1S6CA

Crystal structure of the complex between kchip1 and kv4.2 n1-30
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
165
Chain Sequence
LEQLEAQTNFTKRELQVLYRGFKNEPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGPRQHVDVFFQKMDKNKDGIVTLDEFLESQEDDNIMRSLQLFQNVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kv4 potassium channel-interacting protein KChIP1b
publication title Structural insights into the functional interaction of KChIP1 with Shal-type K(+) channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 63
structure length 165
sequence length 178
ec nomenclature
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6cA00
1QX5B 2LP2A 3AAKA 1QJTA 4MSPA 2LVJA 1KCYA 1AP4A 1DGVA 1K9UA 1S6CA 1UURA 4MEWA 2CNPA 5CSFA 2K61A 3SIBA 1QTXA 3FIAA 1QIWA 3CR2A 1OMRA 2KAYA 3LK0A 1OMDA 1IRJA 1QASA 4WQ2A 1NX0A 1YX7A 1SL7A 2ZNDA 1DJZA 3DVKA 3RLZA 2JTTA 2SASA 1UHIA 1MUXA 3GK1A 2LMVA 2WCFA 2F2PA 5KTYA 3ZWHA 1MQ1A 2ZRTA 2M8UA 4GNKB 2KFGA 3SJSA 1SW8A 2M0RA 3LLEA 1XK4C 2PRUA 2I2RE 2NCPA 1J7RA 2NLNA 4PE1A 4ZCUA 1KQMB 3IQOA 4I5NB 3EKHA 3PM8A 1OMVA 1Q80A 3JVTB 3VROA 1L7ZA 2FCEA 3DD4A 3OHMB 4GFTA 1TNPA 2HQ8A 1CDNA 1XK4A 4FTGA 1G33A 2GV5A 4NDDA 2PMYA 4N1FA 4E68A 1SRAA 2KGBC 5TNCA 1K2HA 1GJYA 4YGEB 3JVTC 2WORA 4HSZA 1MXEA 3FS7A 5I8NA 3I5GB 1KFXS 2KGRA 2WCBA 3KEVA 4PE4A 4P2YB 1S6IA 1H8BA 1EL4A 1HQVA 3SG4A 2M3WA 2NZ0A 5HYDA 2F8PA 1KK8C 1AVSA 5HKYA 1L2OC 1NSHA 3GK4X 1JSAA 4BY5A 3PSRA 1FI5A 1S3PA 2LV7A 3OX5A 1A4PA 2L2EA 1W7JB 2KI6C 1DMOA 3C1VA 4DCKA 1YUUA 1F54A 1Y1UA 4MRXA 4HRGA 4WRIA 3TUYC 2WOSA 5HKZA 4CFRA 1WLZA 1KFUS 5IBWA 1JC2A 3LK1A 3QRXA 1D1OA 2M1KB 1CM1A 1GQMA 1N0YA 2BBMA 2M29A 4F0ZB 1MWNA 2K7OA 4I5KA 5CPVA 4PCWA 1TN4A 1A75A 3D0YB 3NXAA 1V1FA 5I2LA 4XYNA 3KF9A 2KAVA 2KAXA 3O2PA 1R2UA 1AHRA 1UHNA 4UPGA 3I5FC 1B9AA 1NPQA 2RGIA 1SR6C 3TDUA 1LKJA 1M31A 3OP0A 1YX8A 2LMUA 1QVIZ 2Y5IA 1TCOB 3GK2A 4QJ4B 1C7WA 2LHLA 3PLFB 4I5LB 1QV0A 2D8NA 2MRDA 2JQ6A 4A4CA 4C0LA 1BF5A 1M63B 2JZIA 4ZCVA 2KFHA 3BXKA 2K2AA 1BR4B 3HX4A 2LUXA 2ZNEA 5AERA 1QLKA 4ORBB 2MLFC 3IQQA 4MBEA 1CLLA 4DRWA 2KQYA 3EVUA 1CB1A 1MF8B 3SG5A 1PVBA 2BE4A 3D10A 1KFUL 2KYCA 2GGZA 2BBNA 2CT9A 2KBMA 3OB1B 3CGAA 1LA0A 2LC5A 1CFPA 1K94A 2JRFA 1JF0A 4IL1A 1RFJA 3CR4X 4YBHB 4XJKA 3NSLA 1NP8A 1X02A 2M1UA 3CLNA 1HT9A 2ISDA 1TNWA 4YGCB 1SKTA 3WXAA 1CFDA 1PK0D 2OTGB 2Y4QA 1XYDA 4OR9B 4ORCB 3VRNA 4MRYA 1TIZA 2OS8C 3M0WA 2BCXA 4AOMA 1J1EA 1RK9A 4YRUA 2KBIA 2OTGC 3PALA 4D1EA 5KU1A 2G9BA 5JOLA 2L4IA 5JJGA 5G08A 1FPWA 2KYFA 2BCBA 1WRZA 5AEQA 2O5GA 2AMIA 4DUQA 3TDIA 5BPJA 3K21A 2JC2A 4QJ3B 1DF0A 3EK8A 4MZKA 2LLSA 1BT6A 3I5HC 2EGDA 2F3ZA 2LE9B 3O6BA 4ICBA 4P5OE 2KI4B 5CSIA 1SL9A 1C7VA 1SBJA 1PULA 2FCDA 4CLNA 1TOPA 4I5JA 3PATA 1K96A 2FOTA 2HF5A 1F4QA 4M2QA 1CTRA 1PSBA 2JT8A 2KI4C 1SMGA 1YUSA 1AK8A 3A8RA 5I2QA 2MLEC 3OX6A 1QIVA 1YTZC 1PALA 3VRQA 2MJWB 2KDHA 2LVKA 4YGAA 1ZMZA 2VRGA 5F6TA 2P6BB 2A4JA 1NCYA 2JXLA 1OZOA 4MZJA 4GPLB 2H61C 1CDPA 2K7CA 1YVHA 2LLUA 2I94A 2JULA 2LVVA 1KSMA 1PVAA 4OKHA 3FWBA 1B7TZ 2ZFDA 5AXIA 3LCPC 5CSJA 1KK8B 2WNDA 1L2OB 4DS7A 3EK7A 1PRWA 2QACA 1OOJA 1YRTB 1MR8A 2H61A 1SCVA 2WCEA 5B8IB 2LUCA 1EH2A 1AUIB 1U5IA 4OVNF 4AQIA 3BUOB 1DJHA 1Y0VH 1A75B 2G2BA 4N1GA 3TUYB 1QXPA 1B8CA 1J7QA 1EG3A 1A03A 1KK7Z 2M7NA 1XFUO 4USLA 2BECA 3BQ3A 3VRPA 5KSZA 3TDZA 1KK7Y 1KWOB 1WDCC 4MN0A 2K8MB 4A4BA 2I7AA 1ZUZA 4PE7A 2K0JA 5J3XA 1LVCD 1RJVA 2I18A 2ZN9A 1S36A 2PASA 3I5FB 1ALVA 1KQVA 2R2IA 4C0JA 1KWOC 1K9KA 1SR6B 2JNXA 1ALWA 1Y1AA 3BUMB 1B4CA 1RWYA 4M2OA 1IKUA 1FI6A 2OPOA 5D7FA 4TNCA 1B1GA 1BOCA 2QPTA 2HPSA 3BUXB 3EVVA 3GOFA 1AJ4A 2MBXA 2E6WA 1V1GA 1B8LA 3DVJA 1FF1A 1RECA 5DKNA 4ORAB 1JWDA 1XFYO 1G4YR 2JWWA 2CBLA 2L0PA 2L4HA 1RTP1 1QVIY 1QX7A 2DOQA 4PHNA 4MZLA 3JTDB 1DJXA 4L9MA 1JUOA 3PFVA 4NDBA 3WHUB 1CKKA 3NSKA 2JTZA 3KPXA 1JFKA 4YGDB 1H4BA 1DJGA 1IGVA 4XJKB 3IF7A 3DVEA 3JTDC 3KHEA 2LNKA 1DTLA 2H2KA 2JU0A 4PHJA 2SCPA 4ETOA 1IWQA 1SNLA 1FW4A 3LL8B 3BUNB 2Q4UA 2KFFA 4DIRA 1UP5A 2CXJA 1E8AA 3VRRA 1DJYA 1WLMA 2NXQA 5AANA 2KHNA 4YI8A 4C0KA 4AQJA 1BR1B 2HQWA 3BOWA 1NWDA 1WRKA 1YUTA 3CZTX 2LCPA 3AAJA 1A29A 1NX3A 3AKBA 1UUSA 1OZSA 2OS8B 3I5IC 1CM4A 1K9PA 4JPZB 2BE6A 3AKAA 1YURA 4M2PA 1CNPA 2JT3A 1LA3A 5FYXA 1DF0B 2LLTA 4HREE 3MSEB 3SG6A 3EKJA 1XFXO 4BY4A 2KNEA 2KSPA 3O4YA 1N2DA 2MA2A 1CLBA 3TZ1A 1S1EA 1M45A 1G8IA 3DF0B 1A2XA 1XFZO 2PVBA 1CFFA 3WHTB 3SG7A 1SPYA 3BUWB 3I5HB 1AJ5A 1NCXA 3TS5C 5K89A 1DGUA 1LXFC 2F2OA 3BYAA 1QATA 2KOTA 1BJFA 4JWQA 3SG3A 1PSRA 1S5GZ 1TNQA 1IQ3A 1WY9A 3SIAA 3DF0A 2L50A 2LP3A 2IS9A 1S5GY 1M46A 2LVIA 2MHHA 1UWOA 1K8UA 1NYAA 1IG5A 2F33A 2JPTA 3VGOA 3EK4A 2FJUB 3DVMA 1J55A 1FBVA 2M97A 2KI6D 1W7IB 1SYMA 1U5IB 1MXLC 1XVJA 1IH0A 2LM5A 1J7OA 1TRFA 4NDCA 2K2FA 2ZRSA 2E30A 1XFWO 1B8RA 3HCMA 1B7TY 5DKRA 5DKQA 3EVRA 4PHMA 2CCMA 4CPVA 5D69A 1XFVO 3A4UB 1IQ5A 1KQMC 2F3YA 1BMOA 1CDLA 3NSOA 5PALA 3PN7B 1K95A 1ODBA 1WDCB 1ZACA 1BU3A 1OSAA 1EJ3A 3CTNA 2MAZA 1SK6D 2HETA 3PN7C 1K90D 2Y1MA 1OQPA 1S26D 3F45A 1EG4A 4NQGA 4QJ5B 2BL0B 2K7DA 4WQ3A 5ER5A 3I5GC 5I2OA 2BCAA 1XA5A 2Q91A 1C07A 1MHOA 5HLOA 3E3RA 2LHIA 4FQOA 3SG2A 2TN4A 2BL0C 4GGNA 2GGMA 4R1EA 4N5XA 4OV2A 3O78A 1TTXA 1ZFSA 1LINA 2AUCA 1SL8A 2M7LA 1CFCA 1SY9A 1CMGA 1TNXA 3H4SE 1QX2A 5CSNA 1YVLA 2JXCA 4GAOA 4JQ0D 2BKHB 1NX1A 1NCZA 4GBAA 1NIWA 3BOWB 1Y1XA 4MLWA 4YI9A 3FWCA 3NSIA 2LANA 2O60A 1UHJA 1EXRA 1DJIA 2Y1NA 2L51A 1QV1A 1IJ5A 4Q04A 1CDMA 2CTNA 2ZKMX 3CR5X 2JOJA 1BLQA 4PHKA 3ICBA 1KFXL 2BKIB 2JNFA 1K93D 2EC6B 2PSRA 3I5IB 2AAOA 1VRKA 1JFJA 1YR5A 4YGBB 2V53A 1JBAA 2EHBA 2L5XB 1J7PA 2M9GA 3D0YA 1DVIA 2ZN8A 1DT7B 1JF2A 1N65A 4GGFC 2EC6C 1Y6WA 3ZNIA 1ZOTB 1BODA 5ER4X 2M49B 4PALA 3RM1A 1IJ6A 1F4OA 2K7BA 4PDZA 1M39A 1RROA 3OB2B 1F8HA 2COLB 4CFQA 1KSOA 5HKWA 1SCMB 1GGZA 4GGFA 3TS5B 1GGWA 1YRUB 2KQ6A 2LMTA 3KO0A 1R6PA 3CWGA 4HRHA 4GUKA 1NX2A 1WRLA 1CLMA 1F70A 1OE9B 4PE0A 5HLVA 1SCMC 2JT0A 1UHKA 1DJWA 2B1UA 1J1DA 1BG1A 4U8DA 1F55A 1NUBA 1XO5A 4OCIA 1B47A 5AFPA 2LAPA 2L98A 3WNXB 1QS7A 2WC8A 1S6JA 1UHHA 5GQQC 1TCFA 2NCOA 1QLSA 1CMFA 2PALA 4MVFA 1F71A 3CS1A 4CIDA
