2MJWB

Structural insights into calcium bound s100p - v domain of the receptor for advanced glycation end products (rage) complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/metal binding protein
molecule keywords Advanced glycosylation end product-specific receptor
publication title Structural insights into calcium-bound S100P and the V domain of the RAGE complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mjwB00
4DRWA 3O2PA 1C07A 2LP2A 5HKWA 1H8BA 2R2IA 2LVVA 1AK8A 1LA3A 3AKBA 1YX8A 1K93D 1N2DA 1OQPA 2K2AA 1BU3A 3CZTX 4PHJA 2LAPA 5D69A 2KI4B 1G4YR 1DGUA 4M2PA 3ZWHA 2M29A 1TIZA 2NXQA 1N65A 2WOSA 1NX3A 5AANA 1QVIY 4PE0A 1BG1A 4YGCB 5I8NA 1NX2A 1AJ5A 2FCEA 2H61C 2K2FA 2PMYA 1F70A 3O6BA 1KK8C 2WNDA 3KPXA 5G08A 3FS7A 1DJGA 1CDNA 1BJFA 1Y1AA 4XJKB 1FPWA 1M45A 2LLUA 3DF0B 3EVRA 2A4JA 1XK4A 2K61A 1WLMA 1XFXO 1K94A 1SNLA 1EL4A 1KK7Z 3JVTC 1IQ3A 1PVAA 1FW4A 2Q91A 3AAKA 3JVTB 3FWBA 3SG4A 1SL7A 1TRFA 4CPVA 3DVMA 2LLTA 1DTLA 3WXAA 1QIVA 1KWOB 4P5OE 1K95A 1ZACA 2JT8A 3F45A 1NYAA 1JF2A 1A75A 3D10A 2LHLA 1TNQA 3C1VA 2KNEA 3CTNA 2ZNEA 1GGZA 2BCAA 1CFDA 4A4CA 4MN0A 2KDHA 2LE9B 2WC8A 1RWYA 1TTXA 4CFQA 1AP4A 4YBHB 2KHNA 3O78A 1CM4A 1AVSA 1BR4B 1XA5A 2I2RE 5DKNA 4GGNA 2B1UA 2KSPA 1RECA 4ETOA 1ZFSA 3SG7A 4YGDB 1OMRA 1AHRA 1U5IA 1MQ1A 4UPGA 2KGRA 3MSEB 2OS8C 3BYAA 1UUSA 1YRTB 1UURA 1B9AA 2HETA 1KFXS 1CLMA 1CLBA 2PALA 2MBXA 3CR2A 1WDCB 3CS1A 3HCMA 3LLEA 3AAJA 1M63B 3A4UB 2Y4QA 1PVBA 1D1OA 1IRJA 2HPSA 4N1GA 4I5JA 1CKKA 1NCXA 1L7ZA 4JPZB 2M1KB 2KAXA 4F0ZB 2WCEA 2K7OA 4QJ5B 3IF7A 2FJUB 1JC2A 2M97A 1F55A 5HKZA 1XFVO 1KQVA 1QX5B 2H61A 1HT9A 1FI6A 1MXLC 4PHMA 2L5XB 1B8RA 4JWQA 2LMVA 1A29A 4PALA 4GBAA 5AERA 2K0JA 1SK6D 1JWDA 4XJKA 2M8UA 1OMDA 3FIAA 4PE1A 4E68A 1OSAA 2VRGA 2LM5A 4YGBB 1QATA 2BECA 2BCXA 3IQQA 4PHNA 1A03A 2KOTA 2GGMA 1PALA 1A75B 1S5GY 3WHTB 1B7TY 1QS7A 1SKTA 3GOFA 1ALWA 3FWCA 1B8LA 3OX6A 5D7FA 4XYNA 1KSOA 1F4QA 1WRZA 5HYDA 5I2OA 1A4PA 4FTGA 2AUCA 2WCFA 1J1EA 1IGVA 1S26D 2EGDA 1S36A 2PVBA 1XO5A 2WORA 2I94A 2H2KA 1XFZO 2JT0A 1K96A 1XYDA 2AMIA 3CR4X 2JNFA 1GGWA 3PALA 4GPLB 1JFJA 1IH0A 5CSNA 1CMGA 1BODA 1CTRA 2MLFC 1CFCA 2JOJA 4WRIA 2L51A 1OMVA 5CSFA 4CLNA 1J55A 4GFTA 2NLNA 2HQ8A 5AXIA 1CB1A 1OOJA 3SIAA 1R6PA 1RROA 2JT3A 5I2LA 1PULA 4HREE 4NDBA 4PDZA 1IJ5A 1CFFA 2M49B 2LLSA 3M0WA 4GGFC 5DKRA 3SIBA 1XFUO 1PSBA 1CNPA 2FOTA 1TNPA 2LMTA 2NZ0A 3WHUB 4AQIA 1GJYA 3BUXB 3VRNA 4MZJA 4PE4A 3GK2A 3TUYC 1EJ3A 1KK8B 3LK0A 3TUYB 1RFJA 1JF0A 1UP5A 1S6CA 2K7BA 3BUMB 4HRHA 3TZ1A 1QASA 1TNXA 3EK4A 3NSIA 2Y1MA 2CXJA 1YVHA 1LVCD 2LC5A 4ORCB 1LXFC 2F3YA 1DMOA 2CTNA 