1FI5A

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the C-terminal domain of cardiac troponin C free and bound to the N-terminal domain of cardiac troponin I.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
molecule keywords PROTEIN (TROPONIN C)
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi5A00
4FTGA 4PDZA 3D0YA 2JXLA 5ER5A 2KI4C 3DVEA 3O2PA 1OZSA 5AANA 1YUUA 4E68A 1JWDA 2PSRA 1QV0A 3SG5A 1XA5A 2Q4UA 1N0YA 1WDCB 3DVKA 3D10A 2OTGC 3WNXB 2L98A 1EH2A 1BU3A 1NCXA 3QRXA 3PN7C 1NIWA 3TS5C 2LV7A 1M45A 1EG4A 4A4BA 1FBVA 4N5XA 1K9UA 2NCOA 2KAYA 4YRUA 3M0WA 1SL8A 2BE6A 4FQOA 1RFJA 3CZTX 1LA0A 3LK0A 1K93D 1RWYA 3LLEA 1G33A 1HT9A 1NWDA 1QV1A 2LC5A 1NP8A 3CR4X 2PASA 4MZLA 3CTNA 1CLBA 1DJIA 4JWQA 2JWWA 2JT3A 2SASA 2JTTA 1CDNA 3SG2A 2M3WA 2JULA 4WQ2A 5JOLA 3O4YA 1Q80A 1ZMZA 1PRWA 2FJUB 2O5GA 1SKTA 4HRGA 1CFDA 4OR9B 1DF0A 1QVIY 1KQMC 3VROA 1TTXA 5KSZA 2KYCA 1M46A 1JF2A 1GJYA 2JXCA 1OSAA 1SL9A 3EVRA 2ISDA 1AJ4A 2KAVA 4TNCA 2HF5A 1TNQA 3OP0A 1UURA 1XFXO 3CWGA 4GNKB 3SG6A 3BUXB 3BXKA 1PK0D 3VRQA 2Y1NA 3EVUA 2JNFA 2LVJA 4PE7A 3E3RA 2AUCA 1KFXL 2ZKMX 4YI8A 3PATA 3GOFA 3TDZA 2KOTA 2NZ0A 3A8RA 3CS1A 4BY5A 2LE9B 2F2PA 3SG3A 5HYDA 1SK6D 2KFHA 4M2QA 1CMGA 2ZRTA 1PSBA 2LLTA 1AK8A 1OMVA 4M2PA 4Q04A 5CSFA 1G4YR 1YURA 1NYAA 2F3YA 1J7OA 5AERA 4MZKA 4N1GA 2Y5IA 2PMYA 3H4SE 2CXJA 3BUWB 4MRYA 1YRTB 1QATA 2JNXA 1UUSA 1J55A 4MSPA 1K9KA 2F3ZA 3NSIA 1UHJA 1AHRA 1A03A 1B4CA 5CSNA 1FI5A 2P6BB 1KWOB 4MRXA 1MUXA 3ZNIA 5I2QA 1XFYO 3CR5X 2F8PA 1A4PA 2JQ6A 4NDDA 3JTDB 1VRKA 1R2UA 1DJWA 4YBHB 4P5OE 1A29A 4HRHA 1IQ3A 1TNXA 3NSOA 2Q91A 3LK1A 1CFCA 1QVIZ 1J1EA 3AKAA 1BODA 4AQJA 1KK7Y 1WLZA 1ZUZA 1W7IB 1ALWA 2JTZA 4GGNA 1ZOTB 1UWOA 3EK8A 1SR6C 2PVBA 1KSOA 3VGOA 1AVSA 3GK1A 4PHMA 1CDPA 1SMGA 1IJ6A 1CM4A 1K8UA 2AAOA 2LVKA 4A4CA 2KHNA 4DS7A 1CNPA 5FYXA 4DUQA 3EVVA 1R6PA 4GFTA 2ZN9A 1K90D 1YVLA 2BE4A 2L0PA 2LLUA 2MA2A 1U5IB 5PALA 3I5GB 2OS8C 2JOJA 3RM1A 3OB1B 3DF0B 1KQVA 1KWOC 2NXQA 1PVAA 1SPYA 1DJGA 5IBWA 1SCMB 3DVMA 1CFPA 2WOSA 2BCBA 3K21A 5KTYA 5B8IB 1QLSA 3FS7A 1DT7B 4OKHA 4YGAA 2LLSA 3CGAA 1A2XA 1K95A 4XYNA 4GGFC 5ER4X 1UHNA 2K61A 1WRLA 1SR6B 5HKYA 5GQQC 1SBJA 3EK4A 1S1EA 1BR4B 1S36A 2BL0B 1IKUA 1EL4A 1NX3A 1RROA 5HKWA 1QS7A 1A75B 3TDIA 1KFUS 2K7CA 2I7AA 2K7OA 4DCKA 2K7DA 1M39A 1SY9A 1KK7Z 4ORCB 2SCPA 1B1GA 3WHUB 3HX4A 1F54A 1L2OC 1RK9A 2H61A 2LANA 1EXRA 1KSMA 1YTZC 2IS9A 4OVNF 1SL7A 3TUYB 1NCZA 4U8DA 3AKBA 1CDLA 4GPLB 2KFFA 3JVTC 5D7FA 2M29A 1YUTA 2WCEA 4PHKA 4D1EA 2KGRA 3OHMB 1TRFA 3NSKA 2Y4QA 4C0KA 2M49B 4OCIA 2QPTA 2L5XB 3I5FC 1SNLA 1RTP1 3DF0A 3DVJA 2M1KB 5CSIA 2K8MB 2BECA 2E30A 2LVIA 2MRDA 1EG3A 1MHOA 3BOWA 1BLQA 1CTRA 1F4QA 3OX6A 3SIBA 1B8LA 1MQ1A 1LINA 3IF7A 1IH0A 1S5GZ 2JC2A 4ZCUA 1YR5A 2VRGA 1NPQA 1SCMC 4HSZA 5CPVA 1CB1A 1JC2A 1IWQA 2EC6C 1BT6A 3PALA 2M8UA 1KFUL 2L51A 1PALA 3FWCA 4P2YB 2KI4B 4CFQA 1SW8A 4QJ4B 1DJZA 2BBNA 4QJ3B 2ZFDA 4PCWA 4GUKA 1FPWA 2LMUA 1FI6A 1BG1A 1C7WA 1W7JB 1CDMA 5F6TA 1QASA 1ZFSA 4I5JA 4I5LB 1DJHA 1SCVA 1QIVA 1LVCD 1B7TY 1XK4A 5DKRA 1E8AA 2WCFA 1TIZA 2EGDA 3I5FB 4L9MA 3EKHA 5I2OA 2CBLA 1B47A 1YUSA 3GK4X 1XFZO 4I5KA 1S26D 4JQ0D 2CCMA 1IGVA 4PHNA 1TCOB 1JSAA 1KK8B 2K2FA 1NX1A 4MLWA 4CIDA 4NQGA 3CR2A 5I2LA 5JJGA 1IG5A 2GV5A 4UPGA 4GBAA 1CLMA 4GGFA 1X02A 4XJKA 5HKZA 3PN7B 1K2HA 3SJSA 1BR1B 3BUOB 1AUIB 2L4IA 2LMVA 4MZJA 2JRFA 4MEWA 4C0LA 1F55A 4YGDB 3LL8B 3I5IB 1DF0B 1MXLC 1OMRA 4CLNA 1MXEA 2K7BA 4XJKB 2HETA 1QTXA 3CLNA 3KPXA 3PSRA 1OQPA 5HLVA 1C7VA 2H61C 2FCDA 3SG4A 1D1OA 2ZRSA 3DD4A 2M7LA 2FCEA 1CMFA 1F71A 2KSPA 3FIAA 2JU0A 2LNKA 4YI9A 2COLB 2FOTA 2LCPA 1C07A 1G8IA 1DGVA 3SG7A 4YGEB 1SRAA 4PE0A 1CLLA 1BJFA 2F33A 2G2BA 2WCBA 5I8NA 1IRJA 5DKNA 2CTNA 3BQ3A 1RECA 5G08A 4CPVA 2A4JA 1Y0VH 5CSJA 3FWBA 2BKIB 1YVHA 1M31A 1SYMA 2OS8B 1QX5B 3F45A 5D69A 1NX0A 1J1DA 1XFWO 1B7TZ 2O60A 3OB2B 5AXIA 3SIAA 4AOMA 1AP4A 4PHJA 3TZ1A 1WLMA 3PM8A 2JT0A 4M2OA 3PLFB 1WRZA 2BL0C 1XFVO 1QX2A 2L50A 3IQOA 1Y1XA 3IQQA 1KK8C 2TN4A 1J7PA 1UP5A 4OV2A 1JBAA 1HQVA 1ODBA 1U5IA 2LM5A 2I18A 3VRRA 1LKJA 1OOJA 2HQWA 4MN0A 1QXPA 4HREE 4GAOA 1OZOA 3GK2A 1Y1UA 4F0ZB 3EK7A 2BKHB 1ZACA 1NSHA 5DKQA 2L2EA 2M97A 3WXAA 1KFXS 3TS5B 2LVVA 1CFFA 2NLNA 2JZIA 2HPSA 1PVBA 3BUNB 3NXAA 1XYDA 1Y6WA 2KFGA 1A75A 1DJYA 2KNEA 2MLFC 1F4OA 2CNPA 1NX2A 2MLEC 1QLKA 3EKJA 3I5HB 2DOQA 2ZNEA 1WY9A 2KI6C 1YX8A 1WDCC 4ORAB 3TUYC 1EJ3A 4NDCA 1OMDA 2KBIA 3C1VA 1K9PA 2AMIA 3WHTB 2ZNDA 1V1GA 3BUMB 3BYAA 2WC8A 1PULA 3LCPC 3O6BA 3JTDC 1K96A 1B8RA 1MF8B 3ZWHA 2KDHA 1QX7A 1TN4A 1V1FA 1YX7A 4NDBA 2KAXA 4MBEA 5AFPA 1XK4C 1YRUB 1F70A 1J7RA 2EC6B 1JFKA 4ORBB 1S6JA 3A4UB 1S5GY 1XFUO 2EHBA 4AQIA 1F8HA 1RJVA 1QJTA 1CM1A 1PSRA 1S6IA 1TCFA 1CKKA 1FW4A 1XO5A 1QIWA 2HQ8A 2WORA 3BOWB 1XVJA 4PALA 1ALVA 1DVIA 3ICBA 3MSEB 4YGCB 4C0JA 3I5HC 4IL1A 1NCYA 3KHEA 1JFJA 2H2KA 2NCPA 1JUOA 2GGMA 2QACA 1LA3A 2B1UA 3O78A 1J7QA 4I5NB 3AAJA 1IJ5A 1WRKA 3OX5A 1N2DA 3VRNA 4YGBB 3KF9A 3D0YB 1GGWA 3RLZA 2V53A 1OE9B 5BPJA 2BCXA 4BY4A 2PALA 2Y1MA 4N1FA 2KYFA 1B9AA 2I2RE 2M7NA 2MAZA 3NSLA 1N65A 4JPZB 3I5IC 4WQ3A 3TDUA 1NUBA 4CFRA 2LAPA 1TNWA 2K2AA 4PE1A 1DJXA 2L4HA 2OPOA 2KI6D 2LUXA 4QJ5B 2M0RA 2KQ6A 1TNPA 5TNCA 1L2OB 1L7ZA 2MBXA 2R2IA 2JT8A 2LHIA 5HLOA 1Y1AA 1LXFC 4DRWA 2KGBC 1JF0A 5K89A 2BCAA 2I94A 2WNDA 2LUCA 4ZCVA 4PE4A 1BMOA 3PFVA 1S6CA 1FF1A 2LMTA 2RGIA 4USLA 3AAKA 1UHIA 1DTLA 1DMOA 1H4BA 3VRPA 2F2OA 1UHHA 3JVTB 1BF5A 5AEQA 2OTGB 2JPTA 2G9BA 2BBMA 2ZN8A 1UHKA 3HCMA 2M9GA 1DGUA 2LHLA 4MVFA 5J3XA 2D8NA 2GGZA 1TOPA 4ETOA 2M1UA 1AJ5A 1KCYA 4R1EA 2E6WA 1GQMA 2MHHA 1S3PA 1H8BA 1B8CA 1GGZA 4WRIA 1K94A 5KU1A 3KO0A 1KQMB 1IQ5A 2K0JA 4ICBA 3KEVA 4DIRA 1BOCA 1MR8A 1M63B 1MWNA 2CT9A 2KBMA 3I5GC 2MJWB 2LP2A 2LP3A 2PRUA 2KQYA