chains in the Genus database with same CATH superfamily
1QX5B 2LP2A 3AAKA 1QJTA 4MSPA 2LVJA 1KCYA 1AP4A 1DGVA 1K9UA 1S6CA 1UURA 4MEWA 2CNPA 5CSFA 2K61A 3CABA 3SIBA 1QTXA 3FIAA 1QIWA 3CR2A 1OMRA 2KAYA 1LS8A 1Z4HA 3LK0A 1OMDA 1IRJA 1QASA 4WQ2A 1NX0A 1YX7A 1SL7A 2ZNDA 1DJZA 3DVKA 3RLZA 1TUZA 2JTTA 2SASA 1UHIA 1MUXA 3GK1A 1DELA 2KLDA 2LMVA 2WCFA 2F2PA 5KTYA 3ZWHA 1MQ1A 5FI6A 2ZRTA 2M8UA 2WCMA 4GNKB 2KFGA 3SJSA 1SW8A 2M0RA 3LLEA 1XK4C 2PRUA 2I2RE 2NCPA 1J7RA 2NLNA 4PE1A 4ZCUA 1KQMB 3IQOA 4I5NB 3EKHA 3PM8A 1OMVA 2FJYA 3D77A 3NHIA 2QEHA 1Q80A 3JVTB 3O4XA 3VROA 1L7ZA 2FCEA 3DD4A 3OHMB 4GFTA 1TNPA 1C3YA 2HQ8A 1CDNA 1XK4A 4FTGA 1G33A 2GV5A 3CDNA 4NDDA 2PMYA 4N1FA 4E68A 1SRAA 2KGBC 5TNCA 1K2HA 1GJYA 4YGEB 3JVTC 2WORA 4HSZA 1MXEA 3FS7A 5I8NA 3I5GB 1KFXS 2KGRA 2WCBA 3KEVA 4PE4A 4P2YB 1S6IA 3L4LA 1H8BA 1EL4A 1HQVA 3SG4A 1XFRA 3VB1A 2M3WA 2NZ0A 3PM2A 5HYDA 2F8PA 1KK8C 1AVSA 5HKYA 1L2OC 1NSHA 3GK4X 1JSAA 4BY5A 3S0AA 3PSRA 1FI5A 1S3PA 2LV7A 3NGVA 1OW4A 3OX5A 1A4PA 2L2EA 1W7JB 2KI6C 1DMOA 3PJIA 3C1VA 4DCKA 1YUUA 1F54A 3S0FA 1Y1UA 1OOFA 4MRXA 4HRGA 4WRIA 2L2CA 3TUYC 2H8VA 2WOSA 5HKZA 1WLZA 1KFUS 4CFRA 5IBWA 1DC1A 3LK1A 3QRXA 1D1OA 2M1KB 1JC2A 1CM1A 1GQMA 1N0YA 3FE8A 2BBMA 2M29A 3B88A 3RZSA 1ORGA 4F0ZB 1MWNA 2K7OA 3D75A 4I5KA 5CPVA 4PCWA 1TN4A 1A75A 3D0YB 3NXAA 1V1FA 4PT1A 5I2LA 4XYNA 3KF9A 2KAVA 2KAXA 3O2PA 1R2UA 1AHRA 1UHNA 4UPGA 3I5FC 1B9AA 1NPQA 2RGIA 1SR6C 3TDUA 1LKJA 1M31A 3B86A 3OP0A 1YX8A 2LMUA 1QVIZ 2Y5IA 1TCOB 1OOHA 3GK2A 3UO9A 4QJ4B 1C7WA 2LHLA 3PLFB 4I5LB 1QV0A 2D8NA 2MRDA 2JQ6A 4A4CA 4C0LA 1BF5A 3N7HA 5FI7A 1M63B 2JZIA 4ZCVA 2KFHA 3BXKA 2K2AA 1BR4B 3HX4A 2LUXA 2ZNEA 5AERA 1QLKA 4ORBB 2MLFC 3IQQA 4MBEA 1CLLA 4DRWA 2KQYA 1QWVA 3EVUA 1CB1A 1MF8B 3SG5A 1PVBA 2BE4A 3D10A 1KFUL 2KYCA 2GGZA 2BBNA 2CT9A 2KBMA 3OB1B 5FI2A 3CGAA 1LA0A 1TUJA 2LC5A 1CFPA 1K94A 2JRFA 3B87A 1JF0A 4IL1A 1RFJA 3CR4X 4YBHB 1GM0A 4XJKA 3NSLA 1NP8A 1X02A 2ERBA 2M1UA 3CLNA 1HT9A 2ISDA 1TNWA 4YGCB 1SKTA 3WXAA 3SS4A 1CFDA 1PK0D 2OTGB 2Y4QA 1XYDA 4OR9B 4ORCB 3VRNA 3CYZA 4MRYA 1TIZA 2OS8C 3M0WA 2BCXA 4AOMA 1J1EA 1RK9A 4YRUA 2JPOA 2KBIA 2OTGC 3PALA 4D1EA 5KU1A 3R72A 2G9BA 5JOLA 2L4IA 5JJGA 5G08A 1FPWA 2KYFA 2BCBA 1WRZA 5AEQA 2O5GA 2AMIA 4DUQA 3TDIA 5BPJA 1W9ZA 3K21A 2JC2A 4QJ3B 5D3OA 1DF0A 3EK8A 4MZKA 2LLSA 1BT6A 3I5HC 2EGDA 2F3ZA 2LE9B 3O6BA 4ICBA 4P5OE 2KI4B 5CSIA 1SL9A 5HL1A 1C7VA 1SBJA 1PULA 2FCDA 4CLNA 3SS5A 1TOPA 4I5JA 3PATA 1K96A 3OGNA 2FOTA 2HF5A 1F4QA 4M2QA 1CTRA 1PSBA 2JT8A 2KI4C 1SMGA 1YUSA 1AK8A 1T14A 3A8RA 5I2QA 2MLEC 3OX6A 1QIVA 3R1VA 1YTZC 1PALA 3VRQA 2MJWB 2KDHA 2LVKA 4YGAA 1ZMZA 2VRGA 5F6TA 3D74A 2P6BB 2A4JA 1NCYA 2JXLA 1OZOA 4MZJA 4GPLB 3D73A 2H61C 1CDPA 2K7CA 1YVHA 2BAPA 2I94A 2JULA 2LLUA 1KSMA 1PVAA 2LVVA 4OKHA 3FWBA 1B7TZ 2ZFDA 5AXIA 3LCPC 5CSJA 1KK8B 2WNDA 1L2OB 4DS7A 3EK7A 1PRWA 2QACA 1OOJA 3B7AA 1YRTB 1MR8A 2H61A 1SCVA 2WCEA 5B8IB 5I94A 2LUCA 1EH2A 1AUIB 1U5IA 4OVNF 4AQIA 3BUOB 3V2LA 1DJHA 1Y0VH 1A75B 2G2BA 4N1GA 3TUYB 1QXPA 1B8CA 1J7QA 1EG3A 1A03A 1KK7Z 2M7NA 1XFUO 3FE9A 2BECA 3BQ3A 4USLA 3VRPA 5KSZA 3TDZA 1KK7Y 1KWOB 4BY4A 1WDCC 4MN0A 2K8MB 4A4BA 2I7AA 1ZUZA 4PE7A 2K0JA 5J3XA 2L5YA 1LVCD 1RJVA 2I18A 2ZN9A 2GTEA 1S36A 2PASA 3I5FB 1ALVA 1KQVA 2R2IA 4C0JA 1KWOC 1K9KA 1SR6B 2JNXA 4FQTA 1ALWA 1Y1AA 3BUMB 1B4CA 1RWYA 4M2OA 1IKUA 1FI6A 2OPOA 5D7FA 4TNCA 1B1GA 1BOCA 2QPTA 2HPSA 3BUXB 3EVVA 3GOFA 1AJ4A 1C3ZA 2E6WA 2MBXA 1V1GA 1B8LA 3DVJA 1FF1A 1RECA 1Z2CB 4ORAB 5DKNA 1XFYO 1JWDA 1G4YR 2JWWA 2CBLA 2L0PA 2L4HA 3D76A 1RTP1 1QVIY 1QX7A 2DOQA 4PHNA 4MZLA 3JTDB 1DJXA 4L9MA 1JUOA 3PFVA 3B6XA 4NDBA 3WHUB 1CKKA 3NSKA 2JTZA 3KPXA 1JFKA 4YGDB 1H4BA 1DJGA 1IGVA 4XJKB 3IF7A 3DVEA 3JTDC 3KHEA 2LNKA 1DTLA 2H2KA 2JU0A 4PHJA 2SCPA 4ETOA 1IWQA 1SNLA 1FW4A 3LL8B 3BUNB 2PYQA 3R1PA 2Q4UA 2KFFA 4DIRA 1UP5A 2CXJA 5DICA 1E8AA 2K60A 3VRRA 1DJYA 1WLMA 2NXQA 5AANA 2KHNA 4YI8A 4C0KA 4AQJA 1BR1B 2HQWA 3BOWA 3L4AA 1NWDA 1WRKA 1YUTA 3CZTX 2LCPA 3AAJA 1A29A 1NX3A 3AKBA 1UUSA 1OZSA 2OS8B 3I5IC 1CM4A 1K9PA 4JPZB 1TWOA 2BE6A 3AKAA 1YURA 3R1OA 4M2PA 1CNPA 2JT3A 1LA3A 5FYXA 1DF0B 2LLTA 4HREE 3DYEA 3K1EA 3EKJA 1XFXO 3MSEB 3SG6A 2KNEA 2KSPA 3CZ0A 3O4YA 1N2DA 3DY9A 2MA2A 1CLBA 3TZ1A 1S1EA 1M45A 1G8IA 3DF0B 1A2XA 1XFZO 1DEKA 2QDIA 2PVBA 2WC5A 1CFFA 3WHTB 3SG7A 1SPYA 3BUWB 3I5HB 1AJ5A 1NCXA 3TS5C 5K89A 1DGUA 1LXFC 2QEOA 1DQEA 2F2OA 3BYAA 1QATA 2KOTA 1BJFA 4JWQA 3SG3A 1PSRA 1S5GZ 1TNQA 3S0BA 1IQ3A 1WY9A 3SIAA 3CZ2A 2L50A 3DF0A 2LP3A 2IS9A 1S5GY 1M46A 2LVIA 1P28A 2MHHA 4KYNA 1UWOA 2WCLA 3Q8IA 1K8UA 1NYAA 1IG5A 2F33A 2JPTA 3VGOA 3EK4A 2FJUB 3DVMA 1J55A 1FBVA 2P70A 2M97A 2KI6D 1W7IB 1SYMA 1U5IB 1MXLC 1XVJA 1IH0A 2LM5A 1J7OA 1OOGA 1TRFA 4NDCA 2K2FA 2WCKA 2ZRSA 3CZ1A 3UNWA 2E30A 1XFWO 1B8RA 3HCMA 1B7TY 5DKRA 5DKQA 3EVRA 4INWA 4PHMA 2CCMA 4CPVA 5D69A 1XFVO 