  4MN0 A;  1AP4 A;  1XFW O;  3BUM B;  5CPV A;  1KQV A;  1WLM A;  1YUU A;  1XFV O;  2F3Z A;  2WND A;  4CFR A;  5J3X A;  3PSR A;  3ICB A;  2L4H A;  4ETO A;  3DF0 A;  4MLW A;  1ZAC A;  1LVC D;  1FF1 A;  1YUT A;  1WLZ A;  3DVK A;  2QPT A;  3CZT X;  3SIA A;  2Y5I A;  3CR4 X;  1F4Q A;  1WRK A;  2K7D A;  1UHN A;  2EC6 C;  1JFJ A;  4BY4 A;  2JTZ A;  1KK8 B;  3NSO A;  2M7L A;  4JQ0 D;  1SCM B;  1QV0 A;  2GV5 A;  1HT9 A;  1CDM A;  3PN7 B;  4CFQ A;  2KSP A;  1QTX A;  1PSB A;  3VRP A;  2KBM A;  1JC2 A;  2Q4U A;  3JTD B;  3JVT C;  1PRW A;  4PHN A;  2ISD A;  1C07 A;  1M45 A;  3BOW A;  1WY9 A;  4CID A;  3KPX A;  2LNK A;  3CR2 A;  4MBE A;  1DGV A;  3I5H B;  1DJX A;  5PAL A;  1J7Q A;  1L2O B;  4PE0 A;  3IQQ A;  1RJV A;  3C1V A;  4I5K A;  1PVA A;  2LHI A;  5HKY A;  3TDI A;  4OVN F;  1TRF A;  3EK4 A;  2BEC A;  1YUR A;  4MZJ A;  1J7R A;  3EVV A;  2MLE C;  4HRG A;  1XFU O;  1F71 A;  3I5F C;  1A29 A;  1A2X A;  1Y6W A;  1N2D A;  2LVK A;  1KWO C;  1DGU A;  2LP2 A;  2L4I A;  1DF0 A;  1G4Y R;  1HQV A;  4P2Y B;  1QV1 A;  2HET A;  1NSH A;  1DJG A;  4PDZ A;  3TUY B;  1ZFS A;  1CMG A;  2BBN A;  5HLO A;  4GGF C;  2BE4 A;  4QJ3 B;  5KU1 A;  1TIZ A;  1B7T Z;  2MLF C;  3I5G B;  2I2R E;  1B9A A;  1NP8 A;  1XFX O;  3VGO A;  3O78 A;  2LV7 A;  1IKU A;  2NZ0 A;  2AAO A;  1S5G Z;  3BYA A;  2BBM A;  3TDZ A;  1Q80 A;  2E6W A;  5D69 A;  4QJ5 B;  4HRH A;  1S6C A;  1XK4 C;  3DVM A;  1BG1 A;  2O60 A;  2Y4Q A;  4BY5 A;  2QAC A;  4MEW A;  1TNX A;  2G9B A;  3WNX B;  1TN4 A;  1SRA A;  1ZOT B;  1QX2 A;  2K7C A;  1U5I A;  3DVJ A;  1IGV A;  1OSA A;  1CFP A;  1B7T Y;  1OZS A;  2K0J A;  1AJ4 A;  1FW4 A;  1QAS A;  2EHB A;  1IWQ A;  1PVB A;  1S3P A;  1S6I A;  3PM8 A;  1F8H A;  2EC6 B;  2L5X B;  4GAO A;  4M2P A;  1S5G Y;  2BCB A;  1JF2 A;  3LK1 A;  2F8P A;  4GUK A;  1KK8 C;  1K90 D;  3FWB A;  2OPO A;  1RRO A;  3KO0 A;  1SCM C;  2ZRT A;  1J55 A;  2F2O A;  2PRU A;  1DTL A;  1TOP A;  2RGI A;  4DIR A;  3WHT B;  3A4U B;  3CGA A;  3JVT B;  1K94 A;  2M0R A;  1CDN A;  4DCK A;  2JXL A;  4MSP A;  3DVE A;  4TNC A;  1PK0 D;  1GJY A;  1XA5 A;  5BPJ A;  1LKJ A;  1DT7 B;  5HLV A;  1BT6 A;  3A8R A;  1SL9 A;  2JXC A;  1M63 B;  5DKR A;  1F54 A;  3H4S E;  1NPQ A;  1V1G A;  1PSR A;  5I8N A;  4JPZ B;  3EK8 A;  1AJ5 A;  2FOT A;  5JJG A;  1J7P A;  1G33 A;  1OOJ A;  2VRG A;  2E30 A;  2JT8 A;  1CLL A;  1TNP A;  2SAS A;  1OMD A;  1KWO B;  2H2K A;  1MR8 A;  3SG6 A;  2WOS A;  1EH2 A;  2L50 A;  4I5N B;  4OV2 A;  5GQQ C;  4YGE B;  1OE9 B;  2L98 A;  3SIB A;  1AK8 A;  2JNF A;  1WDC C;  1NCY A;  2EGD A;  1S6J A;  1EG4 A;  1UUS A;  4GNK B;  3FWC A;  1B8L A;  1B1G A;  2JU0 A;  2KYC A;  2LAN A;  4NDB A;  4ZCU A;  2M3W A;  2FJU B;  1OZO A;  3D0Y B;  3EK7 A;  3QRX A;  5IBW A;  2L0P A;  1UHJ A;  2BL0 C;  2A4J A;  3LCP C;  1K9P A;  1CFD A;  3O2P A;  2JTT A;  2Q91 A;  