3DD4A

Structural basis of kchip4a modulation of kv4.3 slow inactivation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
214
Chain Sequence
MNLEGLEMIAVLIVIVLFVKLLEQFGLIEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kv channel-interacting protein 4
publication title Structural Insights into KChIP4a Modulation of Kv4.3 Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 80
structure length 214
sequence length 229
ec nomenclature
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dd4A00
3PM8A 3TUYC 3E3RA 2NCOA 4HREE 1K96A 1TRFA 1ZFSA 2KBIA 2Y1NA 1L2OC 2PSRA 2LP2A 3QRXA 1LA0A 4NDBA 3TUYB 4M2OA 1UHNA 2SCPA 2EC6C 1SR6C 2JPTA 4MRXA 4PHJA 4GNKB 5CSFA 3SG5A 2SASA 1XFWO 2L4HA 4PHMA 2I94A 2L0PA 4DIRA 5F6TA 1DJIA 1KQMC 1S26D 2K7DA 3IQOA 1YVHA 2LVJA 1K9KA 2KOTA 2NLNA 1M45A 2OPOA 4YGCB 1B4CA 3TZ1A 2EGDA 2M3WA 4YGAA 4D1EA 1SNLA 4DRWA 4MBEA 4PDZA 5I2OA 3LL8B 3KEVA 3D10A 3FWCA 4PALA 2LP3A 1XFZO 1OMDA 4JPZB 2HQ8A 3CR4X 3EK4A 1PULA 4E68A 1DT7B 4U8DA 1QV1A 4GGNA 1D1OA 4ORAB 4CPVA 5AEQA 3JTDC 4QJ4B 1UHHA 4XYNA 5I2LA 2LMTA 1KK8B 1J7PA 1YRUB 2A4JA 2JWWA 3OB1B 4GFTA 3EK8A 1A29A 1YUTA 2G9BA 2OTGB 1CDNA 4P2YB 1CFDA 4C0KA 3ICBA 1L7ZA 2NXQA 1ZOTB 1CB1A 1MR8A 2ZRTA 5ER4X 3AAJA 4I5LB 1SRAA 1EL4A 3BOWA 1C7VA 1F8HA 3LK0A 3VRRA 4NDDA 1J1DA 1FW4A 1K90D 4OVNF 4FQOA 1B8RA 4XJKA 2WNDA 4MRYA 1EG4A 2GV5A 1RFJA 1S6IA 4GAOA 1K9PA 3VROA 2JNFA 5AERA 1PVBA 2KGRA 1NCYA 2K2FA 5DKQA 2H2KA 4I5KA 1J7RA 2GGZA 3PALA 1M31A 1MUXA 1KCYA 2LLSA 1CLMA 2O5GA 5CSJA 1E8AA 1V1FA 1F71A 4P5OE 3BUOB 2AMIA 2HQWA 1BU3A 1F4OA 5BPJA 1R6PA 1CTRA 3AKBA 1UURA 1QV0A 1TCOB 1J1EA 3DVEA 2MLEC 1SCMC 4WRIA 4DUQA 2LCPA 1XO5A 2KQYA 1KK7Y 3BXKA 1N2DA 1AJ5A 1CM1A 3SG7A 3DD4A 2L5XB 2KI4C 1SCMB 1BG1A 1AVSA 1SYMA 5CPVA 2JU0A 4YGEB 1JFKA 1G4YR 4IL1A 2OS8C 2MHHA 3O78A 2JC2A 2LUXA 4C0JA 1A03A 1QVIZ 1W7JB 1V1GA 3OB2B 1XK4C 3CTNA 2LVVA 1B47A 3HCMA 1LINA 2OS8B 4YBHB 3BYAA 4HSZA 5HKWA 2K0JA 2BECA 2K2AA 2HETA 3CS1A 1GGWA 1KWOB 1QXPA 3VRNA 5I2QA 3LCPC 3DVMA 1Q80A 3O6BA 1A75B 2KBMA 3KF9A 1TIZA 1HQVA 1DMOA 4I5JA 1FF1A 5DKNA 2O60A 4JQ0D 1OZOA 1K8UA 2MA2A 3BUWB 3VRQA 1QIVA 1Y1UA 4ORBB 2WC8A 2M9GA 3K21A 1AP4A 2F33A 3PLFB 1PVAA 2LVKA 5D7FA 3D0YB 1S6JA 3NXAA 1EXRA 1PRWA 1S6CA 3I5FC 4OKHA 1ALVA 2JT8A 1AK8A 4N1FA 4WQ3A 1UWOA 4M2QA 1NUBA 2KSPA 3WHUB 3JVTC 4UPGA 1YX8A 1IJ5A 1QJTA 5CSNA 1CDPA 1IKUA 2PALA 1DF0B 2LLTA 3I5HC 1SMGA 4BY5A 1B9AA 2B1UA 2BE6A 3BUXB 1L2OB 4HRGA 3LLEA 1NX3A 4HRHA 2EC6B 1SR6B 1AHRA 3I5HB 1M63B 1JF2A 1CKKA 3SIAA 1A4PA 3OP0A 2NCPA 3O2PA 4JWQA 1BODA 1XFXO 1YRTB 2FOTA 3NSKA 4MZKA 2LVIA 2K7OA 1K94A 5ER5A 1IQ3A 1KQMB 2JXCA 2M7LA 4DCKA 2K7CA 1S1EA 1K9UA 3H4SE 1S5GY 3A4UB 2ISDA 3NSOA 4TNCA 2M0RA 1UHJA 1KFUS 2ZFDA 2KI6D 4N5XA 4MZLA 1GGZA 1TNWA 3I5IC 4CLNA 2ZNDA 3OX6A 3WNXB 1DGUA 1RJVA 3EKHA 3GK2A 2KAYA 4MLWA 3EVRA 5DKRA 2KNEA 1WDCC 1UHKA 1CDMA 3JTDB 2KYCA 2KDHA 2I7AA 2K8MB 1J7QA 2E30A 2JULA 1GQMA 3SG3A 4I5NB 2FCEA 2JTTA 1SW8A 2Y5IA 4OCIA 1TNQA 1BLQA 1SL9A 1BT6A 1DGVA 2M1KB 3CR2A 3CZTX 2JNXA 5D69A 1TNPA 2LUCA 4CIDA 2M97A 3DVJA 4DS7A 2F2PA 1TNXA 1QLKA 2V53A 2MRDA 3IF7A 2COLB 1J55A 2M1UA 1JUOA 2JT0A 1ODBA 1JSAA 1QATA 2CNPA 1SCVA 1R2UA 3DF0B 2PMYA 2JQ6A 4N1GA 2HF5A 3SJSA 4ZCVA 4BY4A 5AFPA 5K89A 2ZN9A 3TDIA 1QASA 1UUSA 4YGBB 1XK4A 1LKJA 1NIWA 1CFFA 2LV7A 1YR5A 3PSRA 3RM1A 2BCXA 2F3YA 1OOJA 5FYXA 1A75A 1AJ4A 1BR1B 1RTP1 4YI8A 1C7WA 4AQIA 1RK9A 1U5IB 3EKJA 1MF8B 2JXLA 2F2OA 3TS5C 4ICBA 1NCXA 2M8UA 3OX5A 4PE0A 3D0YA 1YX7A 3WXAA 4NDCA 1DJYA 1IJ6A 1NYAA 3C1VA 4GGFC 1FPWA 1Y6WA 5HYDA 1SK6D 3F45A 1YUUA 2KAVA 5KU1A 2KI4B 1XVJA 4MN0A 2ZRSA 1DF0A 1VRKA 1KSOA 2EHBA 1GJYA 1NX0A 1OSAA 1ALWA 1B1GA 2KAXA 2CCMA 2KFGA 1F54A 5J3XA 1B8CA 2BKIB 2JOJA 3NSLA 2JTZA 4QJ5B 2KFHA 1H4BA 1MXEA 1QLSA 2BKHB 2ZKMX 5JOLA 1NX2A 4YI9A 2BE4A 1JC2A 2Q4UA 1BOCA 1IG5A 2LC5A 2MAZA 1JBAA 2ZN8A 1MQ1A 2L50A 3A8RA 1KK7Z 1SY9A 1NWDA 1KSMA 1QTXA 5HKZA 1A2XA 3BUMB 1JF0A 2Q91A 3PN7C 2AUCA 2KQ6A 1IQ5A 4AQJA 2LMUA 1RWYA 2G2BA 3I5FB 1XYDA 2H61C 1DJGA 4GUKA 1F55A 1JWDA 1WLMA 1UHIA 3JVTB 4ETOA 2L2EA 1X02A 1ZACA 1DJXA 1EJ3A 2WORA 1EH2A 2PRUA 2JZIA 4USLA 1NPQA 1CMGA 2JT3A 1CFPA 1QX7A 1EG3A 5G08A 4Q04A 1OE9B 1B8LA 3CWGA 1BR4B 3FS7A 3LK1A 2P6BB 4F0ZB 3SG4A 2WCFA 2L51A 3SG2A 1YVLA 1KQVA 2VRGA 3MSEB 4YGDB 1DJWA 2WCBA 3FIAA 1B7TZ 1CM4A 1NP8A 1TN4A 2KI6C 2WOSA 1N0YA 4PHNA 5HKYA 1H8BA 1S3PA 2Y1MA 4PHKA 1LXFC 3TDUA 1WRKA 2TN4A 2WCEA 1OQPA 3DF0A 1TCFA 1QS7A 5HLOA 5AXIA 1OZSA 4MSPA 4A4CA 1AUIB 2ZNEA 3I5IB 5GQQC 3RLZA 3HX4A 1BJFA 1NCZA 4AOMA 4MEWA 4MVFA 2BCBA 4GPLB 1UP5A 1S36A 4PE4A 1SBJA 1WDCB 1IGVA 5HLVA 1U5IA 1YUSA 2BL0C 2MBXA 4PE7A 1HT9A 5B8IB 4YRUA 2PASA 2M49B 5JJGA 1LVCD 4NQGA 1G8IA 2BL0B 1KK8C 3O4YA 1IH0A 1RECA 1XFVO 2OTGC 2K7BA 1F70A 1FI6A 1S5GZ 1DVIA 2M7NA 3IQQA 1CLBA 1N65A 4FTGA 1Y1AA 3KHEA 3PATA 1OMVA 1MHOA 4GGFA 2R2IA 3ZNIA 1CMFA 1QIWA 3WHTB 2FJUB 1K95A 5PALA 2E6WA 3M0WA 5TNCA 3TDZA 2KYFA 2LANA 3EVUA 1DJZA 1YTZC 2RGIA 1K93D 1W7IB 2KFFA 2LAPA 2PVBA 4WQ2A 5IBWA 2LHLA 2K61A 1XA5A 2KHNA 1KFXL 2CBLA 2GGMA 2NZ0A 1QVIY 1SL8A 2LHIA 4QJ3B 3KO0A 1OMRA 1SL7A 1Y0VH 1TOPA 2LM5A 3EK7A 2F8PA 4CFRA 1QX2A 2CTNA 2MLFC 1SPYA 3I5GC 3TS5B 3BUNB 1ZMZA 2BBMA 1DJHA 3OHMB 2KGBC 4CFQA 1CNPA 1M46A 2Y4QA 1PSRA 2IS9A 4MZJA 1BMOA 3I5GB 4GBAA 3BQ3A 4PCWA 3CR5X 1PK0D 1FBVA 1MXLC 2I2RE 4OR9B 3EVVA 1M39A 1QX5B 1MWNA 2H61A 4A4BA 1JFJA 2F3ZA 1NSHA 3AAKA 3CGAA 2JRFA 1IRJA 2BCAA 1ZUZA 1CLLA 4PE1A 3GK1A 2M29A 2QPTA 2CT9A 5CSIA 1FI5A 3BOWB 2LE9B 1DTLA 1C07A 1XFYO 2I18A 5AANA 3VGOA 1CFCA 4XJKB 3SIBA 3VRPA 2CXJA 2QACA 2LNKA 1XFUO 2MJWB 4ZCUA 1TTXA 1WRLA 1J7OA 1NX1A 3CLNA 1KFXS 1KWOC 4C0LA 3SG6A 3KPXA 1SKTA 4OV2A 2LLUA 2LMVA 3GOFA 1PALA 1LA3A 1WRZA 2FCDA 4L9MA 1WY9A 4R1EA 3PN7B 1Y1XA 3NSIA 3GK4X 1IWQA 3FWBA 1YURA 1KFUL 1PSBA 5KSZA 2D8NA 1G33A 4ORCB 1CDLA 2DOQA 5I8NA 2BBNA 2AAOA 3PFVA 1B7TY 3AKAA 5KTYA 1WLZA 2L98A 1F4QA 1RROA 1K2HA 2HPSA 2L4IA 3DVKA 1BF5A 4M2PA 3ZWHA