3A4UB 1IIOA 1IQ5A 2BNXA 3BFBA 1KQMC 2F3YA 1BMOA 1CDLA 3NSOA 3OBVA 3D78A 2YGUA 5PALA 3PN7B 1K95A 3QMEA 1ODBA 1WDCB 1ZACA 1BU3A 3FE6A 1OSAA 1EJ3A 4INXA 3CTNA 2MAZA 1SK6D 2HETA 3PN7C 1K90D 2Y1MA 1OQPA 1S26D 3F45A 1EG4A 4NQGA 2WCJA 4QJ5B 2BL0B 2K7DA 4WQ3A 5ER5A 2WC6A 3I5GC 5I2OA 2BCAA 1XA5A 2QEBA 2KPHA 2Q91A 1C07A 1MHOA 5HLOA 3E3RA 2LHIA 4FQOA 3SG2A 2TN4A 2BL0C 4GGNA 2GGMA 4R1EA 1SSEB 3L47A 4N5XA 4JD9A 4OV2A 5EL2A 3O78A 1TTXA 1ZFSA 1LINA 2AUCA 3BJHA 1SL8A 2M7LA 1CFCA 1SY9A 1CMGA 1TNXA 3H4SE 1QX2A 5CSNA 1YVLA 2JXCA 4GAOA 4JQ0D 2BKHB 1NX1A 4OZDA 1NCZA 4GBAA 1NIWA 3S0EA 2WCHA 3BOWB 1Y1XA 4MLWA 4YI9A 3S0GA 3FWCA 3NSIA 2LANA 2O60A 1UHJA 1EXRA 1DJIA 2Y1NA 2L51A 3DZTA 3SS3A 1QV1A 1IJ5A 4Q04A 1CDMA 2CTNA 2ZKMX 3CR5X 2JOJA 1BLQA 4PHKA 3ICBA 1KFXL 2BKIB 2JNFA 1K93D 2EC6B 1OOIX 2PSRA 3I5IB 2AAOA 1VRKA 4IJ7A 1YR5A 1JFJA 4YGBB 2V53A 1JBAA 2EHBA 2L5XB 1J7PA 2M9GA 2PQLA 3D0YA 1DVIA 2ZN8A 3BFAA 1JF2A 4JKTA 1DT7B 1N65A 4GGFC 2EC6C 1Y6WA 3ZNIA 1ZOTB 1BODA 5ER4X 2M49B 3IVTA 4PALA 3RM1A 4F7FA 1IJ6A 1F4OA 2K7BA 4PDZA 1M39A 1RROA 3OB2B 1F8HA 2COLB 4CFQA 1KSOA 5HKWA 1SCMB 1GGZA 4GGFA 3TS5B 1GGWA 1YRUB 2KLEA 3EG5B 2KQ6A 2LMTA 3KO0A 3NHTA 1R6PA 3CWGA 4HRHA 4GUKA 1NX2A 1WRLA 1CLMA 1F70A 1OE9B 4PE0A 5HLVA 1SCMC 2JT0A 1UHKA 1DJWA 2B1UA 1J1DA 1BG1A 4U8DA 3BFHA 1F55A 2P71A 1NUBA 3DXLA 2QEVA 1XO5A 4OCIA 1B47A 5AFPA 2LAPA 2L98A 3WNXB 1QS7A 3S0DA 2WC8A 1S6JA 1UHHA 5GQQC 1TCFA 2NCOA 1QLSA 1CMFA 2PALA 4MVFA 1F71A 3CS1A 4CIDA
chains in the Genus database with same CATH topology
1QX5B 2LP2A 3AAKA 1QJTA 4MSPA 2LVJA 1KCYA 1AP4A 1DGVA 1K9UA 1S6CA 1UURA 4MEWA 2CNPA 5CSFA 2K61A 3SIBA 1QTXA 3FIAA 1QIWA 3CR2A 1OMRA 2KAYA 3LK0A 1OMDA 1IRJA 1QASA 4WQ2A 1NX0A 1YX7A 1SL7A 2ZNDA 1DJZA 3DVKA 3RLZA 2JTTA 2SASA 1UHIA 1MUXA 3GK1A 2LMVA 2WCFA 2F2PA 5KTYA 3ZWHA 1MQ1A 2ZRTA 2M8UA 4GNKB 2KFGA 3SJSA 1SW8A 2M0RA 3LLEA 1XK4C 2PRUA 2I2RE 2NCPA 1J7RA 2NLNA 4PE1A 4ZCUA 1KQMB 3IQOA 4I5NB 3EKHA 3PM8A 1OMVA 1Q80A 3JVTB 3VROA 1L7ZA 2FCEA 3DD4A 3OHMB 4GFTA 1TNPA 2HQ8A 1CDNA 1XK4A 4FTGA 1G33A 2GV5A 4NDDA 2PMYA 4N1FA 4E68A 1SRAA 2KGBC 5TNCA 1K2HA 1GJYA 4YGEB 3JVTC 2WORA 4HSZA 1MXEA 3FS7A 5I8NA 3I5GB 1KFXS 2KGRA 2WCBA 3KEVA 4PE4A 4P2YB 1S6IA 1H8BA 1EL4A 1HQVA 3SG4A 2M3WA 2NZ0A 5HYDA 2F8PA 1KK8C 1AVSA 5HKYA 1L2OC 1NSHA 3GK4X 1JSAA 4BY5A 3PSRA 1FI5A 1S3PA 2LV7A 3OX5A 1A4PA 2L2EA 1W7JB 2KI6C 1DMOA 3C1VA 4DCKA 1YUUA 1F54A 1Y1UA 4MRXA 4HRGA 4WRIA 3TUYC 2WOSA 5HKZA 4CFRA 1WLZA 1KFUS 5IBWA 1JC2A 3LK1A 3QRXA 1D1OA 2M1KB 1CM1A 1GQMA 1N0YA 2BBMA 2M29A 4F0ZB 1MWNA 2K7OA 4I5KA 5CPVA 4PCWA 1TN4A 1A75A 3D0YB 3NXAA 1V1FA 5I2LA 4XYNA 3KF9A 2KAVA 2KAXA 3O2PA 1R2UA 1AHRA 1UHNA 4UPGA 3I5FC 1B9AA 1NPQA 2RGIA 1SR6C 3TDUA 1LKJA 1M31A 3OP0A 1YX8A 2LMUA 1QVIZ 2Y5IA 1TCOB 3GK2A 4QJ4B 1C7WA 2LHLA 3PLFB 4I5LB 1QV0A 2D8NA 2MRDA 2JQ6A 4A4CA 4C0LA 1BF5A 1M63B 2JZIA 4ZCVA 2KFHA 3BXKA 2K2AA 1BR4B 3HX4A 2LUXA 2ZNEA 5AERA 1QLKA 4ORBB 2MLFC 3IQQA 4MBEA 1CLLA 4DRWA 2KQYA 3EVUA 1CB1A 1MF8B 3SG5A 1PVBA 2BE4A 3D10A 1KFUL 2KYCA 2GGZA 2BBNA 2CT9A 2KBMA 3OB1B 3CGAA 1LA0A 2LC5A 1CFPA 1K94A 2JRFA 1JF0A 4IL1A 1RFJA 3CR4X 4YBHB 4XJKA 3NSLA 1NP8A 1X02A 2M1UA 3CLNA 1HT9A 2ISDA 1TNWA 4YGCB 1SKTA 3WXAA 1CFDA 1PK0D 2OTGB 2Y4QA 1XYDA 4OR9B 4ORCB 3VRNA 4MRYA 1TIZA 2OS8C 3M0WA 2BCXA 4AOMA 1J1EA 1RK9A 4YRUA 2KBIA 2OTGC 3PALA 4D1EA 5KU1A 2G9BA 5JOLA 2L4IA 5JJGA 5G08A 1FPWA 2KYFA 2BCBA 1WRZA 5AEQA 2O5GA 2AMIA 4DUQA 3TDIA 5BPJA 3K21A 2JC2A 4QJ3B 1DF0A 3EK8A 4MZKA 2LLSA 1BT6A 3I5HC 2EGDA 2F3ZA 2LE9B 3O6BA 4ICBA 4P5OE 2KI4B 5CSIA 1SL9A 1C7VA 1SBJA 1PULA 2FCDA 4CLNA 1TOPA 4I5JA 3PATA 1K96A 2FOTA 2HF5A 1F4QA 4M2QA 1CTRA 1PSBA 2JT8A 2KI4C 1SMGA 1YUSA 1AK8A 3A8RA 5I2QA 2MLEC 3OX6A 1QIVA 1YTZC 1PALA 3VRQA 2MJWB 2KDHA 2LVKA 4YGAA 1ZMZA 2VRGA 5F6TA 2P6BB 2A4JA 1NCYA 2JXLA 1OZOA 4MZJA 4GPLB 2H61C 1CDPA 2K7CA 1YVHA 2LLUA 2I94A 2JULA 2LVVA 1KSMA 1PVAA 4OKHA 3FWBA 1B7TZ 2ZFDA 5AXIA 3LCPC 5CSJA 1KK8B 2WNDA 1L2OB 4DS7A 3EK7A 1PRWA 2QACA 1OOJA 1YRTB 1MR8A 2H61A 1SCVA 2WCEA 5B8IB 2LUCA 1EH2A 1AUIB 1U5IA 4OVNF 4AQIA 3BUOB 1DJHA 1Y0VH 1A75B 2G2BA 4N1GA 3TUYB 1QXPA 1B8CA 1J7QA 1EG3A 1A03A 1KK7Z 2M7NA 1XFUO 4USLA 2BECA 3BQ3A 3VRPA 5KSZA 3TDZA 1KK7Y 1KWOB 1WDCC 4MN0A 2K8MB 4A4BA 2I7AA 1ZUZA 4PE7A 2K0JA 5J3XA 1LVCD 1RJVA 2I18A 2ZN9A 1S36A 2PASA 3I5FB 1ALVA 1KQVA 2R2IA 4C0JA 1KWOC 1K9KA 1SR6B 2JNXA 1ALWA 1Y1AA 3BUMB 1B4CA 1RWYA 4M2OA 1IKUA 1FI6A 2OPOA 5D7FA 4TNCA 1B1GA 1BOCA 2QPTA 2HPSA 3BUXB 3EVVA 3GOFA 1AJ4A 2MBXA 2E6WA 1V1GA 1B8LA 3DVJA 1FF1A 1RECA 5DKNA 4ORAB 1JWDA 1XFYO 1G4YR 2JWWA 2CBLA 2L0PA 2L4HA 1RTP1 1QVIY 1QX7A 2DOQA 4PHNA 4MZLA 3JTDB 1DJXA 4L9MA 1JUOA 3PFVA 4NDBA 3WHUB 1CKKA 3NSKA 2JTZA 3KPXA 1JFKA 4YGDB 1H4BA 1DJGA 1IGVA 4XJKB 3IF7A 3DVEA 3JTDC 3KHEA 2LNKA 1DTLA 2H2KA 2JU0A 4PHJA 2SCPA 4ETOA 1IWQA 1SNLA 1FW4A 3LL8B 3BUNB 2Q4UA 2KFFA 4DIRA 1UP5A 2CXJA 1E8AA 3VRRA 1DJYA 1WLMA 2NXQA 5AANA 2KHNA 4YI8A 4C0KA 4AQJA 1BR1B 2HQWA 3BOWA 1NWDA 1WRKA 1YUTA 3CZTX 2LCPA 3AAJA 1A29A 1NX3A 3AKBA 1UUSA 1OZSA 2OS8B 3I5IC 1CM4A 1K9PA 4JPZB 2BE6A 3AKAA 1YURA 4M2PA 1CNPA 2JT3A 1LA3A 5FYXA 1DF0B 2LLTA 4HREE 3MSEB 3SG6A 3EKJA 1XFXO 4BY4A 2KNEA 2KSPA 3O4YA 1N2DA 2MA2A 1CLBA 3TZ1A 1S1EA 1M45A 1G8IA 3DF0B 1A2XA 1XFZO 2PVBA 1CFFA 3WHTB 3SG7A 1SPYA 3BUWB 3I5HB 1AJ5A 1NCXA 3TS5C 5K89A 1DGUA 1LXFC 2F2OA 3BYAA 1QATA 2KOTA 1BJFA 4JWQA 3SG3A 1PSRA 1S5GZ 1TNQA 1IQ3A 1WY9A 3SIAA 3DF0A 2L50A 2LP3A 2IS9A 1S5GY 1M46A 2LVIA 2MHHA 1UWOA 