2KGB C;  3BUW B;  3EKH A;  2CXJ A;  1MQ1 A;  2JPT A;  2ZND A;  4HRE E;  4QJ4 B;  3I5I C;  2LC5 A;  1FPW A;  2JOJ A;  2TN4 A;  2BE6 A;  4YI8 A;  3OHM B;  1IQ5 A;  1MHO A;  2Y1M A;  2SCP A;  1YX8 A;  4NQG A;  1EG3 A;  1CTR A;  2FCE A;  1KFU S;  1DJZ A;  4N5X A;  5K89 A;  2KAX A;  1B8R A;  2I18 A;  2K61 A;  5DKN A;  1Y1U A;  1K93 D;  1DJI A;  4PHJ A;  1KQM B;  1YRU B;  1MXE A;  5D7F A;  3IF7 A;  1CFF A;  1ALW A;  1J7O A;  3PLF B;  1GGZ A;  2WC8 A;  4C0J A;  2KI6 C;  4MZK A;  1UHH A;  4A4C A;  1NCZ A;  2KOT A;  1CDL A;  1CNP A;  1W7J B;  4MRX A;  2BCA A;  2ZN9 A;  2NCP A;  5B8I B;  1XFY O;  1CMF A;  2JUL A;  2HPS A;  2CTN A;  2Y1N A;  3AKB A;  1BJF A;  3HX4 A;  1WDC B;  1UWO A;  1LIN A;  4WQ3 A;  1YR5 A;  5G08 A;  2JWW A;  1JF0 A;  5I2Q A;  1XVJ A;  1UHI A;  3KHE A;  1SPY A;  1B47 A;  2BKI B;  4YRU A;  2BL0 B;  2LVJ A;  3GOF A;  2LP3 A;  3CLN A;  3ZNI A;  3WHU B;  4FQO A;  1JWD A;  2IS9 A;  4XJK A;  1QIW A;  2KQY A;  2JRF A;  2PAS A;  1A4P A;  2I94 A;  2K2F A;  4AOM A;  3I5I B;  2F3Y A;  3BQ3 A;  2NXQ A;  2ZKM X;  4GGF A;  5AAN A;  2WCE A;  2NCO A;  1SMG A;  1KSO A;  2KI4 C;  3PFV A;  4ICB A;  1IQ3 A;  5CSJ A;  3CS1 A;  4YGB B;  1KSM A;  3AKA A;  1XK4 A;  1BMO A;  3OX6 A;  1YUS A;  2K8M B;  1GQM A;  2AMI A;  1DVI A;  1IRJ A;  2B1U A;  1YX7 A;  2KQ6 A;  4A4B A;  1SW8 A;  2KAY A;  1KQM C;  3CR5 X;  4DUQ A;  2OS8 B;  1CKK A;  1CFC A;  1LA3 A;  3OB1 B;  2K2A A;  1QJT A;  3SG5 A;  1MXL C;  1NCX A;  2CCM A;  4YBH B;  5CSN A;  3M0W A;  3MSE B;  3OX5 A;  5F6T A;  3TDU A;  4OKH A;  3ZWH A;  1WRL A;  1V1F A;  2JC2 A;  3SG2 A;  1ALV A;  1OQP A;  3NSK A;  5KSZ A;  2ZN8 A;  2JZI A;  2CT9 A;  2K7B A;  2L51 A;  3LL8 B;  1NYA A;  4CLN A;  5ER5 A;  1KFX L;  1VRK A;  3EVR A;  2LUX A;  1IJ5 A;  1R2U A;  1X02 A;  1IJ6 A;  3KEV A;  1EL4 A;  4CPV A;  1BLQ A;  1S1E A;  1GGW A;  1BU3 A;  3NSL A;  3GK4 X;  1J1E A;  1N0Y A;  2KFH A;  2H61 C;  4PE7 A;  2V53 A;  3TS5 C;  4F0Z B;  5HYD A;  1BOC A;  2LMV A;  3WXA A;  4U8D A;  3AAK A;  1CLB A;  1UUR A;  4E68 A;  1CB1 A;  1MF8 B;  5JOL A;  2KGR A;  2LVV A;  3PAT A;  4N1F A;  4PE1 A;  1B8C A;  1JUO A;  2PVB A;  5AEQ A;  1PUL A;  1YVH A;  1J1D A;  2O5G A;  1SK6 D;  1Y1A A;  1LXF C;  5CSI A;  4L9M A;  4I5J A;  2KDH A;  1CLM A;  2I7A A;  4PE4 A;  3BUX B;  1FI6 A;  1EJ3 A;  1SY9 A;  4OCI A;  1DJW A;  2KI4 B;  2LMT A;  3RM1 A;  1A75 B;  1YTZ C;  3F45 A;  1C7W A;  4M2Q A;  5HKZ A;  2CBL A;  1UHK A;  2HF5 A; 
#chains in the Genus database with same CATH topology