chains in the Genus database with same CATH superfamily
3PM8A 3TUYC 3D76A 3D74A 3E3RA 3S0AA 1TUJA 2NCOA 4HREE 2QEHA 1K96A 1TRFA 1ZFSA 2KBIA 2Y1NA 1L2OC 2PSRA 2LP2A 3QRXA 1LA0A 4NDBA 3TUYB 4M2OA 1UHNA 2SCPA 2EC6C 1SR6C 2JPTA 4MRXA 4PHJA 4GNKB 5CSFA 3B86A 3SG5A 2SASA 1XFWO 2L4HA 2QDIA 4PHMA 2I94A 2L0PA 2WCHA 4DIRA 5F6TA 3PM2A 1DJIA 1KQMC 1S26D 2K7DA 3IQOA 1YVHA 2LVJA 3K1EA 3V2LA 1K9KA 2KOTA 2NLNA 3DYEA 3R1OA 1M45A 2OPOA 4YGCB 1B4CA 3TZ1A 2EGDA 2M3WA 4YGAA 4D1EA 1SNLA 2WC5A 4MBEA 4PDZA 4DRWA 3LL8B 5I2OA 3KEVA 3D10A 3FWCA 4PALA 2LP3A 1XFZO 1OMDA 4JPZB 2HQ8A 3CR4X 3EK4A 3BJHA 1PULA 4E68A 1DT7B 4U8DA 1QV1A 4GGNA 2H8VA 3DY9A 4ORAB 1D1OA 4CPVA 2FJYA 5AEQA 3JTDC 4QJ4B 1UHHA 2QEVA 3IVTA 4XYNA 5I2LA 3D77A 2LMTA 1KK8B 1J7PA 1YRUB 2A4JA 2JWWA 3OB1B 4GFTA 3EK8A 1A29A 1YUTA 2G9BA 2OTGB 1CDNA 4P2YB 1CFDA 4C0KA 3ICBA 3UNWA 1L7ZA 2NXQA 1ZOTB 1CB1A 1MR8A 2ZRTA 5ER4X 3AAJA 4I5LB 1SRAA 1EL4A 3BOWA 1C7VA 1F8HA 3LK0A 3VRRA 4NDDA 1J1DA 4FQTA 1FW4A 1K90D 4OVNF 5EL2A 4FQOA 1B8RA 4XJKA 2WNDA 4MRYA 1EG4A 2GV5A 1RFJA 1S6IA 4GAOA 1K9PA 3VROA 2JNFA 5AERA 1PVBA 2KGRA 1NCYA 2K2FA 5DKQA 2H2KA 4I5KA 1J7RA 2GGZA 3PALA 1M31A 1MUXA 1T14A 1KCYA 2LLSA 1CLMA 2O5GA 5CSJA 1E8AA 1V1FA 1F71A 4P5OE 3D75A 3BUOB 2AMIA 2HQWA 1BU3A 1F4OA 5BPJA 1R6PA 1Z4HA 1CTRA 3AKBA 1UURA 1QV0A 1TCOB 1J1EA 3DVEA 2MLEC 1SCMC 4WRIA 2GTEA 4IJ7A 4DUQA 2LCPA 1XO5A 2KQYA 1KK7Y 1XFRA 1N2DA 3BXKA 1AJ5A 1CM1A 3SG7A 1OOGA 3DD4A 2L5XB 2KI4C 1SCMB 2WCKA 1AVSA 1SYMA 2KLEA 2JU0A 5CPVA 1BG1A 4YGEB 1JFKA 1G4YR 4IL1A 2OS8C 2MHHA 3O78A 2JC2A 2LUXA 4C0JA 1A03A 1QVIZ 1W7JB 1V1GA 3OB2B 1XK4C 3CTNA 2LVVA 1B47A 3HCMA 1LINA 2OS8B 4YBHB 3BYAA 4HSZA 5HKWA 1OW4A 2K0JA 2BECA 3EG5B 2K2AA 2HETA 3CS1A 1GGWA 1KWOB 1QXPA 3OBVA 3VRNA 5I2QA 3LCPC 3DVMA 3S0FA 1Q80A 3O6BA 1A75B 2KBMA 3KF9A 3CABA 1TIZA 1HQVA 1DMOA 4I5JA 1FF1A 5DKNA 2O60A 4JQ0D 1OZOA 1K8UA 2MA2A 3BUWB 3VRQA 1QIVA 1Y1UA 4ORBB 2WC8A 2M9GA 3K21A 3VB1A 1AP4A 2F33A 3PLFB 1PVAA 2LVKA 1W9ZA 4KYNA 5D7FA 3CDNA 3D0YB 1S6JA 3NXAA 1EXRA 1PRWA 1S6CA 3I5FC 4OKHA 1ALVA 2JT8A 1AK8A 1DQEA 4N1FA 4WQ3A 1UWOA 4M2QA 2BNXA 1NUBA 2KSPA 3WHUB 3JVTC 4UPGA 1YX8A 1IJ5A 1QJTA 5CSNA 1CDPA 1IKUA 2PALA 1DF0B 2LLTA 4JD9A 3DXLA 3I5HC 1SMGA 4BY5A 1B9AA 2B1UA 2BE6A 3NHTA 3BUXB 1L2OB 4HRGA 3LLEA 1NX3A 4HRHA 2EC6B 1SR6B 3NHIA 1AHRA 3I5HB 1M63B 1TUZA 1JF2A 1CKKA 3S0BA 3SIAA 1A4PA 3OP0A 2NCPA 3O2PA 3D73A 3Q8IA 4JWQA 4F7FA 3O4XA 1BODA 1XFXO 1YRTB 2FOTA 3NSKA 4MZKA 2LVIA 2K7OA 1K94A 5ER5A 1IQ3A 1KQMB 2JXCA 2M7LA 4DCKA 3CZ1A 2K7CA 1S1EA 1K9UA 3H4SE 1S5GY 3A4UB 2ISDA 3NSOA 4TNCA 2M0RA 1UHJA 1KFUS 2ZFDA 2KI6D 4N5XA 3S0EA 3DZTA 4MZLA 1GGZA 1TNWA 1DELA 3I5IC 2ZNDA 3OX6A 4CLNA 3WNXB 1DGUA 1RJVA 3D78A 3EKHA 3GK2A 1DEKA 2KAYA 4MLWA 3FE6A 3EVRA 4INXA 5DKRA 2KNEA 1WDCC 1UHKA 1CDMA 3JTDB 2KYCA 2KDHA 2I7AA 2K8MB 1J7QA 2E30A 2JULA 1IIOA 5FI6A 1GQMA 4PT1A 4I5NB 3SG3A 2FCEA 2JTTA 1SW8A 2Y5IA 4OCIA 1TNQA 1BLQA 1SL9A 1BT6A 1DGVA 2M1KB 3CR2A 3CZTX 2JNXA 5D69A 1TNPA 2LUCA 4CIDA 2M97A 3DVJA 4DS7A 2F2PA 1TNXA 1QLKA 5D3OA 2V53A 2MRDA 3IF7A 2COLB 4JKTA 1J55A 2M1UA 3SS5A 1JUOA 2JT0A 1ODBA 3L4LA 4INWA 1JSAA 1QATA 2CNPA 1SCVA 1R2UA 3DF0B 2PMYA 2JQ6A 4N1GA 2HF5A 3SJSA 4ZCVA 4BY4A 5AFPA 5K89A 2ZN9A 3TDIA 1QASA 1UUSA 4YGBB 2WCJA 1XK4A 1LKJA 1NIWA 1CFFA 2LV7A 1YR5A 3PSRA 3RM1A 3QMEA 2BCXA 2F3YA 1OOJA 5FYXA 1A75A 1AJ4A 1BR1B 1RTP1 4YI8A 1C7WA 4AQIA 2WC6A 1RK9A 1U5IB 3EKJA 3CYZA 1MF8B 2JXLA 2F2OA 3TS5C 4ICBA 1NCXA 2M8UA 3OX5A 4PE0A 1TWOA 1LS8A 3D0YA 1YX7A 3WXAA 4NDCA 1DJYA 1IJ6A 1NYAA 2QEBA 3C1VA 4GGFC 1FPWA 1Y6WA 5HYDA 1SK6D 3F45A 1YUUA 2KAVA 1SSEB 5KU1A 4OZDA 2KI4B 1XVJA 4MN0A 2ZRSA 1DF0A 1VRKA 2P70A 1KSOA 2EHBA 1GJYA 1NX0A 1OSAA 1ALWA 1B1GA 2KAXA 2CCMA 2KFGA 1F54A 5J3XA 1B8CA 2BKIB 2JOJA 2QEOA 3NGVA 3NSLA 2JTZA 4QJ5B 2KFHA 1H4BA 1MXEA 1QLSA 2BKHB 2ZKMX 5JOLA 1NX2A 4YI9A 3FE8A 2BE4A 1JC2A 2Q4UA 1BOCA 1IG5A 2PYQA 2LC5A 2MAZA 1JBAA 2ZN8A 1MQ1A 2L50A 3A8RA 1KK7Z 1SY9A 1NWDA 2WCLA 1KSMA 1QTXA 5HKZA 1A2XA 3BUMB 1JF0A 2Q91A 3CZ0A 3PN7C 3S0DA 2AUCA 2KQ6A 1IQ5A 4AQJA 2LMUA 1RWYA 2G2BA 3I5FB 1XYDA 2H61C 1DJGA 4GUKA 1F55A 1JWDA 1WLMA 1UHIA 3JVTB 4ETOA 2L2EA 1X02A 1P28A 1ZACA 5FI2A 1DJXA 1EJ3A 2WORA 3OGNA 1EH2A 2PRUA 2JZIA 4USLA 1NPQA 1CMGA 2JT3A 1CFPA 1QX7A 1EG3A 5G08A 1DC1A 4Q04A 1OE9B 1B8LA 3CWGA 1BR4B 3FS7A 3LK1A 2P6BB 4F0ZB 3SG4A 2WCFA 2L51A 3SG2A 1YVLA 1KQVA 2VRGA 3MSEB 4YGDB 1DJWA 2WCBA 3FIAA 1B7TZ 1CM4A 1NP8A 1TN4A 2KI6C 2WOSA 1N0YA 3L47A 4PHNA 1H8BA 1S3PA 2Y1MA 4PHKA 1LXFC 3TDUA 1WRKA 2TN4A 2WCEA 1OQPA 3DF0A 1TCFA 1QS7A 5HLOA 5AXIA 1OZSA 4MSPA 4A4CA 1C3YA 1AUIB 3FE9A 2ZNEA 3I5IB 5GQQC 3SS3A 2L2CA 3RLZA 3HX4A 1BJFA 1NCZA 4AOMA 4MEWA 3N7HA 4MVFA 2BCBA 4GPLB 1UP5A 1S36A 1OOFA 2ERBA 1SBJA 4PE4A 1WDCB 1IGVA 1OOIX 5HLVA 1U5IA 1YUSA 2BL0C 2MBXA 4PE7A 1HT9A 5B8IB 4YRUA 2PASA 2M49B 5JJGA 2YGUA 1LVCD 2BAPA 4NQGA 1G8IA 2BL0B 1KK8C 3O4YA 1IH0A 1RECA 1XFVO 2KLDA 2OTGC 2K7BA 1F70A 1FI6A 1S5GZ 2PQLA 1DVIA 