1K8UA 1NYAA 1IG5A 2F33A 2JPTA 3VGOA 3EK4A 2FJUB 3DVMA 1J55A 1FBVA 2M97A 2KI6D 1W7IB 1SYMA 1U5IB 1MXLC 1XVJA 1IH0A 2LM5A 1J7OA 1TRFA 4NDCA 2K2FA 2ZRSA 2E30A 1XFWO 1B8RA 3HCMA 1B7TY 5DKRA 5DKQA 3EVRA 4PHMA 2CCMA 4CPVA 5D69A 1XFVO 3A4UB 1IQ5A 1KQMC 2F3YA 1BMOA 1CDLA 3NSOA 5PALA 3PN7B 1K95A 1ODBA 1WDCB 1ZACA 1BU3A 1OSAA 1EJ3A 3CTNA 2MAZA 1SK6D 2HETA 3PN7C 1K90D 2Y1MA 1OQPA 1S26D 3F45A 1EG4A 4NQGA 4QJ5B 2BL0B 2K7DA 4WQ3A 5ER5A 3I5GC 5I2OA 2BCAA 1XA5A 2Q91A 1C07A 1MHOA 5HLOA 3E3RA 2LHIA 4FQOA 3SG2A 2TN4A 2BL0C 4GGNA 2GGMA 4R1EA 4N5XA 4OV2A 3O78A 1TTXA 1ZFSA 1LINA 2AUCA 1SL8A 2M7LA 1CFCA 1SY9A 1CMGA 1TNXA 3H4SE 1QX2A 5CSNA 1YVLA 2JXCA 4GAOA 4JQ0D 2BKHB 1NX1A 1NCZA 4GBAA 1NIWA 3BOWB 1Y1XA 4MLWA 4YI9A 3FWCA 3NSIA 2LANA 2O60A 1UHJA 1EXRA 1DJIA 2Y1NA 2L51A 1QV1A 1IJ5A 4Q04A 1CDMA 2CTNA 2ZKMX 3CR5X 2JOJA 1BLQA 4PHKA 3ICBA 1KFXL 2BKIB 2JNFA 1K93D 2EC6B 2PSRA 3I5IB 2AAOA 1VRKA 1JFJA 1YR5A 4YGBB 2V53A 1JBAA 2EHBA 2L5XB 1J7PA 2M9GA 3D0YA 1DVIA 2ZN8A 1DT7B 1JF2A 1N65A 4GGFC 2EC6C 1Y6WA 3ZNIA 1ZOTB 1BODA 5ER4X 2M49B 4PALA 3RM1A 1IJ6A 1F4OA 2K7BA 4PDZA 1M39A 1RROA 3OB2B 1F8HA 2COLB 4CFQA 1KSOA 5HKWA 1SCMB 1GGZA 4GGFA 3TS5B 1GGWA 1YRUB 2KQ6A 2LMTA 3KO0A 1R6PA 3CWGA 4HRHA 4GUKA 1NX2A 1WRLA 1CLMA 1F70A 1OE9B 4PE0A 5HLVA 1SCMC 2JT0A 1UHKA 1DJWA 2B1UA 1J1DA 1BG1A 4U8DA 1F55A 1NUBA 1XO5A 4OCIA 1B47A 5AFPA 2LAPA 2L98A 3WNXB 1QS7A 2WC8A 1S6JA 1UHHA 5GQQC 1TCFA 2NCOA 1QLSA 1CMFA 2PALA 4MVFA 1F71A 3CS1A 4CIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX5 B;  2LP2 A;  3AAK A;  1QJT A;  4MSP A;  2LVJ A;  1KCY A;  1AP4 A;  1DGV A;  1K9U A;  1S6C A;  1UUR A;  4MEW A;  2CNP A;  5CSF A;  2K61 A;  3SIB A;  1QTX A;  3FIA A;  1QIW A;  3CR2 A;  1OMR A;  2KAY A;  3LK0 A;  1OMD A;  1IRJ A;  1QAS A;  4WQ2 A;  1NX0 A;  1YX7 A;  1SL7 A;  2ZND A;  1DJZ A;  3DVK A;  3RLZ A;  2JTT A;  2SAS A;  1UHI A;  1MUX A;  3GK1 A;  2LMV A;  2WCF A;  2F2P A;  5KTY A;  3ZWH A;  1MQ1 A;  2ZRT A;  2M8U A;  4GNK B;  2KFG A;  3SJS A;  1SW8 A;  2M0R A;  3LLE A;  1XK4 C;  2PRU A;  2I2R E;  2NCP A;  1J7R A;  2NLN A;  4PE1 A;  4ZCU A;  1KQM B;  3IQO A;  4I5N B;  3EKH A;  3PM8 A;  1OMV A;  1Q80 A;  3JVT B;  3VRO A;  1L7Z A;  2FCE A;  3DD4 A;  3OHM B;  4GFT A;  1TNP A;  2HQ8 A;  1CDN A;  1XK4 A;  4FTG A;  1G33 A;  2GV5 A;  4NDD A;  2PMY A;  4N1F A;  4E68 A;  1SRA A;  2KGB C;  5TNC A;  1K2H A;  1GJY A;  4YGE B;  3JVT C;  2WOR A;  4HSZ A;  1MXE A;  3FS7 A;  5I8N A;  3I5G B;  1KFX S;  2KGR A;  2WCB A;  3KEV A;  4PE4 A;  4P2Y B;  1S6I A;  1H8B A;  1EL4 A;  1HQV A;  3SG4 A;  2M3W A;  2NZ0 A;  5HYD A;  2F8P A;  1KK8 C;  1AVS A;  5HKY A;  1L2O C;  1NSH A;  3GK4 X;  1JSA A;  4BY5 A;  3PSR A;  1FI5 A;  1S3P A;  2LV7 A;  3OX5 A;  1A4P A;  2L2E A;  1W7J B;  2KI6 C;  1DMO A;  3C1V A;  4DCK A;  1YUU A;  1F54 A;  1Y1U A;  4MRX A;  4HRG A;  4WRI A;  3TUY C;  2WOS A;  5HKZ A;  4CFR A;  1WLZ A;  1KFU S;  5IBW A;  1JC2 A;  3LK1 A;  3QRX A;  1D1O A;  2M1K B;  1CM1 A;  1GQM A;  1N0Y A;  2BBM A;  2M29 A;  4F0Z B;  1MWN A;  2K7O A;  4I5K A;  5CPV A;  4PCW A;  1TN4 A;  1A75 A;  3D0Y B;  3NXA A;  1V1F A;  5I2L A;  4XYN A;  3KF9 A;  2KAV A;  2KAX A;  3O2P A;  1R2U A;  1AHR A;  1UHN A;  4UPG A;  3I5F C;  1B9A A;  1NPQ A;  2RGI A;  1SR6 C;  3TDU A;  1LKJ A;  1M31 A;  3OP0 A;  1YX8 A;  2LMU A;  1QVI Z;  2Y5I A;  1TCO B;  3GK2 A;  4QJ4 B;  1C7W A;  2LHL A;  3PLF B;  4I5L B;  1QV0 A;  2D8N A;  2MRD A;  2JQ6 A;  4A4C A;  4C0L A;  1BF5 A;  1M63 B;  2JZI A;  4ZCV A;  2KFH A;  3BXK A;  2K2A A;  1BR4 B;  3HX4 A;  2LUX A;  2ZNE A;  5AER A;  1QLK A;  4ORB B;  2MLF C;  3IQQ A;  4MBE A;  1CLL A;  4DRW A;  2KQY A;  3EVU A;  1CB1 A;  1MF8 B;  3SG5 A;  1PVB A;  2BE4 A;  3D10 A;  1KFU L;  2KYC A;  2GGZ A;  2BBN A;  2CT9 A;  2KBM A;  3OB1 B;  3CGA A;  1LA0 A;  2LC5 A;  1CFP A;  1K94 A;  2JRF A;  1JF0 A;  4IL1 A;  1RFJ A;  3CR4 X;  4YBH B;  4XJK A;  3NSL A;  1NP8 A;  1X02 A;  2M1U A;  3CLN A;  1HT9 A;  2ISD A;  1TNW A;  4YGC B;  1SKT A;  3WXA A;  1CFD A;  1PK0 D;  2OTG B;  2Y4Q A;  1XYD A;  4OR9 B;  4ORC B;  3VRN A;  4MRY A;  1TIZ A;  2OS8 C;  3M0W A;  2BCX A;  4AOM A;  1J1E A;  1RK9 A;  4YRU A;  2KBI A;  2OTG C;  3PAL A;  4D1E A;  5KU1 A;  2G9B A;  5JOL A;  2L4I A;  5JJG A;  5G08 A;  1FPW A;  2KYF A;  2BCB A;  1WRZ A;  5AEQ A;  2O5G A;  2AMI A;  4DUQ A;  3TDI A;  5BPJ A;  3K21 A;  2JC2 A;  4QJ3 B;  1DF0 A;  3EK8 A;  4MZK A;  2LLS A;  1BT6 A;  3I5H C;  2EGD A;  2F3Z A;  2LE9 B;  3O6B A;  4ICB A;  4P5O E;  2KI4 B;  5CSI A;  1SL9 A;  1C7V A;  1SBJ A;  1PUL A;  2FCD A;  4CLN A;  1TOP A;  4I5J A;  3PAT A;  1K96 A;  2FOT A;  2HF5 A;  1F4Q A;  4M2Q A;  1CTR A;  1PSB A;  2JT8 A;  2KI4 C;  1SMG A;  1YUS A;  1AK8 A;  3A8R A;  5I2Q A;  2MLE C;  3OX6 A;  1QIV A;  1YTZ C;  1PAL A;  3VRQ A;  2MJW B;  2KDH A;  2LVK A;  4YGA A;  1ZMZ A;  2VRG A;  5F6T A;  2P6B B;  2A4J A;  1NCY A;  2JXL A;  1OZO A;  4MZJ A;  4GPL B;  2H61 C;  1CDP A;  2K7C A;  1YVH A;  2LLU A;  2I94 A;  2JUL A;  2LVV A;  1KSM A;  1PVA A;  4OKH A;  3FWB A;  1B7T Z;  2ZFD A;  5AXI A;  3LCP C;  5CSJ A;  1KK8 B;  2WND A;  1L2O B;  4DS7 A;  3EK7 A;  1PRW A;  2QAC A;  1OOJ A;  1YRT B;  1MR8 A;  2H61 A;  1SCV A;  2WCE A;  5B8I B;  2LUC A;  1EH2 A;  1AUI B;  1U5I A;  4OVN F;  4AQI A;  3BUO B;  1DJH A;  1Y0V H;  1A75 B;  2G2B A;  4N1G A;  3TUY B;  1QXP A;  1B8C A;  1J7Q A;  1EG3 A;  1A03 A;  1KK7 Z;  2M7N A;  1XFU O;  