 1L7Z A;  1ZUZ A;  4YGC B;  1GM0 A;  1QIV A;  1OMV A;  1T14 A;  1SR6 C;  5TNC A;  4DS7 A;  3IVT A;  3BXK A;  2M9G A;  4DRW A;  1K9U A;  2GGZ A;  2F2P A;  3OP0 A;  1KFX S;  2MBX A;  1FI5 A;  1G8I A;  1QLS A;  2MA2 A;  1ODB A;  2WCF A;  1QXP A;  1OOI X;  2KHN A;  2L2E A;  4FQT A;  1FBV A;  2KYF A;  3PAL A;  3D77 A;  2OS8 C;  2WOR A;  1DQE A;  2M1U A;  2K60 A;  2JT0 A;  3TZ1 A;  2QEH A;  3K1E A;  1S36 A;  1D1O A;  1JBA A;  3E3R A;  5I2O A;  1JFK A;  3IQO A;  3SG7 A;  1SYM A;  4MZL A;  1H8B A;  1QLK A;  1Y0V H;  4IL1 A;  3CWG A;  4N1G A;  1NX3 A;  2JT3 A;  1NIW A;  1QVI Z;  4GFT A;  2M49 B;  1OOH A;  2KFG A;  4XYN A;  1BR4 B;  2LLS A;  3VRR A;  2MHH A;  3O4Y A;  1RTP 1;  2LLU A;  2JPO A;  2WC6 A;  1SBJ A;  3VRO A;  1IG5 A;  1R6P A;  2GGM A;  2HQW A;  3B6X A;  4PAL A;  4USL A;  1CDP A;  2F33 A;  2KNE A;  4ORA B;  4ORC B;  3CTN A;  1OMR A;  2HQ8 A;  2KFF A;  1DEL A;  3TS5 B;  2AUC A;  3D74 A;  3SJS A;  4Q04 A;  1OOG A;  1M46 A;  1QVI Y;  2R2I A;  1N65 A;  3LLE A;  5HKW A;  3NHI A;  2PMY A;  3CZ2 A;  2M1K B;  1XO5 A;  5FI2 A;  4YI9 A;  3LK0 A;  4KYN A;  1DMO A;  2OTG B;  1YRT B;  1AVS A;  2L5Y A;  1K96 A;  1RWY A;  2MJW B;  1MWN A;  3DF0 B;  2M7N A;  4OZD A;  4C0K A;  2M97 A;  4PHM A;  1E8A A;  1C3Y A;  4JWQ A;  1ZMZ A;  1K9K A;  3BUO B;  2JNX A;  4PCW A;  1AHR A;  3S0E A;  1F70 A;  3FS7 A;  2CNP A;  2LMU A;  1REC A;  3BFA A;  1Y1X A;  2WCB A;  3EKJ A;  3OB2 B;  3D10 A;  3FIA A;  3OBV A;  4NDD A;  1K95 A;  4YGA A;  1C7V A;  4UPG A;  1QX5 B;  4M2O A;  5AFP A;  1JSA A;  1SR6 B;  1MUX A;  4D1E A;  1QS7 A;  1NX0 A;  2BKH B;  2D8N A;  3D0Y A;  4ORB B;  4YGD B;  1QAT A;  2M8U A;  1DJY A;  4I5L B;  1TCF A;  2LM5 A;  3N7H A;  1EXR A;  3NSI A;  2MRD A;  1KCY A;  3SG3 A;  2PYQ A;  1BF5 A;  3GK1 A;  3BOW B;  3SG4 A;  3NXA A;  2JQ6 A;  2KI6 D;  1NWD A;  3L47 A;  4OR9 B;  2PAL A;  1PAL A;  3KF9 A;  4PHK A;  5I94 A;  1BOD A;  3FE6 A;  3DD4 A;  1RK9 A;  1SSE B;  4AQJ A;  1TCO B;  5I2L A;  1SNL A;  1S26 D;  1A75 A;  2ZFD A;  5DKQ A;  5CSF A;  1SKT A;  4NDC A;  3VRN A;  2FCD A;  2KBI A;  5KTY A;  1F4O A;  2P6B B;  5D3O A;  1NX1 A;  1UP5 A;  1K8U A;  3PN7 C;  1CM1 A;  1TTX A;  4MVF A;  1NUB A;  1SL8 A;  1M31 A;  3VRQ A;  1H4B A;  4MRY A;  2LUC A;  1B4C A;  2KAV A;  3JTD C;  1DF0 B;  1QX7 A;  1SL7 A;  2G2B A;  1TNW A;  1DEK A;  2NLN A;  4HSZ A;  5FYX A;  2GTE A;  4JKT A;  4ZCV A;  3AAJ A;  3S0G A;  5ER4 X;  2LCP A;  2DOQ A;  3DZT A;  3RLZ A;  3I5H C;  3K21 A;  1L2O C;  4AQI A;  1K2H A;  2K7O A;  2MAZ A;  4GPL B;  4INW A;  2LVI A;  3SS3 A;  1KK7 Z;  4WQ2 A;  1XYD A;  3EVU A;  1W7I B;  2PSR A;  3I5F B;  4WRI A;  1KFU L;  4GGN A;  1DJH A;  1NX2 A;  1TWO A;  2COL B;  2LE9 B;  4P5O E;  1RFJ A;  1SCV A;  4XJK B;  1TNQ A;  2BCX A;  1YVL A;  2ZRS A;  1CM4 A;  1XFZ O;  1AUI B;  2LLT A;  5AXI A;  2OTG C;  2LAP A;  4R1E A;  1F55 A;  1IH0 A;  1U5I B;  2ZNE A;  4C0L A;  1A03 A;  1LA0 A;  3D73 A;  2LHL A;  3BUN B;  1M39 A;  3GK2 A;  3UO9 A;  3TUY C;  1BR1 B;  4FTG A;  3HCM A;  2H61 A;  3O6B A;  5AER A;  1KK7 Y;  2M29 A;  3EG5 B;  3I5G C;  1WRZ A;  4GBA A;  3O4X A;  4MN0 A;  1AP4 A;  1XFW O;  3BUM B;  5CPV A;  