chains in the Genus database with same CATH superfamily
4FTGA 4PDZA 3D0YA 2JXLA 5ER5A 2KI4C 3DVEA 3O2PA 1OZSA 5AANA 1YUUA 4E68A 1JWDA 2PSRA 1QV0A 3SG5A 1XA5A 2Q4UA 1N0YA 1WDCB 3DVKA 3D10A 2OTGC 3WNXB 1C3ZA 2L98A 1EH2A 1BU3A 1NCXA 3QRXA 1OOFA 3PN7C 1NIWA 3TS5C 2LV7A 1M45A 1EG4A 4A4BA 1FBVA 4N5XA 1K9UA 2NCOA 2KAYA 1OOGA 3UO9A 4YRUA 3M0WA 3S0AA 1SL8A 2BE6A 4FQOA 1RFJA 3CZTX 1LA0A 3LK0A 1K93D 1RWYA 3D73A 3LLEA 1G33A 2L2CA 1HT9A 1NWDA 5FI6A 1QV1A 2LC5A 3L47A 1NP8A 3CR4X 2PASA 4MZLA 3CTNA 1CLBA 1DJIA 3D75A 4JWQA 2JWWA 2JT3A 2SASA 2JTTA 1CDNA 3SG2A 2M3WA 2JULA 4WQ2A 5JOLA 3O4YA 1Q80A 1ZMZA 3D76A 1PRWA 2FJUB 2O5GA 1SKTA 4HRGA 4XJKB 3UNWA 1CFDA 4INWA 4OR9B 3NHTA 1DF0A 1QVIY 1KQMC 3VROA 1TTXA 5KSZA 2KYCA 1M46A 1JF2A 1GJYA 2JXCA 1OSAA 1SL9A 3EVRA 2ISDA 1AJ4A 2KAVA 4TNCA 2HF5A 1TNQA 3OP0A 1UURA 1XFXO 3CWGA 4GNKB 3SG6A 3BUXB 3BXKA 1PK0D 3VRQA 2Y1NA 3EVUA 2JNFA 3PJIA 2LVJA 4PE7A 3E3RA 2AUCA 1KFXL 2ZKMX 4YI8A 3PATA 3GOFA 3TDZA 1DQEA 2KOTA 2H8VA 2L5YA 2NZ0A 3A8RA 2LE9B 2F2PA 3CS1A 5FI2A 4BY5A 3SG3A 3B7AA 5HYDA 1SK6D 2KFHA 4M2QA 1CMGA 3CZ1A 2ZRTA 3DYEA 1PSBA 2LLTA 3L4LA 3B6XA 1AK8A 1OMVA 4M2PA 4Q04A 5CSFA 1G4YR 1YURA 1NYAA 2F3YA 1J7OA 5AERA 4MZKA 4N1GA 2Y5IA 2PMYA 1ORGA 3H4SE 2CXJA 3BUWB 4MRYA 1YRTB 4JD9A 1QATA 2JNXA 1UUSA 1J55A 4MSPA 1K9KA 2F3ZA 3NSIA 1UHJA 1AHRA 1A03A 1B4CA 5CSNA 1FI5A 2P6BB 1KWOB 4MRXA 5EL2A 1MUXA 1SSEB 3ZNIA 5I2QA 1XFYO 3CR5X 2F8PA 2K60A 2WC5A 1A4PA 2JQ6A 3BFHA 3JTDB 1VRKA 1R2UA 4NDDA 1DJWA 4YBHB 4P5OE 1A29A 4HRHA 5D3OA 1IQ3A 1TNXA 1DELA 3NSOA 2Q91A 3LK1A 1CFCA 1QVIZ 1J1EA 2P71A 3AKAA 4AQJA 1BODA 1KK7Y 1WLZA 1ZUZA 1W7IB 1ALWA 2JTZA 4GGNA 1ZOTB 1UWOA 3EK8A 1SR6C 2PVBA 1KSOA 3VGOA 1DC1A 1AVSA 3GK1A 4PHMA 1CDPA 1SMGA 1IJ6A 1CM4A 1K8UA 2AAOA 2LVKA 4A4CA 3S0GA 2KHNA 1TUJA 4DS7A 5FYXA 4DUQA 3EVVA 1CNPA 1R6PA 4GFTA 2ZN9A 1K90D 1YVLA 2BE4A 2L0PA 2LLUA 2MA2A 2WCJA 1U5IB 3S0EA 5PALA 3I5GB 2OS8C 2JOJA 3RM1A 3OB1B 3DF0B 3BJHA 1KQVA 3OBVA 1KWOC 2NXQA 1PVAA 1SPYA 1DJGA 5IBWA 1SCMB 3DVMA 1CFPA 2WOSA 1QWVA 2ERBA 2BCBA 3BFBA 3K21A 2KLEA 5B8IB 1QLSA 3FS7A 5KTYA 1DT7B 4OKHA 4YGAA 2LLSA 3CGAA 3D78A 1A2XA 1K95A 4XYNA 4GGFC 5ER4X 1UHNA 2K61A 1WRLA 1SR6B 5HKYA 5GQQC 1SBJA 3EK4A 1S1EA 3PM2A 1BR4B 1S36A 2BL0B 1IKUA 1EL4A 3S0DA 1NX3A 1RROA 5HKWA 1QS7A 1A75B 3B87A 3TDIA 1KFUS 2QDIA 2K7CA 4FQTA 2I7AA 2K7OA 4DCKA 1T14A 2K7DA 1M39A 1SY9A 1KK7Z 4ORCB 2SCPA 1B1GA 3WHUB 3HX4A 1F54A 1L2OC 1RK9A 2H61A 2LANA 1EXRA 1KSMA 1YTZC 2IS9A 4OVNF 1SL7A 5DICA 5FI7A 1NCZA 4U8DA 3AKBA 1CDLA 4GPLB 2KFFA 3JVTC 5D7FA 2M29A 1YUTA 2WCEA 4PHKA 4D1EA 2KGRA 3R72A 3OHMB 1TRFA 3NSKA 3FE6A 2Y4QA 4C0KA 2M49B 4OCIA 2QPTA 2L5XB 3I5FC 1SNLA 1RTP1 3DF0A 3DVJA 2M1KB 5CSIA 2K8MB 1XFRA 2BECA 2JPOA 2E30A 2LVIA 2MRDA 1EG3A 1MHOA 3BOWA 1BLQA 1CTRA 2PYQA 1F4QA 3OX6A 3SIBA 1GM0A 1B8LA 1MQ1A 1LINA 3IF7A 1IH0A 1S5GZ 1AP4A 2JC2A 4ZCUA 1YR5A 2VRGA 2BNXA 1NPQA 1SCMC 4HSZA 5CPVA 1CB1A 1IWQA 1JC2A 2EC6C 1BT6A 3PALA 2M8UA 1KFUL 2L51A 2P70A 1PALA 3RZSA 3FWCA 4P2YB 2KI4B 4CFQA 1SW8A 4QJ4B 1DJZA 2BBNA 4QJ3B 2ZFDA 3B88A 4PCWA 4GUKA 4F7FA 1FPWA 2LMUA 1FI6A 4INXA 1BG1A 1C7WA 1W7JB 3FE9A 1CDMA 5F6TA 2YGUA 2WC6A 1QASA 1ZFSA 4I5JA 4I5LB 1DJHA 1SCVA 1QIVA 1LVCD 1B7TY 2KPHA 1XK4A 5DKRA 1E8AA 2WCFA 1TIZA 2EGDA 3I5FB 4L9MA 3EKHA 5I2OA 2CBLA 1B47A 1YUSA 3GK4X 1XFZO 4I5KA 1S26D 4JQ0D 2CCMA 1IGVA 4PHNA 1TCOB 1JSAA 1C3YA 1KK8B 2K2FA 1NX1A 4MLWA 4CIDA 4NQGA 3CR2A 5I2LA 5JJGA 1Z4HA 1IG5A 3V2LA 2GV5A 4UPGA 4GBAA 1CLMA 4GGFA 1X02A 2WCMA 4XJKA 2QEOA 3PN7B 5HKZA 1K2HA 2QEVA 3SJSA 1BR1B 3BUOB 2PQLA 1AUIB 2WCKA 2L4IA 4JKTA 2LMVA 2WCLA 4MZJA 2JRFA 4MEWA 3CDNA 4C0LA 1F55A 4YGDB 3LL8B 3I5IB 1DF0B 3D74A 1MXLC 4OZDA 1OMRA 4CLNA 1MXEA 2K7BA 4PT1A 2HETA 1QTXA 3CLNA 3K1EA 3KPXA 1OQPA 1TWOA 3PSRA 2H61C 5HLVA 1C7VA 2FCDA 3Q8IA 2QEBA 3SG4A 1D1OA 2ZRSA 3DD4A 3O4XA 2M7LA 2FCEA 1CMFA 1F71A 2KSPA 3FIAA 3CABA 2JU0A 2LNKA 3D77A 4YI9A 2COLB 2FOTA 2LCPA 1C07A 1G8IA 1DGVA 3SG7A 4YGEB 1SRAA 4PE0A 1CLLA 1BJFA 2F33A 2G2BA 2WCBA 3DXLA 5I8NA 1IRJA 5DKNA 2CTNA 3BQ3A 1RECA 5G08A 4CPVA 2A4JA 1Y0VH 5CSJA 3FWBA 2BKIB 1YVHA 1M31A 1SYMA 2OS8B 1QX5B 3F45A 5D69A 1NX0A 1J1DA 1XFWO 1B7TZ 2O60A 1DEKA 3DZTA 3OB2B 5AXIA 3SIAA 4PHJA 3TZ1A 4AOMA 1WLMA 3PM8A 2JT0A 4M2OA 3PLFB 3FE8A 3SS3A 1WRZA 2BL0C 3QMEA 1XFVO 1QX2A 2L50A 3IQOA 1Y1XA 3IQQA 1KK8C 2TN4A 1J7PA 1UP5A 4OV2A 3SS4A 1JBAA 1TUZA 1HQVA 1ODBA 1U5IA 2LM5A 2I18A 3VRRA 1LS8A 1LKJA 1OOJA 2HQWA 4MN0A 1QXPA 4HREE 4GAOA 1OZOA 3GK2A 1P28A 1Y1UA 4F0ZB 3EK7A 2BKHB 3NGVA 1ZACA 1NSHA 5DKQA 2L2EA 2M97A 3WXAA 1KFXS 3TS5B 2LVVA 1CFFA 2NLNA 2JZIA 2HPSA 1PVBA 3BUNB 3NXAA 3CZ2A 1XYDA 1Y6WA 2KFGA 1A75A 1DJYA 2KNEA 2MLFC 1F4OA 2CNPA 1NX2A 2MLEC 1QLKA 3EKJA 3BFAA 3I5HB 2DOQA 2ZNEA 1WY9A 2KI6C 1YX8A 1WDCC 4ORAB 1W9ZA 3DY9A 3TUYC 1EJ3A 4NDCA 1OMDA 2KBIA 3C1VA 1K9PA 2AMIA 3B86A 3NHIA 1OW4A 2ZNDA 1V1GA 3BUMB 3BYAA 2WC8A 1PULA 3LCPC 3O6BA 3R1VA 1IIOA 3JTDC 1K96A 1B8RA 1MF8B 3ZWHA 3CZ0A 2KDHA 1QX7A 1TN4A 1V1FA 1YX7A 4NDBA 2KAXA 4MBEA 5AFPA 1XK4C 1YRUB 1F70A 1J7RA 2EC6B 1JFKA 3N7HA 4ORBB 1S6JA 3A4UB 3TUYB 1S5GY 1XFUO 2EHBA 4AQIA 1F8HA 