4USL A;  2BEC A;  3BQ3 A;  3VRP A;  5KSZ A;  3TDZ A;  1KK7 Y;  1KWO B;  1WDC C;  4MN0 A;  2K8M B;  4A4B A;  2I7A A;  1ZUZ A;  4PE7 A;  2K0J A;  5J3X A;  1LVC D;  1RJV A;  2I18 A;  2ZN9 A;  1S36 A;  2PAS A;  3I5F B;  1ALV A;  1KQV A;  2R2I A;  4C0J A;  1KWO C;  1K9K A;  1SR6 B;  2JNX A;  1ALW A;  1Y1A A;  3BUM B;  1B4C A;  1RWY A;  4M2O A;  1IKU A;  1FI6 A;  2OPO A;  5D7F A;  4TNC A;  1B1G A;  1BOC A;  2QPT A;  2HPS A;  3BUX B;  3EVV A;  3GOF A;  1AJ4 A;  2MBX A;  2E6W A;  1V1G A;  1B8L A;  3DVJ A;  1FF1 A;  1REC A;  5DKN A;  4ORA B;  1JWD A;  1XFY O;  1G4Y R;  2JWW A;  2CBL A;  2L0P A;  2L4H A;  1RTP 1;  1QVI Y;  1QX7 A;  2DOQ A;  4PHN A;  4MZL A;  3JTD B;  1DJX A;  4L9M A;  1JUO A;  3PFV A;  4NDB A;  3WHU B;  1CKK A;  3NSK A;  2JTZ A;  3KPX A;  1JFK A;  4YGD B;  1H4B A;  1DJG A;  1IGV A;  4XJK B;  3IF7 A;  3DVE A;  3JTD C;  3KHE A;  2LNK A;  1DTL A;  2H2K A;  2JU0 A;  4PHJ A;  2SCP A;  4ETO A;  1IWQ A;  1SNL A;  1FW4 A;  3LL8 B;  3BUN B;  2Q4U A;  2KFF A;  4DIR A;  1UP5 A;  2CXJ A;  1E8A A;  3VRR A;  1DJY A;  1WLM A;  2NXQ A;  5AAN A;  2KHN A;  4YI8 A;  4C0K A;  4AQJ A;  1BR1 B;  2HQW A;  3BOW A;  1NWD A;  1WRK A;  1YUT A;  3CZT X;  2LCP A;  3AAJ A;  1A29 A;  1NX3 A;  3AKB A;  1UUS A;  1OZS A;  2OS8 B;  3I5I C;  1CM4 A;  1K9P A;  4JPZ B;  2BE6 A;  3AKA A;  1YUR A;  4M2P A;  1CNP A;  2JT3 A;  1LA3 A;  5FYX A;  1DF0 B;  2LLT A;  4HRE E;  3MSE B;  3SG6 A;  3EKJ A;  1XFX O;  4BY4 A;  2KNE A;  2KSP A;  3O4Y A;  1N2D A;  2MA2 A;  1CLB A;  3TZ1 A;  1S1E A;  1M45 A;  1G8I A;  3DF0 B;  1A2X A;  1XFZ O;  2PVB A;  1CFF A;  3WHT B;  3SG7 A;  1SPY A;  3BUW B;  3I5H B;  1AJ5 A;  1NCX A;  3TS5 C;  5K89 A;  1DGU A;  1LXF C;  2F2O A;  3BYA A;  1QAT A;  2KOT A;  1BJF A;  4JWQ A;  3SG3 A;  1PSR A;  1S5G Z;  1TNQ A;  1IQ3 A;  1WY9 A;  3SIA A;  3DF0 A;  2L50 A;  2LP3 A;  2IS9 A;  1S5G Y;  1M46 A;  2LVI A;  2MHH A;  1UWO A;  1K8U A;  1NYA A;  1IG5 A;  2F33 A;  2JPT A;  3VGO A;  3EK4 A;  2FJU B;  3DVM A;  1J55 A;  1FBV A;  2M97 A;  2KI6 D;  1W7I B;  1SYM A;  1U5I B;  1MXL C;  1XVJ A;  1IH0 A;  2LM5 A;  1J7O A;  1TRF A;  4NDC A;  2K2F A;  2ZRS A;  2E30 A;  1XFW O;  1B8R A;  3HCM A;  1B7T Y;  5DKR A;  5DKQ A;  3EVR A;  4PHM A;  2CCM A;  4CPV A;  5D69 A;  1XFV O;  3A4U B;  1IQ5 A;  1KQM C;  2F3Y A;  1BMO A;  1CDL A;  3NSO A;  5PAL A;  3PN7 B;  1K95 A;  1ODB A;  1WDC B;  1ZAC A;  1BU3 A;  1OSA A;  1EJ3 A;  3CTN A;  2MAZ A;  1SK6 D;  2HET A;  3PN7 C;  1K90 D;  2Y1M A;  1OQP A;  1S26 D;  3F45 A;  1EG4 A;  4NQG A;  4QJ5 B;  2BL0 B;  2K7D A;  4WQ3 A;  5ER5 A;  3I5G C;  5I2O A;  2BCA A;  1XA5 A;  2Q91 A;  1C07 A;  1MHO A;  5HLO A;  3E3R A;  2LHI A;  4FQO A;  3SG2 A;  2TN4 A;  2BL0 C;  4GGN A;  2GGM A;  4R1E A;  4N5X A;  4OV2 A;  3O78 A;  1TTX A;  1ZFS A;  1LIN A;  2AUC A;  1SL8 A;  2M7L A;  1CFC A;  1SY9 A;  1CMG A;  1TNX A;  3H4S E;  1QX2 A;  5CSN A;  1YVL A;  2JXC A;  4GAO A;  4JQ0 D;  2BKH B;  1NX1 A;  1NCZ A;  4GBA A;  1NIW A;  3BOW B;  1Y1X A;  4MLW A;  4YI9 A;  3FWC A;  3NSI A;  2LAN A;  2O60 A;  1UHJ A;  1EXR A;  1DJI A;  2Y1N A;  2L51 A;  1QV1 A;  1IJ5 A;  4Q04 A;  1CDM A;  2CTN A;  2ZKM X;  3CR5 X;  2JOJ A;  1BLQ A;  4PHK A;  3ICB A;  1KFX L;  2BKI B;  2JNF A;  1K93 D;  2EC6 B;  2PSR A;  3I5I B;  2AAO A;  1VRK A;  1JFJ A;  1YR5 A;  4YGB B;  2V53 A;  1JBA A;  2EHB A;  2L5X B;  1J7P A;  2M9G A;  3D0Y A;  1DVI A;  2ZN8 A;  1DT7 B;  1JF2 A;  1N65 A;  4GGF C;  2EC6 C;  1Y6W A;  3ZNI A;  1ZOT B;  1BOD A;  5ER4 X;  2M49 B;  4PAL A;  3RM1 A;  1IJ6 A;  1F4O A;  2K7B A;  4PDZ A;  1M39 A;  1RRO A;  3OB2 B;  1F8H A;  2COL B;  4CFQ A;  1KSO A;  5HKW A;  1SCM B;  1GGZ A;  4GGF A;  3TS5 B;  1GGW A;  1YRU B;  2KQ6 A;  2LMT A;  3KO0 A;  1R6P A;  3CWG A;  4HRH A;  4GUK A;  1NX2 A;  1WRL A;  1CLM A;  1F70 A;  1OE9 B;  4PE0 A;  5HLV A;  1SCM C;  2JT0 A;  1UHK A;  1DJW A;  2B1U A;  1J1D A;  1BG1 A;  4U8D A;  1F55 A;  1NUB A;  1XO5 A;  4OCI A;  1B47 A;  5AFP A;  2LAP A;  2L98 A;  3WNX B;  1QS7 A;  2WC8 A;  1S6J A;  1UHH A;  5GQQ C;  1TCF A;  2NCO A;  1QLS A;  1CMF A;  2PAL A;  4MVF A;  1F71 A;  3CS1 A;  4CID A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  2LP2 A;  3AAK A;  1QJT A;  4MSP A;  2LVJ A;  1KCY A;  1AP4 A;  1DGV A;  1K9U A;  1S6C A;  1UUR A;  4MEW A;  2CNP A;  5CSF A;  2K61 A;  3CAB A;  3SIB A;  1QTX A;  3FIA A;  1QIW A;  3CR2 A;  1OMR A;  2KAY A;  1LS8 A;  1Z4H A;  3LK0 A;  1OMD A;  1IRJ A;  1QAS A;  4WQ2 A;  1NX0 A;  1YX7 A;  1SL7 A;  2ZND A;  1DJZ A;  3DVK A;  3RLZ A;  1TUZ A;  2JTT A;  2SAS A;  1UHI A;  1MUX A;  3GK1 A;  1DEL A;  2KLD A;  2LMV A;  2WCF A;  2F2P A;  5KTY A;  3ZWH A;  1MQ1 A;  5FI6 A;  2ZRT A;  2M8U A;  2WCM A;  4GNK B;  2KFG A;  3SJS A;  1SW8 A;  2M0R A;  3LLE A;  1XK4 C;  2PRU A;  2I2R E;  2NCP A;  1J7R A;  2NLN A;  4PE1 A;  4ZCU A;  1KQM B;  3IQO A;  4I5N B;  3EKH A;  3PM8 A;  1OMV A;  2FJY A;  3D77 A;  3NHI A;  2QEH A;  1Q80 A;  3JVT B;  3O4X A;  3VRO A;  1L7Z A;  2FCE A;  3DD4 A;  3OHM B;  4GFT A;  1TNP A;  1C3Y A;  2HQ8 A;  1CDN A;  1XK4 A;  4FTG A;  1G33 A;  2GV5 A;  3CDN A;  4NDD A;  2PMY A;  4N1F A;  4E68 A;  1SRA A;  2KGB C;  5TNC A;  1K2H A;  1GJY A;  4YGE B;  3JVT C;  2WOR A;  4HSZ A;  1MXE A;  3FS7 A;  5I8N A;  3I5G B;  1KFX S;  2KGR A;  2WCB A;  3KEV A;  4PE4 A;  4P2Y B;  1S6I A;  3L4L A;  1H8B A;  1EL4 A;  1HQV A;  3SG4 A;  1XFR A;  3VB1 A;  2M3W