2CCMA 5FYXA 5CPVA 1N0YA 3LCPC 1S1EA 4U8DA 4MVFA 1RJVA 2JZIA 1C7VA 2COLB 3BUOB 1H4BA 2LANA 1BLQA 1SMGA 2EHBA 3EVUA 4HSZA 1KCYA 1W7IB 1YUUA 1QV1A 2Q4UA 4A4BA 5CSIA 2MRDA 2KI6C 3QRXA 2ZFDA 1DJIA 4DIRA 2LP3A 1WY9A 2NCOA 2P6BB 2ZRTA 1W7JB 3I5FC 5F6TA 1NCYA 3I5FB 3KHEA 1Y0VH 1PSRA 1DT7B 2OS8B 2M7LA 2KQYA 1JBAA 2BCBA 4ORAB 1BT6A 2JC2A 2L50A 1SRAA 3BOWB 1ZOTB 2KQ6A 1B4CA 1DJXA 1KSMA 4OR9B 1NWDA 2KAYA 4NQGA 2KBIA 2KFHA 5JJGA 1PK0D 1RTP1 3I5IC 4MRYA 3ICBA 3I5IB 1GQMA 2ZN8A 3HX4A 4C0KA 1S6IA 1MF8B 1XFYO 4C0JA 2MA2A 3PATA 2G9BA 1QLKA 2M7NA 4MEWA 1TCOB 3E3RA 2CNPA 1NP8A 1WRLA 4GGFA 4MRXA 4AOMA 2JULA 2AAOA 3JTDC 1SL8A 3JTDB 1SR6C 2SCPA 2OTGC 2PRUA 1MXEA 1SR6B 2ZNDA 2OTGB 2BE6A 4BY5A 1KK7Y 3GK1A 1SCVA 4OCIA 1YX7A 3NSLA 1JUOA 2JQ6A 2LVIA 3KF9A 1SL9A 2OPOA 1QVIZ 1SW8A 2JTTA 1OZSA 3DVJA 2L4HA 4I5NB 3TDZA 5KSZA 2PASA 3KO0A 2LNKA 3VRRA 1F54A 1YURA 3K21A 3GK4X 3BUWB 2K8MB 1CM1A 3CWGA 1J7OA 1Y1UA 2F33A 2G2BA 2V53A 4MSPA 1FBVA 2JRFA 3EK7A 3LL8B 4D1EA 3TS5C 2MHHA 5CSJA 5HLOA 1J1DA 1K90D 3TS5B 4IL1A 3OB2B 1QTXA 4OVNF 1Y1XA 2Y5IA 1ALVA 1CDPA 2LVKA 1BF5A 1AUIB 3EK8A 4WQ3A 2LCPA 3KEVA 3TDIA 1X02A 1CDMA 4C0LA 1V1GA 4OKHA 1R2UA 3VRQA 4I5LB 1G8IA 2L4IA 1E8AA 1NPQA 2DOQA 1MWNA 2LHIA 4I5KA 1DF0A 3EKHA 1J7QA 1UHNA 3SG6A 3PFVA 3D0YA 1M39A 4MBEA 1S6JA 2KYFA 4AQJA 1M31A 3BOWA 4CIDA 2ZRSA 1B1GA 3VGOA 1YRUB 4NDCA 2RGIA 1HQVA 2ZN9A 3H4SE 5JOLA 2JXCA 2BBMA 5ER5A 1B8CA 2L0PA 4ORBB 3SG5A 1BMOA 1Q80A 2CBLA 2JWWA 1L2OC 1SBJA 1WLZA 2JNXA 2K7CA 1L2OB 2KFFA 1YVLA 1XVJA 1XFWO 3BQ3A 1C7WA 1JSAA 2KI4C 1F8HA 2LV7A 4YRUA 2JXLA 1BOCA 2CT9A 3BXKA 2BE4A 1SYMA 2GV5A 1UWOA 2KAVA 1A2XA 3DVEA 3IQOA 1YR5A 2BKIB 1NSHA 5KTYA 4BY4A 1CMFA 4P2YB 2BL0C 4N5XA 2BL0B 2KGBC 2ZKMX 2F3ZA 2E30A 2HF5A 4MLWA 2BBNA 1IJ6A 1QX7A 3BUNB 4QJ4B 1DJYA 2O60A 1QIWA 1DJZA 4GNKB 3NSKA 3I5HC 2K7DA 4ZCVA 1OE9B 1UHHA 3I5HB 1QV0A 5BPJA 1K9UA 4USLA 1YUTA 2MJWB 2LUCA 3DVKA 1UHIA 5AFPA 3A8RA 4HRGA 5IBWA 2I7AA 3NXAA 1CLLA 1DVIA 1EXRA 3CGAA 1B47A 1FF1A 3EVVA 5K89A 2KFGA 1KWOC 1S5GZ 2PSRA 3EKJA 5DKQA 1B7TZ 1TOPA 2HQWA 2O5GA 1DGVA 1CDLA 2QPTA 1YTZC 2Y1NA 1DF0B 5J3XA 3OHMB 1FI5A 3D0YB 2E6WA 2BKHB 3OX5A 1QLSA 5I2QA 1EH2A 4FQOA 1TNWA 4M2QA 4ICBA 1ODBA 1IKUA 4YGEB 1PRWA 2FCDA 4L9MA 4TNCA 3VRPA 5B8IB 1LKJA 1TCFA 2LUXA 2LVJA 3VROA 4M2OA 1K9PA 1NIWA 3AKAA 4Q04A 3OB1B 1OZOA 2KYCA 5PALA 4N1FA 2ISDA 1DJHA 3OP0A 4GAOA 2MAZA 2F2OA 1SCMC 2IS9A 1SCMB 1WRKA 1QXPA 2M1UA 3I5GC 1LINA 1WDCC 2WCBA 3I5GB 3SG3A 4DCKA 1MHOA 1IWQA 1JFKA 3PLFB 1J7PA 1G33A 3DD4A 1YUSA 4PCWA 3RM1A 1KFXL 4PHKA 1SY9A 2I18A 1RK9A 5ER4X 1NX1A 1AJ4A 3SJSA 1CFPA 1BR1B 1EG3A 4YGAA 2F2PA 