3DD4A

Structural basis of kchip4a modulation of kv4.3 slow inactivation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
214
Chain Sequence
MNLEGLEMIAVLIVIVLFVKLLEQFGLIEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into KChIP4a Modulation of Kv4.3 Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Kv channel-interacting protein 4
total genus 80
structure length 214
sequence length 229
ec nomenclature
pdb deposition date 2008-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3dd4A00
4WQ3A 2JXCA 2ZRSA 3QRXA 3I5FB 1ALVA 2KI4B 2WCBA 1N65A 1M63B 3VRNA 4AQIA 1FPWA 2A4JA 1J7RA 3I5HB 4M2QA 2ISDA 4PE7A 1B4CA 1JUOA 1KWOC 1NYAA 2LLUA 3I5FC 3BUNB 1DJXA 2JT0A 1EJ3A 1MF8B 3I5HC 3GOFA 5DKNA 2KQYA 1BT6A 1CFPA 4WRIA 1J7PA 4DUQA 1QVIZ 1ALWA 5FYXA 3D0YA 1XFWO 1U5IA 3AKAA 3JTDC 4DCKA 2DOQA 2EC6B 3VROA 3NSLA 1KK8C 2QACA 2KHNA 3I5GB 2LVJA 1LVCD 5I2OA 2GGMA 1SPYA 2ZN9A 1PRWA 2KOTA 1XFXO 1A2XA 1DVIA 1IJ5A 2CCMA 3ZWHA 2B1UA 2BBNA 1QIVA 1RTP1 4PE1A 2TN4A 1S6CA 4UPGA 3FWBA 5J3XA 2KFFA 1FF1A 1CFDA 2BE4A 1QIWA 1SR6C 1KFXS 1NP8A 3DF0A 3NXAA 3VRPA 2KGBC 4PALA 2JOJA 3O78A 1OSAA 1NSHA 1F4QA 1YX7A 2EC6C 2HQWA 1BR4B 1KQMC 3KPXA 3O2PA 3BUXB 2CBLA 1BG1A 1PULA 1QTXA 1ZACA 1SRAA 1WDCC 1YUSA 3BOWA 5I2QA 2LLSA 1WLZA 1IGVA 1BR1B 1KQMB 1XFZO 3O6BA 4NDCA 5TNCA 1DJZA 1OZOA 4PHNA 4MRYA 1MR8A 4MRXA 2K2FA 1TN4A 1KK7Z 3LK0A 2KNEA 1E8AA 1J7QA 2WNDA 1A75B 5GQQC 1SR6B 2NCOA 3CR2A 4FTGA 1OMVA 5AANA 4F0ZB 2BCBA 4ZCUA 1GQMA 5HLVA 1NCZA 3CTNA 1J55A 1L2OB 3JTDB 1F71A 1RROA 5DKRA 3OB1B 1M45A 1MWNA 1KFUS 1W7JB 2BECA 2LV7A 4N5XA 2H61C 5I8NA 2JT8A 2L50A 2PVBA 5CPVA 1CTRA 2K2AA 5K89A 1CLLA 1JF2A 1BOCA 1JFJA 2AUCA 1K96A 1U5IB 1JFKA 1SCMC 5F6TA 1DT7B 3FS7A 2E6WA 1TNPA 3BQ3A 2BL0B 3NSIA 3TZ1A 4N1GA 3VRRA 1ZFSA 1XK4A 4DS7A 2L2EA 1YR5A 1KFUL 3MSEB 2M3WA 2Q91A 1B1GA 2QPTA 4IL1A 1B8CA 2K7BA 2F2PA 1S5GY 2K7DA 4OVNF 1CLBA 2GGZA 2WCEA 3DVMA 3ICBA 4ICBA 3DVJA 2NCPA 1EG4A 5HKYA 1V1FA 1CDLA 2LCPA 1CFCA 1B8RA 3EK4A 1TCFA 3CS1A 1C7WA 1DGUA 3DVEA 1SNLA 3EK8A 3O4YA 1QXPA 1SBJA 1V1GA 4QJ4B 4JQ0D 2VRGA 1YX8A 4ETOA 1J1DA 3IQQA 2COLB 4MZJA 4YGAA 4ORBB 1NX1A 4Q04A 2Q4UA 2MA2A 2M7LA 1NCYA 1EH2A 1KK7Y 3PSRA 3SG3A 1KSMA 1BMOA 1YUUA 1BODA 2V53A 4M2OA 3PFVA 1Y1UA 1K9PA 3LCPC 1UHJA 4MZLA 1YRUB 1BJFA 1EG3A 2IS9A 5G08A 1QJTA 1ODBA 1K95A 1UURA 3ZNIA 1QX7A 2PSRA 1S26D 2EGDA 2ZFDA 4P2YB 1JBAA 2JQ6A 1CMFA 5D7FA 2JTTA 1K9UA 1IWQA 1NX2A 1S3PA 1ZUZA 1XA5A 3CLNA 3OB2B 3EVRA 4YI8A 1CLMA 1SY9A 3JVTB 1CDMA 4ORCB 1TOPA 4GGNA 1MXLC 2F33A 3TUYB 2NZ0A 5HYDA 1M39A 1S6JA 2M9GA 3AAKA 4HRGA 1LA3A 3OHMB 3CGAA 3VGOA 4C0KA 1AP4A 2AAOA 4DRWA 4PE4A 1K2HA 4A4BA 3DD4A 4CIDA 4U8DA 4D1EA 1QASA 1C07A 1K90D 4PHMA 2LMTA 4DIRA 1YTZC 3EKJA 3VRQA 1UHHA 3D0YB 3AAJA 1QX2A 1XK4C 4NDDA 1MXEA 1AJ4A 3OX6A 1A29A 1SCVA 1GGZA 2KAVA 2M97A 3KHEA 1JWDA 5IBWA 2LMVA 2JU0A 2M1KB 4E68A 2LAPA 2Y1NA 1D1OA 2GV5A 2LE9B 2OTGC 1WRKA 1IQ3A 2EHBA 2BCAA 4PE0A 1S36A 1H4BA 1UUSA 3SIAA 3WNXB 1M46A 4CFRA 4I5LB 1OMDA 1PK0D 1XFUO 2K61A 2KAYA 1CFFA 4XJKB 1SK6D 1B8LA 2BE6A 2K7OA 1DF0A 4JWQA 2K7CA 1F8HA 4MVFA 1DJWA 1TNXA 4HREE 1DF0B 1GJYA 4GPLB 1KWOB 2PMYA 2G9BA 2JRFA 2L0PA 2LANA 4GFTA 4MSPA 1CKKA 3M0WA 3OX5A 2F3YA 3SG5A 2JNFA 2G2BA 1AVSA 1FW4A 1TNQA 2F8PA 3WXAA 2PALA 4PHKA 4I5NB 1XFVO 1MUXA 3TDUA 1NX3A 2KYCA 1S6IA 2AMIA 2HPSA 4P5OE 1OZSA 3JVTC 5CSJA 3RLZA 2FOTA 2WORA 2L98A 2R2IA 1NWDA 2JC2A 4WQ2A 1NCXA 1PSBA 3KF9A 1SCMB 3SG4A 1G4YR 1FI6A 1KK8B 3I5GC 2L4HA 1SYMA 4N1FA 2MHHA 2KSPA 2RGIA 1QV0A 4OV2A 1F70A 1RK9A 4I5KA 2LMUA 1CNPA 4C0LA 4A4CA 2D8NA 3BXKA 2BBMA 2Y4QA 1SMGA 3IQOA 4MBEA 3GK4X 3FWCA 2F2OA 2HF5A 3EKHA 4MLWA 1IJ6A 3HX4A 1CB1A 2KDHA 3AKBA 4AQJA 4YGEB 1NUBA 1TTXA 1EXRA 1OQPA 1SL9A 4GAOA 3BYAA 1B7TZ 1LKJA 2I2RE 1AUIB 3K21A 1YVHA 5ER5A 2LHIA 1S5GZ 2I7AA 2OS8C 4OR9B 2CT9A 2ZRTA 3CWGA 2L4IA 1PVBA 1C7VA 1VRKA 1MHOA 1WY9A 4I5JA 1M31A 3CR4X 2ZNDA 3H4SE 3EVUA 1HQVA 2I18A 4ZCVA 3SJSA 3BOWB 4FQOA 1RFJA 3I5IB 4L9MA 1W7IB 2PRUA 1QS7A 2MAZA 2JPTA 5HKWA 4AOMA 2LHLA 1XVJA 1YURA 5AERA 2LVVA 1WLMA 1B7TY 4CFQA 3I5IC 1NPQA 2MJWB 2NLNA 1CM4A 1N0YA 1ZOTB 5PALA 5KU1A 5DKQA 3CR5X 1NIWA 1DJGA 1S1EA 2HETA 2ZNEA 3LK1A 2MBXA 1UWOA 2KBMA 1XO5A 2CXJA 2KGRA 1X02A 1XFYO 3PATA 1JSAA 1NX0A 2FJUB 1WDCB 5ER4X 5HKZA 3TUYC 1DJYA 2BKIB 3HCMA 1DMOA 1R6PA 2KQ6A 2HQ8A 2JZIA 5AXIA 1A03A 5B8IB 1FBVA 1YVLA 1AJ5A 1QVIY 5BPJA 2LVKA 2JWWA 2WC8A 3A4UB 3F45A 4JPZB 1SKTA 3DVKA 3KEVA 4PHJA 5JOLA 2M1UA 1OMRA 2KFHA 1F55A 4PDZA 1H8BA 1LXFC 3PN7C 4YBHB 1N2DA 1JF0A 1CM1A 3D10A 2NXQA 2H2KA 2L5XB 1J1EA 3SG6A 1UHIA 5KSZA 5HLOA 1J7OA 1YUTA 1K94A 2O5GA 3LL8B 3EVVA 1AK8A 4C0JA 2FCEA 2BCXA 5AFPA 1BF5A 3TDIA 1DTLA 1Y1XA 1KCYA 1EL4A 1XYDA 1SW8A 2LP2A 1TIZA 3FIAA 2MRDA 1KFXL 1PALA 1QV1A 1UHNA 1UP5A 2H61A 2KBIA 2KFGA 2OTGB 4GBAA 4NDBA 3A8RA 2KAXA 1IG5A 5D69A 5KTYA 4CPVA 1Y1AA 3C1VA 1BU3A 5I2LA 2ZN8A 2LC5A 2LNKA 4TNCA 4HRHA 3PN7B 3SIBA 2FCDA 3GK1A 4M2PA 1OE9B 1LINA 4YRUA 2KYFA 1IQ5A 3TS5B 5JJGA 4MN0A 1LA0A 1JC2A 1DGVA 2KI4C 1IKUA 1KQVA 1DJHA 2CNPA 2Y1MA 1SL8A 1G33A 3OP0A 1F54A 1QX5B 4NQGA 4YGBB 2M0RA 1FI5A 3SG2A 1QATA 2LLTA 4BY4A 1PVAA 2WCFA 1K93D 1B47A 1CDPA 1DJIA 1ZMZA 2JT3A 2BL0C 4XJKA 1L2OC 2KI6C 2ZKMX 2O60A 4YGCB 2SCPA 1RWYA 4GGFC 2Y5IA 1OOJA 1QLSA 2L51A 4MEWA 3SG7A 3DF0B 2M8UA 4ORAB 2WOSA 2SASA 1A75A 2PASA 2JNXA 2MLEC 5CSNA 1TRFA 4HSZA 3PM8A 2M49B 1HT9A 2LVIA 3BUOB 2F3ZA 4USLA 3WHTB 1RJVA 1KSOA 2LP3A 1RECA 1SL7A 1WRZA 4QJ3B 3TDZA 3NSKA 3CZTX 3NSOA 1AHRA 3GK2A 2K0JA 4OKHA 1TCOB 2LUXA 1IH0A 1WRLA 1Q80A 3RM1A 3E3RA 4YGDB 4GNKB 5CSFA 2K8MB 4MZKA 4R1EA 4CLNA 2M7NA 1K8UA 1R2UA 1GGWA 4QJ5B 1BLQA 4OCIA 2MLFC 2OS8B 3BUMB 2JTZA 2I94A 3KO0A 1MQ1A 2CTNA 4GUKA 2KI6D 3TS5C 1Y6WA 1A4PA 1B9AA 1F4OA 5AEQA 4XYNA 5CSIA 1L7ZA 3IF7A 3WHUB 3PALA 1G8IA 1CMGA 1IRJA 2LUCA 1Y0VH 4PCWA 2BKHB 4BY5A 2JXLA 1K9KA 2JULA 1YRTB 2LM5A 2M29A 3EK7A 1UHKA 2OPOA 3PLFB 1QLKA 1CDNA 1TNWA 1PSRA 3LLEA 2E30A 4YI9A 4GGFA 2P6BB 3BUWB