1RJVA 1QJTA 1CM1A 1PSRA 3EG5B 1S6IA 1TCFA 3R1OA 1CKKA 1FW4A 1XO5A 1QIWA 2HQ8A 2WORA 3BOWB 1XVJA 4PALA 1ALVA 2GTEA 1DVIA 3ICBA 3MSEB 5I94A 4YGCB 4C0JA 3I5HC 4IL1A 1NCYA 3KHEA 1JFJA 2H2KA 1Z2CB 2NCPA 1JUOA 2GGMA 2QACA 1LA3A 2FJYA 2B1UA 3O78A 3IVTA 1J7QA 4I5NB 3AAJA 1IJ5A 1WRKA 3OX5A 1N2DA 3CYZA 3SS5A 4YGBB 3VRNA 3KF9A 3D0YB 1GGWA 3RLZA 2V53A 1OE9B 5BPJA 2BCXA 4BY4A 2PALA 2Y1MA 4N1FA 3VB1A 2KYFA 1B9AA 2I2RE 2M7NA 2MAZA 3NSLA 1N65A 4JPZB 3I5IC 4WQ3A 3TDUA 1NUBA 4CFRA 2LAPA 1TNWA 1OOIX 2K2AA 4PE1A 1DJXA 2L4HA 2OPOA 2KI6D 2LUXA 4QJ5B 2M0RA 2KQ6A 1TNPA 5TNCA 3S0FA 1L2OB 1L7ZA 2MBXA 2R2IA 2KLDA 2JT8A 2LHIA 5HLOA 1Y1AA 1LXFC 4DRWA 2KGBC 1JF0A 5K89A 2BCAA 2I94A 2WNDA 2LUCA 4ZCVA 4PE4A 1BMOA 3PFVA 1S6CA 1FF1A 2LMTA 2RGIA 4USLA 3AAKA 1UHIA 1DTLA 4KYNA 1DMOA 1H4BA 3VRPA 2F2OA 1UHHA 3JVTB 1BF5A 5AEQA 3L4AA 2OTGB 2JPTA 2G9BA 2BBMA 2ZN8A 1UHKA 3HCMA 2M9GA 1DGUA 3WHTB 2LHLA 4MVFA 5J3XA 2D8NA 2GGZA 1TOPA 2BAPA 4ETOA 2M1UA 1AJ5A 3OGNA 4R1EA 1KCYA 2E6WA 1GQMA 2MHHA 2QEHA 1S3PA 1H8BA 1B8CA 3R1PA 1GGZA 4WRIA 5HL1A 1K94A 5KU1A 3KO0A 1KQMB 1IQ5A 2K0JA 4ICBA 3KEVA 4DIRA 2WCHA 1BOCA 1MR8A 1M63B 1MWNA 2CT9A 2KBMA 3I5GC 3S0BA 2MJWB 1OOHA 2LP2A 2LP3A 4IJ7A 2PRUA 2KQYA
chains in the Genus database with same CATH topology
4FTGA 4PDZA 3D0YA 2JXLA 5ER5A 2KI4C 3DVEA 3O2PA 1OZSA 5AANA 1YUUA 4E68A 1JWDA 2PSRA 1QV0A 3SG5A 1XA5A 2Q4UA 1N0YA 1WDCB 3DVKA 3D10A 2OTGC 3WNXB 2L98A 1EH2A 1BU3A 1NCXA 3QRXA 3PN7C 1NIWA 3TS5C 2LV7A 1M45A 1EG4A 4A4BA 1FBVA 4N5XA 1K9UA 2NCOA 2KAYA 4YRUA 3M0WA 1SL8A 2BE6A 4FQOA 1RFJA 3CZTX 1LA0A 3LK0A 1K93D 1RWYA 3LLEA 1G33A 1HT9A 1NWDA 1QV1A 2LC5A 1NP8A 3CR4X 2PASA 4MZLA 3CTNA 1CLBA 1DJIA 4JWQA 2JWWA 2JT3A 2SASA 2JTTA 1CDNA 3SG2A 2M3WA 2JULA 4WQ2A 5JOLA 3O4YA 1Q80A 1ZMZA 1PRWA 2FJUB 2O5GA 1SKTA 4HRGA 1CFDA 4OR9B 1DF0A 1QVIY 1KQMC 3VROA 1TTXA 5KSZA 2KYCA 1M46A 1JF2A 1GJYA 2JXCA 1OSAA 1SL9A 3EVRA 2ISDA 1AJ4A 2KAVA 4TNCA 2HF5A 1TNQA 3OP0A 1UURA 1XFXO 3CWGA 4GNKB 3SG6A 3BUXB 3BXKA 1PK0D 3VRQA 2Y1NA 3EVUA 2JNFA 2LVJA 4PE7A 3E3RA 2AUCA 1KFXL 2ZKMX 4YI8A 3PATA 3GOFA 3TDZA 2KOTA 2NZ0A 3A8RA 3CS1A 4BY5A 2LE9B 2F2PA 3SG3A 5HYDA 1SK6D 2KFHA 4M2QA 1CMGA 2ZRTA 1PSBA 2LLTA 1AK8A 1OMVA 4M2PA 4Q04A 5CSFA 1G4YR 1YURA 1NYAA 2F3YA 1J7OA 5AERA 4MZKA 4N1GA 2Y5IA 2PMYA 3H4SE 2CXJA 3BUWB 4MRYA 1YRTB 1QATA 2JNXA 1UUSA 1J55A 4MSPA 1K9KA 2F3ZA 3NSIA 1UHJA 1AHRA 1A03A 1B4CA 5CSNA 1FI5A 2P6BB 1KWOB 4MRXA 1MUXA 3ZNIA 5I2QA 1XFYO 3CR5X 2F8PA 1A4PA 2JQ6A 4NDDA 3JTDB 1VRKA 1R2UA 1DJWA 4YBHB 4P5OE 1A29A 4HRHA 1IQ3A 1TNXA 3NSOA 2Q91A 3LK1A 1CFCA 1QVIZ 1J1EA 3AKAA 1BODA 4AQJA 1KK7Y 1WLZA 1ZUZA 1W7IB 1ALWA 2JTZA 4GGNA 1ZOTB 1UWOA 3EK8A 1SR6C 2PVBA 1KSOA 3VGOA 1AVSA 3GK1A 4PHMA 1CDPA 1SMGA 1IJ6A 1CM4A 1K8UA 2AAOA 2LVKA 4A4CA 2KHNA 4DS7A 1CNPA 5FYXA 4DUQA 3EVVA 1R6PA 4GFTA 2ZN9A 1K90D 1YVLA 2BE4A 2L0PA 2LLUA 2MA2A 1U5IB 5PALA 3I5GB 2OS8C 2JOJA 3RM1A 3OB1B 3DF0B 1KQVA 1KWOC 2NXQA 1PVAA 1SPYA 1DJGA 5IBWA 1SCMB 3DVMA 1CFPA 2WOSA 2BCBA 3K21A 5KTYA 5B8IB 1QLSA 3FS7A 1DT7B 4OKHA 4YGAA 2LLSA 3CGAA 1A2XA 1K95A 4XYNA 4GGFC 5ER4X 1UHNA 2K61A 1WRLA 1SR6B 5HKYA 5GQQC 1SBJA 3EK4A 1S1EA 1BR4B 1S36A 2BL0B 1IKUA 1EL4A 1NX3A 1RROA 5HKWA 1QS7A 1A75B 3TDIA 1KFUS 2K7CA 2I7AA 2K7OA 4DCKA 2K7DA 1M39A 1SY9A 1KK7Z 4ORCB 2SCPA 1B1GA 3WHUB 3HX4A 1F54A 1L2OC 1RK9A 2H61A 2LANA 1EXRA 1KSMA 1YTZC 2IS9A 4OVNF 1SL7A 3TUYB 1NCZA 4U8DA 3AKBA 1CDLA 4GPLB 2KFFA 3JVTC 5D7FA 2M29A 1YUTA 2WCEA 4PHKA 4D1EA 2KGRA 3OHMB 1TRFA 3NSKA 2Y4QA 4C0KA 2M49B 4OCIA 2QPTA 2L5XB 3I5FC 1SNLA 1RTP1 3DF0A 3DVJA 2M1KB 5CSIA 2K8MB 2BECA 2E30A 2LVIA 2MRDA 1EG3A 1MHOA 3BOWA 1BLQA 1CTRA 1F4QA 3OX6A 3SIBA 1B8LA 1MQ1A 1LINA 3IF7A 1IH0A 1S5GZ 2JC2A 4ZCUA 1YR5A 2VRGA 1NPQA 1SCMC 4HSZA 5CPVA 1CB1A 1JC2A 1IWQA 2EC6C 1BT6A 3PALA 2M8UA 1KFUL 2L51A 1PALA 3FWCA 4P2YB 2KI4B 4CFQA 1SW8A 4QJ4B 1DJZA 2BBNA 4QJ3B 2ZFDA 4PCWA 4GUKA 1FPWA 2LMUA 1FI6A 1BG1A 1C7WA 1W7JB 1CDMA 5F6TA 1QASA 1ZFSA 4I5JA 4I5LB 1DJHA 1SCVA 1QIVA 1LVCD 1B7TY 1XK4A 5DKRA 1E8AA 2WCFA 1TIZA 2EGDA 3I5FB 4L9MA 3EKHA 5I2OA 2CBLA 1B47A 1YUSA 3GK4X 1XFZO 4I5KA 1S26D 4JQ0D 2CCMA 1IGVA 4PHNA 1TCOB 1JSAA 1KK8B 2K2FA 1NX1A 4MLWA 4CIDA 4NQGA 3CR2A 5I2LA 5JJGA 1IG5A 2GV5A 4UPGA 4GBAA 1CLMA 4GGFA 1X02A 4XJKA 5HKZA 3PN7B 1K2HA 3SJSA 1BR1B 3BUOB 1AUIB 2L4IA 2LMVA 4MZJA 2JRFA 4MEWA 4C0LA 1F55A 4YGDB 3LL8B 3I5IB 1DF0B 1MXLC 1OMRA 4CLNA 1MXEA 2K7BA 4XJKB 2HETA 1QTXA 3CLNA 3KPXA 3PSRA 1OQPA 5HLVA 1C7VA 2H61C 2FCDA 3SG4A 1D1OA 2ZRSA 3DD4A 2M7LA 2FCEA 1CMFA 1F71A 2KSPA 3FIAA 2JU0A 2LNKA 4YI9A 2COLB 2FOTA 2LCPA 1C07A 1G8IA 1DGVA 3SG7A 4YGEB 1SRAA 4PE0A 1CLLA 1BJFA 2F33A 2G2BA 2WCBA 5I8NA 1IRJA 5DKNA 2CTNA 3BQ3A 1RECA 5G08A 4CPVA 2A4JA 1Y0VH 5CSJA 3FWBA 2BKIB 1YVHA 1M31A 1SYMA 2OS8B 1QX5B 3F45A 5D69A 1NX0A 1J1DA 1XFWO 1B7TZ 2O60A 3OB2B 5AXIA 3SIAA 4AOMA 1AP4A 4PHJA 3TZ1A 1WLMA 3PM8A 2JT0A 4M2OA 3PLFB 1WRZA 2BL0C 1XFVO 1QX2A 2L50A 3IQOA 1Y1XA 3IQQA 1KK8C 2TN4A 1J7PA 1UP5A 4OV2A 1JBAA 1HQVA 1ODBA 1U5IA 2LM5A 2I18A 3VRRA 1LKJA 1OOJA 2HQWA 4MN0A 1QXPA 4HREE 4GAOA 1OZOA 3GK2A 1Y1UA 4F0ZB 3EK7A 2BKHB 1ZACA 1NSHA 5DKQA 2L2EA 2M97A 3WXAA 1KFXS 3TS5B 2LVVA 1CFFA 2NLNA 2JZIA 2HPSA 1PVBA 3BUNB 3NXAA 1XYDA 1Y6WA 2KFGA 1A75A 1DJYA 2KNEA 2MLFC 1F4OA 2CNPA 1NX2A 2MLEC 1QLKA 3EKJA 3I5HB 2DOQA 2ZNEA 1WY9A 2KI6C 1YX8A 1WDCC 4ORAB 3TUYC 1EJ3A 4NDCA 1OMDA 2KBIA 3C1VA 1K9PA 2AMIA 3WHTB 2ZNDA 1V1GA 3BUMB 3BYAA 2WC8A 