1KQV A;  1WLM A;  3PJI A;  1YUU A;  1XFV O;  2F3Z A;  2WND A;  4CFR A;  2P71 A;  5J3X A;  3PSR A;  3ICB A;  2L4H A;  3SS5 A;  1IIO A;  4ETO A;  3DF0 A;  4MLW A;  1ZAC A;  1LVC D;  1FF1 A;  1YUT A;  1WLZ A;  2KPH A;  3DVK A;  2QPT A;  3CZT X;  3SIA A;  2WCK A;  2Y5I A;  3CR4 X;  1F4Q A;  1WRK A;  2K7D A;  1UHN A;  3UNW A;  2EC6 C;  2KLE A;  1JFJ A;  3VB1 A;  4BY4 A;  2JTZ A;  1KK8 B;  3NSO A;  2M7L A;  4JQ0 D;  1SCM B;  1QV0 A;  2P70 A;  2GV5 A;  1HT9 A;  1CDM A;  3PN7 B;  4CFQ A;  1OOF A;  2KSP A;  1QTX A;  1PSB A;  3VRP A;  2KBM A;  1JC2 A;  2Q4U A;  3NGV A;  3JTD B;  3JVT C;  1PRW A;  4PHN A;  2ISD A;  1C07 A;  4INX A;  1M45 A;  3BOW A;  1WY9 A;  4CID A;  3KPX A;  2LNK A;  3CR2 A;  2BAP A;  4MBE A;  1DGV A;  3I5H B;  1DJX A;  5PAL A;  3S0D A;  1L2O B;  4PE0 A;  1J7Q A;  3IQQ A;  1RJV A;  3C1V A;  4I5K A;  1PVA A;  2LHI A;  3CAB A;  5HKY A;  1XFR A;  3TDI A;  4OVN F;  1TRF A;  3EK4 A;  2BEC A;  1YUR A;  4MZJ A;  1J7R A;  2PQL A;  3EVV A;  2MLE C;  4IJ7 A;  4HRG A;  1XFU O;  1F71 A;  3I5F C;  1A29 A;  1A2X A;  1TUJ A;  1Y6W A;  1N2D A;  2LVK A;  1KWO C;  1DGU A;  2LP2 A;  2L4I A;  1DF0 A;  3D75 A;  1G4Y R;  3NHT A;  1HQV A;  4P2Y B;  1QV1 A;  2HET A;  1NSH A;  1DJG A;  4PDZ A;  3TUY B;  1ZFS A;  3S0F A;  2BBN A;  1CMG A;  5HLO A;  4GGF C;  2BE4 A;  4QJ3 B;  5KU1 A;  1TIZ A;  1B7T Z;  2ERB A;  2MLF C;  3SS4 A;  3I5G B;  2I2R E;  1B9A A;  1NP8 A;  1XFX O;  3VGO A;  3O78 A;  2LV7 A;  1IKU A;  2NZ0 A;  3DYE A;  2AAO A;  1S5G Z;  3V2L A;  3BYA A;  1TUZ A;  2BBM A;  3TDZ A;  1Q80 A;  2E6W A;  5D69 A;  4QJ5 B;  4HRH A;  1S6C A;  1XK4 C;  3DVM A;  4F7F A;  1BG1 A;  2O60 A;  2Y4Q A;  1Z2C B;  4BY5 A;  2QAC A;  4MEW A;  1TNX A;  2G9B A;  3WNX B;  1TN4 A;  1SRA A;  1ZOT B;  1QX2 A;  2K7C A;  1U5I A;  3DVJ A;  1IGV A;  1OSA A;  1CFP A;  1B7T Y;  1OZS A;  2K0J A;  1AJ4 A;  1FW4 A;  1QAS A;  2EHB A;  1IWQ A;  1PVB A;  1S3P A;  1S6I A;  3PM8 A;  1F8H A;  2EC6 B;  2L5X B;  4GAO A;  3R1P A;  1S5G Y;  4M2P A;  2BCB A;  5FI7 A;  1JF2 A;  3LK1 A;  2F8P A;  2QDI A;  4GUK A;  1KK8 C;  1K90 D;  3FWB A;  2OPO A;  1RRO A;  3KO0 A;  1SCM C;  2ZRT A;  1J55 A;  2F2O A;  2PRU A;  1DTL A;  1TOP A;  2RGI A;  4DIR A;  3WHT B;  3A4U B;  3CGA A;  3JVT B;  1K94 A;  2M0R A;  1CDN A;  4DCK A;  2JXL A;  1ORG A;  4MSP A;  3DVE A;  4TNC A;  3B86 A;  1PK0 D;  1GJY A;  1XA5 A;  3L4L A;  5BPJ A;  1LKJ A;  1DT7 B;  5HLV A;  1BT6 A;  3A8R A;  1SL9 A;  2JXC A;  1M63 B;  5DKR A;  1F54 A;  3H4S E;  1NPQ A;  1V1G A;  1PSR A;  5I8N A;  4JPZ B;  3EK8 A;  1AJ5 A;  2FOT A;  3S0B A;  5JJG A;  1J7P A;  1G33 A;  1OOJ A;  1OW4 A;  2VRG A;  2E30 A;  2JT8 A;  1CLL A;  1TNP A;  2SAS A;  1OMD A;  1KWO B;  3R72 A;  2H2K A;  1MR8 A;  3SG6 A;  2WOS A;  1EH2 A;  2FJY A;  2L50 A;  4I5N B;  4OV2 A;  4YGE B;  1OE9 B;  2L98 A;  3B88 A;  