2M7NA 3IQQA 1CLBA 1N65A 4FTGA 1Y1AA 3KHEA 3PATA 1OMVA 1MHOA 4GGFA 2R2IA 3ZNIA 1CMFA 1QIWA 3CZ2A 2FJUB 1K95A 3WHTB 1C3ZA 5PALA 2E6WA 3UO9A 3M0WA 5TNCA 3TDZA 2KYFA 2LANA 3EVUA 1DJZA 1YTZC 2RGIA 1K93D 1W7IB 3RZSA 5DICA 3BFAA 2KFFA 2LAPA 2PVBA 4WQ2A 5IBWA 2LHLA 2K61A 1XA5A 2KHNA 3S0GA 1KFXL 2CBLA 2GGMA 2NZ0A 1QVIY 1SL8A 2LHIA 4QJ3B 3KO0A 1OMRA 1SL7A 1Y0VH 1TOPA 2LM5A 3EK7A 2F8PA 4CFRA 1QX2A 2CTNA 2KPHA 2MLFC 1SPYA 3B87A 3I5GC 3TS5B 3BUNB 2L5YA 1ZMZA 2BBMA 1DJHA 3OHMB 2KGBC 4CFQA 1CNPA 1M46A 2Y4QA 3SS4A 1PSRA 1GM0A 2IS9A 4MZJA 1BMOA 3I5GB 4GBAA 3B88A 3BQ3A 3B6XA 3CR5X 3PJIA 1PK0D 3R1VA 1FBVA 1MXLC 2I2RE 4OR9B 3EVVA 3R1PA 2JPOA 1M39A 1QX5B 1MWNA 2H61A 4A4BA 5HL1A 2F3ZA 1JFJA 1NSHA 3AAKA 3CGAA 2JRFA 1IRJA 2BCAA 1ZUZA 3BFHA 1CLLA 2P71A 3GK1A 2M29A 1QWVA 2CT9A 2QPTA 4PE1A 5CSIA 3BFBA 3BOWB 2LE9B 1FI5A 1ORGA 1DTLA 1C07A 1OOHA 1XFYO 2I18A 5AANA 3VGOA 1CFCA 4XJKB 3SIBA 3VRPA 2CXJA 2QACA 2LNKA 2K60A 1XFUO 2MJWB 4ZCUA 1TTXA 1WRLA 1J7OA 1NX1A 3CLNA 1KFXS 1KWOC 4C0LA 3SG6A 3KPXA 1SKTA 2WCMA 2LLUA 4OV2A 5FI7A 2LMVA 3GOFA 1PALA 1LA3A 1WRZA 2FCDA 4L9MA 1WY9A 4R1EA 3PN7B 1Y1XA 3NSIA 3R72A 3GK4X 1IWQA 4PCWA 3FWBA 1YURA 1KFUL 1PSBA 5KSZA 2D8NA 1G33A 1Z2CB 4ORCB 1CDLA 3B7AA 5HKYA 2DOQA 5I8NA 2BBNA 2AAOA 3PFVA 1B7TY 3AKAA 3L4AA 5KTYA 1WLZA 2L98A 1F4QA 1RROA 5I94A 1K2HA 2HPSA 2L4IA 3DVKA 1BF5A 4M2PA 3ZWHA
chains in the Genus database with same CATH topology
3PM8A 3TUYC 3E3RA 2NCOA 4HREE 1K96A 1TRFA 1ZFSA 2KBIA 2Y1NA 1L2OC 2PSRA 2LP2A 3QRXA 1LA0A 4NDBA 3TUYB 4M2OA 1UHNA 2SCPA 2EC6C 1SR6C 2JPTA 4MRXA 4PHJA 4GNKB 5CSFA 3SG5A 2SASA 1XFWO 2L4HA 4PHMA 2I94A 2L0PA 4DIRA 5F6TA 1DJIA 1KQMC 1S26D 2K7DA 3IQOA 1YVHA 2LVJA 1K9KA 2KOTA 2NLNA 1M45A 2OPOA 4YGCB 1B4CA 3TZ1A 2EGDA 2M3WA 4YGAA 4D1EA 1SNLA 4DRWA 4MBEA 4PDZA 5I2OA 3LL8B 3KEVA 3D10A 3FWCA 4PALA 2LP3A 1XFZO 1OMDA 4JPZB 2HQ8A 3CR4X 3EK4A 1PULA 4E68A 1DT7B 4U8DA 1QV1A 4GGNA 1D1OA 4ORAB 4CPVA 5AEQA 3JTDC 4QJ4B 1UHHA 4XYNA 5I2LA 2LMTA 1KK8B 1J7PA 1YRUB 2A4JA 2JWWA 3OB1B 4GFTA 3EK8A 1A29A 1YUTA 2G9BA 2OTGB 1CDNA 4P2YB 1CFDA 4C0KA 3ICBA 1L7ZA 2NXQA 1ZOTB 1CB1A 1MR8A 2ZRTA 5ER4X 3AAJA 4I5LB 1SRAA 1EL4A 3BOWA 1C7VA 1F8HA 3LK0A 3VRRA 4NDDA 1J1DA 1FW4A 1K90D 4OVNF 4FQOA 1B8RA 4XJKA 2WNDA 4MRYA 1EG4A 2GV5A 1RFJA 1S6IA 4GAOA 1K9PA 3VROA 2JNFA 5AERA 1PVBA 2KGRA 1NCYA 2K2FA 5DKQA 2H2KA 4I5KA 1J7RA 2GGZA 3PALA 1M31A 1MUXA 1KCYA 2LLSA 1CLMA 2O5GA 5CSJA 1E8AA 1V1FA 1F71A 4P5OE 3BUOB 2AMIA 2HQWA 1BU3A 1F4OA 5BPJA 1R6PA 1CTRA 3AKBA 1UURA 1QV0A 1TCOB 1J1EA 3DVEA 2MLEC 1SCMC 4WRIA 4DUQA 2LCPA 1XO5A 2KQYA 1KK7Y 3BXKA 1N2DA 1AJ5A 1CM1A 3SG7A 3DD4A 2L5XB 2KI4C 1SCMB 1BG1A 1AVSA 1SYMA 5CPVA 2JU0A 4YGEB 1JFKA 1G4YR 4IL1A 2OS8C 2MHHA 3O78A 2JC2A 2LUXA 4C0JA 1A03A 1QVIZ 1W7JB 1V1GA 3OB2B 1XK4C 3CTNA 2LVVA 1B47A 3HCMA 1LINA 2OS8B 4YBHB 3BYAA 4HSZA 5HKWA 2K0JA 2BECA 2K2AA 2HETA 3CS1A 1GGWA 1KWOB 1QXPA 3VRNA 5I2QA 3LCPC 3DVMA 1Q80A 3O6BA 1A75B 2KBMA 3KF9A 1TIZA 1HQVA 1DMOA 4I5JA 1FF1A 5DKNA 2O60A 4JQ0D 1OZOA 1K8UA 2MA2A 3BUWB 3VRQA 1QIVA 1Y1UA 4ORBB 2WC8A 2M9GA 3K21A 1AP4A 2F33A 3PLFB 1PVAA 2LVKA 5D7FA 3D0YB 1S6JA 3NXAA 1EXRA 1PRWA 1S6CA 3I5FC 4OKHA 1ALVA 2JT8A 1AK8A 4N1FA 4WQ3A 1UWOA 4M2QA 1NUBA 2KSPA 3WHUB 3JVTC 4UPGA 1YX8A 1IJ5A 1QJTA 5CSNA 1CDPA 1IKUA 2PALA 1DF0B 2LLTA 3I5HC 1SMGA 4BY5A 1B9AA 2B1UA 2BE6A 3BUXB 1L2OB 4HRGA 3LLEA 1NX3A 4HRHA 2EC6B 1SR6B 1AHRA 3I5HB 1M63B 1JF2A 1CKKA 3SIAA 1A4PA 3OP0A 2NCPA 3O2PA 4JWQA 1BODA 1XFXO 1YRTB 2FOTA 3NSKA 4MZKA 2LVIA 2K7OA 1K94A 5ER5A 1IQ3A 1KQMB 2JXCA 2M7LA 4DCKA 2K7CA 1S1EA 1K9UA 3H4SE 1S5GY 3A4UB 2ISDA 3NSOA 4TNCA 2M0RA 1UHJA 1KFUS 2ZFDA 2KI6D 4N5XA 4MZLA 1GGZA 1TNWA 3I5IC 4CLNA 2ZNDA 3OX6A 3WNXB 1DGUA 1RJVA 3EKHA 3GK2A 2KAYA 4MLWA 3EVRA 5DKRA 2KNEA 1WDCC 1UHKA 1CDMA 3JTDB 2KYCA 2KDHA 2I7AA 2K8MB 1J7QA 2E30A 2JULA 1GQMA 3SG3A 4I5NB 2FCEA 2JTTA 1SW8A 2Y5IA 4OCIA 1TNQA 1BLQA 1SL9A 1BT6A 1DGVA 2M1KB 3CR2A 3CZTX 2JNXA 5D69A 1TNPA 2LUCA 4CIDA 2M97A 3DVJA 4DS7A 2F2PA 1TNXA 1QLKA 2V53A 2MRDA 3IF7A 2COLB 1J55A 2M1UA 1JUOA 2JT0A 1ODBA 1JSAA 1QATA 2CNPA 1SCVA 1R2UA 3DF0B 2PMYA 2JQ6A 4N1GA 2HF5A 3SJSA 4ZCVA 4BY4A 5AFPA 5K89A 2ZN9A 3TDIA 1QASA 1UUSA 4YGBB 1XK4A 1LKJA 1NIWA 1CFFA 2LV7A 1YR5A 3PSRA 3RM1A 2BCXA 2F3YA 1OOJA 5FYXA 1A75A 1AJ4A 1BR1B 1RTP1 4YI8A 1C7WA 4AQIA 1RK9A 1U5IB 3EKJA 1MF8B 2JXLA 2F2OA 3TS5C 4ICBA 1NCXA 2M8UA 3OX5A 4PE0A 3D0YA 1YX7A 3WXAA 4NDCA 1DJYA 1IJ6A 1NYAA 3C1VA 4GGFC 1FPWA 1Y6WA 5HYDA 1SK6D 3F45A 1YUUA 2KAVA 5KU1A 2KI4B 1XVJA 4MN0A 2ZRSA 1DF0A 1VRKA 1KSOA 2EHBA 1GJYA 1NX0A 1OSAA 1ALWA 1B1GA 2KAXA 2CCMA 2KFGA 1F54A 5J3XA 1B8CA 2BKIB 2JOJA 3NSLA 2JTZA 4QJ5B 2KFHA 1H4BA 1MXEA 1QLSA 2BKHB 2ZKMX 5JOLA 1NX2A 4YI9A 2BE4A 1JC2A 2Q4UA 1BOCA 1IG5A 2LC5A 2MAZA 1JBAA 2ZN8A 1MQ1A 2L50A 3A8RA 1KK7Z 1SY9A 1NWDA 1KSMA 1QTXA 5HKZA 1A2XA 3BUMB 1JF0A 2Q91A 3PN7C 2AUCA 2KQ6A 1IQ5A 4AQJA 2LMUA 1RWYA 2G2BA 3I5FB 1XYDA 2H61C 1DJGA 4GUKA 1F55A 1JWDA 1WLMA 1UHIA 3JVTB 4ETOA 2L2EA 1X02A 1ZACA 1DJXA 1EJ3A 2WORA 1EH2A 2PRUA 2JZIA 4USLA 1NPQA 1CMGA 2JT3A 1CFPA 1QX7A 1EG3A 5G08A 4Q04A 1OE9B 1B8LA 3CWGA 1BR4B 3FS7A 3LK1A 2P6BB 4F0ZB 3SG4A 2WCFA 2L51A 3SG2A 1YVLA 1KQVA 2VRGA 3MSEB 4YGDB 1DJWA 2WCBA 3FIAA 1B7TZ 1CM4A 1NP8A 1TN4A 2KI6C 2WOSA 1N0YA 4PHNA 5HKYA 1H8BA 1S3PA 2Y1MA 4PHKA 1LXFC 3TDUA 1WRKA 2TN4A 2WCEA 1OQPA 3DF0A 1TCFA 1QS7A 5HLOA 5AXIA 1OZSA 4MSPA 4A4CA 1AUIB 2ZNEA 3I5IB 5GQQC 3RLZA 3HX4A 1BJFA 1NCZA 4AOMA 4MEWA 