chains in the Genus database with same CATH superfamily
4WQ3A 2JXCA 1DQEA 2ZRSA 3QRXA 3I5FB 2WCMA 1ALVA 2KI4B 2WCBA 1N65A 1M63B 3VRNA 4AQIA 1FPWA 2A4JA 2BAPA 1J7RA 3I5HB 4M2QA 2ISDA 4PE7A 1B4CA 1JUOA 1KWOC 1NYAA 2LLUA 3I5FC 3SS3A 3BUNB 1DJXA 2JT0A 1EJ3A 1MF8B 3I5HC 3GOFA 5DKNA 2KQYA 1BT6A 2PYQA 1CFPA 4WRIA 1J7PA 4DUQA 1QVIZ 1ALWA 5FYXA 4INWA 3D0YA 1XFWO 1U5IA 3AKAA 3JTDC 4DCKA 2DOQA 2EC6B 3VROA 3NSLA 1KK8C 2QACA 2KHNA 3I5GB 2LVJA 1LVCD 5I2OA 2GGMA 1SPYA 2ZN9A 3CZ2A 1ORGA 1PRWA 2KOTA 2WCLA 1LS8A 1XFXO 1A2XA 1DVIA 1IJ5A 2CCMA 3ZWHA 2B1UA 2BBNA 1QIVA 1QWVA 1C3ZA 1RTP1 4PE1A 2TN4A 1S6CA 4UPGA 3FWBA 5J3XA 2KFFA 1FF1A 1CFDA 2BE4A 1QIWA 1SR6C 1KFXS 1NP8A 3EG5B 3DF0A 3NXAA 3VRPA 2KGBC 4PALA 2JOJA 3O78A 1OSAA 1NSHA 1F4QA 1YX7A 3FE9A 1DELA 2EC6C 2HQWA 1BR4B 1IIOA 1KQMC 3KPXA 3O2PA 3BUXB 2CBLA 3D75A 1BG1A 1PULA 1QTXA 1ZACA 1SRAA 2P71A 1WDCC 1YUSA 2KLDA 3BOWA 5I2QA 2LLSA 1WLZA 4F7FA 1IGVA 1BR1B 1KQMB 1XFZO 3O6BA 4NDCA 5TNCA 1DJZA 1OZOA 4PHNA 4MRYA 1MR8A 4MRXA 2K2FA 1TN4A 1KK7Z 3LK0A 2KNEA 1E8AA 1J7QA 2WNDA 1A75B 5GQQC 1SR6B 2NCOA 3CR2A 4FTGA 1OMVA 5AANA 4F0ZB 2BCBA 4ZCUA 1GQMA 5HLVA 1NCZA 3CABA 5HL1A 3CTNA 1J55A 1L2OB 2K60A 3JTDB 1F71A 1RROA 5DKRA 3OB1B 1M45A 1MWNA 1KFUS 1T14A 1W7JB 2BECA 2LV7A 4N5XA 2H61C 5I8NA 2JT8A 2L50A 2PVBA 1OOIX 2KLEA 3R72A 5CPVA 1CTRA 2KPHA 2K2AA 2P70A 1CLLA 1JF2A 5K89A 1BOCA 1JFJA 2AUCA 1K96A 5D3OA 1U5IB 1JFKA 1SCMC 5F6TA 1DT7B 3FS7A 2E6WA 1TNPA 3BQ3A 2BL0B 1DC1A 3NSIA 3TZ1A 4N1GA 3VRRA 3NHTA 1ZFSA 1XK4A 3S0EA 4DS7A 2L2EA 1YR5A 1KFUL 3MSEB 2M3WA 3D74A 2Q91A 1B1GA 2QPTA 4IL1A 1B8CA 2K7BA 2F2PA 1S5GY 2K7DA 4OVNF 1CLBA 2GGZA 2WCEA 3DVMA 4JD9A 3ICBA 4ICBA 3IVTA 1OOHA 3DY9A 3DVJA 2NCPA 1EG4A 5HKYA 1V1FA 1CDLA 2LCPA 1CFCA 1B8RA 3EK4A 1TCFA 3CS1A 1C7WA 1DGUA 3BFAA 1SNLA 3DVEA 3EK8A 1QXPA 1SBJA 3O4YA 1V1GA 4QJ4B 4JQ0D 2VRGA 3B87A 1YX8A 4ETOA 1J1DA 3IQQA 2COLB 4MZJA 4YGAA 4ORBB 1NX1A 3Q8IA 4Q04A 2Q4UA 2MA2A 2M7LA 1NCYA 2H8VA 1KK7Y 1EH2A 3PSRA 3SG3A 1KSMA 3B86A 3RLZA 1BMOA 1YUUA 1BODA 4KYNA 2V53A 4M2OA 3PFVA 1Y1UA 1K9PA 3LCPC 1UHJA 4MZLA 1YRUB 1BJFA 1EG3A 2IS9A 5G08A 1QJTA 1ODBA 1K95A 1UURA 3ZNIA 3SS5A 3UNWA 1QX7A 3CYZA 2PSRA 1S26D 2EGDA 2ZFDA 4P2YB 1JBAA 2JQ6A 3BJHA 1CMFA 5D7FA 2JTTA 1K9UA 1IWQA 1NX2A 1S3PA 1ZUZA 1XA5A 3CLNA 3OB2B 3EVRA 4YI8A 1CLMA 1SY9A 3JVTB 1CDMA 3R1PA 4ORCB 1TOPA 4GGNA 1MXLC 2F33A 3DXLA 3TUYB 2NZ0A 5HYDA 1M39A 1S6JA 2M9GA 3AAKA 4HRGA 1Z4HA 1LA3A 3OHMB 3CGAA 3VGOA 3S0FA 1GM0A 4C0KA 3RZSA 1AP4A 2AAOA 3S0GA 4DRWA 3OBVA 4PE4A 3S0AA 4A4BA 1K2HA 3DD4A 4CIDA 4U8DA 4D1EA 1QASA 1C07A 1K90D 4PHMA 2LMTA 4DIRA 1YTZC 3EKJA 3L47A 3VRQA 1UHHA 3D0YB 3AAJA 1QX2A 1XK4C 4NDDA 1MXEA 1AJ4A 3OX6A 1A29A 1SCVA 3PM2A 1GGZA 2KAVA 2M97A 3KHEA 1JWDA 5IBWA 2LMVA 2JU0A 2M1KB 3BFBA 4E68A 2LAPA 5DICA 2Y1NA 1D1OA 2GV5A 2LE9B 2OTGC 1WRKA 1IQ3A 2EHBA 2BCAA 3DYEA 1S36A 1TUJA 4PE0A 1H4BA 1UUSA 3SIAA 3WNXB 1M46A 4CFRA 4I5LB 3CZ1A 1OMDA 1PK0D 1XFUO 2K61A 2KAYA 1CFFA 4XJKB 1SK6D 1B8LA 2BE6A 2K7OA 1DF0A 4JWQA 2ERBA 2K7CA 1F8HA 4MVFA 1DJWA 1TNXA 4HREE 1DF0B 1GJYA 2L5YA 4GPLB 1KWOB 2PMYA 2G9BA 2JRFA 2L0PA 2LANA 4GFTA 4MSPA 1CKKA 3M0WA 3OX5A 2F3YA 3SG5A 2JNFA 2G2BA 1AVSA 1FW4A 1TNQA 5FI7A 2F8PA 5FI6A 3WXAA 2PALA 4PHKA 3CDNA 4I5NB 1XFVO 1MUXA 3TDUA 1NX3A 2QDIA 2KYCA 1S6IA 2AMIA 2HPSA 3NGVA 1OZSA 3JVTC 4P5OE 5CSJA 2FOTA 2WORA 2L98A 2R2IA 1NWDA 2JC2A 4WQ2A 1NCXA 1PSBA 3KF9A 1SCMB 3SG4A 1G4YR 4IJ7A 1KK8B 3I5GC 1FI6A 2L4HA 1SYMA 3S0DA 4N1FA 2MHHA 2KSPA 2RGIA 1QV0A 3B6XA 4OV2A 1F70A 1RK9A 1DEKA 4I5KA 2LMUA 1CNPA 4C0LA 4A4CA 2FJYA 2D8NA 3CZ0A 3BXKA 2BBMA 3K1EA 2Y4QA 1SMGA 3IQOA 5EL2A 4MBEA 2YGUA 3B88A 3GK4X 3FWCA 2F2OA 2HF5A 3EKHA 4MLWA 4OZDA 1IJ6A 3HX4A 1CB1A 1W9ZA 2KDHA 3AKBA 4AQJA 4YGEB 1NUBA 1TTXA 3D77A 1EXRA 1OQPA 1SL9A 4GAOA 3BYAA 1B7TZ 1LKJA 2I2RE 1AUIB 3K21A 1YVHA 5ER5A 2LHIA 1S5GZ 2I7AA 2OS8C 3O4XA 4OR9B 3PJIA 2CT9A 2ZRTA 3CWGA 2L4IA 1PVBA 1C7VA 1VRKA 1MHOA 1WY9A 4I5JA 1M31A 3CR4X 2ZNDA 3H4SE 3EVUA 3OGNA 2PQLA 1HQVA 2I18A 4PT1A 4ZCVA 3SJSA 3BOWB 4FQOA 1RFJA 3I5IB 4L9MA 1W7IB 2PRUA 1QS7A 2MAZA 2JPTA 5HKWA 4AOMA 2LHLA 1XVJA 1YURA 5AERA 3L4AA 2LVVA 2WCKA 1WLMA 1B7TY 2QEBA 5FI2A 2WC6A 4CFQA 3I5IC 1NPQA 2MJWB 2NLNA 3D78A 1CM4A 1N0YA 1ZOTB 3DZTA 5PALA 3N7HA 5KU1A 3FE8A 3CR5X 1NIWA 1DJGA 1S1EA 2HETA 2ZNEA 3LK1A 5DKQA 4FQTA 2MBXA 1UWOA 1C3YA 2KBMA 1XO5A 2CXJA 2KGRA 1X02A 1XFYO 3PATA 1JSAA 1OOFA 1NX0A 2WCHA 2FJUB 1WDCB 3UO9A 5ER4X 5HKZA 3TUYC 1DJYA 2BKIB 3HCMA 1DMOA 1R6PA 2KQ6A 2HQ8A 2GTEA 2JZIA 5AXIA 1A03A 5B8IB 1FBVA 1YVLA 1AJ5A 1QVIY 5BPJA 2LVKA 2JWWA 2WC8A 3A4UB 3F45A 4JPZB 1SKTA 3DVKA 3KEVA 4PHJA 5JOLA 1TWOA 2M1UA 1OMRA 2KFHA 1F55A 3S0BA 4PDZA 2WCJA 4INXA 1LXFC 3PN7C 4YBHB 1H8BA 1N2DA 1JF0A 1CM1A 3D10A 2NXQA 2H2KA 2L5XB 1J1EA 3R1OA 3SG6A 1UHIA 5KSZA 5HLOA 1J7OA 1YUTA 1K94A 2O5GA 3LL8B 3EVVA 1AK8A 4C0JA 2FCEA 2BCXA 5AFPA 1BF5A 3TDIA 1DTLA 1Y1XA 2L2CA 1EL4A 1XYDA 1SW8A 2LP2A 1TIZA 1OOGA 3FIAA 2MRDA 1KCYA 1KFXL 1PALA 1QV1A 1UHNA 1UP5A 2H61A 