4GUKA 4YI9A 5AEQA 2EC6C 3LK1A 2EC6B 1DJWA 1KFUS 2F8PA 4JQ0D 3SG2A 2L2EA 1ZUZA 1NCZA 1Y6WA 1XK4C 3WNXB 2QACA 5TNCA 1KFUL 3TDUA 1J7RA 1M46A 3RLZA 2M9GA 3PN7C 3PN7B 2L98A 2JPTA 1K9KA 1ZMZA 1S3PA 4WQ2A 2JTZA 1VRKA 1UHJA 2TN4A 1K8UA 3DF0A 1EG4A 2JU0A 3O4YA 4CFRA 4PE7A 1IQ5A 1KQMC 1KQMB 4ZCUA 2M3WA 5GQQC 4MZKA 1MUXA 3CLNA 4DS7A 5HKYA 1QJTA 1TN4A 2SASA 2KI6D 2MLEC 5HLVA 2D8NA 3PSRA 1K2HA 3NSOA 1SPYA 2NCPA 4R1EA 4YI8A 5KU1A 1LA0A 3CR5X 3PM8A 4DUQA 2LMUA 3ZNIA 1F4OA 4NDDA 1UHKA 2GGZA 2KBMA 4OV2A 4QJ3B 1U5IB 1IG5A 2M0RA 1F71A 4MZLA 1NUBA 1MR8A 1V1FA 1QX2A 1NX0A
chains in the Genus database with same CATH superfamily
4DRWA 3O2PA 1C07A 2LP2A 5HKWA 1H8BA 2R2IA 2LVVA 1AK8A 1LA3A 3CZ0A 3AKBA 1YX8A 1K93D 1N2DA 1OQPA 2K2AA 1BU3A 3CZTX 4PHJA 2LAPA 5D69A 3BFAA 2KI4B 1G4YR 1DGUA 2WCJA 3B6XA 4M2PA 2M29A 3ZWHA 1TIZA 2NXQA 1N65A 2WOSA 1NX3A 3S0FA 5AANA 1QVIY 4PE0A 1BG1A 4YGCB 5I8NA 1NX2A 4INWA 3VB1A 1AJ5A 2FCEA 2H61C 2K2FA 2GTEA 2PMYA 1F70A 3O6BA 1KK8C 2WNDA 3KPXA 5G08A 3FS7A 1DJGA 3D78A 1CDNA 1BJFA 1Y1AA 4XJKB 1FPWA 1M45A 2LLUA 3DF0B 3EVRA 2A4JA 1XK4A 2K61A 1OOHA 1WLMA 3CZ1A 1XFXO 1K94A 1SNLA 1EL4A 1KK7Z 1OW4A 3JVTC 1IQ3A 3SS3A 1PVAA 1FW4A 2Q91A 3AAKA 3JVTB 3FWBA 3SG4A 1SL7A 1TRFA 4CPVA 3DVMA 2LLTA 1DTLA 3WXAA 1QIVA 1KWOB 2KPHA 1TUZA 1K95A 3D74A 1ZACA 2JT8A 3F45A 4P5OE 1NYAA 1JF2A 1A75A 3D10A 2LHLA 1TNQA 3C1VA 2KNEA 3CTNA 2ZNEA 1GGZA 2BCAA 1CFDA 4A4CA 4MN0A 2KDHA 2LE9B 2WC8A 1RWYA 1TTXA 4CFQA 1AP4A 4INXA 4YBHB 2KHNA 3O78A 1CM4A 1AVSA 1BR4B 1XA5A 2I2RE 5DKNA 4GGNA 2B1UA 2KSPA 1RECA 4ETOA 1ZFSA 3SG7A 4YGDB 2QEOA 3QMEA 1OMRA 3FE8A 1AHRA 1U5IA 1MQ1A 4UPGA 2KGRA 3MSEB 2OS8C 3BYAA 1UUSA 1YRTB 1UURA 1B9AA 2HETA 3R72A 1KFXS 1CLMA 1CLBA 2PALA 2MBXA 3DY9A 3CR2A 1WDCB 3CS1A 1Z4HA 3HCMA 2BNXA 3LLEA 3AAJA 1M63B 3A4UB 2Y4QA 1PVBA 1D1OA 1IRJA 1T14A 2HPSA 4N1GA 2L2CA 4I5JA 1CKKA 1NCXA 1L7ZA 4JPZB 2M1KB 2KAXA 3R1OA 3DYEA 4F0ZB 2WCEA 3B86A 2K7OA 4QJ5B 3PJIA 3IF7A 2FJUB 3S0AA 2M97A 1JC2A 1F55A 5HKZA 1XFVO 1KQVA 1QX5B 2H61A 1HT9A 1FI6A 1MXLC 4PHMA 2L5XB 1B8RA 4JKTA 4JWQA 2LMVA 1A29A 4PALA 4GBAA 5AERA 2K0JA 1SK6D 1JWDA 4XJKA 2M8UA 1OMDA 3FIAA 4PE1A 4E68A 1OSAA 2VRGA 2LM5A 4YGBB 1QATA 2BCXA 2BECA 3IQQA 4PHNA 1A03A 2KOTA 2GGMA 1PALA 1A75B 1S5GY 3WHTB 1B7TY 1QS7A 1SKTA 3GOFA 1ALWA 3FWCA 1B8LA 3OX6A 5D7FA 3CDNA 1KSOA 4PT1A 1F4QA 4XYNA 1WRZA 5HYDA 5I2OA 1A4PA 4FTGA 2AUCA 2BAPA 2WCFA 1J1EA 1IGVA 1S26D 2EGDA 1S36A 2PVBA 1XO5A 2WORA 2I94A 2H2KA 1XFZO 2JT0A 1K96A 1XYDA 2AMIA 3CR4X 2JNFA 3EG5B 1GGWA 3PALA 4GPLB 1JFJA 1SSEB 1IH0A 5CSNA 1CMGA 1BODA 1CTRA 2MLFC 1DC1A 1CFCA 2JOJA 4WRIA 2L51A 