1PULA 3LCPC 3O6BA 3JTDC 1K96A 1B8RA 1MF8B 3ZWHA 2KDHA 1QX7A 1TN4A 1V1FA 1YX7A 4NDBA 2KAXA 4MBEA 5AFPA 1XK4C 1YRUB 1F70A 1J7RA 2EC6B 1JFKA 4ORBB 1S6JA 3A4UB 1S5GY 1XFUO 2EHBA 4AQIA 1F8HA 1RJVA 1QJTA 1CM1A 1PSRA 1S6IA 1TCFA 1CKKA 1FW4A 1XO5A 1QIWA 2HQ8A 2WORA 3BOWB 1XVJA 4PALA 1ALVA 1DVIA 3ICBA 3MSEB 4YGCB 4C0JA 3I5HC 4IL1A 1NCYA 3KHEA 1JFJA 2H2KA 2NCPA 1JUOA 2GGMA 2QACA 1LA3A 2B1UA 3O78A 1J7QA 4I5NB 3AAJA 1IJ5A 1WRKA 3OX5A 1N2DA 3VRNA 4YGBB 3KF9A 3D0YB 1GGWA 3RLZA 2V53A 1OE9B 5BPJA 2BCXA 4BY4A 2PALA 2Y1MA 4N1FA 2KYFA 1B9AA 2I2RE 2M7NA 2MAZA 3NSLA 1N65A 4JPZB 3I5IC 4WQ3A 3TDUA 1NUBA 4CFRA 2LAPA 1TNWA 2K2AA 4PE1A 1DJXA 2L4HA 2OPOA 2KI6D 2LUXA 4QJ5B 2M0RA 2KQ6A 1TNPA 5TNCA 1L2OB 1L7ZA 2MBXA 2R2IA 2JT8A 2LHIA 5HLOA 1Y1AA 1LXFC 4DRWA 2KGBC 1JF0A 5K89A 2BCAA 2I94A 2WNDA 2LUCA 4ZCVA 4PE4A 1BMOA 3PFVA 1S6CA 1FF1A 2LMTA 2RGIA 4USLA 3AAKA 1UHIA 1DTLA 1DMOA 1H4BA 3VRPA 2F2OA 1UHHA 3JVTB 1BF5A 5AEQA 2OTGB 2JPTA 2G9BA 2BBMA 2ZN8A 1UHKA 3HCMA 2M9GA 1DGUA 2LHLA 4MVFA 5J3XA 2D8NA 2GGZA 1TOPA 4ETOA 2M1UA 1AJ5A 1KCYA 4R1EA 2E6WA 1GQMA 2MHHA 1S3PA 1H8BA 1B8CA 1GGZA 4WRIA 1K94A 5KU1A 3KO0A 1KQMB 1IQ5A 2K0JA 4ICBA 3KEVA 4DIRA 1BOCA 1MR8A 1M63B 1MWNA 2CT9A 2KBMA 3I5GC 2MJWB 2LP2A 2LP3A 2PRUA 2KQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTG A;  4PDZ A;  3D0Y A;  2JXL A;  5ER5 A;  2KI4 C;  3DVE A;  3O2P A;  1OZS A;  5AAN A;  1YUU A;  4E68 A;  1JWD A;  2PSR A;  1QV0 A;  3SG5 A;  1XA5 A;  2Q4U A;  1N0Y A;  1WDC B;  3DVK A;  3D10 A;  2OTG C;  3WNX B;  2L98 A;  1EH2 A;  1BU3 A;  1NCX A;  3QRX A;  3PN7 C;  1NIW A;  3TS5 C;  2LV7 A;  1M45 A;  1EG4 A;  4A4B A;  1FBV A;  4N5X A;  1K9U A;  2NCO A;  2KAY A;  4YRU A;  3M0W A;  1SL8 A;  2BE6 A;  4FQO A;  1RFJ A;  3CZT X;  1LA0 A;  3LK0 A;  1K93 D;  1RWY A;  3LLE A;  1G33 A;  1HT9 A;  1NWD A;  1QV1 A;  2LC5 A;  1NP8 A;  3CR4 X;  2PAS A;  4MZL A;  3CTN A;  1CLB A;  1DJI A;  4JWQ A;  2JWW A;  2JT3 A;  2SAS A;  2JTT A;  1CDN A;  3SG2 A;  2M3W A;  2JUL A;  4WQ2 A;  5JOL A;  3O4Y A;  1Q80 A;  1ZMZ A;  1PRW A;  2FJU B;  2O5G A;  1SKT A;  4HRG A;  1CFD A;  4OR9 B;  1DF0 A;  1QVI Y;  1KQM C;  3VRO A;  1TTX A;  5KSZ A;  2KYC A;  1M46 A;  1JF2 A;  1GJY A;  2JXC A;  1OSA A;  1SL9 A;  3EVR A;  2ISD A;  1AJ4 A;  2KAV A;  4TNC A;  2HF5 A;  1TNQ A;  3OP0 A;  1UUR A;  1XFX O;  3CWG A;  4GNK B;  3SG6 A;  3BUX B;  3BXK A;  1PK0 D;  3VRQ A;  2Y1N A;  3EVU A;  2JNF A;  2LVJ A;  4PE7 A;  3E3R A;  2AUC A;  1KFX L;  2ZKM X;  4YI8 A;  3PAT A;  3GOF A;  3TDZ A;  2KOT A;  2NZ0 A;  3A8R A;  3CS1 A;  4BY5 A;  2LE9 B;  2F2P A;  3SG3 A;  5HYD A;  1SK6 D;  2KFH A;  4M2Q A;  1CMG A;  2ZRT A;  1PSB A;  2LLT A;  1AK8 A;  1OMV A;  4M2P A;  4Q04 A;  5CSF A;  1G4Y R;  1YUR A;  1NYA A;  2F3Y A;  1J7O A;  5AER A;  4MZK A;  4N1G A;  2Y5I A;  2PMY A;  3H4S E;  2CXJ A;  3BUW B;  4MRY A;  1YRT B;  1QAT A;  2JNX A;  1UUS A;  1J55 A;  4MSP A;  1K9K A;  2F3Z A;  3NSI A;  1UHJ A;  1AHR A;  1A03 A;  1B4C A;  5CSN A;  1FI5 A;  2P6B B;  1KWO B;  4MRX A;  1MUX A;  3ZNI A;  5I2Q A;  1XFY O;  3CR5 X;  2F8P A;  1A4P A;  2JQ6 A;  4NDD A;  3JTD B;  1VRK A;  1R2U A;  1DJW A;  4YBH B;  4P5O E;  1A29 A;  4HRH A;  1IQ3 A;  1TNX A;  3NSO A;  2Q91 A;  3LK1 A;  1CFC A;  1QVI Z;  1J1E A;  3AKA A;  1BOD A;  4AQJ A;  1KK7 Y;  1WLZ A;  1ZUZ A;  1W7I B;  1ALW A;  2JTZ A;  4GGN A;  1ZOT B;  1UWO A;  3EK8 A;  1SR6 C;  2PVB A;  1KSO A;  3VGO A;  1AVS A;  3GK1 A;  4PHM A;  1CDP A;  1SMG A;  1IJ6 A;  1CM4 A;  1K8U A;  2AAO A;  2LVK A;  4A4C A;  2KHN A;  4DS7 A;  1CNP A;  5FYX A;  4DUQ A;  3EVV A;  1R6P A;  4GFT A;  2ZN9 A;  1K90 D;  1YVL A;  2BE4 A;  2L0P A;  2LLU A;  2MA2 A;  1U5I B;  5PAL A;  3I5G B;  2OS8 C;  2JOJ A;  3RM1 A;  3OB1 B;  3DF0 B;  1KQV A;  1KWO C;  2NXQ A;  1PVA A;  1SPY A;  1DJG A;  5IBW A;  1SCM B;  3DVM A;  1CFP A;  2WOS A;  2BCB A;  3K21 A;  5KTY A;  5B8I B;  1QLS A;  3FS7 A;  1DT7 B;  4OKH A;  4YGA A;  2LLS A;  3CGA A;  1A2X A;  1K95 A;  4XYN A;  4GGF C;  5ER4 X;  1UHN A;  2K61 A;  1WRL A;  1SR6 B;  5HKY A;  5GQQ C;  1SBJ A;  3EK4 A;  1S1E A;  1BR4 B;  1S36 A;  2BL0 B;  1IKU A;  1EL4 A;  1NX3 A;  1RRO A;  5HKW A;  1QS7 A;  1A75 B;  3TDI A;  1KFU S;  2K7C A;  2I7A A;  2K7O A;  4DCK A;  2K7D A;  1M39 A;  1SY9 A;  1KK7 Z;  4ORC B;  2SCP A;  1B1G A;  3WHU B;  3HX4 A;  1F54 A;  1L2O C;  1RK9 A;  2H61 A;  2LAN A;  1EXR A;  1KSM A;  1YTZ C;  2IS9 A;  4OVN F;  1SL7 A;  3TUY B;  1NCZ A;  4U8D A;  3AKB A;  1CDL A;  4GPL B;  2KFF A;  3JVT C;  5D7F A;  2M29 A;  1YUT A;  2WCE A;  4PHK A;  4D1E A;  2KGR A;  3OHM B;  1TRF A;  3NSK A;  2Y4Q A;  4C0K A;  2M49 B;  4OCI A;  2QPT A;  2L5X B;  3I5F C;  1SNL A;  1RTP 1;  3DF0 A;  3DVJ A;  2M1K B;  5CSI A;  2K8M B;  2BEC A;  2E30 A;  2LVI A;  2MRD A;  1EG3 A;  1MHO A;  3BOW A;  1BLQ A;  1CTR A;  1F4Q A;  3OX6 A;  3SIB A;  1B8L A;  1MQ1 A;  1LIN A;  3IF7 A;  1IH0 A;  1S5G Z;  2JC2 A;  4ZCU A;  1YR5 A;  2VRG A;  1NPQ A;  1SCM C;  4HSZ A;  5CPV A;  1CB1 A;  1JC2 A;  1IWQ A;  2EC6 C;  1BT6 A;  3PAL A;  2M8U A;  1KFU L;  2L51 A;  1PAL A;  3FWC A;  4P2Y B;  2KI4 B;  4CFQ A;  1SW8 A;  4QJ4 B;  1DJZ A;  2BBN A;  4QJ3 B;  2ZFD A;  4PCW A;  4GUK A;  1FPW A;  2LMU A;  1FI6 A;  1BG1 A;  1C7W A;  1W7J B;  1CDM A;  5F6T A;  1QAS A;  1ZFS A;  4I5J A;  4I5L B;  1DJH A;  1SCV A;  1QIV A;  1LVC D;  1B7T Y;  1XK4 A;  5DKR A;  1E8A A;  