2KBIA 2KFGA 2OTGB 4GBAA 4NDBA 3A8RA 2KAXA 1IG5A 1XFRA 5D69A 4CPVA 3D73A 1Y1AA 5KTYA 3C1VA 1BU3A 1SSEB 5I2LA 2ZN8A 2LC5A 3L4LA 2LNKA 4TNCA 4HRHA 3PN7B 3SIBA 2FCDA 2WC5A 3GK1A 4M2PA 1OE9B 1LINA 4YRUA 2KYFA 1IQ5A 3VB1A 3TS5B 5JJGA 4MN0A 1LA0A 2QEHA 1JC2A 1DGVA 2KI4C 1IKUA 1KQVA 1DJHA 2CNPA 2Y1MA 1SL8A 1G33A 3OP0A 1F54A 1QX5B 4NQGA 4YGBB 2M0RA 1FI5A 3SG2A 1QATA 2QEVA 2LLTA 4BY4A 1PVAA 2WCFA 1K93D 3SS4A 1B47A 1CDPA 1DJIA 1ZMZA 2JT3A 2BL0C 3NHIA 4XJKA 1L2OC 2KI6C 2ZKMX 2O60A 4YGCB 2SCPA 1P28A 1RWYA 4GGFC 2Y5IA 1OOJA 1QLSA 2L51A 4MEWA 3SG7A 3DF0B 2M8UA 4ORAB 2WOSA 2SASA 3QMEA 1A75A 2PASA 2JNXA 2MLEC 5CSNA 1TRFA 4HSZA 3PM8A 2M49B 1HT9A 2LVIA 2BNXA 2F3ZA 3BUOB 4USLA 3WHTB 1RJVA 1KSOA 2LP3A 1RECA 1SL7A 1WRZA 4QJ3B 3TDZA 3NSKA 3CZTX 3NSOA 3R1VA 5I94A 1AHRA 3GK2A 2K0JA 4OKHA 1TCOB 2LUXA 1IH0A 1WRLA 1Q80A 3RM1A 3E3RA 4YGDB 4GNKB 5CSFA 3B7AA 3D76A 2K8MB 4MZKA 4R1EA 4CLNA 2M7NA 1K8UA 1R2UA 1GGWA 4QJ5B 1BLQA 4OCIA 2MLFC 2OS8B 2JPOA 3BUMB 2JTZA 3FE6A 1OW4A 2I94A 1MQ1A 3KO0A 2CTNA 3V2LA 4GUKA 2KI6D 3TS5C 1Y6WA 1A4PA 1B9AA 1F4OA 5AEQA 4XYNA 5CSIA 1L7ZA 3IF7A 3WHUB 3BFHA 3PALA 1G8IA 1CMGA 1TUZA 1Z2CB 1IRJA 2LUCA 1Y0VH 4PCWA 2BKHB 4BY5A 2JXLA 1K9KA 2JULA 1YRTB 2LM5A 2M29A 3EK7A 1UHKA 2OPOA 3PLFB 1QLKA 4JKTA 1CDNA 1TNWA 1PSRA 3LLEA 2E30A 4YI9A 2QEOA 4GGFA 2P6BB 3BUWB
chains in the Genus database with same CATH topology
4WQ3A 2JXCA 2ZRSA 3QRXA 3I5FB 1ALVA 2KI4B 2WCBA 1N65A 1M63B 3VRNA 4AQIA 1FPWA 2A4JA 1J7RA 3I5HB 4M2QA 2ISDA 4PE7A 1B4CA 1JUOA 1KWOC 1NYAA 2LLUA 3I5FC 3BUNB 1DJXA 2JT0A 1EJ3A 1MF8B 3I5HC 3GOFA 5DKNA 2KQYA 1BT6A 1CFPA 4WRIA 1J7PA 4DUQA 1QVIZ 1ALWA 5FYXA 3D0YA 1XFWO 1U5IA 3AKAA 3JTDC 4DCKA 2DOQA 2EC6B 3VROA 3NSLA 1KK8C 2QACA 2KHNA 3I5GB 2LVJA 1LVCD 5I2OA 2GGMA 1SPYA 2ZN9A 1PRWA 2KOTA 1XFXO 1A2XA 1DVIA 1IJ5A 2CCMA 3ZWHA 2B1UA 2BBNA 1QIVA 1RTP1 4PE1A 2TN4A 1S6CA 4UPGA 3FWBA 5J3XA 2KFFA 1FF1A 1CFDA 2BE4A 1QIWA 1SR6C 1KFXS 1NP8A 3DF0A 3NXAA 3VRPA 2KGBC 4PALA 2JOJA 3O78A 1OSAA 1NSHA 1F4QA 1YX7A 2EC6C 2HQWA 1BR4B 1KQMC 3KPXA 3O2PA 3BUXB 2CBLA 1BG1A 1PULA 1QTXA 1ZACA 1SRAA 1WDCC 1YUSA 3BOWA 5I2QA 2LLSA 1WLZA 1IGVA 1BR1B 1KQMB 1XFZO 3O6BA 4NDCA 5TNCA 1DJZA 1OZOA 4PHNA 4MRYA 1MR8A 4MRXA 2K2FA 1TN4A 1KK7Z 3LK0A 2KNEA 1E8AA 1J7QA 2WNDA 1A75B 5GQQC 1SR6B 2NCOA 3CR2A 4FTGA 1OMVA 5AANA 4F0ZB 2BCBA 4ZCUA 1GQMA 5HLVA 1NCZA 3CTNA 1J55A 1L2OB 3JTDB 1F71A 1RROA 5DKRA 3OB1B 1M45A 1MWNA 1KFUS 1W7JB 2BECA 2LV7A 4N5XA 2H61C 5I8NA 2JT8A 2L50A 2PVBA 5CPVA 1CTRA 2K2AA 5K89A 1CLLA 1JF2A 1BOCA 1JFJA 2AUCA 1K96A 1U5IB 1JFKA 1SCMC 5F6TA 1DT7B 3FS7A 2E6WA 1TNPA 3BQ3A 2BL0B 3NSIA 3TZ1A 4N1GA 3VRRA 1ZFSA 1XK4A 4DS7A 2L2EA 1YR5A 1KFUL 3MSEB 2M3WA 2Q91A 1B1GA 2QPTA 4IL1A 1B8CA 2K7BA 2F2PA 1S5GY 2K7DA 4OVNF 1CLBA 2GGZA 2WCEA 3DVMA 3ICBA 4ICBA 3DVJA 2NCPA 1EG4A 5HKYA 1V1FA 1CDLA 2LCPA 1CFCA 1B8RA 3EK4A 1TCFA 3CS1A 1C7WA 1DGUA 3DVEA 1SNLA 3EK8A 3O4YA 1QXPA 1SBJA 1V1GA 4QJ4B 4JQ0D 2VRGA 1YX8A 4ETOA 1J1DA 3IQQA 2COLB 4MZJA 4YGAA 4ORBB 1NX1A 4Q04A 2Q4UA 2MA2A 2M7LA 1NCYA 1EH2A 1KK7Y 3PSRA 3SG3A 1KSMA 1BMOA 1YUUA 1BODA 2V53A 4M2OA 3PFVA 1Y1UA 1K9PA 3LCPC 1UHJA 4MZLA 1YRUB 1BJFA 1EG3A 2IS9A 5G08A 1QJTA 1ODBA 1K95A 1UURA 3ZNIA 1QX7A 2PSRA 1S26D 2EGDA 2ZFDA 4P2YB 1JBAA 2JQ6A 1CMFA 5D7FA 2JTTA 1K9UA 1IWQA 1NX2A 1S3PA 1ZUZA 1XA5A 3CLNA 3OB2B 3EVRA 4YI8A 1CLMA 1SY9A 3JVTB 1CDMA 4ORCB 1TOPA 4GGNA 1MXLC 2F33A 3TUYB 2NZ0A 5HYDA 1M39A 1S6JA 2M9GA 3AAKA 4HRGA 1LA3A 3OHMB 3CGAA 3VGOA 4C0KA 1AP4A 2AAOA 4DRWA 4PE4A 1K2HA 4A4BA 3DD4A 4CIDA 4U8DA 4D1EA 1QASA 1C07A 1K90D 4PHMA 2LMTA 4DIRA 1YTZC 3EKJA 3VRQA 1UHHA 3D0YB 3AAJA 1QX2A 1XK4C 4NDDA 1MXEA 1AJ4A 3OX6A 1A29A 1SCVA 1GGZA 2KAVA 2M97A 3KHEA 1JWDA 5IBWA 2LMVA 2JU0A 2M1KB 4E68A 2LAPA 2Y1NA 1D1OA 2GV5A 2LE9B 2OTGC 1WRKA 1IQ3A 2EHBA 2BCAA 4PE0A 1S36A 1H4BA 1UUSA 3SIAA 3WNXB 1M46A 4CFRA 4I5LB 1OMDA 1PK0D 1XFUO 2K61A 2KAYA 1CFFA 4XJKB 1SK6D 1B8LA 2BE6A 2K7OA 1DF0A 4JWQA 2K7CA 1F8HA 4MVFA 1DJWA 1TNXA 4HREE 1DF0B 1GJYA 4GPLB 1KWOB 2PMYA 2G9BA 2JRFA 2L0PA 2LANA 4GFTA 4MSPA 1CKKA 3M0WA 3OX5A 2F3YA 3SG5A 2JNFA 2G2BA 1AVSA 1FW4A 1TNQA 2F8PA 3WXAA 2PALA 4PHKA 4I5NB 1XFVO 1MUXA 3TDUA 1NX3A 2KYCA 1S6IA 2AMIA 2HPSA 4P5OE 1OZSA 3JVTC 5CSJA 3RLZA 2FOTA 2WORA 2L98A 2R2IA 1NWDA 2JC2A 4WQ2A 1NCXA 1PSBA 3KF9A 1SCMB 3SG4A 1G4YR 1FI6A 1KK8B 3I5GC 2L4HA 1SYMA 4N1FA 2MHHA 2KSPA 2RGIA 1QV0A 4OV2A 1F70A 1RK9A 4I5KA 2LMUA 1CNPA 4C0LA 4A4CA 2D8NA 3BXKA 2BBMA 2Y4QA 1SMGA 3IQOA 4MBEA 3GK4X 3FWCA 2F2OA 2HF5A 3EKHA 4MLWA 1IJ6A 3HX4A 1CB1A 2KDHA 3AKBA 4AQJA 4YGEB 1NUBA 1TTXA 1EXRA 1OQPA 1SL9A 4GAOA 3BYAA 1B7TZ 1LKJA 2I2RE 1AUIB 3K21A 1YVHA 5ER5A 2LHIA 1S5GZ 2I7AA 2OS8C 4OR9B 2CT9A 2ZRTA 3CWGA 2L4IA 1PVBA 1C7VA 1VRKA 1MHOA 1WY9A 4I5JA 1M31A 3CR4X 2ZNDA 3H4SE 3EVUA 1HQVA 2I18A 4ZCVA 3SJSA 3BOWB 4FQOA 1RFJA 3I5IB 4L9MA 1W7IB 2PRUA 1QS7A 2MAZA 2JPTA 5HKWA 4AOMA 2LHLA 1XVJA 1YURA 5AERA 2LVVA 1WLMA 1B7TY 4CFQA 3I5IC 1NPQA 2MJWB 2NLNA 1CM4A 1N0YA 1ZOTB 5PALA 5KU1A 5DKQA 3CR5X 1NIWA 1DJGA 1S1EA 2HETA 2ZNEA 3LK1A 2MBXA 1UWOA 2KBMA 1XO5A 2CXJA 2KGRA 1X02A 1XFYO 3PATA 1JSAA 1NX0A 2FJUB 1WDCB 5ER4X 5HKZA 3TUYC 1DJYA 2BKIB 3HCMA 1DMOA 1R6PA 2KQ6A 2HQ8A 2JZIA 5AXIA 1A03A 5B8IB 1FBVA 1YVLA 1AJ5A 1QVIY 5BPJA 2LVKA 2JWWA 2WC8A 3A4UB 3F45A 4JPZB 1SKTA 3DVKA 3KEVA 4PHJA 5JOLA 2M1UA 1OMRA 2KFHA 1F55A 4PDZA 1H8BA 1LXFC 3PN7C 4YBHB 1N2DA 1JF0A 1CM1A 3D10A 2NXQA 2H2KA 2L5XB 1J1EA 3SG6A 1UHIA 5KSZA 5HLOA 1J7OA 1YUTA 1K94A 2O5GA 