A;  2NZ0 A;  3PM2 A;  5HYD A;  2F8P A;  1KK8 C;  1AVS A;  5HKY A;  1L2O C;  1NSH A;  3GK4 X;  1JSA A;  4BY5 A;  3S0A A;  3PSR A;  1FI5 A;  1S3P A;  2LV7 A;  3NGV A;  1OW4 A;  3OX5 A;  1A4P A;  2L2E A;  1W7J B;  2KI6 C;  1DMO A;  3PJI A;  3C1V A;  4DCK A;  1YUU A;  1F54 A;  3S0F A;  1Y1U A;  1OOF A;  4MRX A;  4HRG A;  4WRI A;  2L2C A;  3TUY C;  2H8V A;  2WOS A;  5HKZ A;  1WLZ A;  1KFU S;  4CFR A;  5IBW A;  1DC1 A;  3LK1 A;  3QRX A;  1D1O A;  2M1K B;  1JC2 A;  1CM1 A;  1GQM A;  1N0Y A;  3FE8 A;  2BBM A;  2M29 A;  3B88 A;  3RZS A;  1ORG A;  4F0Z B;  1MWN A;  2K7O A;  3D75 A;  4I5K A;  5CPV A;  4PCW A;  1TN4 A;  1A75 A;  3D0Y B;  3NXA A;  1V1F A;  4PT1 A;  5I2L A;  4XYN A;  3KF9 A;  2KAV A;  2KAX A;  3O2P A;  1R2U A;  1AHR A;  1UHN A;  4UPG A;  3I5F C;  1B9A A;  1NPQ A;  2RGI A;  1SR6 C;  3TDU A;  1LKJ A;  1M31 A;  3B86 A;  3OP0 A;  1YX8 A;  2LMU A;  1QVI Z;  2Y5I A;  1TCO B;  1OOH A;  3GK2 A;  3UO9 A;  4QJ4 B;  1C7W A;  2LHL A;  3PLF B;  4I5L B;  1QV0 A;  2D8N A;  2MRD A;  2JQ6 A;  4A4C A;  4C0L A;  1BF5 A;  3N7H A;  5FI7 A;  1M63 B;  2JZI A;  4ZCV A;  2KFH A;  3BXK A;  2K2A A;  1BR4 B;  3HX4 A;  2LUX A;  2ZNE A;  5AER A;  1QLK A;  4ORB B;  2MLF C;  3IQQ A;  4MBE A;  1CLL A;  4DRW A;  2KQY A;  1QWV A;  3EVU A;  1CB1 A;  1MF8 B;  3SG5 A;  1PVB A;  2BE4 A;  3D10 A;  1KFU L;  2KYC A;  2GGZ A;  2BBN A;  2CT9 A;  2KBM A;  3OB1 B;  5FI2 A;  3CGA A;  1LA0 A;  1TUJ A;  2LC5 A;  1CFP A;  1K94 A;  2JRF A;  3B87 A;  1JF0 A;  4IL1 A;  1RFJ A;  3CR4 X;  4YBH B;  1GM0 A;  4XJK A;  3NSL A;  1NP8 A;  1X02 A;  2ERB A;  2M1U A;  3CLN A;  1HT9 A;  2ISD A;  1TNW A;  4YGC B;  1SKT A;  3WXA A;  3SS4 A;  1CFD A;  1PK0 D;  2OTG B;  2Y4Q A;  1XYD A;  4OR9 B;  4ORC B;  3VRN A;  3CYZ A;  4MRY A;  1TIZ A;  2OS8 C;  3M0W A;  2BCX A;  4AOM A;  1J1E A;  1RK9 A;  4YRU A;  2JPO A;  2KBI A;  2OTG C;  3PAL A;  4D1E A;  5KU1 A;  3R72 A;  2G9B A;  5JOL A;  2L4I A;  5JJG A;  5G08 A;  1FPW A;  2KYF A;  2BCB A;  1WRZ A;  5AEQ A;  2O5G A;  2AMI A;  4DUQ A;  3TDI A;  5BPJ A;  1W9Z A;  3K21 A;  2JC2 A;  4QJ3 B;  5D3O A;  1DF0 A;  3EK8 A;  4MZK A;  2LLS A;  1BT6 A;  3I5H C;  2EGD A;  2F3Z A;  2LE9 B;  3O6B A;  4ICB A;  4P5O E;  2KI4 B;  5CSI A;  1SL9 A;  5HL1 A;  1C7V A;  1SBJ A;  1PUL A;  2FCD A;  4CLN A;  3SS5 A;  1TOP A;  4I5J A;  3PAT A;  1K96 A;  3OGN A;  2FOT A;  2HF5 A;  1F4Q A;  4M2Q A;  1CTR A;  1PSB A;  2JT8 A;  2KI4 C;  1SMG A;  1YUS A;  1AK8 A;  1T14 A;  3A8R A;  5I2Q A;  2MLE C;  3OX6 A;  1QIV A;  3R1V A;  1YTZ C;  1PAL A;  3VRQ A;  2MJW B;  2KDH A;  2LVK A;  4YGA A;  1ZMZ A;  2VRG A;  5F6T A;  3D74 A;  2P6B B;  2A4J A;  1NCY A;  2JXL A;  1OZO A;  4MZJ A;  4GPL B;  3D73 A;  2H61 C;  1CDP A;  2K7C A;  1YVH A;  2BAP A;  2I94 A;  2JUL A;  2LLU A;  1KSM A;  1PVA A;  2LVV A;  4OKH A;  3FWB A;  1B7T Z;  2ZFD A;  5AXI A;  3LCP C;  5CSJ A;  1KK8 B;  2WND A;  1L2O B;  4DS7 A;  3EK7 A;  1PRW A;  2QAC A;  1OOJ A;  3B7A A;  1YRT B;  1MR8 A;  2H61 A;  1SCV A;  2WCE A;  5B8I B;  5I94 A;  2LUC A;  1EH2 A;  1AUI B;  1U5I A;  4OVN F;  4AQI A;  3BUO B;  3V2L A;  1DJH A;  1Y0V H;  1A75 B;  2G2B A;  4N1G A;  3TUY B;  1QXP A;  1B8C A;  1J7Q A;  1EG3 A;  1A03 A;  1KK7 Z;  2M7N A;  1XFU O;  3FE9 A;  2BEC A;  3BQ3 A;  4USL A;  3VRP A;  5KSZ A;  3TDZ A;  1KK7 Y;  1KWO B;  4BY4 A;  1WDC C;  4MN0 A;  2K8M B;  4A4B A;  2I7A A;  1ZUZ A;  4PE7 A;  2K0J A;  5J3X A;  2L5Y A;  1LVC D;  1RJV A;  2I18 A;  2ZN9 A;  2GTE A;  1S36 A;  2PAS A;  3I5F B;  1ALV A;  1KQV A;  2R2I A;  4C0J A;  1KWO C;  1K9K A;  1SR6 B;  2JNX A;  4FQT A;  1ALW A;  1Y1A A;  3BUM B;  1B4C A;  1RWY A;  4M2O A;  1IKU A;  1FI6 A;  2OPO A;  5D7F A;  4TNC A;  1B1G A;  1BOC A;  2QPT A;  2HPS A;  3BUX B;  3EVV A;  3GOF A;  1AJ4 A;  1C3Z A;  2E6W A;  2MBX A;  1V1G A;  1B8L A;  3DVJ A;  1FF1 A;  1REC A;  1Z2C B;  4ORA B;  5DKN A;  1XFY O;  1JWD A;  1G4Y R;  2JWW A;  2CBL A;  2L0P A;  2L4H A;  3D76 A;  1RTP 1;  1QVI Y;  1QX7 A;  2DOQ A;  4PHN A;  4MZL A;  3JTD B;  1DJX A;  4L9M A;  1JUO A;  3PFV A;  3B6X A;  4NDB A;  3WHU B;  1CKK A;  3NSK A;  2JTZ A;  3KPX A;  1JFK A;  4YGD B;  1H4B A;  1DJG A;  1IGV A;  4XJK B;  3IF7 A;  3DVE A;  3JTD C;  3KHE A;  2LNK A;  1DTL A;  2H2K A;  2JU0 A;  4PHJ A;  2SCP A;  4ETO A;  1IWQ A;  1SNL A;  1FW4 A;  3LL8 B;  3BUN B;  2PYQ A;  3R1P A;  2Q4U A;  2KFF A;  4DIR A;  1UP5 A;  2CXJ A;  5DIC A;  1E8A A;  2K60 A;  3VRR A;  1DJY A;  1WLM A;  2NXQ A;  5AAN A;  2KHN A;  4YI8 A;  4C0K A;  4AQJ A;  1BR1 B;  2HQW A;  3BOW A;  3L4A A;  1NWD A;  1WRK A;  1YUT A;  3CZT X;  2LCP A;  3AAJ A;  1A29 A;  1NX3 A;  3AKB A;  1UUS A;  1OZS A;  2OS8 B;  3I5I C;  1CM4 A;  1K9P A;  4JPZ B;  1TWO A;  2BE6 A;  3AKA A;  1YUR A;  3R1O A;  4M2P A;  1CNP A;  2JT3 A;  1LA3 A;  5FYX A;  1DF0 B;  2LLT A;  4HRE E;  3DYE A;  3K1E A;  3EKJ A;  1XFX O;  3MSE B;  3SG6 A;  2KNE A;  2KSP A;  3CZ0 A;  3O4Y A;  1N2D A;  3DY9 A;  2MA2 A;  1CLB A;  3TZ1 A;  1S1E A;  1M45 A;  1G8I A;  3DF0 B;  1A2X A;  1XFZ O;  1DEK A;  2QDI A;  2PVB A;  2WC5 A;  1CFF A;  3WHT B;  3SG7 A;  1SPY A;  3BUW B;  3I5H B;  1AJ5 A;  1NCX A;  3TS5 C;  5K89 A;  1DGU A;  1LXF C;  2QEO A;  1DQE A;  2F2O A;  3BYA A;  1QAT A;  2KOT A;  1BJF A;  4JWQ A;  3SG3 A;  1PSR A;  1S5G Z;  1TNQ A;  3S0B A;  1IQ3 A;  1WY9 A;  3SIA A;  3CZ2 A;  2L50 A;  3DF0 A;  2LP3 A;  2IS9 A;  1S5G Y;  1M46 A;  2LVI A;  1P28 A;  