5GQQ C;  3SIB A;  1AK8 A;  2JNF A;  1WDC C;  1NCY A;  2EGD A;  1S6J A;  1EG4 A;  1C3Z A;  1UUS A;  3B87 A;  4GNK B;  3FWC A;  1B8L A;  1B1G A;  2JU0 A;  2KYC A;  2LAN A;  4NDB A;  3FE9 A;  4ZCU A;  2M3W A;  2FJU B;  1OZO A;  3D0Y B;  3EK7 A;  3QRX A;  5IBW A;  2L0P A;  1UHJ A;  2BL0 C;  2A4J A;  3LCP C;  3D76 A;  1K9P A;  3CZ0 A;  1CFD A;  3O2P A;  2JTT A;  2Q91 A;  2KGB C;  3BUW B;  3EKH A;  2CXJ A;  1MQ1 A;  2JPT A;  2WC5 A;  2ZND A;  4HRE E;  4QJ4 B;  3I5I C;  5EL2 A;  3Q8I A;  2LC5 A;  1FPW A;  2JOJ A;  2TN4 A;  2BE6 A;  4JD9 A;  2WCJ A;  4YI8 A;  3OHM B;  1IQ5 A;  1MHO A;  2Y1M A;  2SCP A;  1YX8 A;  4NQG A;  1EG3 A;  1CTR A;  2FCE A;  2WCL A;  1KFU S;  1DJZ A;  4N5X A;  3CYZ A;  3R1O A;  5K89 A;  2KAX A;  1B8R A;  2I18 A;  2K61 A;  5FI6 A;  5DKN A;  1Y1U A;  1K93 D;  1DJI A;  4PHJ A;  1KQM B;  3CDN A;  3FE8 A;  1YRU B;  1MXE A;  5D7F A;  3PM2 A;  3IF7 A;  1CFF A;  1ALW A;  1J7O A;  3D78 A;  3PLF B;  2YGU A;  1GGZ A;  2WC8 A;  2KLD A;  4C0J A;  1DC1 A;  2KI6 C;  2QEB A;  3BFB A;  4MZK A;  1UHH A;  4A4C A;  1NCZ A;  2KOT A;  1CDL A;  1CNP A;  1W7J B;  4MRX A;  2BCA A;  2ZN9 A;  2NCP A;  5B8I B;  1XFY O;  1CMF A;  3DY9 A;  2JUL A;  2HPS A;  2CTN A;  2Y1N A;  3RZS A;  3AKB A;  1BJF A;  3HX4 A;  1WDC B;  2WCH A;  1UWO A;  3BJH A;  1LIN A;  3CZ1 A;  4WQ3 A;  1YR5 A;  5G08 A;  5HL1 A;  2JWW A;  1JF0 A;  5I2Q A;  1XVJ A;  1UHI A;  3KHE A;  1SPY A;  3DXL A;  1B47 A;  2BKI B;  2H8V A;  4YRU A;  2BL0 B;  2LVJ A;  3GOF A;  2LP3 A;  3CLN A;  3ZNI A;  3WHU B;  4FQO A;  1JWD A;  2IS9 A;  4XJK A;  2L2C A;  1QIW A;  3B7A A;  3R1V A;  2KQY A;  2JRF A;  2PAS A;  1A4P A;  2I94 A;  2K2F A;  4AOM A;  3I5I B;  2F3Y A;  3OGN A;  3BQ3 A;  2NXQ A;  2QEO A;  1LS8 A;  2ZKM X;  4GGF A;  5AAN A;  2WCE A;  2NCO A;  1SMG A;  3QME A;  1KSO A;  2KI4 C;  3PFV A;  4ICB A;  1IQ3 A;  5CSJ A;  3CS1 A;  4YGB B;  1KSM A;  3AKA A;  1XK4 A;  1BMO A;  3OX6 A;  1YUS A;  2K8M B;  1GQM A;  2AMI A;  1DVI A;  2WCM A;  1IRJ A;  2B1U A;  1YX7 A;  2KQ6 A;  4A4B A;  1QWV A;  1SW8 A;  2KAY A;  1KQM C;  3CR5 X;  4DUQ A;  2OS8 B;  3S0A A;  1CKK A;  1CFC A;  2BNX A;  1LA3 A;  3OB1 B;  2K2A A;  1W9Z A;  1QJT A;  3SG5 A;  1MXL C;  1NCX A;  2CCM A;  4YBH B;  5CSN A;  3M0W A;  3MSE B;  1Z4H A;  3OX5 A;  5F6T A;  3TDU A;  4OKH A;  3ZWH A;  1WRL A;  1V1F A;  2JC2 A;  3SG2 A;  1ALV A;  1OQP A;  3NSK A;  5KSZ A;  2ZN8 A;  2JZI A;  2CT9 A;  2K7B A;  2L51 A;  3LL8 B;  1NYA A;  4CLN A;  5ER5 A;  1KFX L;  1VRK A;  3EVR A;  2LUX A;  1IJ5 A;  1R2U A;  1X02 A;  1IJ6 A;  3KEV A;  1EL4 A;  4CPV A;  5DIC A;  1BLQ A;  1S1E A;  1GGW A;  1BU3 A;  3NSL A;  3GK4 X;  1J1E A;  3L4A A;  1N0Y A;  2KFH A;  2H61 C;  3BFH A;  2V53 A;  4PE7 A;  3TS5 C;  4F0Z B;  5HYD A;  2LMV A;  1BOC A;  3WXA A;  4U8D A;  3AAK A;  1CLB A;  1UUR A;  4E68 A;  1CB1 A;  1MF8 