3LL8B 3EVVA 1AK8A 4C0JA 2FCEA 2BCXA 5AFPA 1BF5A 3TDIA 1DTLA 1Y1XA 1KCYA 1EL4A 1XYDA 1SW8A 2LP2A 1TIZA 3FIAA 2MRDA 1KFXL 1PALA 1QV1A 1UHNA 1UP5A 2H61A 2KBIA 2KFGA 2OTGB 4GBAA 4NDBA 3A8RA 2KAXA 1IG5A 5D69A 5KTYA 4CPVA 1Y1AA 3C1VA 1BU3A 5I2LA 2ZN8A 2LC5A 2LNKA 4TNCA 4HRHA 3PN7B 3SIBA 2FCDA 3GK1A 4M2PA 1OE9B 1LINA 4YRUA 2KYFA 1IQ5A 3TS5B 5JJGA 4MN0A 1LA0A 1JC2A 1DGVA 2KI4C 1IKUA 1KQVA 1DJHA 2CNPA 2Y1MA 1SL8A 1G33A 3OP0A 1F54A 1QX5B 4NQGA 4YGBB 2M0RA 1FI5A 3SG2A 1QATA 2LLTA 4BY4A 1PVAA 2WCFA 1K93D 1B47A 1CDPA 1DJIA 1ZMZA 2JT3A 2BL0C 4XJKA 1L2OC 2KI6C 2ZKMX 2O60A 4YGCB 2SCPA 1RWYA 4GGFC 2Y5IA 1OOJA 1QLSA 2L51A 4MEWA 3SG7A 3DF0B 2M8UA 4ORAB 2WOSA 2SASA 1A75A 2PASA 2JNXA 2MLEC 5CSNA 1TRFA 4HSZA 3PM8A 2M49B 1HT9A 2LVIA 3BUOB 2F3ZA 4USLA 3WHTB 1RJVA 1KSOA 2LP3A 1RECA 1SL7A 1WRZA 4QJ3B 3TDZA 3NSKA 3CZTX 3NSOA 1AHRA 3GK2A 2K0JA 4OKHA 1TCOB 2LUXA 1IH0A 1WRLA 1Q80A 3RM1A 3E3RA 4YGDB 4GNKB 5CSFA 2K8MB 4MZKA 4R1EA 4CLNA 2M7NA 1K8UA 1R2UA 1GGWA 4QJ5B 1BLQA 4OCIA 2MLFC 2OS8B 3BUMB 2JTZA 2I94A 3KO0A 1MQ1A 2CTNA 4GUKA 2KI6D 3TS5C 1Y6WA 1A4PA 1B9AA 1F4OA 5AEQA 4XYNA 5CSIA 1L7ZA 3IF7A 3WHUB 3PALA 1G8IA 1CMGA 1IRJA 2LUCA 1Y0VH 4PCWA 2BKHB 4BY5A 2JXLA 1K9KA 2JULA 1YRTB 2LM5A 2M29A 3EK7A 1UHKA 2OPOA 3PLFB 1QLKA 1CDNA 1TNWA 1PSRA 3LLEA 2E30A 4YI9A 4GGFA 2P6BB 3BUWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ3 A;  2JXC A;  2ZRS A;  3QRX A;  3I5F B;  1ALV A;  2KI4 B;  2WCB A;  1N65 A;  1M63 B;  3VRN A;  4AQI A;  1FPW A;  2A4J A;  1J7R A;  3I5H B;  4M2Q A;  2ISD A;  4PE7 A;  1B4C A;  1JUO A;  1KWO C;  1NYA A;  2LLU A;  3I5F C;  3BUN B;  1DJX A;  2JT0 A;  1EJ3 A;  1MF8 B;  3I5H C;  3GOF A;  5DKN A;  2KQY A;  1BT6 A;  1CFP A;  4WRI A;  1J7P A;  4DUQ A;  1QVI Z;  1ALW A;  5FYX A;  3D0Y A;  1XFW O;  1U5I A;  3AKA A;  3JTD C;  4DCK A;  2DOQ A;  2EC6 B;  3VRO A;  3NSL A;  1KK8 C;  2QAC A;  2KHN A;  3I5G B;  2LVJ A;  1LVC D;  5I2O A;  2GGM A;  1SPY A;  2ZN9 A;  1PRW A;  2KOT A;  1XFX O;  1A2X A;  1DVI A;  1IJ5 A;  2CCM A;  3ZWH A;  2B1U A;  2BBN A;  1QIV A;  1RTP 1;  4PE1 A;  2TN4 A;  1S6C A;  4UPG A;  3FWB A;  5J3X A;  2KFF A;  1FF1 A;  1CFD A;  2BE4 A;  1QIW A;  1SR6 C;  1KFX S;  1NP8 A;  3DF0 A;  3NXA A;  3VRP A;  2KGB C;  4PAL A;  2JOJ A;  3O78 A;  1OSA A;  1NSH A;  1F4Q A;  1YX7 A;  2EC6 C;  2HQW A;  1BR4 B;  1KQM C;  3KPX A;  3O2P A;  3BUX B;  2CBL A;  1BG1 A;  1PUL A;  1QTX A;  1ZAC A;  1SRA A;  1WDC C;  1YUS A;  3BOW A;  5I2Q A;  2LLS A;  1WLZ A;  1IGV A;  1BR1 B;  1KQM B;  1XFZ O;  3O6B A;  4NDC A;  5TNC A;  1DJZ A;  1OZO A;  4PHN A;  4MRY A;  1MR8 A;  4MRX A;  2K2F A;  1TN4 A;  1KK7 Z;  3LK0 A;  2KNE A;  1E8A A;  1J7Q A;  2WND A;  1A75 B;  5GQQ C;  1SR6 B;  2NCO A;  3CR2 A;  4FTG A;  1OMV A;  5AAN A;  4F0Z B;  2BCB A;  4ZCU A;  1GQM A;  5HLV A;  1NCZ A;  3CTN A;  1J55 A;  1L2O B;  3JTD B;  1F71 A;  1RRO A;  5DKR A;  3OB1 B;  1M45 A;  1MWN A;  1KFU S;  1W7J B;  2BEC A;  2LV7 A;  4N5X A;  2H61 C;  5I8N A;  2JT8 A;  2L50 A;  2PVB A;  5CPV A;  1CTR A;  2K2A A;  5K89 A;  1CLL A;  1JF2 A;  1BOC A;  1JFJ A;  2AUC A;  1K96 A;  1U5I B;  1JFK A;  1SCM C;  5F6T A;  1DT7 B;  3FS7 A;  2E6W A;  1TNP A;  3BQ3 A;  2BL0 B;  3NSI A;  3TZ1 A;  4N1G A;  3VRR A;  1ZFS A;  1XK4 A;  4DS7 A;  2L2E A;  1YR5 A;  1KFU L;  3MSE B;  2M3W A;  2Q91 A;  1B1G A;  2QPT A;  4IL1 A;  1B8C A;  2K7B A;  2F2P A;  1S5G Y;  2K7D A;  4OVN F;  1CLB A;  2GGZ A;  2WCE A;  3DVM A;  3ICB A;  4ICB A;  3DVJ A;  2NCP A;  1EG4 A;  5HKY A;  1V1F A;  1CDL A;  2LCP A;  1CFC A;  1B8R A;  3EK4 A;  1TCF A;  3CS1 A;  1C7W A;  1DGU A;  3DVE A;  1SNL A;  3EK8 A;  3O4Y A;  1QXP A;  1SBJ A;  1V1G A;  4QJ4 B;  4JQ0 D;  2VRG A;  1YX8 A;  4ETO A;  1J1D A;  3IQQ A;  2COL B;  4MZJ A;  4YGA A;  4ORB B;  1NX1 A;  4Q04 A;  2Q4U A;  2MA2 A;  2M7L A;  1NCY A;  1EH2 A;  1KK7 Y;  3PSR A;  3SG3 A;  1KSM A;  1BMO A;  1YUU A;  1BOD A;  2V53 A;  4M2O A;  3PFV A;  1Y1U A;  1K9P A;  3LCP C;  1UHJ A;  4MZL A;  1YRU B;  1BJF A;  1EG3 A;  2IS9 A;  5G08 A;  1QJT A;  1ODB A;  1K95 A;  1UUR A;  3ZNI A;  1QX7 A;  2PSR A;  1S26 D;  2EGD A;  2ZFD A;  4P2Y B;  1JBA A;  2JQ6 A;  1CMF A;  5D7F A;  2JTT A;  1K9U A;  1IWQ A;  1NX2 A;  1S3P A;  1ZUZ A;  1XA5 A;  3CLN A;  3OB2 B;  3EVR A;  4YI8 A;  1CLM A;  1SY9 A;  3JVT B;  1CDM A;  4ORC B;  1TOP A;  4GGN A;  1MXL C;  2F33 A;  3TUY B;  2NZ0 A;  5HYD A;  1M39 A;  1S6J A;  2M9G A;  3AAK A;  4HRG A;  1LA3 A;  3OHM B;  3CGA A;  3VGO A;  4C0K A;  1AP4 A;  2AAO A;  4DRW A;  4PE4 A;  1K2H A;  4A4B A;  3DD4 A;  4CID A;  4U8D A;  4D1E A;  1QAS A;  1C07 A;  1K90 D;  4PHM A;  2LMT A;  4DIR A;  1YTZ C;  3EKJ A;  3VRQ A;  1UHH A;  3D0Y B;  3AAJ A;  1QX2 A;  1XK4 C;  4NDD A;  1MXE A;  1AJ4 A;  3OX6 A;  1A29 A;  1SCV A;  1GGZ A;  2KAV A;  2M97 A;  3KHE A;  1JWD A;  5IBW A;  2LMV A;  2JU0 A;  2M1K B;  4E68 A;  2LAP A;  2Y1N A;  1D1O A;  2GV5 A;  2LE9 B;  2OTG C;  1WRK A;  1IQ3 A;  2EHB A;  2BCA A;  4PE0 A;  1S36 A;  1H4B A;  1UUS A;  3SIA A;  3WNX B;  1M46 A;  4CFR A;  4I5L B;  1OMD A;  1PK0 D;  1XFU O;  2K61 A;  2KAY A;  1CFF A;  4XJK B;  1SK6 D;  1B8L A;  2BE6 A;  2K7O A;  1DF0 A;  4JWQ A;  2K7C A;  1F8H A;  4MVF A;  1DJW A;  1TNX A;  4HRE E;  1DF0 B;  1GJY A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  2JRF A;  2L0P A;  2LAN A;  4GFT A;  4MSP A;  1CKK A;  3M0W A;  3OX5 A;  2F3Y A;  3SG5 A;  2JNF A;  2G2B A;  1AVS A;  1FW4 