2MHH A;  4KYN A;  1UWO A;  2WCL A;  3Q8I A;  1K8U A;  1NYA A;  1IG5 A;  2F33 A;  2JPT A;  3VGO A;  3EK4 A;  2FJU B;  3DVM A;  1J55 A;  1FBV A;  2P70 A;  2M97 A;  2KI6 D;  1W7I B;  1SYM A;  1U5I B;  1MXL C;  1XVJ A;  1IH0 A;  2LM5 A;  1J7O A;  1OOG A;  1TRF A;  4NDC A;  2K2F A;  2WCK A;  2ZRS A;  3CZ1 A;  3UNW A;  2E30 A;  1XFW O;  1B8R A;  3HCM A;  1B7T Y;  5DKR A;  5DKQ A;  3EVR A;  4INW A;  4PHM A;  2CCM A;  4CPV A;  5D69 A;  1XFV O;  3A4U B;  1IIO A;  1IQ5 A;  2BNX A;  3BFB A;  1KQM C;  2F3Y A;  1BMO A;  1CDL A;  3NSO A;  3OBV A;  3D78 A;  2YGU A;  5PAL A;  3PN7 B;  1K95 A;  3QME A;  1ODB A;  1WDC B;  1ZAC A;  1BU3 A;  3FE6 A;  1OSA A;  1EJ3 A;  4INX A;  3CTN A;  2MAZ A;  1SK6 D;  2HET A;  3PN7 C;  1K90 D;  2Y1M A;  1OQP A;  1S26 D;  3F45 A;  1EG4 A;  4NQG A;  2WCJ A;  4QJ5 B;  2BL0 B;  2K7D A;  4WQ3 A;  5ER5 A;  2WC6 A;  3I5G C;  5I2O A;  2BCA A;  1XA5 A;  2QEB A;  2KPH A;  2Q91 A;  1C07 A;  1MHO A;  5HLO A;  3E3R A;  2LHI A;  4FQO A;  3SG2 A;  2TN4 A;  2BL0 C;  4GGN A;  2GGM A;  4R1E A;  1SSE B;  3L47 A;  4N5X A;  4JD9 A;  4OV2 A;  5EL2 A;  3O78 A;  1TTX A;  1ZFS A;  1LIN A;  2AUC A;  3BJH A;  1SL8 A;  2M7L A;  1CFC A;  1SY9 A;  1CMG A;  1TNX A;  3H4S E;  1QX2 A;  5CSN A;  1YVL A;  2JXC A;  4GAO A;  4JQ0 D;  2BKH B;  1NX1 A;  4OZD A;  1NCZ A;  4GBA A;  1NIW A;  3S0E A;  2WCH A;  3BOW B;  1Y1X A;  4MLW A;  4YI9 A;  3S0G A;  3FWC A;  3NSI A;  2LAN A;  2O60 A;  1UHJ A;  1EXR A;  1DJI A;  2Y1N A;  2L51 A;  3DZT A;  3SS3 A;  1QV1 A;  1IJ5 A;  4Q04 A;  1CDM A;  2CTN A;  2ZKM X;  3CR5 X;  2JOJ A;  1BLQ A;  4PHK A;  3ICB A;  1KFX L;  2BKI B;  2JNF A;  1K93 D;  2EC6 B;  1OOI X;  2PSR A;  3I5I B;  2AAO A;  1VRK A;  4IJ7 A;  1YR5 A;  1JFJ A;  4YGB B;  2V53 A;  1JBA A;  2EHB A;  2L5X B;  1J7P A;  2M9G A;  2PQL A;  3D0Y A;  1DVI A;  2ZN8 A;  3BFA A;  1JF2 A;  4JKT A;  1DT7 B;  1N65 A;  4GGF C;  2EC6 C;  1Y6W A;  3ZNI A;  1ZOT B;  1BOD A;  5ER4 X;  2M49 B;  3IVT A;  4PAL A;  3RM1 A;  4F7F A;  1IJ6 A;  1F4O A;  2K7B A;  4PDZ A;  1M39 A;  1RRO A;  3OB2 B;  1F8H A;  2COL B;  4CFQ A;  1KSO A;  5HKW A;  1SCM B;  1GGZ A;  4GGF A;  3TS5 B;  1GGW A;  1YRU B;  2KLE A;  3EG5 B;  2KQ6 A;  2LMT A;  3KO0 A;  3NHT A;  1R6P A;  3CWG A;  4HRH A;  4GUK A;  1NX2 A;  1WRL A;  1CLM A;  1F70 A;  1OE9 B;  4PE0 A;  5HLV A;  1SCM C;  2JT0 A;  1UHK A;  1DJW A;  2B1U A;  1J1D A;  1BG1 A;  4U8D A;  3BFH A;  1F55 A;  2P71 A;  1NUB A;  3DXL A;  2QEV A;  1XO5 A;  4OCI A;  1B47 A;  5AFP A;  2LAP A;  2L98 A;  3WNX B;  1QS7 A;  3S0D A;  2WC8 A;  1S6J A;  1UHH A;  5GQQ C;  1TCF A;  2NCO A;  1QLS A;  1CMF A;  2PAL A;  4MVF A;  1F71 A;  3CS1 A;  4CID A; 
#chains in the Genus database with same CATH homology
 1QX5 B;  2LP2 A;  3AAK A;  1QJT A;  4MSP A;  2LVJ A;  1KCY A;  1AP4 A;  1DGV A;  1K9U A;  1S6C A;  1UUR A;  4MEW A;  2CNP A;  5CSF A;  2K61 A;  3SIB A;  1QTX A;  3FIA A;  1QIW A;  3CR2 A;  1OMR A;  2KAY A;  3LK0 A;  1OMD A;  1IRJ A;  1QAS A;  4WQ2 A;  1NX0 A;  1YX7 A;  1SL7 A;  2ZND A;  1DJZ A;  3DVK A;  3RLZ A;  2JTT A;  2SAS A;  1UHI A;  1MUX A;  3GK1 A;  2LMV A;  2WCF A;  2F2P A;  5KTY A;  3ZWH A;  1MQ1 A;  2ZRT A;  2M8U A;  4GNK B;  2KFG A;  3SJS A;  1SW8 A;  2M0R A;  3LLE A;  1XK4 C;  2PRU A;  2I2R E;  2NCP A;  1J7R A;  2NLN A;  4PE1 A;  4ZCU A;  1KQM B;  3IQO A;  4I5N B;  3EKH A;  3PM8 A;  1OMV A;  1Q80 A;  3JVT B;  3VRO A;  1L7Z A;  2FCE A;  3DD4 A;  3OHM B;  4GFT A;  1TNP A;  2HQ8 A;  1CDN A;  1XK4 A;  4FTG A;  1G33 A;  2GV5 A;  4NDD A;  2PMY A;  4N1F A;  4E68 A;  1SRA A;  2KGB C;  5TNC A;  1K2H A;  1GJY A;  4YGE B;  3JVT C;  2WOR A;  4HSZ A;  1MXE A;  3FS7 A;  5I8N A;  3I5G B;  1KFX S;  2KGR A;  2WCB A;  3KEV A;  4PE4 A;  4P2Y B;  1S6I A;  1H8B A;  1EL4 A;  1HQV A;  3SG4 A;  2M3W A;  2NZ0 A;  5HYD A;  2F8P A;  1KK8 C;  1AVS A;  5HKY A;  1L2O C;  1NSH A;  3GK4 X;  1JSA A;  4BY5 A;  3PSR A;  1FI5 A;  1S3P A;  2LV7 A;  3OX5 A;  1A4P A;  2L2E A;  1W7J B;  2KI6 C;  1DMO A;  3C1V A;  4DCK A;  1YUU A;  1F54 A;  1Y1U A;  4MRX A;  4HRG A;  4WRI A;  3TUY C;  2WOS A;  5HKZ A;  4CFR A;  1WLZ A;  1KFU S;  5IBW A;  1JC2 A;  3LK1 A;  3QRX A;  1D1O A;  2M1K B;  1CM1 A;  1GQM A;  1N0Y A;  2BBM A;  2M29 A;  4F0Z B;  1MWN A;  2K7O A;  4I5K A;  5CPV A;  4PCW A;  1TN4 A;  1A75 A;  3D0Y B;  3NXA A;  1V1F A;  5I2L A;  4XYN A;  3KF9 A;  2KAV A;  2KAX A;  3O2P A;  1R2U A;  1AHR A;  1UHN A;  4UPG A;  3I5F C;  1B9A A;  1NPQ A;  2RGI A;  1SR6 C;  3TDU A;  1LKJ A;  1M31 A;  3OP0 A;  1YX8 A;  2LMU A;  1QVI Z;  2Y5I A;  1TCO B;  3GK2 A;  4QJ4 B;  1C7W A;  2LHL A;  3PLF B;  4I5L B;  1QV0 A;  2D8N A;  2MRD A;  2JQ6 A;  4A4C A;  4C0L A;  1BF5 A;  1M63 B;  2JZI A;  4ZCV A;  2KFH A;  3BXK A;  2K2A A;  1BR4 B;  3HX4 A;  2LUX A;  2ZNE A;  5AER A;  1QLK A;  4ORB B;  2MLF C;  3IQQ A;  4MBE A;  1CLL A;  4DRW A;  2KQY A;  3EVU A;  1CB1 A;  1MF8 B;  3SG5 A;  1PVB A;  2BE4 A;  3D10 A;  1KFU L;  2KYC A;  2GGZ A;  2BBN A;  2CT9 A;  2KBM A;  3OB1 B;  3CGA A;  1LA0 A;  2LC5 A;  1CFP A;  1K94 A;  2JRF A;  1JF0 A;  4IL1 A;  1RFJ A;  3CR4 X;  4YBH B;  4XJK A;  3NSL A;  1NP8 A;  1X02 A;  2M1U A;  3CLN A;  1HT9 A;  2ISD A;  1TNW A;  4YGC B;  1SKT A;  3WXA A;  1CFD A;  1PK0 D;  2OTG B;  2Y4Q A;  1XYD A;  4OR9 B;  4ORC B;  3VRN A;  4MRY A;  1TIZ A;  2OS8 C;  3M0W A;  2BCX A;  4AOM A;  1J1E A;  1RK9 A;  4YRU A;  2KBI A;  2OTG C;  3PAL A;  