2WCF A;  1TIZ A;  2EGD A;  3I5F B;  4L9M A;  3EKH A;  5I2O A;  2CBL A;  1B47 A;  1YUS A;  3GK4 X;  1XFZ O;  4I5K A;  1S26 D;  4JQ0 D;  2CCM A;  1IGV A;  4PHN A;  1TCO B;  1JSA A;  1KK8 B;  2K2F A;  1NX1 A;  4MLW A;  4CID A;  4NQG A;  3CR2 A;  5I2L A;  5JJG A;  1IG5 A;  2GV5 A;  4UPG A;  4GBA A;  1CLM A;  4GGF A;  1X02 A;  4XJK A;  5HKZ A;  3PN7 B;  1K2H A;  3SJS A;  1BR1 B;  3BUO B;  1AUI B;  2L4I A;  2LMV A;  4MZJ A;  2JRF A;  4MEW A;  4C0L A;  1F55 A;  4YGD B;  3LL8 B;  3I5I B;  1DF0 B;  1MXL C;  1OMR A;  4CLN A;  1MXE A;  2K7B A;  4XJK B;  2HET A;  1QTX A;  3CLN A;  3KPX A;  3PSR A;  1OQP A;  5HLV A;  1C7V A;  2H61 C;  2FCD A;  3SG4 A;  1D1O A;  2ZRS A;  3DD4 A;  2M7L A;  2FCE A;  1CMF A;  1F71 A;  2KSP A;  3FIA A;  2JU0 A;  2LNK A;  4YI9 A;  2COL B;  2FOT A;  2LCP A;  1C07 A;  1G8I A;  1DGV A;  3SG7 A;  4YGE B;  1SRA A;  4PE0 A;  1CLL A;  1BJF A;  2F33 A;  2G2B A;  2WCB A;  5I8N A;  1IRJ A;  5DKN A;  2CTN A;  3BQ3 A;  1REC A;  5G08 A;  4CPV A;  2A4J A;  1Y0V H;  5CSJ A;  3FWB A;  2BKI B;  1YVH A;  1M31 A;  1SYM A;  2OS8 B;  1QX5 B;  3F45 A;  5D69 A;  1NX0 A;  1J1D A;  1XFW O;  1B7T Z;  2O60 A;  3OB2 B;  5AXI A;  3SIA A;  4AOM A;  1AP4 A;  4PHJ A;  3TZ1 A;  1WLM A;  3PM8 A;  2JT0 A;  4M2O A;  3PLF B;  1WRZ A;  2BL0 C;  1XFV O;  1QX2 A;  2L50 A;  3IQO A;  1Y1X A;  3IQQ A;  1KK8 C;  2TN4 A;  1J7P A;  1UP5 A;  4OV2 A;  1JBA A;  1HQV A;  1ODB A;  1U5I A;  2LM5 A;  2I18 A;  3VRR A;  1LKJ A;  1OOJ A;  2HQW A;  4MN0 A;  1QXP A;  4HRE E;  4GAO A;  1OZO A;  3GK2 A;  1Y1U A;  4F0Z B;  3EK7 A;  2BKH B;  1ZAC A;  1NSH A;  5DKQ A;  2L2E A;  2M97 A;  3WXA A;  1KFX S;  3TS5 B;  2LVV A;  1CFF A;  2NLN A;  2JZI A;  2HPS A;  1PVB A;  3BUN B;  3NXA A;  1XYD A;  1Y6W A;  2KFG A;  1A75 A;  1DJY A;  2KNE A;  2MLF C;  1F4O A;  2CNP A;  1NX2 A;  2MLE C;  1QLK A;  3EKJ A;  3I5H B;  2DOQ A;  2ZNE A;  1WY9 A;  2KI6 C;  1YX8 A;  1WDC C;  4ORA B;  3TUY C;  1EJ3 A;  4NDC A;  1OMD A;  2KBI A;  3C1V A;  1K9P A;  2AMI A;  3WHT B;  2ZND A;  1V1G A;  3BUM B;  3BYA A;  2WC8 A;  1PUL A;  3LCP C;  3O6B A;  3JTD C;  1K96 A;  1B8R A;  1MF8 B;  3ZWH A;  2KDH A;  1QX7 A;  1TN4 A;  1V1F A;  1YX7 A;  4NDB A;  2KAX A;  4MBE A;  5AFP A;  1XK4 C;  1YRU B;  1F70 A;  1J7R A;  2EC6 B;  1JFK A;  4ORB B;  1S6J A;  3A4U B;  1S5G Y;  1XFU O;  2EHB A;  4AQI A;  1F8H A;  1RJV A;  1QJT A;  1CM1 A;  1PSR A;  1S6I A;  1TCF A;  1CKK A;  1FW4 A;  1XO5 A;  1QIW A;  2HQ8 A;  2WOR A;  3BOW B;  1XVJ A;  4PAL A;  1ALV A;  1DVI A;  3ICB A;  3MSE B;  4YGC B;  4C0J A;  3I5H C;  4IL1 A;  1NCY A;  3KHE A;  1JFJ A;  2H2K A;  2NCP A;  1JUO A;  2GGM A;  2QAC A;  1LA3 A;  2B1U A;  3O78 A;  1J7Q A;  4I5N B;  3AAJ A;  1IJ5 A;  1WRK A;  3OX5 A;  1N2D A;  3VRN A;  4YGB B;  3KF9 A;  3D0Y B;  1GGW A;  3RLZ A;  2V53 A;  1OE9 B;  5BPJ A;  2BCX A;  4BY4 A;  2PAL A;  2Y1M A;  4N1F A;  2KYF A;  1B9A A;  2I2R E;  2M7N A;  2MAZ A;  3NSL A;  1N65 A;  4JPZ B;  3I5I C;  4WQ3 A;  3TDU A;  1NUB A;  4CFR A;  2LAP A;  1TNW A;  2K2A A;  4PE1 A;  1DJX A;  2L4H A;  2OPO A;  2KI6 D;  2LUX A;  4QJ5 B;  2M0R A;  2KQ6 A;  1TNP A;  5TNC A;  1L2O B;  1L7Z A;  2MBX A;  2R2I A;  2JT8 A;  2LHI A;  5HLO A;  1Y1A A;  1LXF C;  4DRW A;  2KGB C;  1JF0 A;  5K89 A;  2BCA A;  2I94 A;  2WND A;  2LUC A;  4ZCV A;  4PE4 A;  1BMO A;  3PFV A;  1S6C A;  1FF1 A;  2LMT A;  2RGI A;  4USL A;  3AAK A;  1UHI A;  1DTL A;  1DMO A;  1H4B A;  3VRP A;  2F2O A;  1UHH A;  3JVT B;  1BF5 A;  5AEQ A;  2OTG B;  2JPT A;  2G9B A;  2BBM A;  2ZN8 A;  1UHK A;  3HCM A;  2M9G A;  1DGU A;  2LHL A;  4MVF A;  5J3X A;  2D8N A;  2GGZ A;  1TOP A;  4ETO A;  2M1U A;  1AJ5 A;  1KCY A;  4R1E A;  2E6W A;  1GQM A;  2MHH A;  1S3P A;  1H8B A;  1B8C A;  1GGZ A;  4WRI A;  1K94 A;  5KU1 A;  3KO0 A;  1KQM B;  1IQ5 A;  2K0J A;  4ICB A;  3KEV A;  4DIR A;  1BOC A;  1MR8 A;  1M63 B;  1MWN A;  2CT9 A;  2KBM A;  3I5G C;  2MJW B;  2LP2 A;  2LP3 A;  2PRU A;  2KQY A; 
#chains in the Genus database with same CATH topology
 4FTG A;  4PDZ A;  3D0Y A;  2JXL A;  5ER5 A;  2KI4 C;  3DVE A;  3O2P A;  1OZS A;  5AAN A;  1YUU A;  4E68 A;  1JWD A;  2PSR A;  1QV0 A;  3SG5 A;  1XA5 A;  2Q4U A;  1N0Y A;  1WDC B;  3DVK A;  3D10 A;  2OTG C;  3WNX B;  1C3Z A;  2L98 A;  1EH2 A;  1BU3 A;  1NCX A;  3QRX A;  1OOF A;  3PN7 C;  1NIW A;  3TS5 C;  2LV7 A;  1M45 A;  1EG4 A;  4A4B A;  1FBV A;  4N5X A;  1K9U A;  2NCO A;  2KAY A;  1OOG A;  3UO9 A;  4YRU A;  3M0W A;  3S0A A;  1SL8 A;  2BE6 A;  4FQO A;  1RFJ A;  3CZT X;  1LA0 A;  3LK0 A;  1K93 D;  1RWY A;  3D73 A;  3LLE A;  1G33 A;  2L2C A;  1HT9 A;  1NWD A;  5FI6 A;  1QV1 A;  2LC5 A;  3L47 A;  1NP8 A;  3CR4 X;  2PAS A;  4MZL A;  3CTN A;  1CLB A;  1DJI A;  3D75 A;  4JWQ A;  2JWW A;  2JT3 A;  2SAS A;  2JTT A;  1CDN A;  3SG2 A;  2M3W A;  2JUL A;  4WQ2 A;  5JOL A;  3O4Y A;  1Q80 A;  1ZMZ A;  3D76 A;  1PRW A;  2FJU B;  2O5G A;  1SKT A;  4HRG A;  4XJK B;  3UNW A;  1CFD A;  4INW A;  4OR9 B;  3NHT A;  1DF0 A;  1QVI Y;  1KQM C;  3VRO A;  1TTX A;  5KSZ A;  2KYC A;  1M46 A;  1JF2 A;  1GJY A;  2JXC A;  1OSA A;  1SL9 A;  3EVR A;  2ISD A;  1AJ4 A;  2KAV A;  4TNC A;  2HF5 A;  1TNQ A;  3OP0 A;  1UUR A;  1XFX O;  3CWG A;  4GNK B;  3SG6 A;  3BUX B;  3BXK A;  1PK0 D;  3VRQ A;  2Y1N A;  3EVU A;  2JNF A;  3PJI A;  2LVJ A;  4PE7 A;  3E3R A;  2AUC A;  1KFX L;  2ZKM X;  4YI8 A;  3PAT