4MVFA 2BCBA 4GPLB 1UP5A 1S36A 4PE4A 1SBJA 1WDCB 1IGVA 5HLVA 1U5IA 1YUSA 2BL0C 2MBXA 4PE7A 1HT9A 5B8IB 4YRUA 2PASA 2M49B 5JJGA 1LVCD 4NQGA 1G8IA 2BL0B 1KK8C 3O4YA 1IH0A 1RECA 1XFVO 2OTGC 2K7BA 1F70A 1FI6A 1S5GZ 1DVIA 2M7NA 3IQQA 1CLBA 1N65A 4FTGA 1Y1AA 3KHEA 3PATA 1OMVA 1MHOA 4GGFA 2R2IA 3ZNIA 1CMFA 1QIWA 3WHTB 2FJUB 1K95A 5PALA 2E6WA 3M0WA 5TNCA 3TDZA 2KYFA 2LANA 3EVUA 1DJZA 1YTZC 2RGIA 1K93D 1W7IB 2KFFA 2LAPA 2PVBA 4WQ2A 5IBWA 2LHLA 2K61A 1XA5A 2KHNA 1KFXL 2CBLA 2GGMA 2NZ0A 1QVIY 1SL8A 2LHIA 4QJ3B 3KO0A 1OMRA 1SL7A 1Y0VH 1TOPA 2LM5A 3EK7A 2F8PA 4CFRA 1QX2A 2CTNA 2MLFC 1SPYA 3I5GC 3TS5B 3BUNB 1ZMZA 2BBMA 1DJHA 3OHMB 2KGBC 4CFQA 1CNPA 1M46A 2Y4QA 1PSRA 2IS9A 4MZJA 1BMOA 3I5GB 4GBAA 3BQ3A 4PCWA 3CR5X 1PK0D 1FBVA 1MXLC 2I2RE 4OR9B 3EVVA 1M39A 1QX5B 1MWNA 2H61A 4A4BA 1JFJA 2F3ZA 1NSHA 3AAKA 3CGAA 2JRFA 1IRJA 2BCAA 1ZUZA 1CLLA 4PE1A 3GK1A 2M29A 2QPTA 2CT9A 5CSIA 1FI5A 3BOWB 2LE9B 1DTLA 1C07A 1XFYO 2I18A 5AANA 3VGOA 1CFCA 4XJKB 3SIBA 3VRPA 2CXJA 2QACA 2LNKA 1XFUO 2MJWB 4ZCUA 1TTXA 1WRLA 1J7OA 1NX1A 3CLNA 1KFXS 1KWOC 4C0LA 3SG6A 3KPXA 1SKTA 4OV2A 2LLUA 2LMVA 3GOFA 1PALA 1LA3A 1WRZA 2FCDA 4L9MA 1WY9A 4R1EA 3PN7B 1Y1XA 3NSIA 3GK4X 1IWQA 3FWBA 1YURA 1KFUL 1PSBA 5KSZA 2D8NA 1G33A 4ORCB 1CDLA 2DOQA 5I8NA 2BBNA 2AAOA 3PFVA 1B7TY 3AKAA 5KTYA 1WLZA 2L98A 1F4QA 1RROA 1K2HA 2HPSA 2L4IA 3DVKA 1BF5A 4M2PA 3ZWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM8 A;  3TUY C;  3E3R A;  2NCO A;  4HRE E;  1K96 A;  1TRF A;  1ZFS A;  2KBI A;  2Y1N A;  1L2O C;  2PSR A;  2LP2 A;  3QRX A;  1LA0 A;  4NDB A;  3TUY B;  4M2O A;  1UHN A;  2SCP A;  2EC6 C;  1SR6 C;  2JPT A;  4MRX A;  4PHJ A;  4GNK B;  5CSF A;  3SG5 A;  2SAS A;  1XFW O;  2L4H A;  4PHM A;  2I94 A;  2L0P A;  4DIR A;  5F6T A;  1DJI A;  1KQM C;  1S26 D;  2K7D A;  3IQO A;  1YVH A;  2LVJ A;  1K9K A;  2KOT A;  2NLN A;  1M45 A;  2OPO A;  4YGC B;  1B4C A;  3TZ1 A;  2EGD A;  2M3W A;  4YGA A;  4D1E A;  1SNL A;  4DRW A;  4MBE A;  4PDZ A;  5I2O A;  3LL8 B;  3KEV A;  3D10 A;  3FWC A;  4PAL A;  2LP3 A;  1XFZ O;  1OMD A;  4JPZ B;  2HQ8 A;  3CR4 X;  3EK4 A;  1PUL A;  4E68 A;  1DT7 B;  4U8D A;  1QV1 A;  4GGN A;  1D1O A;  4ORA B;  4CPV A;  5AEQ A;  3JTD C;  4QJ4 B;  1UHH A;  4XYN A;  5I2L A;  2LMT A;  1KK8 B;  1J7P A;  1YRU B;  2A4J A;  2JWW A;  3OB1 B;  4GFT A;  3EK8 A;  1A29 A;  1YUT A;  2G9B A;  2OTG B;  1CDN A;  4P2Y B;  1CFD A;  4C0K A;  3ICB A;  1L7Z A;  2NXQ A;  1ZOT B;  1CB1 A;  1MR8 A;  2ZRT A;  5ER4 X;  3AAJ A;  4I5L B;  1SRA A;  1EL4 A;  3BOW A;  1C7V A;  1F8H A;  3LK0 A;  3VRR A;  4NDD A;  1J1D A;  1FW4 A;  1K90 D;  4OVN F;  4FQO A;  1B8R A;  4XJK A;  2WND A;  4MRY A;  1EG4 A;  2GV5 A;  1RFJ A;  1S6I A;  4GAO A;  1K9P A;  3VRO A;  2JNF A;  5AER A;  1PVB A;  2KGR A;  1NCY A;  2K2F A;  5DKQ A;  2H2K A;  4I5K A;  1J7R A;  2GGZ A;  3PAL A;  1M31 A;  1MUX A;  1KCY A;  2LLS A;  1CLM A;  2O5G A;  5CSJ A;  1E8A A;  1V1F A;  1F71 A;  4P5O E;  3BUO B;  2AMI A;  2HQW A;  1BU3 A;  1F4O A;  5BPJ A;  1R6P A;  1CTR A;  3AKB A;  1UUR A;  1QV0 A;  1TCO B;  1J1E A;  3DVE A;  2MLE C;  1SCM C;  4WRI A;  4DUQ A;  2LCP A;  1XO5 A;  2KQY A;  1KK7 Y;  3BXK A;  1N2D A;  1AJ5 A;  1CM1 A;  3SG7 A;  3DD4 A;  2L5X B;  2KI4 C;  1SCM B;  1BG1 A;  1AVS A;  1SYM A;  5CPV A;  2JU0 A;  4YGE B;  1JFK A;  1G4Y R;  4IL1 A;  2OS8 C;  2MHH A;  3O78 A;  2JC2 A;  2LUX A;  4C0J A;  1A03 A;  1QVI Z;  1W7J B;  1V1G A;  3OB2 B;  1XK4 C;  3CTN A;  2LVV A;  1B47 A;  3HCM A;  1LIN A;  2OS8 B;  4YBH B;  3BYA A;  4HSZ A;  5HKW A;  2K0J A;  2BEC A;  2K2A A;  2HET A;  3CS1 A;  1GGW A;  1KWO B;  1QXP A;  3VRN A;  5I2Q A;  3LCP C;  3DVM A;  1Q80 A;  3O6B A;  1A75 B;  2KBM A;  3KF9 A;  1TIZ A;  1HQV A;  1DMO A;  4I5J A;  1FF1 A;  5DKN A;  2O60 A;  4JQ0 D;  1OZO A;  1K8U A;  2MA2 A;  3BUW B;  3VRQ A;  1QIV A;  1Y1U A;  4ORB B;  2WC8 A;  2M9G A;  3K21 A;  1AP4 A;  2F33 A;  3PLF B;  1PVA A;  2LVK A;  5D7F A;  3D0Y B;  1S6J A;  3NXA A;  1EXR A;  1PRW A;  1S6C A;  3I5F C;  4OKH A;  1ALV A;  2JT8 A;  1AK8 A;  4N1F A;  4WQ3 A;  1UWO A;  4M2Q A;  1NUB A;  2KSP A;  3WHU B;  3JVT C;  4UPG A;  1YX8 A;  1IJ5 A;  1QJT A;  5CSN A;  1CDP A;  1IKU A;  2PAL A;  1DF0 B;  2LLT A;  3I5H C;  1SMG A;  4BY5 A;  1B9A A;  2B1U A;  2BE6 A;  3BUX B;  1L2O B;  4HRG A;  3LLE A;  1NX3 A;  4HRH A;  2EC6 B;  1SR6 B;  1AHR A;  3I5H B;  1M63 B;  1JF2 A;  1CKK A;  3SIA A;  1A4P A;  3OP0 A;  2NCP A;  3O2P A;  4JWQ A;  1BOD A;  1XFX O;  1YRT B;  2FOT A;  3NSK A;  4MZK A;  2LVI A;  2K7O A;  1K94 A;  5ER5 A;  1IQ3 A;  1KQM B;  2JXC A;  2M7L A;  4DCK A;  2K7C A;  1S1E A;  1K9U A;  3H4S E;  1S5G Y;  3A4U B;  2ISD A;  3NSO A;  4TNC A;  2M0R A;  1UHJ A;  1KFU S;  2ZFD A;  2KI6 D;  4N5X A;  4MZL A;  1GGZ A;  1TNW A;  3I5I C;  4CLN A;  2ZND A;  3OX6 A;  3WNX B;  1DGU A;  1RJV A;  3EKH A;  3GK2 A;  2KAY A;  4MLW A;  3EVR A;  5DKR A;  2KNE A;  1WDC C;  1UHK A;  1CDM A;  3JTD B;  2KYC A;  2KDH A;  2I7A A;  2K8M B;  1J7Q A;  2E30 A;  2JUL A;  1GQM A;  3SG3 A;  4I5N B;  2FCE A;  2JTT A;  1SW8 A;  2Y5I A;  4OCI A;  1TNQ A;  1BLQ A;  1SL9 A;  1BT6 A;  1DGV A;  2M1K B;  3CR2 A;  3CZT X;  2JNX A;  5D69 A;  1TNP A;  2LUC A;  4CID A;  2M97 A;  3DVJ A;  4DS7 A;  2F2P A;  1TNX A;  1QLK A;  2V53 A;  2MRD A;  3IF7 A;  2COL B;  1J55 A;  2M1U A;  1JUO A;  2JT0 A;  1ODB A;  1JSA A;  1QAT A;  2CNP A;  1SCV A;  1R2U A;  3DF0 B;  2PMY