4D1E A;  5KU1 A;  2G9B A;  5JOL A;  2L4I A;  5JJG A;  5G08 A;  1FPW A;  2KYF A;  2BCB A;  1WRZ A;  5AEQ A;  2O5G A;  2AMI A;  4DUQ A;  3TDI A;  5BPJ A;  3K21 A;  2JC2 A;  4QJ3 B;  1DF0 A;  3EK8 A;  4MZK A;  2LLS A;  1BT6 A;  3I5H C;  2EGD A;  2F3Z A;  2LE9 B;  3O6B A;  4ICB A;  4P5O E;  2KI4 B;  5CSI A;  1SL9 A;  1C7V A;  1SBJ A;  1PUL A;  2FCD A;  4CLN A;  1TOP A;  4I5J A;  3PAT A;  1K96 A;  2FOT A;  2HF5 A;  1F4Q A;  4M2Q A;  1CTR A;  1PSB A;  2JT8 A;  2KI4 C;  1SMG A;  1YUS A;  1AK8 A;  3A8R A;  5I2Q A;  2MLE C;  3OX6 A;  1QIV A;  1YTZ C;  1PAL A;  3VRQ A;  2MJW B;  2KDH A;  2LVK A;  4YGA A;  1ZMZ A;  2VRG A;  5F6T A;  2P6B B;  2A4J A;  1NCY A;  2JXL A;  1OZO A;  4MZJ A;  4GPL B;  2H61 C;  1CDP A;  2K7C A;  1YVH A;  2LLU A;  2I94 A;  2JUL A;  2LVV A;  1KSM A;  1PVA A;  4OKH A;  3FWB A;  1B7T Z;  2ZFD A;  5AXI A;  3LCP C;  5CSJ A;  1KK8 B;  2WND A;  1L2O B;  4DS7 A;  3EK7 A;  1PRW A;  2QAC A;  1OOJ A;  1YRT B;  1MR8 A;  2H61 A;  1SCV A;  2WCE A;  5B8I B;  2LUC A;  1EH2 A;  1AUI B;  1U5I A;  4OVN F;  4AQI A;  3BUO B;  1DJH A;  1Y0V H;  1A75 B;  2G2B A;  4N1G A;  3TUY B;  1QXP A;  1B8C A;  1J7Q A;  1EG3 A;  1A03 A;  1KK7 Z;  2M7N A;  1XFU O;  4USL A;  2BEC A;  3BQ3 A;  3VRP A;  5KSZ A;  3TDZ A;  1KK7 Y;  1KWO B;  1WDC C;  4MN0 A;  2K8M B;  4A4B A;  2I7A A;  1ZUZ A;  4PE7 A;  2K0J A;  5J3X A;  1LVC D;  1RJV A;  2I18 A;  2ZN9 A;  1S36 A;  2PAS A;  3I5F B;  1ALV A;  1KQV A;  2R2I A;  4C0J A;  1KWO C;  1K9K A;  1SR6 B;  2JNX A;  1ALW A;  1Y1A A;  3BUM B;  1B4C A;  1RWY A;  4M2O A;  1IKU A;  1FI6 A;  2OPO A;  5D7F A;  4TNC A;  1B1G A;  1BOC A;  2QPT A;  2HPS A;  3BUX B;  3EVV A;  3GOF A;  1AJ4 A;  2MBX A;  2E6W A;  1V1G A;  1B8L A;  3DVJ A;  1FF1 A;  1REC A;  5DKN A;  4ORA B;  1JWD A;  1XFY O;  1G4Y R;  2JWW A;  2CBL A;  2L0P A;  2L4H A;  1RTP 1;  1QVI Y;  1QX7 A;  2DOQ A;  4PHN A;  4MZL A;  3JTD B;  1DJX A;  4L9M A;  1JUO A;  3PFV A;  4NDB A;  3WHU B;  1CKK A;  3NSK A;  2JTZ A;  3KPX A;  1JFK A;  4YGD B;  1H4B A;  1DJG A;  1IGV A;  4XJK B;  3IF7 A;  3DVE A;  3JTD C;  3KHE A;  2LNK A;  1DTL A;  2H2K A;  2JU0 A;  4PHJ A;  2SCP A;  4ETO A;  1IWQ A;  1SNL A;  1FW4 A;  3LL8 B;  3BUN B;  2Q4U A;  2KFF A;  4DIR A;  1UP5 A;  2CXJ A;  1E8A A;  3VRR A;  1DJY A;  1WLM A;  2NXQ A;  5AAN A;  2KHN A;  4YI8 A;  4C0K A;  4AQJ A;  1BR1 B;  2HQW A;  3BOW A;  1NWD A;  1WRK A;  1YUT A;  3CZT X;  2LCP A;  3AAJ A;  1A29 A;  1NX3 A;  3AKB A;  1UUS A;  1OZS A;  2OS8 B;  3I5I C;  1CM4 A;  1K9P A;  4JPZ B;  2BE6 A;  3AKA A;  1YUR A;  4M2P A;  1CNP A;  2JT3 A;  1LA3 A;  5FYX A;  1DF0 B;  2LLT A;  4HRE E;  3MSE B;  3SG6 A;  3EKJ A;  1XFX O;  4BY4 A;  2KNE A;  2KSP A;  3O4Y A;  1N2D A;  2MA2 A;  1CLB A;  3TZ1 A;  1S1E A;  1M45 A;  1G8I A;  3DF0 B;  1A2X A;  1XFZ O;  2PVB A;  1CFF A;  3WHT B;  3SG7 A;  1SPY A;  3BUW B;  3I5H B;  1AJ5 A;  1NCX A;  3TS5 C;  5K89 A;  1DGU A;  1LXF C;  2F2O A;  3BYA A;  1QAT A;  2KOT A;  1BJF A;  4JWQ A;  3SG3 A;  1PSR A;  1S5G Z;  1TNQ A;  1IQ3 A;  1WY9 A;  3SIA A;  3DF0 A;  2L50 A;  2LP3 A;  2IS9 A;  1S5G Y;  1M46 A;  2LVI A;  2MHH A;  1UWO A;  1K8U A;  1NYA A;  1IG5 A;  2F33 A;  2JPT A;  3VGO A;  3EK4 A;  2FJU B;  3DVM A;  1J55 A;  1FBV A;  2M97 A;  2KI6 D;  1W7I B;  1SYM A;  1U5I B;  1MXL C;  1XVJ A;  1IH0 A;  2LM5 A;  1J7O A;  1TRF A;  4NDC A;  2K2F A;  2ZRS A;  2E30 A;  1XFW O;  1B8R A;  3HCM A;  1B7T Y;  5DKR A;  5DKQ A;  3EVR A;  4PHM A;  2CCM A;  4CPV A;  5D69 A;  1XFV O;  3A4U B;  1IQ5 A;  1KQM C;  2F3Y A;  1BMO A;  1CDL A;  3NSO A;  5PAL A;  3PN7 B;  1K95 A;  1ODB A;  1WDC B;  1ZAC A;  1BU3 A;  1OSA A;  1EJ3 A;  3CTN A;  2MAZ A;  1SK6 D;  2HET A;  3PN7 C;  1K90 D;  2Y1M A;  1OQP A;  1S26 D;  3F45 A;  1EG4 A;  4NQG A;  4QJ5 B;  2BL0 B;  2K7D A;  4WQ3 A;  5ER5 A;  3I5G C;  5I2O A;  2BCA A;  1XA5 A;  2Q91 A;  1C07 A;  1MHO A;  5HLO A;  3E3R A;  2LHI A;  4FQO A;  3SG2 A;  2TN4 A;  2BL0 C;  4GGN A;  2GGM A;  4R1E A;  4N5X A;  4OV2 A;  3O78 A;  1TTX A;  1ZFS A;  1LIN A;  2AUC A;  1SL8 A;  2M7L A;  1CFC A;  1SY9 A;  1CMG A;  1TNX A;  3H4S E;  1QX2 A;  5CSN A;  1YVL A;  2JXC A;  4GAO A;  4JQ0 D;  2BKH B;  1NX1 A;  1NCZ A;  4GBA A;  1NIW A;  3BOW B;  1Y1X A;  4MLW A;  4YI9 A;  3FWC A;  3NSI A;  2LAN A;  2O60 A;  1UHJ A;  1EXR A;  1DJI A;  2Y1N A;  2L51 A;  1QV1 A;  1IJ5 A;  4Q04 A;  1CDM A;  2CTN A;  2ZKM X;  3CR5 X;  2JOJ A;  1BLQ A;  4PHK A;  3ICB A;  1KFX L;  2BKI B;  2JNF A;  1K93 D;  2EC6 B;  2PSR A;  3I5I B;  2AAO A;  1VRK A;  1JFJ A;  1YR5 A;  4YGB B;  2V53 A;  1JBA A;  2EHB A;  2L5X B;  1J7P A;  2M9G A;  3D0Y A;  1DVI A;  2ZN8 A;  1DT7 B;  1JF2 A;  1N65 A;  4GGF C;  2EC6 C;  1Y6W A;  3ZNI A;  1ZOT B;  1BOD A;  5ER4 X;  2M49 B;  4PAL A;  3RM1 A;  1IJ6 A;  1F4O A;  2K7B A;  4PDZ A;  1M39 A;  1RRO A;  3OB2 B;  1F8H A;  2COL B;  4CFQ A;  1KSO A;  5HKW A;  1SCM B;  1GGZ A;  4GGF A;  3TS5 B;  1GGW A;  1YRU B;  2KQ6 A;  2LMT A;  3KO0 A;  1R6P A;  3CWG A;  4HRH A;  4GUK A;  1NX2 A;  1WRL A;  1CLM A;  1F70 A;  1OE9 B;  4PE0 A;  5HLV A;  1SCM C;  2JT0 A;  1UHK A;  1DJW A;  2B1U A;  1J1D A;  1BG1 A;  4U8D A;  1F55 A;  1NUB A;  1XO5 A;  4OCI A;  1B47 A;  5AFP A;  2LAP A;  2L98 A;  3WNX B;  1QS7 A;  2WC8 A;  1S6J A;  1UHH A;  5GQQ C;  1TCF A;  2NCO A;  1QLS A;  1CMF A;  2PAL A;  4MVF A;  1F71 A;  3CS1 A;  4CID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...