A;  3GOF A;  3TDZ A;  1DQE A;  2KOT A;  2H8V A;  2L5Y A;  2NZ0 A;  3A8R A;  2LE9 B;  2F2P A;  3CS1 A;  5FI2 A;  4BY5 A;  3SG3 A;  3B7A A;  5HYD A;  1SK6 D;  2KFH A;  4M2Q A;  1CMG A;  3CZ1 A;  2ZRT A;  3DYE A;  1PSB A;  2LLT A;  3L4L A;  3B6X A;  1AK8 A;  1OMV A;  4M2P A;  4Q04 A;  5CSF A;  1G4Y R;  1YUR A;  1NYA A;  2F3Y A;  1J7O A;  5AER A;  4MZK A;  4N1G A;  2Y5I A;  2PMY A;  1ORG A;  3H4S E;  2CXJ A;  3BUW B;  4MRY A;  1YRT B;  4JD9 A;  1QAT A;  2JNX A;  1UUS A;  1J55 A;  4MSP A;  1K9K A;  2F3Z A;  3NSI A;  1UHJ A;  1AHR A;  1A03 A;  1B4C A;  5CSN A;  1FI5 A;  2P6B B;  1KWO B;  4MRX A;  5EL2 A;  1MUX A;  1SSE B;  3ZNI A;  5I2Q A;  1XFY O;  3CR5 X;  2F8P A;  2K60 A;  2WC5 A;  1A4P A;  2JQ6 A;  3BFH A;  3JTD B;  1VRK A;  1R2U A;  4NDD A;  1DJW A;  4YBH B;  4P5O E;  1A29 A;  4HRH A;  5D3O A;  1IQ3 A;  1TNX A;  1DEL A;  3NSO A;  2Q91 A;  3LK1 A;  1CFC A;  1QVI Z;  1J1E A;  2P71 A;  3AKA A;  4AQJ A;  1BOD A;  1KK7 Y;  1WLZ A;  1ZUZ A;  1W7I B;  1ALW A;  2JTZ A;  4GGN A;  1ZOT B;  1UWO A;  3EK8 A;  1SR6 C;  2PVB A;  1KSO A;  3VGO A;  1DC1 A;  1AVS A;  3GK1 A;  4PHM A;  1CDP A;  1SMG A;  1IJ6 A;  1CM4 A;  1K8U A;  2AAO A;  2LVK A;  4A4C A;  3S0G A;  2KHN A;  1TUJ A;  4DS7 A;  5FYX A;  4DUQ A;  3EVV A;  1CNP A;  1R6P A;  4GFT A;  2ZN9 A;  1K90 D;  1YVL A;  2BE4 A;  2L0P A;  2LLU A;  2MA2 A;  2WCJ A;  1U5I B;  3S0E A;  5PAL A;  3I5G B;  2OS8 C;  2JOJ A;  3RM1 A;  3OB1 B;  3DF0 B;  3BJH A;  1KQV A;  3OBV A;  1KWO C;  2NXQ A;  1PVA A;  1SPY A;  1DJG A;  5IBW A;  1SCM B;  3DVM A;  1CFP A;  2WOS A;  1QWV A;  2ERB A;  2BCB A;  3BFB A;  3K21 A;  2KLE A;  5B8I B;  1QLS A;  3FS7 A;  5KTY A;  1DT7 B;  4OKH A;  4YGA A;  2LLS A;  3CGA A;  3D78 A;  1A2X A;  1K95 A;  4XYN A;  4GGF C;  5ER4 X;  1UHN A;  2K61 A;  1WRL A;  1SR6 B;  5HKY A;  5GQQ C;  1SBJ A;  3EK4 A;  1S1E A;  3PM2 A;  1BR4 B;  1S36 A;  2BL0 B;  1IKU A;  1EL4 A;  3S0D A;  1NX3 A;  1RRO A;  5HKW A;  1QS7 A;  1A75 B;  3B87 A;  3TDI A;  1KFU S;  2QDI A;  2K7C A;  4FQT A;  2I7A A;  2K7O A;  4DCK A;  1T14 A;  2K7D A;  1M39 A;  1SY9 A;  1KK7 Z;  4ORC B;  2SCP A;  1B1G A;  3WHU B;  3HX4 A;  1F54 A;  1L2O C;  1RK9 A;  2H61 A;  2LAN A;  1EXR A;  1KSM A;  1YTZ C;  2IS9 A;  4OVN F;  1SL7 A;  5DIC A;  5FI7 A;  1NCZ A;  4U8D A;  3AKB A;  1CDL A;  4GPL B;  2KFF A;  3JVT C;  5D7F A;  2M29 A;  1YUT A;  2WCE A;  4PHK A;  4D1E A;  2KGR A;  3R72 A;  3OHM B;  1TRF A;  3NSK A;  3FE6 A;  2Y4Q A;  4C0K A;  2M49 B;  4OCI A;  2QPT A;  2L5X B;  3I5F C;  1SNL A;  1RTP 1;  3DF0 A;  3DVJ A;  2M1K B;  5CSI A;  2K8M B;  1XFR A;  2BEC A;  2JPO A;  2E30 A;  2LVI A;  2MRD A;  1EG3 A;  1MHO A;  3BOW A;  1BLQ A;  1CTR A;  2PYQ A;  1F4Q A;  3OX6 A;  3SIB A;  1GM0 A;  1B8L A;  1MQ1 A;  1LIN A;  3IF7 A;  1IH0 A;  1S5G Z;  1AP4 A;  2JC2 A;  4ZCU A;  1YR5 A;  2VRG A;  2BNX A;  1NPQ A;  1SCM C;  4HSZ A;  5CPV A;  1CB1 A;  1IWQ A;  1JC2 A;  2EC6 C;  1BT6 A;  3PAL A;  2M8U A;  1KFU L;  2L51 A;  2P70 A;  1PAL A;  3RZS A;  3FWC A;  4P2Y B;  2KI4 B;  4CFQ A;  1SW8 A;  4QJ4 B;  1DJZ A;  2BBN A;  4QJ3 B;  2ZFD A;  3B88 A;  4PCW A;  4GUK A;  4F7F A;  1FPW A;  2LMU A;  1FI6 A;  4INX A;  1BG1 A;  1C7W A;  1W7J B;  3FE9 A;  1CDM A;  5F6T A;  2YGU A;  2WC6 A;  1QAS A;  1ZFS A;  4I5J A;  4I5L B;  1DJH A;  1SCV A;  1QIV A;  1LVC D;  1B7T Y;  2KPH A;  1XK4 A;  5DKR A;  1E8A A;  2WCF A;  1TIZ A;  2EGD A;  3I5F B;  4L9M A;  3EKH A;  5I2O A;  2CBL A;  1B47 A;  1YUS A;  3GK4 X;  1XFZ O;  4I5K A;  1S26 D;  4JQ0 D;  2CCM A;  1IGV A;  4PHN A;  1TCO B;  1JSA A;  1C3Y A;  1KK8 B;  2K2F A;  1NX1 A;  4MLW A;  4CID A;  4NQG A;  3CR2 A;  5I2L A;  5JJG A;  1Z4H A;  1IG5 A;  3V2L A;  2GV5 A;  4UPG A;  4GBA A;  1CLM A;  4GGF A;  1X02 A;  2WCM A;  4XJK A;  2QEO A;  3PN7 B;  5HKZ A;  1K2H A;  2QEV A;  3SJS A;  1BR1 B;  3BUO B;  2PQL A;  1AUI B;  2WCK A;  2L4I A;  4JKT A;  2LMV A;  2WCL A;  4MZJ A;  2JRF A;  4MEW A;  3CDN A;  4C0L A;  1F55 A;  4YGD B;  3LL8 B;  3I5I B;  1DF0 B;  3D74 A;  1MXL C;  4OZD A;  1OMR A;  4CLN A;  1MXE A;  2K7B A;  4PT1 A;  2HET A;  1QTX A;  3CLN A;  3K1E A;  3KPX A;  1OQP A;  1TWO A;  3PSR A;  2H61 C;  5HLV A;  1C7V A;  2FCD A;  3Q8I A;  2QEB A;  3SG4 A;  1D1O A;  2ZRS A;  3DD4 A;  3O4X A;  2M7L A;  2FCE A;  1CMF A;  1F71 A;  2KSP A;  3FIA A;  3CAB A;  2JU0 A;  2LNK A;  3D77 A;  4YI9 A;  2COL B;  2FOT A;  2LCP A;  1C07 A;  1G8I A;  1DGV A;  3SG7 A;  4YGE B;  1SRA A;  4PE0 A;  1CLL A;  1BJF A;  2F33 A;  2G2B A;  2WCB A;  3DXL A;  5I8N A;  1IRJ A;  5DKN A;  2CTN A;  3BQ3 A;  1REC A;  5G08 A;  4CPV A;  2A4J A;  1Y0V H;  5CSJ A;  3FWB A;  2BKI B;  1YVH A;  1M31 A;  1SYM A;  2OS8 B;  1QX5 B;  3F45 A;  5D69 A;  1NX0 A;  1J1D A;  1XFW O;  1B7T Z;  2O60 A;  1DEK A;  3DZT A;  3OB2 B;  5AXI A;  3SIA A;  4PHJ A;  3TZ1 A;  4AOM A;  1WLM A;  3PM8 A;  2JT0 A;  4M2O A;  3PLF B;  3FE8 A;  3SS3 A;  1WRZ A;  2BL0 C;  3QME A;  1XFV O;  1QX2 A;  2L50 A;  3IQO A;  1Y1X A;  3IQQ A;  1KK8 C;  2TN4 A;  1J7P A;  1UP5 A;  4OV2 A;  3SS4 A;  1JBA A;  1TUZ A;  1HQV A;  1ODB A;  1U5I A;  2LM5 A;  2I18 A;  3VRR A;  1LS8 A;  1LKJ A;  1OOJ A;  2HQW A;  4MN0 A;  1QXP A;  4HRE E;  4GAO A;  1OZO A;  3GK2 A;  1P28 A;  1Y1U A;  4F0Z B;  3EK7 A;  2BKH B;  3NGV A;  1ZAC A;  1NSH A;  5DKQ A;  2L2E A;  2M97 A;  3WXA A;  1KFX S;  3TS5 B;  2LVV A;  1CFF A;  2NLN