A;  2JQ6 A;  4N1G A;  2HF5 A;  3SJS A;  4ZCV A;  4BY4 A;  5AFP A;  5K89 A;  2ZN9 A;  3TDI A;  1QAS A;  1UUS A;  4YGB B;  1XK4 A;  1LKJ A;  1NIW A;  1CFF A;  2LV7 A;  1YR5 A;  3PSR A;  3RM1 A;  2BCX A;  2F3Y A;  1OOJ A;  5FYX A;  1A75 A;  1AJ4 A;  1BR1 B;  1RTP 1;  4YI8 A;  1C7W A;  4AQI A;  1RK9 A;  1U5I B;  3EKJ A;  1MF8 B;  2JXL A;  2F2O A;  3TS5 C;  4ICB A;  1NCX A;  2M8U A;  3OX5 A;  4PE0 A;  3D0Y A;  1YX7 A;  3WXA A;  4NDC A;  1DJY A;  1IJ6 A;  1NYA A;  3C1V A;  4GGF C;  1FPW A;  1Y6W A;  5HYD A;  1SK6 D;  3F45 A;  1YUU A;  2KAV A;  5KU1 A;  2KI4 B;  1XVJ A;  4MN0 A;  2ZRS A;  1DF0 A;  1VRK A;  1KSO A;  2EHB A;  1GJY A;  1NX0 A;  1OSA A;  1ALW A;  1B1G A;  2KAX A;  2CCM A;  2KFG A;  1F54 A;  5J3X A;  1B8C A;  2BKI B;  2JOJ A;  3NSL A;  2JTZ A;  4QJ5 B;  2KFH A;  1H4B A;  1MXE A;  1QLS A;  2BKH B;  2ZKM X;  5JOL A;  1NX2 A;  4YI9 A;  2BE4 A;  1JC2 A;  2Q4U A;  1BOC A;  1IG5 A;  2LC5 A;  2MAZ A;  1JBA A;  2ZN8 A;  1MQ1 A;  2L50 A;  3A8R A;  1KK7 Z;  1SY9 A;  1NWD A;  1KSM A;  1QTX A;  5HKZ A;  1A2X A;  3BUM B;  1JF0 A;  2Q91 A;  3PN7 C;  2AUC A;  2KQ6 A;  1IQ5 A;  4AQJ A;  2LMU A;  1RWY A;  2G2B A;  3I5F B;  1XYD A;  2H61 C;  1DJG A;  4GUK A;  1F55 A;  1JWD A;  1WLM A;  1UHI A;  3JVT B;  4ETO A;  2L2E A;  1X02 A;  1ZAC A;  1DJX A;  1EJ3 A;  2WOR A;  1EH2 A;  2PRU A;  2JZI A;  4USL A;  1NPQ A;  1CMG A;  2JT3 A;  1CFP A;  1QX7 A;  1EG3 A;  5G08 A;  4Q04 A;  1OE9 B;  1B8L A;  3CWG A;  1BR4 B;  3FS7 A;  3LK1 A;  2P6B B;  4F0Z B;  3SG4 A;  2WCF A;  2L51 A;  3SG2 A;  1YVL A;  1KQV A;  2VRG A;  3MSE B;  4YGD B;  1DJW A;  2WCB A;  3FIA A;  1B7T Z;  1CM4 A;  1NP8 A;  1TN4 A;  2KI6 C;  2WOS A;  1N0Y A;  4PHN A;  5HKY A;  1H8B A;  1S3P A;  2Y1M A;  4PHK A;  1LXF C;  3TDU A;  1WRK A;  2TN4 A;  2WCE A;  1OQP A;  3DF0 A;  1TCF A;  1QS7 A;  5HLO A;  5AXI A;  1OZS A;  4MSP A;  4A4C A;  1AUI B;  2ZNE A;  3I5I B;  5GQQ C;  3RLZ A;  3HX4 A;  1BJF A;  1NCZ A;  4AOM A;  4MEW A;  4MVF A;  2BCB A;  4GPL B;  1UP5 A;  1S36 A;  4PE4 A;  1SBJ A;  1WDC B;  1IGV A;  5HLV A;  1U5I A;  1YUS A;  2BL0 C;  2MBX A;  4PE7 A;  1HT9 A;  5B8I B;  4YRU A;  2PAS A;  2M49 B;  5JJG A;  1LVC D;  4NQG A;  1G8I A;  2BL0 B;  1KK8 C;  3O4Y A;  1IH0 A;  1REC A;  1XFV O;  2OTG C;  2K7B A;  1F70 A;  1FI6 A;  1S5G Z;  1DVI A;  2M7N A;  3IQQ A;  1CLB A;  1N65 A;  4FTG A;  1Y1A A;  3KHE A;  3PAT A;  1OMV A;  1MHO A;  4GGF A;  2R2I A;  3ZNI A;  1CMF A;  1QIW A;  3WHT B;  2FJU B;  1K95 A;  5PAL A;  2E6W A;  3M0W A;  5TNC A;  3TDZ A;  2KYF A;  2LAN A;  3EVU A;  1DJZ A;  1YTZ C;  2RGI A;  1K93 D;  1W7I B;  2KFF A;  2LAP A;  2PVB A;  4WQ2 A;  5IBW A;  2LHL A;  2K61 A;  1XA5 A;  2KHN A;  1KFX L;  2CBL A;  2GGM A;  2NZ0 A;  1QVI Y;  1SL8 A;  2LHI A;  4QJ3 B;  3KO0 A;  1OMR A;  1SL7 A;  1Y0V H;  1TOP A;  2LM5 A;  3EK7 A;  2F8P A;  4CFR A;  1QX2 A;  2CTN A;  2MLF C;  1SPY A;  3I5G C;  3TS5 B;  3BUN B;  1ZMZ A;  2BBM A;  1DJH A;  3OHM B;  2KGB C;  4CFQ A;  1CNP A;  1M46 A;  2Y4Q A;  1PSR A;  2IS9 A;  4MZJ A;  1BMO A;  3I5G B;  4GBA A;  3BQ3 A;  4PCW A;  3CR5 X;  1PK0 D;  1FBV A;  1MXL C;  2I2R E;  4OR9 B;  3EVV A;  1M39 A;  1QX5 B;  1MWN A;  2H61 A;  4A4B A;  1JFJ A;  2F3Z A;  1NSH A;  3AAK A;  3CGA A;  2JRF A;  1IRJ A;  2BCA A;  1ZUZ A;  1CLL A;  4PE1 A;  3GK1 A;  2M29 A;  2QPT A;  2CT9 A;  5CSI A;  1FI5 A;  3BOW B;  2LE9 B;  1DTL A;  1C07 A;  1XFY O;  2I18 A;  5AAN A;  3VGO A;  1CFC A;  4XJK B;  3SIB A;  3VRP A;  2CXJ A;  2QAC A;  2LNK A;  1XFU O;  2MJW B;  4ZCU A;  1TTX A;  1WRL A;  1J7O A;  1NX1 A;  3CLN A;  1KFX S;  1KWO C;  4C0L A;  3SG6 A;  3KPX A;  1SKT A;  4OV2 A;  2LLU A;  2LMV A;  3GOF A;  1PAL A;  1LA3 A;  1WRZ A;  2FCD A;  4L9M A;  1WY9 A;  4R1E A;  3PN7 B;  1Y1X A;  3NSI A;  3GK4 X;  1IWQ A;  3FWB A;  1YUR A;  1KFU L;  1PSB A;  5KSZ A;  2D8N A;  1G33 A;  4ORC B;  1CDL A;  2DOQ A;  5I8N A;  2BBN A;  2AAO A;  3PFV A;  1B7T Y;  3AKA A;  5KTY A;  1WLZ A;  2L98 A;  1F4Q A;  1RRO A;  1K2H A;  2HPS A;  2L4I A;  3DVK A;  1BF5 A;  4M2P A;  3ZWH A; 
#chains in the Genus database with same CATH topology
 3PM8 A;  3TUY C;  3D76 A;  3D74 A;  3E3R A;  3S0A A;  1TUJ A;  2NCO A;  4HRE E;  2QEH A;  1K96 A;  1TRF A;  1ZFS A;  2KBI A;  2Y1N A;  1L2O C;  2PSR A;  2LP2 A;  3QRX A;  1LA0 A;  4NDB A;  3TUY B;  4M2O A;  1UHN A;  2SCP A;  2EC6 C;  1SR6 C;  2JPT A;  4MRX A;  4PHJ A;  4GNK B;  5CSF A;  3B86 A;  3SG5 A;  2SAS A;  1XFW O;  2L4H A;  2QDI A;  4PHM A;  2I94 A;  2L0P A;  2WCH A;  4DIR A;  5F6T A;  3PM2 A;  1DJI A;  1KQM C;  1S26 D;  2K7D A;  3IQO A;  1YVH A;  2LVJ A;  3K1E A;  3V2L A;  1K9K A;  2KOT A;  2NLN A;  3DYE A;  3R1O A;  1M45 A;  2OPO A;  4YGC B;  1B4C A;  3TZ1 A;  2EGD A;  2M3W A;  4YGA A;  4D1E A;  1SNL A;  2WC5 A;  4MBE A;  4PDZ A;  4DRW A;  3LL8 B;  5I2O A;  3KEV A;  3D10 A;  3FWC A;  4PAL A;  2LP3 A;  1XFZ O;  1OMD A;  4JPZ B;  2HQ8 A;  3CR4 X;  3EK4 A;  3BJH A;  1PUL A;  4E68 A;  1DT7 B;  4U8D A;  1QV1 A;  4GGN A;  2H8V A;  3DY9 A;  4ORA B;  1D1O A;  4CPV A;  2FJY A;  5AEQ A;  3JTD C;  4QJ4 B;  1UHH A;  2QEV A;  3IVT A;  4XYN A;  5I2L A;  3D77 A;  2LMT A;  1KK8 B;  1J7P A;  1YRU B;  2A4J A;  2JWW A;  3OB1 B;  4GFT A;  3EK8 A;  1A29 A;  1YUT A;  2G9B A;  2OTG B;  1CDN A;  4P2Y B;  1CFD A;  4C0K A;  3ICB A;  3UNW A;  1L7Z A;  2NXQ A;  1ZOT B;  1CB1 A;  1MR8 A;  2ZRT A;  5ER4 X;  3AAJ A;  