1OMVA 3BFHA 5CSFA 4CLNA 1J55A 4GFTA 2NLNA 3D75A 3SS4A 2HQ8A 5AXIA 1CB1A 1OOJA 3SIAA 1R6PA 1RROA 2JT3A 5I2LA 1PULA 4HREE 4NDBA 4PDZA 1IJ5A 1CFFA 2M49B 2LLSA 2H8VA 3M0WA 4GGFC 5DKRA 3SIBA 1XFUO 1PSBA 1CNPA 2FOTA 1TNPA 2LMTA 2NZ0A 3WHUB 4AQIA 1GJYA 3BUXB 3VRNA 5DICA 1OOIX 4MZJA 3GK2A 4PE4A 3TUYC 1EJ3A 1KK8B 3LK0A 2PYQA 3TUYB 1RFJA 1JF0A 1UP5A 1S6CA 2K7BA 3BUMB 4HRHA 3TZ1A 1ORGA 1QASA 2FJYA 3Q8IA 1TNXA 3EK4A 3NSIA 2Y1MA 2CXJA 1YVHA 1LVCD 2LC5A 4ORCB 1LXFC 2F3YA 1DMOA 2CTNA 2CCMA 5FYXA 5CPVA 1N0YA 3LCPC 1S1EA 3B88A 4U8DA 4MVFA 1RJVA 2JZIA 1C7VA 3BJHA 2COLB 3BUOB 1H4BA 2LANA 1BLQA 1SMGA 2EHBA 3EVUA 4HSZA 1KCYA 1W7IB 1YUUA 1QV1A 3S0BA 2Q4UA 4A4BA 3L4LA 3V2LA 2K60A 5CSIA 2MRDA 2KI6C 2WCKA 3QRXA 4IJ7A 2ZFDA 1DJIA 4DIRA 2LP3A 5FI7A 1WY9A 2NCOA 2P6BB 2ZRTA 3S0DA 1W7JB 3D76A 3I5FC 5F6TA 3UNWA 1NCYA 3I5FB 3KHEA 1Y0VH 1PSRA 1DT7B 3PM2A 2OS8B 2M7LA 2KQYA 1JBAA 2BCBA 4ORAB 1BT6A 2JC2A 2L50A 3O4XA 1SRAA 3CZ2A 3BOWB 1ZOTB 2KQ6A 1B4CA 1DJXA 1KSMA 4OR9B 3S0GA 1NWDA 2KAYA 2WCMA 4NQGA 2KBIA 2KFHA 2WCHA 5JJGA 1PK0D 2WC6A 2QEBA 1RTP1 2WCLA 3CABA 3I5IC 4MRYA 3ICBA 3I5IB 2KLDA 5HL1A 1GQMA 3OBVA 2ZN8A 3HX4A 4C0KA 1S6IA 1MF8B 1XFYO 4C0JA 3D73A 1DQEA 2MA2A 3PATA 2G9BA 1QLKA 2M7NA 4MEWA 1TCOB 3E3RA 2CNPA 1NP8A 1WRLA 4GGFA 4MRXA 4AOMA 2QDIA 2JULA 2AAOA 3JTDC 1SL8A 3JTDB 1SR6C 2SCPA 2OTGC 2PRUA 1MXEA 1SR6B 2ZNDA 2OTGB 2BE6A 3FE6A 4BY5A 1KK7Y 3GK1A 1SCVA 4OCIA 1YX7A 3NSLA 1IIOA 1JUOA 2JQ6A 2LVIA 1DELA 3KF9A 1SL9A 2OPOA 1QVIZ 5I94A 1SW8A 2JTTA 1OZSA 3DVJA 2L4HA 4I5NB 3TDZA 5KSZA 2PASA 3KO0A 2LNKA 3VRRA 1F54A 1YURA 2YGUA 3K21A 3GK4X 3BUWB 2K8MB 1CM1A 3CWGA 1J7OA 4KYNA 1C3ZA 1Y1UA 2F33A 2G2BA 1QWVA 2V53A 4MSPA 1FBVA 2JRFA 3EK7A 3LL8B 3DZTA 4D1EA 3L4AA 3TS5C 2MHHA 5CSJA 5HLOA 1J1DA 1K90D 3TS5B 4IL1A 3OB2B 1QTXA 4OVNF 3UO9A 1Y1XA 2Y5IA 1ALVA 1CDPA 2JPOA 2LVKA 1BF5A 1AUIB 3EK8A 4WQ3A 2LCPA 3KEVA 3TDIA 1X02A 1CDMA 3L47A 4C0LA 5EL2A 1V1GA 4OKHA 1R2UA 3VRQA 4I5LB 1G8IA 2L4IA 1E8AA 1NPQA 2DOQA 2QEHA 1MWNA 2LHIA 4I5KA 1DF0A 3EKHA 1J7QA 1UHNA 3SG6A 3PFVA 3NHTA 3D0YA 1M39A 4MBEA 1S6JA 2KYFA 3OGNA 4AQJA 1M31A 3BOWA 4CIDA 3N7HA 2ZRSA 1B1GA 3VGOA 1YRUB 3DXLA 4NDCA 2RGIA 1HQVA 2ZN9A 3H4SE 3K1EA 5JOLA 4F7FA 2JXCA 2BBMA 3IVTA 5ER5A 1B8CA 2L0PA 4ORBB 3SG5A 1BMOA 1Q80A 2CBLA 2JWWA 1L2OC 1SBJA 1WLZA 2JNXA 2K7CA 1L2OB 1Z2CB 3D77A 2KFFA 1YVLA 2L5YA 1XVJA 1XFWO 3R1VA 3BQ3A 1C7WA 1JSAA 2KI4C 1F8HA 1GM0A 2LV7A 4YRUA 2JXLA 3BFBA 2CT9A 1BOCA 3BXKA 2BE4A 1SYMA 2GV5A 1UWOA 2KAVA 1A2XA 3DVEA 3IQOA 1YR5A 2BKIB 1NSHA 5KTYA 4BY4A 1CMFA 3B7AA 4P2YB 2BL0C 4N5XA 2BL0B 3SS5A 2KGBC 3FE9A 2ZKMX 2F3ZA 2E30A 3RZSA 