A;  2JZI A;  2HPS A;  1PVB A;  3BUN B;  3NXA A;  3CZ2 A;  1XYD A;  1Y6W A;  2KFG A;  1A75 A;  1DJY A;  2KNE A;  2MLF C;  1F4O A;  2CNP A;  1NX2 A;  2MLE C;  1QLK A;  3EKJ A;  3BFA A;  3I5H B;  2DOQ A;  2ZNE A;  1WY9 A;  2KI6 C;  1YX8 A;  1WDC C;  4ORA B;  1W9Z A;  3DY9 A;  3TUY C;  1EJ3 A;  4NDC A;  1OMD A;  2KBI A;  3C1V A;  1K9P A;  2AMI A;  3B86 A;  3NHI A;  1OW4 A;  2ZND A;  1V1G A;  3BUM B;  3BYA A;  2WC8 A;  1PUL A;  3LCP C;  3O6B A;  3R1V A;  1IIO A;  3JTD C;  1K96 A;  1B8R A;  1MF8 B;  3ZWH A;  3CZ0 A;  2KDH A;  1QX7 A;  1TN4 A;  1V1F A;  1YX7 A;  4NDB A;  2KAX A;  4MBE A;  5AFP A;  1XK4 C;  1YRU B;  1F70 A;  1J7R A;  2EC6 B;  1JFK A;  3N7H A;  4ORB B;  1S6J A;  3A4U B;  3TUY B;  1S5G Y;  1XFU O;  2EHB A;  4AQI A;  1F8H A;  1RJV A;  1QJT A;  1CM1 A;  1PSR A;  3EG5 B;  1S6I A;  1TCF A;  3R1O A;  1CKK A;  1FW4 A;  1XO5 A;  1QIW A;  2HQ8 A;  2WOR A;  3BOW B;  1XVJ A;  4PAL A;  1ALV A;  2GTE A;  1DVI A;  3ICB A;  3MSE B;  5I94 A;  4YGC B;  4C0J A;  3I5H C;  4IL1 A;  1NCY A;  3KHE A;  1JFJ A;  2H2K A;  1Z2C B;  2NCP A;  1JUO A;  2GGM A;  2QAC A;  1LA3 A;  2FJY A;  2B1U A;  3O78 A;  3IVT A;  1J7Q A;  4I5N B;  3AAJ A;  1IJ5 A;  1WRK A;  3OX5 A;  1N2D A;  3CYZ A;  3SS5 A;  4YGB B;  3VRN A;  3KF9 A;  3D0Y B;  1GGW A;  3RLZ A;  2V53 A;  1OE9 B;  5BPJ A;  2BCX A;  4BY4 A;  2PAL A;  2Y1M A;  4N1F A;  3VB1 A;  2KYF A;  1B9A A;  2I2R E;  2M7N A;  2MAZ A;  3NSL A;  1N65 A;  4JPZ B;  3I5I C;  4WQ3 A;  3TDU A;  1NUB A;  4CFR A;  2LAP A;  1TNW A;  1OOI X;  2K2A A;  4PE1 A;  1DJX A;  2L4H A;  2OPO A;  2KI6 D;  2LUX A;  4QJ5 B;  2M0R A;  2KQ6 A;  1TNP A;  5TNC A;  3S0F A;  1L2O B;  1L7Z A;  2MBX A;  2R2I A;  2KLD A;  2JT8 A;  2LHI A;  5HLO A;  1Y1A A;  1LXF C;  4DRW A;  2KGB C;  1JF0 A;  5K89 A;  2BCA A;  2I94 A;  2WND A;  2LUC A;  4ZCV A;  4PE4 A;  1BMO A;  3PFV A;  1S6C A;  1FF1 A;  2LMT A;  2RGI A;  4USL A;  3AAK A;  1UHI A;  1DTL A;  4KYN A;  1DMO A;  1H4B A;  3VRP A;  2F2O A;  1UHH A;  3JVT B;  1BF5 A;  5AEQ A;  3L4A A;  2OTG B;  2JPT A;  2G9B A;  2BBM A;  2ZN8 A;  1UHK A;  3HCM A;  2M9G A;  1DGU A;  3WHT B;  2LHL A;  4MVF A;  5J3X A;  2D8N A;  2GGZ A;  1TOP A;  2BAP A;  4ETO A;  2M1U A;  1AJ5 A;  3OGN A;  4R1E A;  1KCY A;  2E6W A;  1GQM A;  2MHH A;  2QEH A;  1S3P A;  1H8B A;  1B8C A;  3R1P A;  1GGZ A;  4WRI A;  5HL1 A;  1K94 A;  5KU1 A;  3KO0 A;  1KQM B;  1IQ5 A;  2K0J A;  4ICB A;  3KEV A;  4DIR A;  2WCH A;  1BOC A;  1MR8 A;  1M63 B;  1MWN A;  2CT9 A;  2KBM A;  3I5G C;  3S0B A;  2MJW B;  1OOH A;  2LP2 A;  2LP3 A;  4IJ7 A;  2PRU A;  2KQY A; 
#chains in the Genus database with same CATH homology
 4FTG A;  4PDZ A;  3D0Y A;  2JXL A;  5ER5 A;  2KI4 C;  3DVE A;  3O2P A;  1OZS A;  5AAN A;  1YUU A;  4E68 A;  1JWD A;  2PSR A;  1QV0 A;  3SG5 A;  1XA5 A;  2Q4U A;  1N0Y A;  1WDC B;  3DVK A;  3D10 A;  2OTG C;  3WNX B;  2L98 A;  1EH2 A;  1BU3 A;  1NCX A;  3QRX A;  3PN7 C;  1NIW A;  3TS5 C;  2LV7 A;  1M45 A;  1EG4 A;  4A4B A;  1FBV A;  4N5X A;  1K9U A;  2NCO A;  2KAY A;  4YRU A;  3M0W A;  1SL8 A;  2BE6 A;  4FQO A;  1RFJ A;  3CZT X;  1LA0 A;  3LK0 A;  1K93 D;  1RWY A;  3LLE A;  1G33 A;  1HT9 A;  1NWD A;  1QV1 A;  2LC5 A;  1NP8 A;  3CR4 X;  2PAS A;  4MZL A;  3CTN A;  1CLB A;  1DJI A;  4JWQ A;  2JWW A;  2JT3 A;  2SAS A;  2JTT A;  1CDN A;  3SG2 A;  2M3W A;  2JUL A;  4WQ2 A;  5JOL A;  3O4Y A;  1Q80 A;  1ZMZ A;  1PRW A;  2FJU B;  2O5G A;  1SKT A;  4HRG A;  1CFD A;  4OR9 B;  1DF0 A;  1QVI Y;  1KQM C;  3VRO A;  1TTX A;  5KSZ A;  2KYC A;  1M46 A;  1JF2 A;  1GJY A;  2JXC A;  1OSA A;  1SL9 A;  3EVR A;  2ISD A;  1AJ4 A;  2KAV A;  4TNC A;  2HF5 A;  1TNQ A;  3OP0 A;  1UUR A;  1XFX O;  3CWG A;  4GNK B;  3SG6 A;  3BUX B;  3BXK A;  1PK0 D;  3VRQ A;  2Y1N A;  3EVU A;  2JNF A;  2LVJ A;  4PE7 A;  3E3R A;  2AUC A;  1KFX L;  2ZKM X;  4YI8 A;  3PAT A;  3GOF A;  3TDZ A;  2KOT A;  2NZ0 A;  3A8R A;  3CS1 A;  4BY5 A;  2LE9 B;  2F2P A;  3SG3 A;  5HYD A;  1SK6 D;  2KFH A;  4M2Q A;  1CMG A;  2ZRT A;  1PSB A;  2LLT A;  1AK8 A;  1OMV A;  4M2P A;  4Q04 A;  5CSF A;  1G4Y R;  1YUR A;  1NYA A;  2F3Y A;  1J7O A;  5AER A;  4MZK A;  4N1G A;  2Y5I A;  2PMY A;  3H4S E;  2CXJ A;  3BUW B;  4MRY A;  1YRT B;  1QAT A;  2JNX A;  1UUS A;  1J55 A;  4MSP A;  1K9K A;  2F3Z A;  3NSI A;  1UHJ A;  1AHR A;  1A03 A;  1B4C A;  5CSN A;  1FI5 A;  2P6B B;  1KWO B;  4MRX A;  1MUX A;  3ZNI A;  5I2Q A;  1XFY O;  3CR5 X;  2F8P A;  1A4P A;  2JQ6 A;  4NDD A;  3JTD B;  1VRK A;  1R2U A;  1DJW A;  4YBH B;  4P5O E;  1A29 A;  4HRH A;  1IQ3 A;  1TNX A;  3NSO A;  2Q91 A;  3LK1 A;  1CFC A;  1QVI Z;  1J1E A;  3AKA A;  1BOD A;  4AQJ A;  1KK7 Y;  1WLZ A;  1ZUZ A;  1W7I B;  1ALW A;  2JTZ A;  4GGN A;  1ZOT B;  1UWO A;  3EK8 A;  1SR6 C;  2PVB A;  1KSO A;  3VGO A;  1AVS A;  3GK1 A;  4PHM A;  1CDP A;  1SMG A;  1IJ6 A;  1CM4 A;  1K8U A;  2AAO A;  2LVK A;  4A4C A;  2KHN A;  4DS7 A;  1CNP A;  5FYX A;  4DUQ A;  3EVV A;  1R6P A;  4GFT A;  2ZN9 A;  1K90 D;  1YVL A;  2BE4 A;  2L0P A;  2LLU A;  2MA2 A;  1U5I B;  5PAL A;  3I5G B;  2OS8 C;  2JOJ A;  3RM1 A;  3OB1 B;  3DF0 B;  1KQV A;  1KWO C;  2NXQ A;  1PVA A;  1SPY A;  1DJG A;  5IBW A;  1SCM B;  3DVM A;  1CFP A;  2WOS A;  2BCB A;  3K21 A;  5KTY A;  5B8I B;  1QLS A;  3FS7 A;  1DT7 B;  4OKH A;  4YGA A;  2LLS A;  3CGA A;  1A2X A;  1K95 A;  4XYN A;  4GGF C;  5ER4 X;  1UHN A;  2K61 