4I5L B;  1SRA A;  1EL4 A;  3BOW A;  1C7V A;  1F8H A;  3LK0 A;  3VRR A;  4NDD A;  1J1D A;  4FQT A;  1FW4 A;  1K90 D;  4OVN F;  5EL2 A;  4FQO A;  1B8R A;  4XJK A;  2WND A;  4MRY A;  1EG4 A;  2GV5 A;  1RFJ A;  1S6I A;  4GAO A;  1K9P A;  3VRO A;  2JNF A;  5AER A;  1PVB A;  2KGR A;  1NCY A;  2K2F A;  5DKQ A;  2H2K A;  4I5K A;  1J7R A;  2GGZ A;  3PAL A;  1M31 A;  1MUX A;  1T14 A;  1KCY A;  2LLS A;  1CLM A;  2O5G A;  5CSJ A;  1E8A A;  1V1F A;  1F71 A;  4P5O E;  3D75 A;  3BUO B;  2AMI A;  2HQW A;  1BU3 A;  1F4O A;  5BPJ A;  1R6P A;  1Z4H A;  1CTR A;  3AKB A;  1UUR A;  1QV0 A;  1TCO B;  1J1E A;  3DVE A;  2MLE C;  1SCM C;  4WRI A;  2GTE A;  4IJ7 A;  4DUQ A;  2LCP A;  1XO5 A;  2KQY A;  1KK7 Y;  1XFR A;  1N2D A;  3BXK A;  1AJ5 A;  1CM1 A;  3SG7 A;  1OOG A;  3DD4 A;  2L5X B;  2KI4 C;  1SCM B;  2WCK A;  1AVS A;  1SYM A;  2KLE A;  2JU0 A;  5CPV A;  1BG1 A;  4YGE B;  1JFK A;  1G4Y R;  4IL1 A;  2OS8 C;  2MHH A;  3O78 A;  2JC2 A;  2LUX A;  4C0J A;  1A03 A;  1QVI Z;  1W7J B;  1V1G A;  3OB2 B;  1XK4 C;  3CTN A;  2LVV A;  1B47 A;  3HCM A;  1LIN A;  2OS8 B;  4YBH B;  3BYA A;  4HSZ A;  5HKW A;  1OW4 A;  2K0J A;  2BEC A;  3EG5 B;  2K2A A;  2HET A;  3CS1 A;  1GGW A;  1KWO B;  1QXP A;  3OBV A;  3VRN A;  5I2Q A;  3LCP C;  3DVM A;  3S0F A;  1Q80 A;  3O6B A;  1A75 B;  2KBM A;  3KF9 A;  3CAB A;  1TIZ A;  1HQV A;  1DMO A;  4I5J A;  1FF1 A;  5DKN A;  2O60 A;  4JQ0 D;  1OZO A;  1K8U A;  2MA2 A;  3BUW B;  3VRQ A;  1QIV A;  1Y1U A;  4ORB B;  2WC8 A;  2M9G A;  3K21 A;  3VB1 A;  1AP4 A;  2F33 A;  3PLF B;  1PVA A;  2LVK A;  1W9Z A;  4KYN A;  5D7F A;  3CDN A;  3D0Y B;  1S6J A;  3NXA A;  1EXR A;  1PRW A;  1S6C A;  3I5F C;  4OKH A;  1ALV A;  2JT8 A;  1AK8 A;  1DQE A;  4N1F A;  4WQ3 A;  1UWO A;  4M2Q A;  2BNX A;  1NUB A;  2KSP A;  3WHU B;  3JVT C;  4UPG A;  1YX8 A;  1IJ5 A;  1QJT A;  5CSN A;  1CDP A;  1IKU A;  2PAL A;  1DF0 B;  2LLT A;  4JD9 A;  3DXL A;  3I5H C;  1SMG A;  4BY5 A;  1B9A A;  2B1U A;  2BE6 A;  3NHT A;  3BUX B;  1L2O B;  4HRG A;  3LLE A;  1NX3 A;  4HRH A;  2EC6 B;  1SR6 B;  3NHI A;  1AHR A;  3I5H B;  1M63 B;  1TUZ A;  1JF2 A;  1CKK A;  3S0B A;  3SIA A;  1A4P A;  3OP0 A;  2NCP A;  3O2P A;  3D73 A;  3Q8I A;  4JWQ A;  4F7F A;  3O4X A;  1BOD A;  1XFX O;  1YRT B;  2FOT A;  3NSK A;  4MZK A;  2LVI A;  2K7O A;  1K94 A;  5ER5 A;  1IQ3 A;  1KQM B;  2JXC A;  2M7L A;  4DCK A;  3CZ1 A;  2K7C A;  1S1E A;  1K9U A;  3H4S E;  1S5G Y;  3A4U B;  2ISD A;  3NSO A;  4TNC A;  2M0R A;  1UHJ A;  1KFU S;  2ZFD A;  2KI6 D;  4N5X A;  3S0E A;  3DZT A;  4MZL A;  1GGZ A;  1TNW A;  1DEL A;  3I5I C;  2ZND A;  3OX6 A;  4CLN A;  3WNX B;  1DGU A;  1RJV A;  3D78 A;  3EKH A;  3GK2 A;  1DEK A;  2KAY A;  4MLW A;  3FE6 A;  3EVR A;  4INX A;  5DKR A;  2KNE A;  1WDC C;  1UHK A;  1CDM A;  3JTD B;  2KYC A;  2KDH A;  2I7A A;  2K8M B;  1J7Q A;  2E30 A;  2JUL A;  1IIO A;  5FI6 A;  1GQM A;  4PT1 A;  4I5N B;  3SG3 A;  2FCE A;  2JTT A;  1SW8 A;  2Y5I A;  4OCI A;  1TNQ A;  1BLQ A;  1SL9 A;  1BT6 A;  1DGV A;  2M1K B;  3CR2 A;  3CZT X;  2JNX A;  5D69 A;  1TNP A;  2LUC A;  4CID A;  2M97 A;  3DVJ A;  4DS7 A;  2F2P A;  1TNX A;  1QLK A;  5D3O A;  2V53 A;  2MRD A;  3IF7 A;  2COL B;  4JKT A;  1J55 A;  2M1U A;  3SS5 A;  1JUO A;  2JT0 A;  1ODB A;  3L4L A;  4INW A;  1JSA A;  1QAT A;  2CNP A;  1SCV A;  1R2U A;  3DF0 B;  2PMY A;  2JQ6 A;  4N1G A;  2HF5 A;  3SJS A;  4ZCV A;  4BY4 A;  5AFP A;  5K89 A;  2ZN9 A;  3TDI A;  1QAS A;  1UUS A;  4YGB B;  2WCJ A;  1XK4 A;  1LKJ A;  1NIW A;  1CFF A;  2LV7 A;  1YR5 A;  3PSR A;  3RM1 A;  3QME A;  2BCX A;  2F3Y A;  1OOJ A;  5FYX A;  1A75 A;  1AJ4 A;  1BR1 B;  1RTP 1;  4YI8 A;  1C7W A;  4AQI A;  2WC6 A;  1RK9 A;  1U5I B;  3EKJ A;  3CYZ A;  1MF8 B;  2JXL A;  2F2O A;  3TS5 C;  4ICB A;  1NCX A;  2M8U A;  3OX5 A;  4PE0 A;  1TWO A;  1LS8 A;  3D0Y A;  1YX7 A;  3WXA A;  4NDC A;  1DJY A;  1IJ6 A;  1NYA A;  2QEB A;  3C1V A;  4GGF C;  1FPW A;  1Y6W A;  5HYD A;  1SK6 D;  3F45 A;  1YUU A;  2KAV A;  1SSE B;  5KU1 A;  4OZD A;  2KI4 B;  1XVJ A;  4MN0 A;  2ZRS A;  1DF0 A;  1VRK A;  2P70 A;  1KSO A;  2EHB A;  1GJY A;  1NX0 A;  1OSA A;  1ALW A;  1B1G A;  2KAX A;  2CCM A;  2KFG A;  1F54 A;  5J3X A;  1B8C A;  2BKI B;  2JOJ A;  2QEO A;  3NGV A;  3NSL A;  2JTZ A;  4QJ5 B;  2KFH A;  1H4B A;  1MXE A;  1QLS A;  2BKH B;  2ZKM X;  5JOL A;  1NX2 A;  4YI9 A;  3FE8 A;  2BE4 A;  1JC2 A;  2Q4U A;  1BOC A;  1IG5 A;  2PYQ A;  2LC5 A;  2MAZ A;  1JBA A;  2ZN8 A;  1MQ1 A;  2L50 A;  3A8R A;  1KK7 Z;  1SY9 A;  1NWD A;  2WCL A;  1KSM A;  1QTX A;  5HKZ A;  1A2X A;  3BUM B;  1JF0 A;  2Q91 A;  3CZ0 A;  3PN7 C;  3S0D A;  2AUC A;  2KQ6 A;  1IQ5 A;  4AQJ A;  2LMU A;  1RWY A;  2G2B A;  3I5F B;  1XYD A;  2H61 C;  1DJG A;  4GUK A;  1F55 A;  1JWD A;  1WLM A;  1UHI A;  3JVT B;  4ETO A;  2L2E A;  1X02 A;  1P28 A;  1ZAC A;  5FI2 A;  1DJX A;  1EJ3 A;  2WOR A;  3OGN A;  1EH2 A;  2PRU A;  2JZI A;  4USL A;  1NPQ A;  1CMG A;  2JT3 A;  1CFP A;  1QX7 A;  1EG3 A;  5G08 A;  1DC1 A;  4Q04 A;  1OE9 B;  1B8L A;  3CWG A;  1BR4 B;  3FS7 A;  3LK1 A;  2P6B B;  4F0Z B;  3SG4 A;  2WCF A;  2L51 A;  3SG2 A;  1YVL A;  1KQV A;  2VRG A;  3MSE B;  4YGD B;  1DJW A;  2WCB A;  3FIA A;  1B7T Z;  1CM4 A;  1NP8 A;  1TN4 A;  2KI6 C;  2WOS A;  1N0Y A;  3L47 A;  4PHN A;  1H8B A;  1S3P A;  2Y1M A;  4PHK A;  1LXF C;  3TDU A;  1WRK A;  2TN4 A;  2WCE A;  1OQP A;  3DF0 A;  1TCF A;  1QS7 