B;  5JOL A;  2KGR A;  2LVV A;  3PAT A;  4N1F A;  4PE1 A;  1B8C A;  1JUO A;  2PVB A;  5AEQ A;  1PUL A;  1YVH A;  1P28 A;  1J1D A;  2O5G A;  1SK6 D;  1Y1A A;  1LXF C;  5CSI A;  4L9M A;  4I5J A;  2KDH A;  1CLM A;  2I7A A;  4PE4 A;  3BUX B;  1FI6 A;  1EJ3 A;  1SY9 A;  4OCI A;  1DJW A;  2KI4 B;  2LMT A;  4PT1 A;  3RM1 A;  1A75 B;  1YTZ C;  3F45 A;  1C7W A;  4M2Q A;  2QEV A;  2CBL A;  5HKZ A;  1UHK A;  2HF5 A; 
#chains in the Genus database with same CATH homology
 1L7Z A;  1ZUZ A;  4YGC B;  1QIV A;  1OMV A;  1SR6 C;  5TNC A;  4DS7 A;  3BXK A;  2M9G A;  4DRW A;  1K9U A;  2GGZ A;  2F2P A;  3OP0 A;  1KFX S;  2MBX A;  1FI5 A;  1G8I A;  1QLS A;  2MA2 A;  1ODB A;  2WCF A;  1QXP A;  2KHN A;  2L2E A;  1FBV A;  2KYF A;  3PAL A;  2OS8 C;  2WOR A;  2M1U A;  2JT0 A;  3TZ1 A;  1D1O A;  1S36 A;  1JBA A;  3E3R A;  5I2O A;  1JFK A;  3IQO A;  3SG7 A;  1SYM A;  4MZL A;  1H8B A;  1QLK A;  1Y0V H;  4IL1 A;  3CWG A;  4N1G A;  1NX3 A;  2JT3 A;  1NIW A;  1QVI Z;  4GFT A;  2M49 B;  2KFG A;  4XYN A;  1BR4 B;  2LLS A;  3VRR A;  2MHH A;  3O4Y A;  1RTP 1;  2LLU A;  1SBJ A;  3VRO A;  1IG5 A;  1R6P A;  2GGM A;  2HQW A;  4PAL A;  4USL A;  1CDP A;  2F33 A;  2KNE A;  4ORA B;  4ORC B;  3CTN A;  1OMR A;  2HQ8 A;  2KFF A;  3TS5 B;  2AUC A;  3SJS A;  4Q04 A;  1M46 A;  1QVI Y;  2R2I A;  1N65 A;  3LLE A;  5HKW A;  2PMY A;  2M1K B;  1XO5 A;  4YI9 A;  3LK0 A;  1DMO A;  2OTG B;  1YRT B;  1AVS A;  1K96 A;  1RWY A;  2MJW B;  1MWN A;  3DF0 B;  2M7N A;  4C0K A;  2M97 A;  4PHM A;  1E8A A;  4JWQ A;  1ZMZ A;  1K9K A;  3BUO B;  2JNX A;  4PCW A;  1AHR A;  1F70 A;  3FS7 A;  2CNP A;  2LMU A;  1REC A;  3EKJ A;  1Y1X A;  2WCB A;  3OB2 B;  4NDD A;  3D10 A;  3FIA A;  4YGA A;  1C7V A;  1K95 A;  4UPG A;  1QX5 B;  4M2O A;  5AFP A;  1JSA A;  1SR6 B;  1MUX A;  4D1E A;  1QS7 A;  1NX0 A;  2BKH B;  2D8N A;  3D0Y A;  4ORB B;  4YGD B;  1QAT A;  2M8U A;  1DJY A;  4I5L B;  1TCF A;  2LM5 A;  1EXR A;  3NSI A;  2MRD A;  1KCY A;  3SG3 A;  1BF5 A;  3GK1 A;  3BOW B;  3SG4 A;  3NXA A;  2JQ6 A;  2KI6 D;  1NWD A;  4OR9 B;  2PAL A;  1PAL A;  3KF9 A;  4PHK A;  1BOD A;  3DD4 A;  1RK9 A;  4AQJ A;  1TCO B;  5I2L A;  1SNL A;  1S26 D;  1A75 A;  2ZFD A;  5DKQ A;  5CSF A;  1SKT A;  4NDC A;  3VRN A;  2FCD A;  2KBI A;  5KTY A;  1F4O A;  2P6B B;  1NX1 A;  1UP5 A;  1K8U A;  3PN7 C;  1CM1 A;  1TTX A;  4MVF A;  1NUB A;  1SL8 A;  1M31 A;  3VRQ A;  1H4B A;  4MRY A;  2LUC A;  1B4C A;  2KAV A;  3JTD C;  1DF0 B;  1QX7 A;  1SL7 A;  2G2B A;  1TNW A;  2NLN A;  4HSZ A;  5FYX A;  4ZCV A;  3AAJ A;  5ER4 X;  2LCP A;  2DOQ A;  3RLZ A;  3I5H C;  3K21 A;  1L2O C;  4AQI A;  1K2H A;  2K7O A;  2MAZ A;  4GPL B;  2LVI A;  1KK7 Z;  4WQ2 A;  1XYD A;  3EVU A;  1W7I B;  2PSR A;  3I5F B;  4WRI A;  1KFU L;  4GGN A;  1DJH A;  1NX2 A;  2COL B;  2LE9 B;  4P5O E;  1RFJ A;  1SCV A;  4XJK B;  1TNQ A;  2BCX A;  1YVL A;  2ZRS A;  1CM4 A;  1XFZ O;  1AUI B;  2LLT A;  5AXI A;  2OTG C;  2LAP A;  4R1E A;  1F55 A;  1IH0 A;  1U5I B;  2ZNE A;  4C0L A;  1A03 A;  1LA0 A;  3GK2 A;  2LHL A;  3BUN B;  1M39 A;  3TUY C;  1BR1 B;  4FTG A;  3HCM A;  2H61 A;  3O6B A;  5AER A;  1KK7 Y;  2M29 A;  3I5G C;  1WRZ A;  4GBA A;  4MN0 A;  1AP4 A;  1XFW O;  3BUM B;  5CPV A;  1KQV A;  1WLM A;  1YUU A;  1XFV O;  2F3Z A;  2WND A;  4CFR A;  5J3X A;  3PSR A;  3ICB A;  2L4H A;  4ETO A;  3DF0 A;  4MLW A;  1ZAC A;  1LVC D;  1FF1 A;  1YUT A;  1WLZ A;  3DVK A;  2QPT A;  3CZT X;  3SIA A;  2Y5I A;  3CR4 X;  1F4Q A;  1WRK A;  2K7D A;  1UHN A;  2EC6 C;  1JFJ A;  4BY4 A;  2JTZ A;  1KK8 B;  3NSO A;  2M7L A;  4JQ0 D;  1SCM B;  1QV0 A;  2GV5 A;  1HT9 A;  1CDM A;  3PN7 B;  4CFQ A;  2KSP A;  1QTX A;  1PSB A;  3VRP A;  2KBM A;  1JC2 A;  2Q4U A;  3JTD B;  3JVT C;  1PRW A;  4PHN A;  2ISD A;  1C07 A;  1M45 A;  3BOW A;  1WY9 A;  4CID A;  3KPX A;  2LNK A;  3CR2 A;  4MBE A;  1DGV A;  3I5H B;  1DJX A;  5PAL A;  1J7Q A;  1L2O B;  4PE0 A;  3IQQ A;  1RJV A;  3C1V A;  4I5K A;  1PVA A;  2LHI A;  5HKY A;  3TDI A;  4OVN F;  1TRF A;  3EK4 A;  2BEC A;  1YUR A;  4MZJ A;  1J7R A;  3EVV A;  2MLE C;  4HRG A;  1XFU O;  1F71 A;  3I5F C;  1A29 A;  1A2X A;  1Y6W A;  1N2D A;  2LVK A;  1KWO C;  1DGU A;  2LP2 A;  2L4I A;  1DF0 A;  1G4Y R;  1HQV A;  4P2Y B;  1QV1 A;  2HET A;  1NSH A;  1DJG A;  4PDZ A;  3TUY B;  1ZFS A;  1CMG A;  2BBN A;  5HLO A;  4GGF C;  2BE4 A;  4QJ3 B;  5KU1 A;  1TIZ A;  1B7T Z;  2MLF C;  3I5G B;  2I2R E;  1B9A A;  1NP8 A;  1XFX O;  3VGO A;  3O78 A;  2LV7 A;  1IKU A;  2NZ0 A;  2AAO A;  1S5G Z;  3BYA A;  2BBM A;  3TDZ A;  1Q80 A;  2E6W A;  5D69 A;  4QJ5 B;  4HRH A;  1S6C A;  1XK4 C;  3DVM A;  1BG1 A;  2O60 A;  2Y4Q A;  4BY5 A;  2QAC A;  4MEW A;  1TNX A;  2G9B A;  3WNX B;  1TN4 A;  1SRA A;  1ZOT B;  1QX2 A;  2K7C A;  1U5I A;  3DVJ A;  1IGV A;  1OSA A;  1CFP A;  1B7T Y;  1OZS A;  2K0J A;  1AJ4 A;  1FW4 A;  1QAS A;  2EHB A;  1IWQ A;  1PVB A;  1S3P A;  1S6I A;  3PM8 A;  1F8H A;  2EC6 B;  2L5X B;  4GAO A;  4M2P A;  1S5G Y;  2BCB A;  1JF2 A;  3LK1 A;  2F8P A;  4GUK A;  1KK8 C;  1K90 D;  3FWB A;  2OPO A;  1RRO A;  3KO0 A;  1SCM C;  2ZRT A;  1J55 A;  2F2O A;  2PRU A;  1DTL A;  1TOP A;  2RGI A;  4DIR A;  3WHT B;  3A4U B;  3CGA A;  3JVT B;  1K94 A;  2M0R A;  1CDN A;  4DCK A;  2JXL A;  4MSP A;  3DVE A;  4TNC A;  1PK0 D;  1GJY A;  1XA5 A;  5BPJ A;  1LKJ A;  1DT7 B;  5HLV A;  1BT6 A;  3A8R A;  1SL9 A;  2JXC A;  1M63 B;  5DKR A;  1F54 A;  3H4S E;  1NPQ A;  1V1G A;  1PSR A;  5I8N A;  4JPZ B;  3EK8 A;  1AJ5 A;  2FOT A;  5JJG A;  1J7P A;  1G33 A;  1OOJ A;  2VRG A;  2E30 A;  2JT8 A;  1CLL A;  1TNP A;  2SAS A;  1OMD A;  1KWO B;  2H2K A;  1MR8 A;  3SG6 A;  2WOS A;  1EH2 A;  2L50 A;  4I5N B;  4OV2 A;  5GQQ C;  4YGE B;  1OE9 B;  2L98 A;  3SIB