A;  1WRL A;  1SR6 B;  5HKY A;  5GQQ C;  1SBJ A;  3EK4 A;  1S1E A;  1BR4 B;  1S36 A;  2BL0 B;  1IKU A;  1EL4 A;  1NX3 A;  1RRO A;  5HKW A;  1QS7 A;  1A75 B;  3TDI A;  1KFU S;  2K7C A;  2I7A A;  2K7O A;  4DCK A;  2K7D A;  1M39 A;  1SY9 A;  1KK7 Z;  4ORC B;  2SCP A;  1B1G A;  3WHU B;  3HX4 A;  1F54 A;  1L2O C;  1RK9 A;  2H61 A;  2LAN A;  1EXR A;  1KSM A;  1YTZ C;  2IS9 A;  4OVN F;  1SL7 A;  3TUY B;  1NCZ A;  4U8D A;  3AKB A;  1CDL A;  4GPL B;  2KFF A;  3JVT C;  5D7F A;  2M29 A;  1YUT A;  2WCE A;  4PHK A;  4D1E A;  2KGR A;  3OHM B;  1TRF A;  3NSK A;  2Y4Q A;  4C0K A;  2M49 B;  4OCI A;  2QPT A;  2L5X B;  3I5F C;  1SNL A;  1RTP 1;  3DF0 A;  3DVJ A;  2M1K B;  5CSI A;  2K8M B;  2BEC A;  2E30 A;  2LVI A;  2MRD A;  1EG3 A;  1MHO A;  3BOW A;  1BLQ A;  1CTR A;  1F4Q A;  3OX6 A;  3SIB A;  1B8L A;  1MQ1 A;  1LIN A;  3IF7 A;  1IH0 A;  1S5G Z;  2JC2 A;  4ZCU A;  1YR5 A;  2VRG A;  1NPQ A;  1SCM C;  4HSZ A;  5CPV A;  1CB1 A;  1JC2 A;  1IWQ A;  2EC6 C;  1BT6 A;  3PAL A;  2M8U A;  1KFU L;  2L51 A;  1PAL A;  3FWC A;  4P2Y B;  2KI4 B;  4CFQ A;  1SW8 A;  4QJ4 B;  1DJZ A;  2BBN A;  4QJ3 B;  2ZFD A;  4PCW A;  4GUK A;  1FPW A;  2LMU A;  1FI6 A;  1BG1 A;  1C7W A;  1W7J B;  1CDM A;  5F6T A;  1QAS A;  1ZFS A;  4I5J A;  4I5L B;  1DJH A;  1SCV A;  1QIV A;  1LVC D;  1B7T Y;  1XK4 A;  5DKR A;  1E8A A;  2WCF A;  1TIZ A;  2EGD A;  3I5F B;  4L9M A;  3EKH A;  5I2O A;  2CBL A;  1B47 A;  1YUS A;  3GK4 X;  1XFZ O;  4I5K A;  1S26 D;  4JQ0 D;  2CCM A;  1IGV A;  4PHN A;  1TCO B;  1JSA A;  1KK8 B;  2K2F A;  1NX1 A;  4MLW A;  4CID A;  4NQG A;  3CR2 A;  5I2L A;  5JJG A;  1IG5 A;  2GV5 A;  4UPG A;  4GBA A;  1CLM A;  4GGF A;  1X02 A;  4XJK A;  5HKZ A;  3PN7 B;  1K2H A;  3SJS A;  1BR1 B;  3BUO B;  1AUI B;  2L4I A;  2LMV A;  4MZJ A;  2JRF A;  4MEW A;  4C0L A;  1F55 A;  4YGD B;  3LL8 B;  3I5I B;  1DF0 B;  1MXL C;  1OMR A;  4CLN A;  1MXE A;  2K7B A;  4XJK B;  2HET A;  1QTX A;  3CLN A;  3KPX A;  3PSR A;  1OQP A;  5HLV A;  1C7V A;  2H61 C;  2FCD A;  3SG4 A;  1D1O A;  2ZRS A;  3DD4 A;  2M7L A;  2FCE A;  1CMF A;  1F71 A;  2KSP A;  3FIA A;  2JU0 A;  2LNK A;  4YI9 A;  2COL B;  2FOT A;  2LCP A;  1C07 A;  1G8I A;  1DGV A;  3SG7 A;  4YGE B;  1SRA A;  4PE0 A;  1CLL A;  1BJF A;  2F33 A;  2G2B A;  2WCB A;  5I8N A;  1IRJ A;  5DKN A;  2CTN A;  3BQ3 A;  1REC A;  5G08 A;  4CPV A;  2A4J A;  1Y0V H;  5CSJ A;  3FWB A;  2BKI B;  1YVH A;  1M31 A;  1SYM A;  2OS8 B;  1QX5 B;  3F45 A;  5D69 A;  1NX0 A;  1J1D A;  1XFW O;  1B7T Z;  2O60 A;  3OB2 B;  5AXI A;  3SIA A;  4AOM A;  1AP4 A;  4PHJ A;  3TZ1 A;  1WLM A;  3PM8 A;  2JT0 A;  4M2O A;  3PLF B;  1WRZ A;  2BL0 C;  1XFV O;  1QX2 A;  2L50 A;  3IQO A;  1Y1X A;  3IQQ A;  1KK8 C;  2TN4 A;  1J7P A;  1UP5 A;  4OV2 A;  1JBA A;  1HQV A;  1ODB A;  1U5I A;  2LM5 A;  2I18 A;  3VRR A;  1LKJ A;  1OOJ A;  2HQW A;  4MN0 A;  1QXP A;  4HRE E;  4GAO A;  1OZO A;  3GK2 A;  1Y1U A;  4F0Z B;  3EK7 A;  2BKH B;  1ZAC A;  1NSH A;  5DKQ A;  2L2E A;  2M97 A;  3WXA A;  1KFX S;  3TS5 B;  2LVV A;  1CFF A;  2NLN A;  2JZI A;  2HPS A;  1PVB A;  3BUN B;  3NXA A;  1XYD A;  1Y6W A;  2KFG A;  1A75 A;  1DJY A;  2KNE A;  2MLF C;  1F4O A;  2CNP A;  1NX2 A;  2MLE C;  1QLK A;  3EKJ A;  3I5H B;  2DOQ A;  2ZNE A;  1WY9 A;  2KI6 C;  1YX8 A;  1WDC C;  4ORA B;  3TUY C;  1EJ3 A;  4NDC A;  1OMD A;  2KBI A;  3C1V A;  1K9P A;  2AMI A;  3WHT B;  2ZND A;  1V1G A;  3BUM B;  3BYA A;  2WC8 A;  1PUL A;  3LCP C;  3O6B A;  3JTD C;  1K96 A;  1B8R A;  1MF8 B;  3ZWH A;  2KDH A;  1QX7 A;  1TN4 A;  1V1F A;  1YX7 A;  4NDB A;  2KAX A;  4MBE A;  5AFP A;  1XK4 C;  1YRU B;  1F70 A;  1J7R A;  2EC6 B;  1JFK A;  4ORB B;  1S6J A;  3A4U B;  1S5G Y;  1XFU O;  2EHB A;  4AQI A;  1F8H A;  1RJV A;  1QJT A;  1CM1 A;  1PSR A;  1S6I A;  1TCF A;  1CKK A;  1FW4 A;  1XO5 A;  1QIW A;  2HQ8 A;  2WOR A;  3BOW B;  1XVJ A;  4PAL A;  1ALV A;  1DVI A;  3ICB A;  3MSE B;  4YGC B;  4C0J A;  3I5H C;  4IL1 A;  1NCY A;  3KHE A;  1JFJ A;  2H2K A;  2NCP A;  1JUO A;  2GGM A;  2QAC A;  1LA3 A;  2B1U A;  3O78 A;  1J7Q A;  4I5N B;  3AAJ A;  1IJ5 A;  1WRK A;  3OX5 A;  1N2D A;  3VRN A;  4YGB B;  3KF9 A;  3D0Y B;  1GGW A;  3RLZ A;  2V53 A;  1OE9 B;  5BPJ A;  2BCX A;  4BY4 A;  2PAL A;  2Y1M A;  4N1F A;  2KYF A;  1B9A A;  2I2R E;  2M7N A;  2MAZ A;  3NSL A;  1N65 A;  4JPZ B;  3I5I C;  4WQ3 A;  3TDU A;  1NUB A;  4CFR A;  2LAP A;  1TNW A;  2K2A A;  4PE1 A;  1DJX A;  2L4H A;  2OPO A;  2KI6 D;  2LUX A;  4QJ5 B;  2M0R A;  2KQ6 A;  1TNP A;  5TNC A;  1L2O B;  1L7Z A;  2MBX A;  2R2I A;  2JT8 A;  2LHI A;  5HLO A;  1Y1A A;  1LXF C;  4DRW A;  2KGB C;  1JF0 A;  5K89 A;  2BCA A;  2I94 A;  2WND A;  2LUC A;  4ZCV A;  4PE4 A;  1BMO A;  3PFV A;  1S6C A;  1FF1 A;  2LMT A;  2RGI A;  4USL A;  3AAK A;  1UHI A;  1DTL A;  1DMO A;  1H4B A;  3VRP A;  2F2O A;  1UHH A;  3JVT B;  1BF5 A;  5AEQ A;  2OTG B;  2JPT A;  2G9B A;  2BBM A;  2ZN8 A;  1UHK A;  3HCM A;  2M9G A;  1DGU A;  2LHL A;  4MVF A;  5J3X A;  2D8N A;  2GGZ A;  1TOP A;  4ETO A;  2M1U A;  1AJ5 A;  1KCY A;  4R1E A;  2E6W A;  1GQM A;  2MHH A;  1S3P A;  1H8B A;  1B8C A;  1GGZ A;  4WRI A;  1K94 A;  5KU1 A;  3KO0 A;  1KQM B;  1IQ5 A;  2K0J A;  4ICB A;  3KEV A;  4DIR A;  1BOC A;  1MR8 A;  1M63 B;  1MWN A;  2CT9 A;  2KBM A;  3I5G C;  2MJW B;  2LP2 A;  2LP3 A;  2PRU A;  2KQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...