A;  5HLO A;  5AXI A;  1OZS A;  4MSP A;  4A4C A;  1C3Y A;  1AUI B;  3FE9 A;  2ZNE A;  3I5I B;  5GQQ C;  3SS3 A;  2L2C A;  3RLZ A;  3HX4 A;  1BJF A;  1NCZ A;  4AOM A;  4MEW A;  3N7H A;  4MVF A;  2BCB A;  4GPL B;  1UP5 A;  1S36 A;  1OOF A;  2ERB A;  1SBJ A;  4PE4 A;  1WDC B;  1IGV A;  1OOI X;  5HLV A;  1U5I A;  1YUS A;  2BL0 C;  2MBX A;  4PE7 A;  1HT9 A;  5B8I B;  4YRU A;  2PAS A;  2M49 B;  5JJG A;  2YGU A;  1LVC D;  2BAP A;  4NQG A;  1G8I A;  2BL0 B;  1KK8 C;  3O4Y A;  1IH0 A;  1REC A;  1XFV O;  2KLD A;  2OTG C;  2K7B A;  1F70 A;  1FI6 A;  1S5G Z;  2PQL A;  1DVI A;  2M7N A;  3IQQ A;  1CLB A;  1N65 A;  4FTG A;  1Y1A A;  3KHE A;  3PAT A;  1OMV A;  1MHO A;  4GGF A;  2R2I A;  3ZNI A;  1CMF A;  1QIW A;  3CZ2 A;  2FJU B;  1K95 A;  3WHT B;  1C3Z A;  5PAL A;  2E6W A;  3UO9 A;  3M0W A;  5TNC A;  3TDZ A;  2KYF A;  2LAN A;  3EVU A;  1DJZ A;  1YTZ C;  2RGI A;  1K93 D;  1W7I B;  3RZS A;  5DIC A;  3BFA A;  2KFF A;  2LAP A;  2PVB A;  4WQ2 A;  5IBW A;  2LHL A;  2K61 A;  1XA5 A;  2KHN A;  3S0G A;  1KFX L;  2CBL A;  2GGM A;  2NZ0 A;  1QVI Y;  1SL8 A;  2LHI A;  4QJ3 B;  3KO0 A;  1OMR A;  1SL7 A;  1Y0V H;  1TOP A;  2LM5 A;  3EK7 A;  2F8P A;  4CFR A;  1QX2 A;  2CTN A;  2KPH A;  2MLF C;  1SPY A;  3B87 A;  3I5G C;  3TS5 B;  3BUN B;  2L5Y A;  1ZMZ A;  2BBM A;  1DJH A;  3OHM B;  2KGB C;  4CFQ A;  1CNP A;  1M46 A;  2Y4Q A;  3SS4 A;  1PSR A;  1GM0 A;  2IS9 A;  4MZJ A;  1BMO A;  3I5G B;  4GBA A;  3B88 A;  3BQ3 A;  3B6X A;  3CR5 X;  3PJI A;  1PK0 D;  3R1V A;  1FBV A;  1MXL C;  2I2R E;  4OR9 B;  3EVV A;  3R1P A;  2JPO A;  1M39 A;  1QX5 B;  1MWN A;  2H61 A;  4A4B A;  5HL1 A;  2F3Z A;  1JFJ A;  1NSH A;  3AAK A;  3CGA A;  2JRF A;  1IRJ A;  2BCA A;  1ZUZ A;  3BFH A;  1CLL A;  2P71 A;  3GK1 A;  2M29 A;  1QWV A;  2CT9 A;  2QPT A;  4PE1 A;  5CSI A;  3BFB A;  3BOW B;  2LE9 B;  1FI5 A;  1ORG A;  1DTL A;  1C07 A;  1OOH A;  1XFY O;  2I18 A;  5AAN A;  3VGO A;  1CFC A;  4XJK B;  3SIB A;  3VRP A;  2CXJ A;  2QAC A;  2LNK A;  2K60 A;  1XFU O;  2MJW B;  4ZCU A;  1TTX A;  1WRL A;  1J7O A;  1NX1 A;  3CLN A;  1KFX S;  1KWO C;  4C0L A;  3SG6 A;  3KPX A;  1SKT A;  2WCM A;  2LLU A;  4OV2 A;  5FI7 A;  2LMV A;  3GOF A;  1PAL A;  1LA3 A;  1WRZ A;  2FCD A;  4L9M A;  1WY9 A;  4R1E A;  3PN7 B;  1Y1X A;  3NSI A;  3R72 A;  3GK4 X;  1IWQ A;  4PCW A;  3FWB A;  1YUR A;  1KFU L;  1PSB A;  5KSZ A;  2D8N A;  1G33 A;  1Z2C B;  4ORC B;  1CDL A;  3B7A A;  5HKY A;  2DOQ A;  5I8N A;  2BBN A;  2AAO A;  3PFV A;  1B7T Y;  3AKA A;  3L4A A;  5KTY A;  1WLZ A;  2L98 A;  1F4Q A;  1RRO A;  5I94 A;  1K2H A;  2HPS A;  2L4I A;  3DVK A;  1BF5 A;  4M2P A;  3ZWH A; 
#chains in the Genus database with same CATH homology
 3PM8 A;  3TUY C;  3E3R A;  2NCO A;  4HRE E;  1K96 A;  1TRF A;  1ZFS A;  2KBI A;  2Y1N A;  1L2O C;  2PSR A;  2LP2 A;  3QRX A;  1LA0 A;  4NDB A;  3TUY B;  4M2O A;  1UHN A;  2SCP A;  2EC6 C;  1SR6 C;  2JPT A;  4MRX A;  4PHJ A;  4GNK B;  5CSF A;  3SG5 A;  2SAS A;  1XFW O;  2L4H A;  4PHM A;  2I94 A;  2L0P A;  4DIR A;  5F6T A;  1DJI A;  1KQM C;  1S26 D;  2K7D A;  3IQO A;  1YVH A;  2LVJ A;  1K9K A;  2KOT A;  2NLN A;  1M45 A;  2OPO A;  4YGC B;  1B4C A;  3TZ1 A;  2EGD A;  2M3W A;  4YGA A;  4D1E A;  1SNL A;  4DRW A;  4MBE A;  4PDZ A;  5I2O A;  3LL8 B;  3KEV A;  3D10 A;  3FWC A;  4PAL A;  2LP3 A;  1XFZ O;  1OMD A;  4JPZ B;  2HQ8 A;  3CR4 X;  3EK4 A;  1PUL A;  4E68 A;  1DT7 B;  4U8D A;  1QV1 A;  4GGN A;  1D1O A;  4ORA B;  4CPV A;  5AEQ A;  3JTD C;  4QJ4 B;  1UHH A;  4XYN A;  5I2L A;  2LMT A;  1KK8 B;  1J7P A;  1YRU B;  2A4J A;  2JWW A;  3OB1 B;  4GFT A;  3EK8 A;  1A29 A;  1YUT A;  2G9B A;  2OTG B;  1CDN A;  4P2Y B;  1CFD A;  4C0K A;  3ICB A;  1L7Z A;  2NXQ A;  1ZOT B;  1CB1 A;  1MR8 A;  2ZRT A;  5ER4 X;  3AAJ A;  4I5L B;  1SRA A;  1EL4 A;  3BOW A;  1C7V A;  1F8H A;  3LK0 A;  3VRR A;  4NDD A;  1J1D A;  1FW4 A;  1K90 D;  4OVN F;  4FQO A;  1B8R A;  4XJK A;  2WND A;  4MRY A;  1EG4 A;  2GV5 A;  1RFJ A;  1S6I A;  4GAO A;  1K9P A;  3VRO A;  2JNF A;  5AER A;  1PVB A;  2KGR A;  1NCY A;  2K2F A;  5DKQ A;  2H2K A;  4I5K A;  1J7R A;  2GGZ A;  3PAL A;  1M31 A;  1MUX A;  1KCY A;  2LLS A;  1CLM A;  2O5G A;  5CSJ A;  1E8A A;  1V1F A;  1F71 A;  4P5O E;  3BUO B;  2AMI A;  2HQW A;  1BU3 A;  1F4O A;  5BPJ A;  1R6P A;  1CTR A;  3AKB A;  1UUR A;  1QV0 A;  1TCO B;  1J1E A;  3DVE A;  2MLE C;  1SCM C;  4WRI A;  4DUQ A;  2LCP A;  1XO5 A;  2KQY A;  1KK7 Y;  3BXK A;  1N2D A;  1AJ5 A;  1CM1 A;  3SG7 A;  3DD4 A;  2L5X B;  2KI4 C;  1SCM B;  1BG1 A;  1AVS A;  1SYM A;  5CPV A;  2JU0 A;  4YGE B;  1JFK A;  1G4Y R;  4IL1 A;  2OS8 C;  2MHH A;  3O78 A;  2JC2 A;  2LUX A;  4C0J A;  1A03 A;  1QVI Z;  1W7J B;  1V1G A;  3OB2 B;  1XK4 C;  3CTN A;  2LVV A;  1B47 A;  3HCM A;  1LIN A;  2OS8 B;  4YBH B;  3BYA A;  4HSZ A;  5HKW A;  2K0J A;  2BEC A;  2K2A A;  2HET A;  3CS1 A;  1GGW A;  1KWO B;  1QXP A;  3VRN A;  5I2Q A;  3LCP C;  3DVM A;  1Q80 A;  3O6B A;  1A75 B;  2KBM A;  3KF9 A;  1TIZ A;  1HQV A;  1DMO A;  4I5J A;  1FF1 A;  5DKN A;  2O60 A;  4JQ0 D;  1OZO A;  1K8U A;  2MA2 A;  3BUW B;  3VRQ A;  1QIV A;  1Y1U A;  4ORB B;  2WC8 A;  2M9G A;  3K21 A;  1AP4 A;  2F33 A;  3PLF B;  1PVA A;  2LVK A;  5D7F A;  3D0Y B;  1S6J A;  3NXA A;  1EXR A;  1PRW A;  1S6C A;  3I5F C;  4OKH A;  1ALV A;  2JT8 A;  1AK8 A;  4N1F A;  4WQ3 A;  1UWO A;  4M2Q A;  1NUB A;  2KSP A;  3WHU B;  3JVT C;  