2KLEA 2HF5A 4MLWA 2BBNA 1IJ6A 1QX7A 3B87A 3BUNB 4QJ4B 1DJYA 1OOGA 1QIWA 1DJZA 2O60A 4GNKB 3NSKA 3I5HC 2K7DA 4ZCVA 1OE9B 1UHHA 3I5HB 1QV0A 5BPJA 1K9UA 4USLA 1YUTA 2MJWB 2LUCA 3DVKA 1UHIA 5AFPA 5FI2A 3A8RA 4HRGA 5IBWA 1OOFA 2I7AA 3NXAA 1CLLA 1DVIA 1DEKA 1EXRA 3CGAA 1B47A 1FF1A 3EVVA 5K89A 2KFGA 1KWOC 1S5GZ 2PSRA 3EKJA 1C3YA 5DKQA 1B7TZ 1TOPA 2HQWA 2O5GA 1DGVA 1CDLA 2QPTA 1YTZC 2Y1NA 1DF0B 5J3XA 3OHMB 1FI5A 3D0YB 2E6WA 2BKHB 4FQTA 3OX5A 1QLSA 5FI6A 5I2QA 2PQLA 1W9ZA 1EH2A 4FQOA 1TNWA 4M2QA 4ICBA 1ODBA 1IKUA 4YGEB 1PRWA 2FCDA 4L9MA 4TNCA 3VRPA 5B8IB 1LKJA 1TCFA 1XFRA 2LVJA 2LUXA 4M2OA 1K9PA 1NIWA 3AKAA 1P28A 4Q04A 3VROA 3OB1B 1OZOA 2KYCA 4JD9A 4N1FA 5PALA 2ISDA 1LS8A 1DJHA 3OP0A 4GAOA 2MAZA 2F2OA 1SCMC 3NGVA 2IS9A 1SCMB 1WRKA 1QXPA 2M1UA 3I5GC 1LINA 1WDCC 2WCBA 3I5GB 3SG3A 4DCKA 1MHOA 1IWQA 1JFKA 3PLFB 1J7PA 1G33A 3DD4A 1YUSA 4PCWA 3RM1A 1KFXL 4PHKA 1SY9A 3S0EA 2I18A 1RK9A 5ER4X 1NX1A 1AJ4A 3SJSA 1CFPA 1BR1B 1EG3A 4YGAA 2F2PA 4GUKA 4YI9A 5AEQA 2EC6C 3LK1A 2EC6B 1DJWA 1KFUS 2F8PA 4JQ0D 3SG2A 2L2EA 1ZUZA 1NCZA 1Y6WA 1XK4C 3WNXB 2QACA 5TNCA 1KFUL 3TDUA 1J7RA 1M46A 3RLZA 2M9GA 3PN7C 2QEVA 2L98A 3PN7B 2JPTA 1K9KA 1ZMZA 1S3PA 4WQ2A 2JTZA 1VRKA 1UHJA 2TN4A 1K8UA 3DF0A 1EG4A 2JU0A 3CYZA 3O4YA 4CFRA 2P70A 1IQ5A 4PE7A 1KQMC 1KQMB 4OZDA 1TUJA 2M3WA 4ZCUA 5GQQC 4MZKA 1MUXA 3CLNA 4DS7A 5HKYA 1QJTA 1TN4A 2SASA 2KI6D 2MLEC 5HLVA 2D8NA 3PSRA 1K2HA 3NSOA 1SPYA 3R1PA 2ERBA 2NCPA 4R1EA 4YI8A 5KU1A 1LA0A 3CR5X 3NHIA 3PM8A 4DUQA 2LMUA 3ZNIA 1TWOA 1F4OA 4NDDA 5D3OA 1UHKA 2GGZA 2P71A 2KBMA 4OV2A 4QJ3B 1U5IB 1IG5A 2M0RA 2WC5A 4MZLA 1F71A 1NUBA 1MR8A 1V1FA 1QX2A 1NX0A
chains in the Genus database with same CATH topology
4DRWA 3O2PA 1C07A 2LP2A 5HKWA 1H8BA 2R2IA 2LVVA 1AK8A 1LA3A 3AKBA 1YX8A 1K93D 1N2DA 1OQPA 2K2AA 1BU3A 3CZTX 4PHJA 2LAPA 5D69A 2KI4B 1G4YR 1DGUA 4M2PA 3ZWHA 2M29A 1TIZA 2NXQA 1N65A 2WOSA 1NX3A 5AANA 1QVIY 4PE0A 1BG1A 4YGCB 5I8NA 1NX2A 1AJ5A 2FCEA 2H61C 2K2FA 2PMYA 1F70A 3O6BA 1KK8C 2WNDA 3KPXA 5G08A 3FS7A 1DJGA 1CDNA 1BJFA 1Y1AA 4XJKB 1FPWA 1M45A 2LLUA 3DF0B 3EVRA 2A4JA 1XK4A 2K61A 1WLMA 1XFXO 1K94A 1SNLA 1EL4A 1KK7Z 3JVTC 1IQ3A 1PVAA 1FW4A 2Q91A 3AAKA 3JVTB 3FWBA 3SG4A 1SL7A 1TRFA 4CPVA 3DVMA 2LLTA 1DTLA 3WXAA 1QIVA 1KWOB 4P5OE 1K95A 1ZACA 2JT8A 3F45A 1NYAA 1JF2A 1A75A 3D10A 2LHLA 1TNQA 3C1VA 2KNEA 3CTNA 2ZNEA 1GGZA 2BCAA 1CFDA 4A4CA 4MN0A 2KDHA 2LE9B 2WC8A 1RWYA 1TTXA 4CFQA 1AP4A 4YBHB 2KHNA 3O78A 1CM4A 1AVSA 1BR4B 1XA5A 2I2RE 5DKNA 4GGNA 2B1UA 2KSPA 1RECA 4ETOA 1ZFSA 3SG7A 4YGDB 1OMRA 1AHRA 1U5IA 1MQ1A 4UPGA 2KGRA 3MSEB 2OS8C 3BYAA 1UUSA 1YRTB 1UURA 