A;  1TNQ A;  2F8P A;  3WXA A;  2PAL A;  4PHK A;  4I5N B;  1XFV O;  1MUX A;  3TDU A;  1NX3 A;  2KYC A;  1S6I A;  2AMI A;  2HPS A;  4P5O E;  1OZS A;  3JVT C;  5CSJ A;  3RLZ A;  2FOT A;  2WOR A;  2L98 A;  2R2I A;  1NWD A;  2JC2 A;  4WQ2 A;  1NCX A;  1PSB A;  3KF9 A;  1SCM B;  3SG4 A;  1G4Y R;  1FI6 A;  1KK8 B;  3I5G C;  2L4H A;  1SYM A;  4N1F A;  2MHH A;  2KSP A;  2RGI A;  1QV0 A;  4OV2 A;  1F70 A;  1RK9 A;  4I5K A;  2LMU A;  1CNP A;  4C0L A;  4A4C A;  2D8N A;  3BXK A;  2BBM A;  2Y4Q A;  1SMG A;  3IQO A;  4MBE A;  3GK4 X;  3FWC A;  2F2O A;  2HF5 A;  3EKH A;  4MLW A;  1IJ6 A;  3HX4 A;  1CB1 A;  2KDH A;  3AKB A;  4AQJ A;  4YGE B;  1NUB A;  1TTX A;  1EXR A;  1OQP A;  1SL9 A;  4GAO A;  3BYA A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3K21 A;  1YVH A;  5ER5 A;  2LHI A;  1S5G Z;  2I7A A;  2OS8 C;  4OR9 B;  2CT9 A;  2ZRT A;  3CWG A;  2L4I A;  1PVB A;  1C7V A;  1VRK A;  1MHO A;  1WY9 A;  4I5J A;  1M31 A;  3CR4 X;  2ZND A;  3H4S E;  3EVU A;  1HQV A;  2I18 A;  4ZCV A;  3SJS A;  3BOW B;  4FQO A;  1RFJ A;  3I5I B;  4L9M A;  1W7I B;  2PRU A;  1QS7 A;  2MAZ A;  2JPT A;  5HKW A;  4AOM A;  2LHL A;  1XVJ A;  1YUR A;  5AER A;  2LVV A;  1WLM A;  1B7T Y;  4CFQ A;  3I5I C;  1NPQ A;  2MJW B;  2NLN A;  1CM4 A;  1N0Y A;  1ZOT B;  5PAL A;  5KU1 A;  5DKQ A;  3CR5 X;  1NIW A;  1DJG A;  1S1E A;  2HET A;  2ZNE A;  3LK1 A;  2MBX A;  1UWO A;  2KBM A;  1XO5 A;  2CXJ A;  2KGR A;  1X02 A;  1XFY O;  3PAT A;  1JSA A;  1NX0 A;  2FJU B;  1WDC B;  5ER4 X;  5HKZ A;  3TUY C;  1DJY A;  2BKI B;  3HCM A;  1DMO A;  1R6P A;  2KQ6 A;  2HQ8 A;  2JZI A;  5AXI A;  1A03 A;  5B8I B;  1FBV A;  1YVL A;  1AJ5 A;  1QVI Y;  5BPJ A;  2LVK A;  2JWW A;  2WC8 A;  3A4U B;  3F45 A;  4JPZ B;  1SKT A;  3DVK A;  3KEV A;  4PHJ A;  5JOL A;  2M1U A;  1OMR A;  2KFH A;  1F55 A;  4PDZ A;  1H8B A;  1LXF C;  3PN7 C;  4YBH B;  1N2D A;  1JF0 A;  1CM1 A;  3D10 A;  2NXQ A;  2H2K A;  2L5X B;  1J1E A;  3SG6 A;  1UHI A;  5KSZ A;  5HLO A;  1J7O A;  1YUT A;  1K94 A;  2O5G A;  3LL8 B;  3EVV A;  1AK8 A;  4C0J A;  2FCE A;  2BCX A;  5AFP A;  1BF5 A;  3TDI A;  1DTL A;  1Y1X A;  1KCY A;  1EL4 A;  1XYD A;  1SW8 A;  2LP2 A;  1TIZ A;  3FIA A;  2MRD A;  1KFX L;  1PAL A;  1QV1 A;  1UHN A;  1UP5 A;  2H61 A;  2KBI A;  2KFG A;  2OTG B;  4GBA A;  4NDB A;  3A8R A;  2KAX A;  1IG5 A;  5D69 A;  5KTY A;  4CPV A;  1Y1A A;  3C1V A;  1BU3 A;  5I2L A;  2ZN8 A;  2LC5 A;  2LNK A;  4TNC A;  4HRH A;  3PN7 B;  3SIB A;  2FCD A;  3GK1 A;  4M2P A;  1OE9 B;  1LIN A;  4YRU A;  2KYF A;  1IQ5 A;  3TS5 B;  5JJG A;  4MN0 A;  1LA0 A;  1JC2 A;  1DGV A;  2KI4 C;  1IKU A;  1KQV A;  1DJH A;  2CNP A;  2Y1M A;  1SL8 A;  1G33 A;  3OP0 A;  1F54 A;  1QX5 B;  4NQG A;  4YGB B;  2M0R A;  1FI5 A;  3SG2 A;  1QAT A;  2LLT A;  4BY4 A;  1PVA A;  2WCF A;  1K93 D;  1B47 A;  1CDP A;  1DJI A;  1ZMZ A;  2JT3 A;  2BL0 C;  4XJK A;  1L2O C;  2KI6 C;  2ZKM X;  2O60 A;  4YGC B;  2SCP A;  1RWY A;  4GGF C;  2Y5I A;  1OOJ A;  1QLS A;  2L51 A;  4MEW A;  3SG7 A;  3DF0 B;  2M8U A;  4ORA B;  2WOS A;  2SAS A;  1A75 A;  2PAS A;  2JNX A;  2MLE C;  5CSN A;  1TRF A;  4HSZ A;  3PM8 A;  2M49 B;  1HT9 A;  2LVI A;  3BUO B;  2F3Z A;  4USL A;  3WHT B;  1RJV A;  1KSO A;  2LP3 A;  1REC A;  1SL7 A;  1WRZ A;  4QJ3 B;  3TDZ A;  3NSK A;  3CZT X;  3NSO A;  1AHR A;  3GK2 A;  2K0J A;  4OKH A;  1TCO B;  2LUX A;  1IH0 A;  1WRL A;  1Q80 A;  3RM1 A;  3E3R A;  4YGD B;  4GNK B;  5CSF A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  2M7N A;  1K8U A;  1R2U A;  1GGW A;  4QJ5 B;  1BLQ A;  4OCI A;  2MLF C;  2OS8 B;  3BUM B;  2JTZ A;  2I94 A;  3KO0 A;  1MQ1 A;  2CTN A;  4GUK A;  2KI6 D;  3TS5 C;  1Y6W A;  1A4P A;  1B9A A;  1F4O A;  5AEQ A;  4XYN A;  5CSI A;  1L7Z A;  3IF7 A;  3WHU B;  3PAL A;  1G8I A;  1CMG A;  1IRJ A;  2LUC A;  1Y0V H;  4PCW A;  2BKH B;  4BY5 A;  2JXL A;  1K9K A;  2JUL A;  1YRT B;  2LM5 A;  2M29 A;  3EK7 A;  1UHK A;  2OPO A;  3PLF B;  1QLK A;  1CDN A;  1TNW A;  1PSR A;  3LLE A;  2E30 A;  4YI9 A;  4GGF A;  2P6B B;  3BUW B; 
#chains in the Genus database with same CATH topology
 4WQ3 A;  2JXC A;  1DQE A;  2ZRS A;  3QRX A;  3I5F B;  2WCM A;  1ALV A;  2KI4 B;  2WCB A;  1N65 A;  1M63 B;  3VRN A;  4AQI A;  1FPW A;  2A4J A;  2BAP A;  1J7R A;  3I5H B;  4M2Q A;  2ISD A;  4PE7 A;  1B4C A;  1JUO A;  1KWO C;  1NYA A;  2LLU A;  3I5F C;  3SS3 A;  3BUN B;  1DJX A;  2JT0 A;  1EJ3 A;  1MF8 B;  3I5H C;  3GOF A;  5DKN A;  2KQY A;  1BT6 A;  2PYQ A;  1CFP A;  4WRI A;  1J7P A;  4DUQ A;  1QVI Z;  1ALW A;  5FYX A;  4INW A;  3D0Y A;  1XFW O;  1U5I A;  3AKA A;  3JTD C;  4DCK A;  2DOQ A;  2EC6 B;  3VRO A;  3NSL A;  1KK8 C;  2QAC A;  2KHN A;  3I5G B;  2LVJ A;  1LVC D;  5I2O A;  2GGM A;  1SPY A;  2ZN9 A;  3CZ2 A;  1ORG A;  1PRW A;  2KOT A;  2WCL A;  1LS8 A;  1XFX O;  1A2X A;  1DVI A;  1IJ5 A;  2CCM A;  3ZWH A;  2B1U A;  2BBN A;  1QIV A;  1QWV A;  1C3Z A;  1RTP 1;  4PE1 A;  2TN4 A;  1S6C A;  4UPG A;  3FWB A;  5J3X A;  2KFF A;  1FF1 A;  1CFD A;  2BE4 A;  1QIW A;  1SR6 C;  1KFX S;  1NP8 A;  3EG5 B;  3DF0 A;  3NXA A;  3VRP A;  2KGB C;  4PAL A;  2JOJ A;  3O78 A;  1OSA A;  1NSH A;  1F4Q A;  1YX7 A;  3FE9 A;  1DEL A;  2EC6 C;  2HQW A;  1BR4 B;  1IIO A;  1KQM C;  3KPX A;  3O2P A;  3BUX B;  2CBL A;  3D75 A;  1BG1 A;  1PUL A;  1QTX A;  1ZAC A;  1SRA A;  2P71 A;  1WDC C;  1YUS A;  2KLD A;  3BOW A;  5I2Q A;  2LLS A;  1WLZ A;  4F7F A;  1IGV A;  1BR1 B;  1KQM B;  1XFZ O;  3O6B A;  4NDC A;  5TNC A;  1DJZ A;  1OZO A;  4PHN A;  4MRY A;  1MR8 A;  4MRX A;  2K2F A;  1TN4 A;  1KK7 Z;  3LK0 A;  2KNE A;  1E8A A;  1J7Q A;  2WND A;  1A75 B;  5GQQ C;  1SR6 B;  2NCO A;  3CR2 A;  4FTG A;  1OMV A;  5AAN A;  4F0Z B;  2BCB A;  4ZCU A;  1GQM A;  5HLV A;  1NCZ A;  3CAB A;  5HL1 A;  3CTN A;  1J55 A;  1L2O B;  2K60 A;  3JTD B;  1F71 A;  1RRO A;  5DKR A;  3OB1 B;  1M45 A;  1MWN A;  1KFU S;  1T14 A;  1W7J B;  2BEC A;  2LV7 A;  4N5X A;  2H61 C;  5I8N A;  2JT8 A;  2L50 A;  2PVB A;  1OOI X;  2KLE A;  3R72 A;  5CPV A;  1CTR A;  2KPH A;  2K2A A;  2P70 A;  1CLL A;  1JF2 A;  5K89 A;  1BOC A;  1JFJ A;  2AUC A;  1K96 A;  5D3O A;  1U5I B;  1JFK A;  1SCM C;  5F6T A;  1DT7 B;  3FS7 A;  2E6W A;  1TNP A;  3BQ3 A;  2BL0 B;  1DC1 A;  3NSI A;  3TZ1 A;  4N1G A;  3VRR A;  3NHT A;  1ZFS A;  1XK4 A;  3S0E A;  4DS7 A;  2L2E A;  1YR5 A;  1KFU L;  3MSE B;  2M3W A;  3D74 A;  2Q91 A;  1B1G A;  2QPT A;  4IL1 A;  1B8C A;  2K7B A;  2F2P A;  1S5G Y;  2K7D A;  4OVN F;  1CLB A;  2GGZ A;  2WCE A;  3DVM A;  4JD9 A;  3ICB A;  4ICB A;  3IVT A;  1OOH A;  3DY9 A;  3DVJ A;  2NCP A;  1EG4 A;  5HKY A;  1V1F A;  1CDL A;  2LCP A;  1CFC A;  1B8R A;  3EK4 A;  1TCF A;  3CS1 A;  1C7W A;  1DGU A;  3BFA A;  1SNL A;  3DVE A;  3EK8 A;  1QXP A;  1SBJ A;  3O4Y A;  1V1G A;  4QJ4 B;  4JQ0 D;  2VRG A;  3B87 A;  1YX8 A;  4ETO A;  1J1D A;  3IQQ A;  2COL B;  4MZJ A;  4YGA A;  4ORB B;  1NX1 A;  3Q8I A;  4Q04 A;  2Q4U A;  2MA2 A;  2M7L A;  1NCY A;  2H8V A;  1KK7 Y;  1EH2 A;  3PSR A;  3SG3 A;  1KSM A;  3B86 A;  3RLZ A;  1BMO A;  1YUU A;  1BOD A;  4KYN A;  2V53 A;  4M2O A;  3PFV A;  1Y1U A;  1K9P A;  3LCP C;  1UHJ A;  4MZL A;  1YRU B;  1BJF A;  1EG3 A;  2IS9 A;  5G08 A;  1QJT A;  1ODB A;  1K95 A;  1UUR A;  3ZNI A;  3SS5 A;  3UNW A;  1QX7 A;  3CYZ A;  2PSR A;  1S26 D;  2EGD A;  2ZFD A;  4P2Y B;  1JBA A;  2JQ6 A;  3BJH A;  1CMF A;  5D7F A;  2JTT A;  1K9U A;  1IWQ A;  1NX2 A;  1S3P A;  1ZUZ A;  1XA5 A;  3CLN A;  3OB2 B;  3EVR A;  4YI8 A;  1CLM A;  1SY9 A;  3JVT B;  1CDM A;  3R1P A;  4ORC B;  1TOP A;  4GGN A;  1MXL C;  2F33 A;  3DXL A;  3TUY B;  2NZ0 A;  5HYD A;  1M39 A;  1S6J A;  2M9G A;  3AAK A;  4HRG A;  1Z4H A;  1LA3 A;  3OHM B;  3CGA A;  3VGO A;  3S0F A;  1GM0 A;  4C0K A;  3RZS A;  1AP4 A;  2AAO A;  3S0G A;  4DRW A;  3OBV A;  4PE4 A;  3S0A A;  4A4B A;  1K2H A;  3DD4 A;  4CID A;  4U8D A;  4D1E A;  1QAS A;  1C07 A;  1K90 D;  4PHM A;  2LMT A;  4DIR A;  1YTZ C;  3EKJ A;  3L47 A;  3VRQ A;  1UHH A;  3D0Y B;  3AAJ A;  1QX2 A;  1XK4 C;  4NDD A;  1MXE A;  1AJ4 A;  3OX6 A;  1A29 A;  1SCV A;  3PM2 A;  1GGZ A;  2KAV A;  2M97 A;  3KHE A;  1JWD A;  5IBW A;  2LMV A;  2JU0 A;  2M1K B;  3BFB A;  4E68 A;  2LAP A;  5DIC A;  2Y1N A;  1D1O A;  2GV5 A;  2LE9 B;  2OTG C;  1WRK A;  1IQ3 A;  2EHB A;  2BCA A;  3DYE A;  1S36 A;  1TUJ A;  4PE0 A;  1H4B A;  1UUS A;  3SIA A;  3WNX B;  1M46 A;  4CFR A;  4I5L B;  3CZ1 A;  1OMD A;  1PK0 D;  1XFU O;  2K61 A;  2KAY A;  1CFF A;  4XJK B;  1SK6 D;  1B8L A;  2BE6 A;  2K7O A;  1DF0 A;  4JWQ A;  2ERB A;  2K7C A;  1F8H A;  4MVF A;  1DJW A;  1TNX A;  4HRE E;  1DF0 B;  1GJY A;  2L5Y A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  2JRF A;  2L0P A;  2LAN A;  4GFT A;  4MSP A;  1CKK A;  3M0W A;  3OX5 A;  2F3Y A;  3SG5 A;  2JNF A;  2G2B A;  1AVS A;  1FW4 A;  1TNQ A;  5FI7 A;  2F8P A;  5FI6 A;  3WXA A;  2PAL A;  4PHK A;  3CDN A;  4I5N B;  1XFV O;  1MUX A;  3TDU A;  1NX3 A;  2QDI A;  2KYC A;  1S6I A;  2AMI A;  2HPS A;  3NGV A;  1OZS A;  3JVT C;  4P5O E;  5CSJ A;  2FOT A;  2WOR A;  2L98 A;  2R2I A;  1NWD A;  2JC2 A;  4WQ2 A;  1NCX A;  1PSB A;  3KF9 A;  1SCM B;  3SG4 A;  1G4Y R;  4IJ7 A;  1KK8 B;  3I5G C;  1FI6 A;  2L4H A;  1SYM A;  3S0D A;  4N1F A;  2MHH A;  2KSP A;  2RGI A;  1QV0 A;  3B6X A;  4OV2 A;  1F70 A;  1RK9 A;  1DEK A;  4I5K A;  2LMU A;  1CNP A;  4C0L A;  4A4C A;  2FJY A;  2D8N A;  3CZ0 A;  3BXK A;  2BBM A;  3K1E A;  2Y4Q A;  1SMG A;  3IQO A;  5EL2 A;  4MBE A;  2YGU A;  3B88 A;  3GK4 X;  3FWC A;  2F2O A;  2HF5 A;  3EKH A;  4MLW A;  4OZD A;  1IJ6 A;  3HX4 A;  1CB1 A;  1W9Z A;  2KDH A;  3AKB A;  4AQJ A;  4YGE B;  1NUB A;  1TTX A;  3D77 A;  1EXR A;  1OQP A;  1SL9 A;  4GAO A;  3BYA A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3K21 A;  1YVH A;  5ER5 A;  2LHI A;  1S5G Z;  2I7A A;  2OS8 C;  3O4X A;  4OR9 B;  3PJI A;  2CT9 A;  2ZRT A;  3CWG A;  2L4I A;  1PVB A;  1C7V A;  1VRK A;  1MHO A;  1WY9 A;  4I5J A;  1M31 A;  3CR4 X;  2ZND A;  3H4S E;  3EVU A;  3OGN A;  2PQL A;  1HQV A;  2I18 A;  4PT1 A;  4ZCV A;  3SJS A;  3BOW B;  4FQO A;  1RFJ A;  3I5I B;  4L9M A;  1W7I B;  2PRU A;  1QS7 A;  2MAZ A;  2JPT A;  5HKW A;  4AOM A;  2LHL A;  1XVJ A;  1YUR A;  5AER A;  3L4A A;  2LVV A;  2WCK A;  1WLM A;  1B7T Y;  2QEB A;  5FI2 A;  2WC6 A;  4CFQ A;  3I5I C;  1NPQ A;  2MJW B;  2NLN A;  3D78 A;  1CM4 A;  1N0Y A;  1ZOT B;  3DZT A;  5PAL A;  3N7H A;  5KU1 A;  3FE8 A;  3CR5 X;  1NIW A;  1DJG A;  1S1E A;  2HET A;  2ZNE A;  3LK1 A;  5DKQ A;  4FQT A;  2MBX A;  1UWO A;  1C3Y A;  2KBM A;  1XO5 A;  2CXJ A;  2KGR A;  1X02 A;  1XFY O;  3PAT A;  1JSA A;  1OOF A;  1NX0 A;  2WCH A;  2FJU B;  1WDC B;  3UO9 A;  5ER4 X;  5HKZ A;  3TUY C;  1DJY A;  2BKI B;  3HCM A;  1DMO A;  1R6P A;  2KQ6 A;  2HQ8 A;  2GTE A;  2JZI A;  5AXI A;  1A03 A;  5B8I B;  1FBV A;  1YVL A;  1AJ5 A;  1QVI Y;  5BPJ A;  2LVK A;  2JWW