4UPG A;  1YX8 A;  1IJ5 A;  1QJT A;  5CSN A;  1CDP A;  1IKU A;  2PAL A;  1DF0 B;  2LLT A;  3I5H C;  1SMG A;  4BY5 A;  1B9A A;  2B1U A;  2BE6 A;  3BUX B;  1L2O B;  4HRG A;  3LLE A;  1NX3 A;  4HRH A;  2EC6 B;  1SR6 B;  1AHR A;  3I5H B;  1M63 B;  1JF2 A;  1CKK A;  3SIA A;  1A4P A;  3OP0 A;  2NCP A;  3O2P A;  4JWQ A;  1BOD A;  1XFX O;  1YRT B;  2FOT A;  3NSK A;  4MZK A;  2LVI A;  2K7O A;  1K94 A;  5ER5 A;  1IQ3 A;  1KQM B;  2JXC A;  2M7L A;  4DCK A;  2K7C A;  1S1E A;  1K9U A;  3H4S E;  1S5G Y;  3A4U B;  2ISD A;  3NSO A;  4TNC A;  2M0R A;  1UHJ A;  1KFU S;  2ZFD A;  2KI6 D;  4N5X A;  4MZL A;  1GGZ A;  1TNW A;  3I5I C;  4CLN A;  2ZND A;  3OX6 A;  3WNX B;  1DGU A;  1RJV A;  3EKH A;  3GK2 A;  2KAY A;  4MLW A;  3EVR A;  5DKR A;  2KNE A;  1WDC C;  1UHK A;  1CDM A;  3JTD B;  2KYC A;  2KDH A;  2I7A A;  2K8M B;  1J7Q A;  2E30 A;  2JUL A;  1GQM A;  3SG3 A;  4I5N B;  2FCE A;  2JTT A;  1SW8 A;  2Y5I A;  4OCI A;  1TNQ A;  1BLQ A;  1SL9 A;  1BT6 A;  1DGV A;  2M1K B;  3CR2 A;  3CZT X;  2JNX A;  5D69 A;  1TNP A;  2LUC A;  4CID A;  2M97 A;  3DVJ A;  4DS7 A;  2F2P A;  1TNX A;  1QLK A;  2V53 A;  2MRD A;  3IF7 A;  2COL B;  1J55 A;  2M1U A;  1JUO A;  2JT0 A;  1ODB A;  1JSA A;  1QAT A;  2CNP A;  1SCV A;  1R2U A;  3DF0 B;  2PMY A;  2JQ6 A;  4N1G A;  2HF5 A;  3SJS A;  4ZCV A;  4BY4 A;  5AFP A;  5K89 A;  2ZN9 A;  3TDI A;  1QAS A;  1UUS A;  4YGB B;  1XK4 A;  1LKJ A;  1NIW A;  1CFF A;  2LV7 A;  1YR5 A;  3PSR A;  3RM1 A;  2BCX A;  2F3Y A;  1OOJ A;  5FYX A;  1A75 A;  1AJ4 A;  1BR1 B;  1RTP 1;  4YI8 A;  1C7W A;  4AQI A;  1RK9 A;  1U5I B;  3EKJ A;  1MF8 B;  2JXL A;  2F2O A;  3TS5 C;  4ICB A;  1NCX A;  2M8U A;  3OX5 A;  4PE0 A;  3D0Y A;  1YX7 A;  3WXA A;  4NDC A;  1DJY A;  1IJ6 A;  1NYA A;  3C1V A;  4GGF C;  1FPW A;  1Y6W A;  5HYD A;  1SK6 D;  3F45 A;  1YUU A;  2KAV A;  5KU1 A;  2KI4 B;  1XVJ A;  4MN0 A;  2ZRS A;  1DF0 A;  1VRK A;  1KSO A;  2EHB A;  1GJY A;  1NX0 A;  1OSA A;  1ALW A;  1B1G A;  2KAX A;  2CCM A;  2KFG A;  1F54 A;  5J3X A;  1B8C A;  2BKI B;  2JOJ A;  3NSL A;  2JTZ A;  4QJ5 B;  2KFH A;  1H4B A;  1MXE A;  1QLS A;  2BKH B;  2ZKM X;  5JOL A;  1NX2 A;  4YI9 A;  2BE4 A;  1JC2 A;  2Q4U A;  1BOC A;  1IG5 A;  2LC5 A;  2MAZ A;  1JBA A;  2ZN8 A;  1MQ1 A;  2L50 A;  3A8R A;  1KK7 Z;  1SY9 A;  1NWD A;  1KSM A;  1QTX A;  5HKZ A;  1A2X A;  3BUM B;  1JF0 A;  2Q91 A;  3PN7 C;  2AUC A;  2KQ6 A;  1IQ5 A;  4AQJ A;  2LMU A;  1RWY A;  2G2B A;  3I5F B;  1XYD A;  2H61 C;  1DJG A;  4GUK A;  1F55 A;  1JWD A;  1WLM A;  1UHI A;  3JVT B;  4ETO A;  2L2E A;  1X02 A;  1ZAC A;  1DJX A;  1EJ3 A;  2WOR A;  1EH2 A;  2PRU A;  2JZI A;  4USL A;  1NPQ A;  1CMG A;  2JT3 A;  1CFP A;  1QX7 A;  1EG3 A;  5G08 A;  4Q04 A;  1OE9 B;  1B8L A;  3CWG A;  1BR4 B;  3FS7 A;  3LK1 A;  2P6B B;  4F0Z B;  3SG4 A;  2WCF A;  2L51 A;  3SG2 A;  1YVL A;  1KQV A;  2VRG A;  3MSE B;  4YGD B;  1DJW A;  2WCB A;  3FIA A;  1B7T Z;  1CM4 A;  1NP8 A;  1TN4 A;  2KI6 C;  2WOS A;  1N0Y A;  4PHN A;  5HKY A;  1H8B A;  1S3P A;  2Y1M A;  4PHK A;  1LXF C;  3TDU A;  1WRK A;  2TN4 A;  2WCE A;  1OQP A;  3DF0 A;  1TCF A;  1QS7 A;  5HLO A;  5AXI A;  1OZS A;  4MSP A;  4A4C A;  1AUI B;  2ZNE A;  3I5I B;  5GQQ C;  3RLZ A;  3HX4 A;  1BJF A;  1NCZ A;  4AOM A;  4MEW A;  4MVF A;  2BCB A;  4GPL B;  1UP5 A;  1S36 A;  4PE4 A;  1SBJ A;  1WDC B;  1IGV A;  5HLV A;  1U5I A;  1YUS A;  2BL0 C;  2MBX A;  4PE7 A;  1HT9 A;  5B8I B;  4YRU A;  2PAS A;  2M49 B;  5JJG A;  1LVC D;  4NQG A;  1G8I A;  2BL0 B;  1KK8 C;  3O4Y A;  1IH0 A;  1REC A;  1XFV O;  2OTG C;  2K7B A;  1F70 A;  1FI6 A;  1S5G Z;  1DVI A;  2M7N A;  3IQQ A;  1CLB A;  1N65 A;  4FTG A;  1Y1A A;  3KHE A;  3PAT A;  1OMV A;  1MHO A;  4GGF A;  2R2I A;  3ZNI A;  1CMF A;  1QIW A;  3WHT B;  2FJU B;  1K95 A;  5PAL A;  2E6W A;  3M0W A;  5TNC A;  3TDZ A;  2KYF A;  2LAN A;  3EVU A;  1DJZ A;  1YTZ C;  2RGI A;  1K93 D;  1W7I B;  2KFF A;  2LAP A;  2PVB A;  4WQ2 A;  5IBW A;  2LHL A;  2K61 A;  1XA5 A;  2KHN A;  1KFX L;  2CBL A;  2GGM A;  2NZ0 A;  1QVI Y;  1SL8 A;  2LHI A;  4QJ3 B;  3KO0 A;  1OMR A;  1SL7 A;  1Y0V H;  1TOP A;  2LM5 A;  3EK7 A;  2F8P A;  4CFR A;  1QX2 A;  2CTN A;  2MLF C;  1SPY A;  3I5G C;  3TS5 B;  3BUN B;  1ZMZ A;  2BBM A;  1DJH A;  3OHM B;  2KGB C;  4CFQ A;  1CNP A;  1M46 A;  2Y4Q A;  1PSR A;  2IS9 A;  4MZJ A;  1BMO A;  3I5G B;  4GBA A;  3BQ3 A;  4PCW A;  3CR5 X;  1PK0 D;  1FBV A;  1MXL C;  2I2R E;  4OR9 B;  3EVV A;  1M39 A;  1QX5 B;  1MWN A;  2H61 A;  4A4B A;  1JFJ A;  2F3Z A;  1NSH A;  3AAK A;  3CGA A;  2JRF A;  1IRJ A;  2BCA A;  1ZUZ A;  1CLL A;  4PE1 A;  3GK1 A;  2M29 A;  2QPT A;  2CT9 A;  5CSI A;  1FI5 A;  3BOW B;  2LE9 B;  1DTL A;  1C07 A;  1XFY O;  2I18 A;  5AAN A;  3VGO A;  1CFC A;  4XJK B;  3SIB A;  3VRP A;  2CXJ A;  2QAC A;  2LNK A;  1XFU O;  2MJW B;  4ZCU A;  1TTX A;  1WRL A;  1J7O A;  1NX1 A;  3CLN A;  1KFX S;  1KWO C;  4C0L A;  3SG6 A;  3KPX A;  1SKT A;  4OV2 A;  2LLU A;  2LMV A;  3GOF A;  1PAL A;  1LA3 A;  1WRZ A;  2FCD A;  4L9M A;  1WY9 A;  4R1E A;  3PN7 B;  1Y1X A;  3NSI A;  3GK4 X;  1IWQ A;  3FWB A;  1YUR A;  1KFU L;  1PSB A;  5KSZ A;  2D8N A;  1G33 A;  4ORC B;  1CDL A;  2DOQ A;  5I8N A;  2BBN A;  2AAO A;  3PFV A;  1B7T Y;  3AKA A;  5KTY A;  1WLZ A;  2L98 A;  1F4Q A;  1RRO A;  1K2H A;  2HPS A;  2L4I A;  3DVK A;  1BF5 A;  4M2P A;  3ZWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...