1B9AA 2HETA 1KFXS 1CLMA 1CLBA 2PALA 2MBXA 3CR2A 1WDCB 3CS1A 3HCMA 3LLEA 3AAJA 1M63B 3A4UB 2Y4QA 1PVBA 1D1OA 1IRJA 2HPSA 4N1GA 4I5JA 1CKKA 1NCXA 1L7ZA 4JPZB 2M1KB 2KAXA 4F0ZB 2WCEA 2K7OA 4QJ5B 3IF7A 2FJUB 1JC2A 2M97A 1F55A 5HKZA 1XFVO 1KQVA 1QX5B 2H61A 1HT9A 1FI6A 1MXLC 4PHMA 2L5XB 1B8RA 4JWQA 2LMVA 1A29A 4PALA 4GBAA 5AERA 2K0JA 1SK6D 1JWDA 4XJKA 2M8UA 1OMDA 3FIAA 4PE1A 4E68A 1OSAA 2VRGA 2LM5A 4YGBB 1QATA 2BECA 2BCXA 3IQQA 4PHNA 1A03A 2KOTA 2GGMA 1PALA 1A75B 1S5GY 3WHTB 1B7TY 1QS7A 1SKTA 3GOFA 1ALWA 3FWCA 1B8LA 3OX6A 5D7FA 4XYNA 1KSOA 1F4QA 1WRZA 5HYDA 5I2OA 1A4PA 4FTGA 2AUCA 2WCFA 1J1EA 1IGVA 1S26D 2EGDA 1S36A 2PVBA 1XO5A 2WORA 2I94A 2H2KA 1XFZO 2JT0A 1K96A 1XYDA 2AMIA 3CR4X 2JNFA 1GGWA 3PALA 4GPLB 1JFJA 1IH0A 5CSNA 1CMGA 1BODA 1CTRA 2MLFC 1CFCA 2JOJA 4WRIA 2L51A 1OMVA 5CSFA 4CLNA 1J55A 4GFTA 2NLNA 2HQ8A 5AXIA 1CB1A 1OOJA 3SIAA 1R6PA 1RROA 2JT3A 5I2LA 1PULA 4HREE 4NDBA 4PDZA 1IJ5A 1CFFA 2M49B 2LLSA 3M0WA 4GGFC 5DKRA 3SIBA 1XFUO 1PSBA 1CNPA 2FOTA 1TNPA 2LMTA 2NZ0A 3WHUB 4AQIA 1GJYA 3BUXB 3VRNA 4MZJA 4PE4A 3GK2A 3TUYC 1EJ3A 1KK8B 3LK0A 3TUYB 1RFJA 1JF0A 1UP5A 1S6CA 2K7BA 3BUMB 4HRHA 3TZ1A 1QASA 1TNXA 3EK4A 3NSIA 2Y1MA 2CXJA 1YVHA 1LVCD 2LC5A 4ORCB 1LXFC 2F3YA 1DMOA 2CTNA 2CCMA 5FYXA 5CPVA 1N0YA 3LCPC 1S1EA 4U8DA 4MVFA 1RJVA 2JZIA 1C7VA 2COLB 3BUOB 1H4BA 2LANA 1BLQA 1SMGA 2EHBA 3EVUA 4HSZA 1KCYA 1W7IB 1YUUA 1QV1A 2Q4UA 4A4BA 5CSIA 2MRDA 2KI6C 3QRXA 2ZFDA 1DJIA 4DIRA 2LP3A 1WY9A 2NCOA 2P6BB 2ZRTA 1W7JB 3I5FC 5F6TA 1NCYA 3I5FB 3KHEA 1Y0VH 1PSRA 1DT7B 2OS8B 2M7LA 2KQYA 1JBAA 2BCBA 4ORAB 1BT6A 2JC2A 2L50A 1SRAA 3BOWB 1ZOTB 2KQ6A 1B4CA 1DJXA 1KSMA 4OR9B 1NWDA 2KAYA 4NQGA 2KBIA 2KFHA 5JJGA 1PK0D 1RTP1 3I5IC 4MRYA 3ICBA 3I5IB 1GQMA 2ZN8A 3HX4A 4C0KA 1S6IA 1MF8B 1XFYO 4C0JA 2MA2A 3PATA 2G9BA 1QLKA 2M7NA 4MEWA 1TCOB 3E3RA 2CNPA 1NP8A 1WRLA 4GGFA 4MRXA 4AOMA 2JULA 2AAOA 3JTDC 1SL8A 3JTDB 1SR6C 2SCPA 2OTGC 2PRUA 1MXEA 1SR6B 2ZNDA 2OTGB 2BE6A 4BY5A 1KK7Y 3GK1A 1SCVA 4OCIA 1YX7A 3NSLA 1JUOA 2JQ6A 2LVIA 3KF9A 1SL9A 2OPOA 1QVIZ 1SW8A 2JTTA 1OZSA 3DVJA 2L4HA 4I5NB 3TDZA 5KSZA 2PASA 3KO0A 2LNKA 3VRRA 1F54A 1YURA 3K21A 3GK4X 3BUWB 2K8MB 1CM1A 3CWGA 1J7OA 1Y1UA 2F33A 2G2BA 2V53A 4MSPA 1FBVA 2JRFA 3EK7A 3LL8B 4D1EA 3TS5C 2MHHA 5CSJA 5HLOA 1J1DA 1K90D 3TS5B 4IL1A 3OB2B 1QTXA 4OVNF 1Y1XA 2Y5IA 1ALVA 1CDPA 2LVKA 1BF5A 1AUIB 3EK8A 4WQ3A 2LCPA 3KEVA 3TDIA 1X02A 1CDMA 4C0LA 1V1GA 4OKHA 1R2UA 3VRQA 4I5LB 1G8IA 2L4IA 1E8AA 1NPQA 2DOQA 1MWNA 2LHIA 4I5KA 1DF0A 3EKHA 1J7QA 1UHNA 3SG6A 3PFVA 3D0YA 1M39A 4MBEA 1S6JA 2KYFA 4AQJA 1M31A 3BOWA 4CIDA 2ZRSA 1B1GA 3VGOA 1YRUB 4NDCA 