A;  2WC8 A;  3A4U B;  3F45 A;  4JPZ B;  1SKT A;  3DVK A;  3KEV A;  4PHJ A;  5JOL A;  1TWO A;  2M1U A;  1OMR A;  2KFH A;  1F55 A;  3S0B A;  4PDZ A;  2WCJ A;  4INX A;  1LXF C;  3PN7 C;  4YBH B;  1H8B A;  1N2D A;  1JF0 A;  1CM1 A;  3D10 A;  2NXQ A;  2H2K A;  2L5X B;  1J1E A;  3R1O A;  3SG6 A;  1UHI A;  5KSZ A;  5HLO A;  1J7O A;  1YUT A;  1K94 A;  2O5G A;  3LL8 B;  3EVV A;  1AK8 A;  4C0J A;  2FCE A;  2BCX A;  5AFP A;  1BF5 A;  3TDI A;  1DTL A;  1Y1X A;  2L2C A;  1EL4 A;  1XYD A;  1SW8 A;  2LP2 A;  1TIZ A;  1OOG A;  3FIA A;  2MRD A;  1KCY A;  1KFX L;  1PAL A;  1QV1 A;  1UHN A;  1UP5 A;  2H61 A;  2KBI A;  2KFG A;  2OTG B;  4GBA A;  4NDB A;  3A8R A;  2KAX A;  1IG5 A;  1XFR A;  5D69 A;  4CPV A;  3D73 A;  1Y1A A;  5KTY A;  3C1V A;  1BU3 A;  1SSE B;  5I2L A;  2ZN8 A;  2LC5 A;  3L4L A;  2LNK A;  4TNC A;  4HRH A;  3PN7 B;  3SIB A;  2FCD A;  2WC5 A;  3GK1 A;  4M2P A;  1OE9 B;  1LIN A;  4YRU A;  2KYF A;  1IQ5 A;  3VB1 A;  3TS5 B;  5JJG A;  4MN0 A;  1LA0 A;  2QEH A;  1JC2 A;  1DGV A;  2KI4 C;  1IKU A;  1KQV A;  1DJH A;  2CNP A;  2Y1M A;  1SL8 A;  1G33 A;  3OP0 A;  1F54 A;  1QX5 B;  4NQG A;  4YGB B;  2M0R A;  1FI5 A;  3SG2 A;  1QAT A;  2QEV A;  2LLT A;  4BY4 A;  1PVA A;  2WCF A;  1K93 D;  3SS4 A;  1B47 A;  1CDP A;  1DJI A;  1ZMZ A;  2JT3 A;  2BL0 C;  3NHI A;  4XJK A;  1L2O C;  2KI6 C;  2ZKM X;  2O60 A;  4YGC B;  2SCP A;  1P28 A;  1RWY A;  4GGF C;  2Y5I A;  1OOJ A;  1QLS A;  2L51 A;  4MEW A;  3SG7 A;  3DF0 B;  2M8U A;  4ORA B;  2WOS A;  2SAS A;  3QME A;  1A75 A;  2PAS A;  2JNX A;  2MLE C;  5CSN A;  1TRF A;  4HSZ A;  3PM8 A;  2M49 B;  1HT9 A;  2LVI A;  2BNX A;  2F3Z A;  3BUO B;  4USL A;  3WHT B;  1RJV A;  1KSO A;  2LP3 A;  1REC A;  1SL7 A;  1WRZ A;  4QJ3 B;  3TDZ A;  3NSK A;  3CZT X;  3NSO A;  3R1V A;  5I94 A;  1AHR A;  3GK2 A;  2K0J A;  4OKH A;  1TCO B;  2LUX A;  1IH0 A;  1WRL A;  1Q80 A;  3RM1 A;  3E3R A;  4YGD B;  4GNK B;  5CSF A;  3B7A A;  3D76 A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  2M7N A;  1K8U A;  1R2U A;  1GGW A;  4QJ5 B;  1BLQ A;  4OCI A;  2MLF C;  2OS8 B;  2JPO A;  3BUM B;  2JTZ A;  3FE6 A;  1OW4 A;  2I94 A;  1MQ1 A;  3KO0 A;  2CTN A;  3V2L A;  4GUK A;  2KI6 D;  3TS5 C;  1Y6W A;  1A4P A;  1B9A A;  1F4O A;  5AEQ A;  4XYN A;  5CSI A;  1L7Z A;  3IF7 A;  3WHU B;  3BFH A;  3PAL A;  1G8I A;  1CMG A;  1TUZ A;  1Z2C B;  1IRJ A;  2LUC A;  1Y0V H;  4PCW A;  2BKH B;  4BY5 A;  2JXL A;  1K9K A;  2JUL A;  1YRT B;  2LM5 A;  2M29 A;  3EK7 A;  1UHK A;  2OPO A;  3PLF B;  1QLK A;  4JKT A;  1CDN A;  1TNW A;  1PSR A;  3LLE A;  2E30 A;  4YI9 A;  2QEO A;  4GGF A;  2P6B B;  3BUW B; 
#chains in the Genus database with same CATH homology
 4WQ3 A;  2JXC A;  2ZRS A;  3QRX A;  3I5F B;  1ALV A;  2KI4 B;  2WCB A;  1N65 A;  1M63 B;  3VRN A;  4AQI A;  1FPW A;  2A4J A;  1J7R A;  3I5H B;  4M2Q A;  2ISD A;  4PE7 A;  1B4C A;  1JUO A;  1KWO C;  1NYA A;  2LLU A;  3I5F C;  3BUN B;  1DJX A;  2JT0 A;  1EJ3 A;  1MF8 B;  3I5H C;  3GOF A;  5DKN A;  2KQY A;  1BT6 A;  1CFP A;  4WRI A;  1J7P A;  4DUQ A;  1QVI Z;  1ALW A;  5FYX A;  3D0Y A;  1XFW O;  1U5I A;  3AKA A;  3JTD C;  4DCK A;  2DOQ A;  2EC6 B;  3VRO A;  3NSL A;  1KK8 C;  2QAC A;  2KHN A;  3I5G B;  2LVJ A;  1LVC D;  5I2O A;  2GGM A;  1SPY A;  2ZN9 A;  1PRW A;  2KOT A;  1XFX O;  1A2X A;  1DVI A;  1IJ5 A;  2CCM A;  3ZWH A;  2B1U A;  2BBN A;  1QIV A;  1RTP 1;  4PE1 A;  2TN4 A;  1S6C A;  4UPG A;  3FWB A;  5J3X A;  2KFF A;  1FF1 A;  1CFD A;  2BE4 A;  1QIW A;  1SR6 C;  1KFX S;  1NP8 A;  3DF0 A;  3NXA A;  3VRP A;  2KGB C;  4PAL A;  2JOJ A;  3O78 A;  1OSA A;  1NSH A;  1F4Q A;  1YX7 A;  2EC6 C;  2HQW A;  1BR4 B;  1KQM C;  3KPX A;  3O2P A;  3BUX B;  2CBL A;  1BG1 A;  1PUL A;  1QTX A;  1ZAC A;  1SRA A;  1WDC C;  1YUS A;  3BOW A;  5I2Q A;  2LLS A;  1WLZ A;  1IGV A;  1BR1 B;  1KQM B;  1XFZ O;  3O6B A;  4NDC A;  5TNC A;  1DJZ A;  1OZO A;  4PHN A;  4MRY A;  1MR8 A;  4MRX A;  2K2F A;  1TN4 A;  1KK7 Z;  3LK0 A;  2KNE A;  1E8A A;  1J7Q A;  2WND A;  1A75 B;  5GQQ C;  1SR6 B;  2NCO A;  3CR2 A;  4FTG A;  1OMV A;  5AAN A;  4F0Z B;  2BCB A;  4ZCU A;  1GQM A;  5HLV A;  1NCZ A;  3CTN A;  1J55 A;  1L2O B;  3JTD B;  1F71 A;  1RRO A;  5DKR A;  3OB1 B;  1M45 A;  1MWN A;  1KFU S;  1W7J B;  2BEC A;  2LV7 A;  4N5X A;  2H61 C;  5I8N A;  2JT8 A;  2L50 A;  2PVB A;  5CPV A;  1CTR A;  2K2A A;  5K89 A;  1CLL A;  1JF2 A;  1BOC A;  1JFJ A;  2AUC A;  1K96 A;  1U5I B;  1JFK A;  1SCM C;  5F6T A;  1DT7 B;  3FS7 A;  2E6W A;  1TNP A;  3BQ3 A;  2BL0 B;  3NSI A;  3TZ1 A;  4N1G A;  3VRR A;  1ZFS A;  1XK4 A;  4DS7 A;  2L2E A;  1YR5 A;  1KFU L;  3MSE B;  2M3W A;  2Q91 A;  1B1G A;  2QPT A;  4IL1 A;  1B8C A;  2K7B A;  2F2P A;  1S5G Y;  2K7D A;  4OVN F;  1CLB A;  2GGZ A;  2WCE A;  3DVM A;  3ICB A;  4ICB A;  3DVJ A;  2NCP A;  1EG4 A;  5HKY A;  1V1F A;  1CDL A;  2LCP A;  1CFC A;  1B8R A;  3EK4 A;  1TCF A;  3CS1 A;  1C7W A;  1DGU A;  3DVE A;  1SNL A;  3EK8 A;  3O4Y A;  1QXP A;  1SBJ A;  1V1G A;  4QJ4 B;  4JQ0 D;  2VRG A;  1YX8 A;  4ETO A;  1J1D A;  3IQQ A;  2COL B;  4MZJ A;  4YGA A;  4ORB B;  1NX1 A;  4Q04 A;  2Q4U A;  2MA2 A;  2M7L A;  1NCY A;  1EH2 A;  1KK7 Y;  3PSR A;  3SG3 A;  1KSM A;  1BMO A;  1YUU A;  1BOD A;  2V53 A;  4M2O A;  3PFV A;  1Y1U A;  1K9P A;  3LCP C;  1UHJ A;  4MZL A;  1YRU B;  1BJF A;  1EG3 A;  2IS9 A;  5G08 A;  1QJT A;  1ODB A;  1K95 A;  1UUR A;  3ZNI A;  1QX7 A;  2PSR A;  