A;  1AK8 A;  2JNF A;  1WDC C;  1NCY A;  2EGD A;  1S6J A;  1EG4 A;  1UUS A;  4GNK B;  3FWC A;  1B8L A;  1B1G A;  2JU0 A;  2KYC A;  2LAN A;  4NDB A;  4ZCU A;  2M3W A;  2FJU B;  1OZO A;  3D0Y B;  3EK7 A;  3QRX A;  5IBW A;  2L0P A;  1UHJ A;  2BL0 C;  2A4J A;  3LCP C;  1K9P A;  1CFD A;  3O2P A;  2JTT A;  2Q91 A;  2KGB C;  3BUW B;  3EKH A;  2CXJ A;  1MQ1 A;  2JPT A;  2ZND A;  4HRE E;  4QJ4 B;  3I5I C;  2LC5 A;  1FPW A;  2JOJ A;  2TN4 A;  2BE6 A;  4YI8 A;  3OHM B;  1IQ5 A;  1MHO A;  2Y1M A;  2SCP A;  1YX8 A;  4NQG A;  1EG3 A;  1CTR A;  2FCE A;  1KFU S;  1DJZ A;  4N5X A;  5K89 A;  2KAX A;  1B8R A;  2I18 A;  2K61 A;  5DKN A;  1Y1U A;  1K93 D;  1DJI A;  4PHJ A;  1KQM B;  1YRU B;  1MXE A;  5D7F A;  3IF7 A;  1CFF A;  1ALW A;  1J7O A;  3PLF B;  1GGZ A;  2WC8 A;  4C0J A;  2KI6 C;  4MZK A;  1UHH A;  4A4C A;  1NCZ A;  2KOT A;  1CDL A;  1CNP A;  1W7J B;  4MRX A;  2BCA A;  2ZN9 A;  2NCP A;  5B8I B;  1XFY O;  1CMF A;  2JUL A;  2HPS A;  2CTN A;  2Y1N A;  3AKB A;  1BJF A;  3HX4 A;  1WDC B;  1UWO A;  1LIN A;  4WQ3 A;  1YR5 A;  5G08 A;  2JWW A;  1JF0 A;  5I2Q A;  1XVJ A;  1UHI A;  3KHE A;  1SPY A;  1B47 A;  2BKI B;  4YRU A;  2BL0 B;  2LVJ A;  3GOF A;  2LP3 A;  3CLN A;  3ZNI A;  3WHU B;  4FQO A;  1JWD A;  2IS9 A;  4XJK A;  1QIW A;  2KQY A;  2JRF A;  2PAS A;  1A4P A;  2I94 A;  2K2F A;  4AOM A;  3I5I B;  2F3Y A;  3BQ3 A;  2NXQ A;  2ZKM X;  4GGF A;  5AAN A;  2WCE A;  2NCO A;  1SMG A;  1KSO A;  2KI4 C;  3PFV A;  4ICB A;  1IQ3 A;  5CSJ A;  3CS1 A;  4YGB B;  1KSM A;  3AKA A;  1XK4 A;  1BMO A;  3OX6 A;  1YUS A;  2K8M B;  1GQM A;  2AMI A;  1DVI A;  1IRJ A;  2B1U A;  1YX7 A;  2KQ6 A;  4A4B A;  1SW8 A;  2KAY A;  1KQM C;  3CR5 X;  4DUQ A;  2OS8 B;  1CKK A;  1CFC A;  1LA3 A;  3OB1 B;  2K2A A;  1QJT A;  3SG5 A;  1MXL C;  1NCX A;  2CCM A;  4YBH B;  5CSN A;  3M0W A;  3MSE B;  3OX5 A;  5F6T A;  3TDU A;  4OKH A;  3ZWH A;  1WRL A;  1V1F A;  2JC2 A;  3SG2 A;  1ALV A;  1OQP A;  3NSK A;  5KSZ A;  2ZN8 A;  2JZI A;  2CT9 A;  2K7B A;  2L51 A;  3LL8 B;  1NYA A;  4CLN A;  5ER5 A;  1KFX L;  1VRK A;  3EVR A;  2LUX A;  1IJ5 A;  1R2U A;  1X02 A;  1IJ6 A;  3KEV A;  1EL4 A;  4CPV A;  1BLQ A;  1S1E A;  1GGW A;  1BU3 A;  3NSL A;  3GK4 X;  1J1E A;  1N0Y A;  2KFH A;  2H61 C;  4PE7 A;  2V53 A;  3TS5 C;  4F0Z B;  5HYD A;  1BOC A;  2LMV A;  3WXA A;  4U8D A;  3AAK A;  1CLB A;  1UUR A;  4E68 A;  1CB1 A;  1MF8 B;  5JOL A;  2KGR A;  2LVV A;  3PAT A;  4N1F A;  4PE1 A;  1B8C A;  1JUO A;  2PVB A;  5AEQ A;  1PUL A;  1YVH A;  1J1D A;  2O5G A;  1SK6 D;  1Y1A A;  1LXF C;  5CSI A;  4L9M A;  4I5J A;  2KDH A;  1CLM A;  2I7A A;  4PE4 A;  3BUX B;  1FI6 A;  1EJ3 A;  1SY9 A;  4OCI A;  1DJW A;  2KI4 B;  2LMT A;  3RM1 A;  1A75 B;  1YTZ C;  3F45 A;  1C7W A;  4M2Q A;  5HKZ A;  2CBL A;  1UHK A;  2HF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...