2RGIA 1HQVA 2ZN9A 3H4SE 5JOLA 2JXCA 2BBMA 5ER5A 1B8CA 2L0PA 4ORBB 3SG5A 1BMOA 1Q80A 2CBLA 2JWWA 1L2OC 1SBJA 1WLZA 2JNXA 2K7CA 1L2OB 2KFFA 1YVLA 1XVJA 1XFWO 3BQ3A 1C7WA 1JSAA 2KI4C 1F8HA 2LV7A 4YRUA 2JXLA 1BOCA 2CT9A 3BXKA 2BE4A 1SYMA 2GV5A 1UWOA 2KAVA 1A2XA 3DVEA 3IQOA 1YR5A 2BKIB 1NSHA 5KTYA 4BY4A 1CMFA 4P2YB 2BL0C 4N5XA 2BL0B 2KGBC 2ZKMX 2F3ZA 2E30A 2HF5A 4MLWA 2BBNA 1IJ6A 1QX7A 3BUNB 4QJ4B 1DJYA 2O60A 1QIWA 1DJZA 4GNKB 3NSKA 3I5HC 2K7DA 4ZCVA 1OE9B 1UHHA 3I5HB 1QV0A 5BPJA 1K9UA 4USLA 1YUTA 2MJWB 2LUCA 3DVKA 1UHIA 5AFPA 3A8RA 4HRGA 5IBWA 2I7AA 3NXAA 1CLLA 1DVIA 1EXRA 3CGAA 1B47A 1FF1A 3EVVA 5K89A 2KFGA 1KWOC 1S5GZ 2PSRA 3EKJA 5DKQA 1B7TZ 1TOPA 2HQWA 2O5GA 1DGVA 1CDLA 2QPTA 1YTZC 2Y1NA 1DF0B 5J3XA 3OHMB 1FI5A 3D0YB 2E6WA 2BKHB 3OX5A 1QLSA 5I2QA 1EH2A 4FQOA 1TNWA 4M2QA 4ICBA 1ODBA 1IKUA 4YGEB 1PRWA 2FCDA 4L9MA 4TNCA 3VRPA 5B8IB 1LKJA 1TCFA 2LUXA 2LVJA 3VROA 4M2OA 1K9PA 1NIWA 3AKAA 4Q04A 3OB1B 1OZOA 2KYCA 5PALA 4N1FA 2ISDA 1DJHA 3OP0A 4GAOA 2MAZA 2F2OA 1SCMC 2IS9A 1SCMB 1WRKA 1QXPA 2M1UA 3I5GC 1LINA 1WDCC 2WCBA 3I5GB 3SG3A 4DCKA 1MHOA 1IWQA 1JFKA 3PLFB 1J7PA 1G33A 3DD4A 1YUSA 4PCWA 3RM1A 1KFXL 4PHKA 1SY9A 2I18A 1RK9A 5ER4X 1NX1A 1AJ4A 3SJSA 1CFPA 1BR1B 1EG3A 4YGAA 2F2PA 4GUKA 4YI9A 5AEQA 2EC6C 3LK1A 2EC6B 1DJWA 1KFUS 2F8PA 4JQ0D 3SG2A 2L2EA 1ZUZA 1NCZA 1Y6WA 1XK4C 3WNXB 2QACA 5TNCA 1KFUL 3TDUA 1J7RA 1M46A 3RLZA 2M9GA 3PN7C 3PN7B 2L98A 2JPTA 1K9KA 1ZMZA 1S3PA 4WQ2A 2JTZA 1VRKA 1UHJA 2TN4A 1K8UA 3DF0A 1EG4A 2JU0A 3O4YA 4CFRA 4PE7A 1IQ5A 1KQMC 1KQMB 4ZCUA 2M3WA 5GQQC 4MZKA 1MUXA 3CLNA 4DS7A 5HKYA 1QJTA 1TN4A 2SASA 2KI6D 2MLEC 5HLVA 2D8NA 3PSRA 1K2HA 3NSOA 1SPYA 2NCPA 4R1EA 4YI8A 5KU1A 1LA0A 3CR5X 3PM8A 4DUQA 2LMUA 3ZNIA 1F4OA 4NDDA 1UHKA 2GGZA 2KBMA 4OV2A 4QJ3B 1U5IB 1IG5A 2M0RA 1F71A 4MZLA 1NUBA 1MR8A 1V1FA 1QX2A 1NX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRW A;  3O2P A;  1C07 A;  2LP2 A;  5HKW A;  1H8B A;  2R2I A;  2LVV A;  1AK8 A;  1LA3 A;  3AKB A;  1YX8 A;  1K93 D;  1N2D A;  1OQP A;  2K2A A;  1BU3 A;  3CZT X;  4PHJ A;  2LAP A;  5D69 A;  2KI4 B;  1G4Y R;  1DGU A;  4M2P A;  3ZWH A;  2M29 A;  1TIZ A;  2NXQ A;  1N65 A;  2WOS A;  1NX3 A;  5AAN A;  1QVI Y;  4PE0 A;  1BG1 A;  4YGC B;  5I8N A;  1NX2 A;  1AJ5 A;  2FCE A;  2H61 C;  2K2F A;  2PMY A;  1F70 A;  3O6B A;  1KK8 C;  2WND A;  3KPX A;  5G08 A;  3FS7 A;  1DJG A;  1CDN A;  1BJF A;  1Y1A A;  4XJK B;  1FPW A;  1M45 A;  2LLU A;  3DF0 B;  3EVR A;  2A4J A;  1XK4 A;  2K61 A;  1WLM A;  1XFX O;  1K94 A;  1SNL A;  1EL4 A;  1KK7 Z;  3JVT C;  1IQ3 A;  1PVA A;  1FW4 A;  2Q91 A;  3AAK A;  3JVT