1S26 D;  2EGD A;  2ZFD A;  4P2Y B;  1JBA A;  2JQ6 A;  1CMF A;  5D7F A;  2JTT A;  1K9U A;  1IWQ A;  1NX2 A;  1S3P A;  1ZUZ A;  1XA5 A;  3CLN A;  3OB2 B;  3EVR A;  4YI8 A;  1CLM A;  1SY9 A;  3JVT B;  1CDM A;  4ORC B;  1TOP A;  4GGN A;  1MXL C;  2F33 A;  3TUY B;  2NZ0 A;  5HYD A;  1M39 A;  1S6J A;  2M9G A;  3AAK A;  4HRG A;  1LA3 A;  3OHM B;  3CGA A;  3VGO A;  4C0K A;  1AP4 A;  2AAO A;  4DRW A;  4PE4 A;  1K2H A;  4A4B A;  3DD4 A;  4CID A;  4U8D A;  4D1E A;  1QAS A;  1C07 A;  1K90 D;  4PHM A;  2LMT A;  4DIR A;  1YTZ C;  3EKJ A;  3VRQ A;  1UHH A;  3D0Y B;  3AAJ A;  1QX2 A;  1XK4 C;  4NDD A;  1MXE A;  1AJ4 A;  3OX6 A;  1A29 A;  1SCV A;  1GGZ A;  2KAV A;  2M97 A;  3KHE A;  1JWD A;  5IBW A;  2LMV A;  2JU0 A;  2M1K B;  4E68 A;  2LAP A;  2Y1N A;  1D1O A;  2GV5 A;  2LE9 B;  2OTG C;  1WRK A;  1IQ3 A;  2EHB A;  2BCA A;  4PE0 A;  1S36 A;  1H4B A;  1UUS A;  3SIA A;  3WNX B;  1M46 A;  4CFR A;  4I5L B;  1OMD A;  1PK0 D;  1XFU O;  2K61 A;  2KAY A;  1CFF A;  4XJK B;  1SK6 D;  1B8L A;  2BE6 A;  2K7O A;  1DF0 A;  4JWQ A;  2K7C A;  1F8H A;  4MVF A;  1DJW A;  1TNX A;  4HRE E;  1DF0 B;  1GJY A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  2JRF A;  2L0P A;  2LAN A;  4GFT A;  4MSP A;  1CKK A;  3M0W A;  3OX5 A;  2F3Y A;  3SG5 A;  2JNF A;  2G2B A;  1AVS A;  1FW4 A;  1TNQ A;  2F8P A;  3WXA A;  2PAL A;  4PHK A;  4I5N B;  1XFV O;  1MUX A;  3TDU A;  1NX3 A;  2KYC A;  1S6I A;  2AMI A;  2HPS A;  4P5O E;  1OZS A;  3JVT C;  5CSJ A;  3RLZ A;  2FOT A;  2WOR A;  2L98 A;  2R2I A;  1NWD A;  2JC2 A;  4WQ2 A;  1NCX A;  1PSB A;  3KF9 A;  1SCM B;  3SG4 A;  1G4Y R;  1FI6 A;  1KK8 B;  3I5G C;  2L4H A;  1SYM A;  4N1F A;  2MHH A;  2KSP A;  2RGI A;  1QV0 A;  4OV2 A;  1F70 A;  1RK9 A;  4I5K A;  2LMU A;  1CNP A;  4C0L A;  4A4C A;  2D8N A;  3BXK A;  2BBM A;  2Y4Q A;  1SMG A;  3IQO A;  4MBE A;  3GK4 X;  3FWC A;  2F2O A;  2HF5 A;  3EKH A;  4MLW A;  1IJ6 A;  3HX4 A;  1CB1 A;  2KDH A;  3AKB A;  4AQJ A;  4YGE B;  1NUB A;  1TTX A;  1EXR A;  1OQP A;  1SL9 A;  4GAO A;  3BYA A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3K21 A;  1YVH A;  5ER5 A;  2LHI A;  1S5G Z;  2I7A A;  2OS8 C;  4OR9 B;  2CT9 A;  2ZRT A;  3CWG A;  2L4I A;  1PVB A;  1C7V A;  1VRK A;  1MHO A;  1WY9 A;  4I5J A;  1M31 A;  3CR4 X;  2ZND A;  3H4S E;  3EVU A;  1HQV A;  2I18 A;  4ZCV A;  3SJS A;  3BOW B;  4FQO A;  1RFJ A;  3I5I B;  4L9M A;  1W7I B;  2PRU A;  1QS7 A;  2MAZ A;  2JPT A;  5HKW A;  4AOM A;  2LHL A;  1XVJ A;  1YUR A;  5AER A;  2LVV A;  1WLM A;  1B7T Y;  4CFQ A;  3I5I C;  1NPQ A;  2MJW B;  2NLN A;  1CM4 A;  1N0Y A;  1ZOT B;  5PAL A;  5KU1 A;  5DKQ A;  3CR5 X;  1NIW A;  1DJG A;  1S1E A;  2HET A;  2ZNE A;  3LK1 A;  2MBX A;  1UWO A;  2KBM A;  1XO5 A;  2CXJ A;  2KGR A;  1X02 A;  1XFY O;  3PAT A;  1JSA A;  1NX0 A;  2FJU B;  1WDC B;  5ER4 X;  5HKZ A;  3TUY C;  1DJY A;  2BKI B;  3HCM A;  1DMO A;  1R6P A;  2KQ6 A;  2HQ8 A;  2JZI A;  5AXI A;  1A03 A;  5B8I B;  1FBV A;  1YVL A;  1AJ5 A;  1QVI Y;  5BPJ A;  2LVK A;  2JWW A;  2WC8 A;  3A4U B;  3F45 A;  4JPZ B;  1SKT A;  3DVK A;  3KEV A;  4PHJ A;  5JOL A;  2M1U A;  1OMR A;  2KFH A;  1F55 A;  4PDZ A;  1H8B A;  1LXF C;  3PN7 C;  4YBH B;  1N2D A;  1JF0 A;  1CM1 A;  3D10 A;  2NXQ A;  2H2K A;  2L5X B;  1J1E A;  3SG6 A;  1UHI A;  5KSZ A;  5HLO A;  1J7O A;  1YUT A;  1K94 A;  2O5G A;  3LL8 B;  3EVV A;  1AK8 A;  4C0J A;  2FCE A;  2BCX A;  5AFP A;  1BF5 A;  3TDI A;  1DTL A;  1Y1X A;  1KCY A;  1EL4 A;  1XYD A;  1SW8 A;  2LP2 A;  1TIZ A;  3FIA A;  2MRD A;  1KFX L;  1PAL A;  1QV1 A;  1UHN A;  1UP5 A;  2H61 A;  2KBI A;  2KFG A;  2OTG B;  4GBA A;  4NDB A;  3A8R A;  2KAX A;  1IG5 A;  5D69 A;  5KTY A;  4CPV A;  1Y1A A;  3C1V A;  1BU3 A;  5I2L A;  2ZN8 A;  2LC5 A;  2LNK A;  4TNC A;  4HRH A;  3PN7 B;  3SIB A;  2FCD A;  3GK1 A;  4M2P A;  1OE9 B;  1LIN A;  4YRU A;  2KYF A;  1IQ5 A;  3TS5 B;  5JJG A;  4MN0 A;  1LA0 A;  1JC2 A;  1DGV A;  2KI4 C;  1IKU A;  1KQV A;  1DJH A;  2CNP A;  2Y1M A;  1SL8 A;  1G33 A;  3OP0 A;  1F54 A;  1QX5 B;  4NQG A;  4YGB B;  2M0R A;  1FI5 A;  3SG2 A;  1QAT A;  2LLT A;  4BY4 A;  1PVA A;  2WCF A;  1K93 D;  1B47 A;  1CDP A;  1DJI A;  1ZMZ A;  2JT3 A;  2BL0 C;  4XJK A;  1L2O C;  2KI6 C;  2ZKM X;  2O60 A;  4YGC B;  2SCP A;  1RWY A;  4GGF C;  2Y5I A;  1OOJ A;  1QLS A;  2L51 A;  4MEW A;  3SG7 A;  3DF0 B;  2M8U A;  4ORA B;  2WOS A;  2SAS A;  1A75 A;  2PAS A;  2JNX A;  2MLE C;  5CSN A;  1TRF A;  4HSZ A;  3PM8 A;  2M49 B;  1HT9 A;  2LVI A;  3BUO B;  2F3Z A;  4USL A;  3WHT B;  1RJV A;  1KSO A;  2LP3 A;  1REC A;  1SL7 A;  1WRZ A;  4QJ3 B;  3TDZ A;  3NSK A;  3CZT X;  3NSO A;  1AHR A;  3GK2 A;  2K0J A;  4OKH A;  1TCO B;  2LUX A;  1IH0 A;  1WRL A;  1Q80 A;  3RM1 A;  3E3R A;  4YGD B;  4GNK B;  5CSF A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  2M7N A;  1K8U A;  1R2U A;  1GGW A;  4QJ5 B;  1BLQ A;  4OCI A;  2MLF C;  2OS8 B;  3BUM B;  2JTZ A;  2I94 A;  3KO0 A;  1MQ1 A;  2CTN A;  4GUK A;  2KI6 D;  3TS5 C;  1Y6W A;  1A4P A;  1B9A A;  1F4O A;  5AEQ A;  4XYN A;  5CSI A;  1L7Z A;  3IF7 A;  3WHU B;  3PAL A;  1G8I A;  1CMG A;  1IRJ A;  2LUC A;  1Y0V H;  4PCW A;  2BKH B;  4BY5 A;  2JXL A;  1K9K A;  2JUL A;  1YRT B;  2LM5 A;  2M29 A;  3EK7 A;  1UHK A;  2OPO A;  3PLF B;  1QLK A;  1CDN A;  1TNW A;  1PSR A;  3LLE A;  2E30 A;  4YI9 A;  4GGF A;  2P6B B;  3BUW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...