B;  3FWB A;  3SG4 A;  1SL7 A;  1TRF A;  4CPV A;  3DVM A;  2LLT A;  1DTL A;  3WXA A;  1QIV A;  1KWO B;  4P5O E;  1K95 A;  1ZAC A;  2JT8 A;  3F45 A;  1NYA A;  1JF2 A;  1A75 A;  3D10 A;  2LHL A;  1TNQ A;  3C1V A;  2KNE A;  3CTN A;  2ZNE A;  1GGZ A;  2BCA A;  1CFD A;  4A4C A;  4MN0 A;  2KDH A;  2LE9 B;  2WC8 A;  1RWY A;  1TTX A;  4CFQ A;  1AP4 A;  4YBH B;  2KHN A;  3O78 A;  1CM4 A;  1AVS A;  1BR4 B;  1XA5 A;  2I2R E;  5DKN A;  4GGN A;  2B1U A;  2KSP A;  1REC A;  4ETO A;  1ZFS A;  3SG7 A;  4YGD B;  1OMR A;  1AHR A;  1U5I A;  1MQ1 A;  4UPG A;  2KGR A;  3MSE B;  2OS8 C;  3BYA A;  1UUS A;  1YRT B;  1UUR A;  1B9A A;  2HET A;  1KFX S;  1CLM A;  1CLB A;  2PAL A;  2MBX A;  3CR2 A;  1WDC B;  3CS1 A;  3HCM A;  3LLE A;  3AAJ A;  1M63 B;  3A4U B;  2Y4Q A;  1PVB A;  1D1O A;  1IRJ A;  2HPS A;  4N1G A;  4I5J A;  1CKK A;  1NCX A;  1L7Z A;  4JPZ B;  2M1K B;  2KAX A;  4F0Z B;  2WCE A;  2K7O A;  4QJ5 B;  3IF7 A;  2FJU B;  1JC2 A;  2M97 A;  1F55 A;  5HKZ A;  1XFV O;  1KQV A;  1QX5 B;  2H61 A;  1HT9 A;  1FI6 A;  1MXL C;  4PHM A;  2L5X B;  1B8R A;  4JWQ A;  2LMV A;  1A29 A;  4PAL A;  4GBA A;  5AER A;  2K0J A;  1SK6 D;  1JWD A;  4XJK A;  2M8U A;  1OMD A;  3FIA A;  4PE1 A;  4E68 A;  1OSA A;  2VRG A;  2LM5 A;  4YGB B;  1QAT A;  2BEC A;  2BCX A;  3IQQ A;  4PHN A;  1A03 A;  2KOT A;  2GGM A;  1PAL A;  1A75 B;  1S5G Y;  3WHT B;  1B7T Y;  1QS7 A;  1SKT A;  3GOF A;  1ALW A;  3FWC A;  1B8L A;  3OX6 A;  5D7F A;  4XYN A;  1KSO A;  1F4Q A;  1WRZ A;  5HYD A;  5I2O A;  1A4P A;  4FTG A;  2AUC A;  2WCF A;  1J1E A;  1IGV A;  1S26 D;  2EGD A;  1S36 A;  2PVB A;  1XO5 A;  2WOR A;  2I94 A;  2H2K A;  1XFZ O;  2JT0 A;  1K96 A;  1XYD A;  2AMI A;  3CR4 X;  2JNF A;  1GGW A;  3PAL A;  4GPL B;  1JFJ A;  1IH0 A;  5CSN A;  1CMG A;  1BOD A;  1CTR A;  2MLF C;  1CFC A;  2JOJ A;  4WRI A;  2L51 A;  1OMV A;  5CSF A;  4CLN A;  1J55 A;  4GFT A;  2NLN A;  2HQ8 A;  5AXI A;  1CB1 A;  1OOJ A;  3SIA A;  1R6P A;  1RRO A;  2JT3 A;  5I2L A;  1PUL A;  4HRE E;  4NDB A;  4PDZ A;  1IJ5 A;  1CFF A;  2M49 B;  2LLS A;  3M0W A;  4GGF C;  5DKR A;  3SIB A;  1XFU O;  1PSB A;  1CNP A;  2FOT A;  1TNP A;  2LMT A;  2NZ0 A;  3WHU B;  4AQI A;  1GJY A;  3BUX B;  3VRN A;  4MZJ A;  4PE4 A;  3GK2 A;  3TUY C;  1EJ3 A;  1KK8 B;  3LK0 A;  3TUY B;  1RFJ A;  1JF0 A;  1UP5 A;  1S6C A;  2K7B A;  3BUM B;  4HRH A;  3TZ1 A;  1QAS A;  1TNX A;  3EK4 A;  3NSI A;  2Y1M A;  2CXJ A;  1YVH A;  1LVC D;  2LC5 A;  4ORC B;  1LXF C;  2F3Y A;  1DMO A;  2CTN A;  2CCM A;  5FYX A;  5CPV A;  1N0Y A;  3LCP C;  1S1E A;  4U8D A;  4MVF A;  1RJV A;  2JZI A;  1C7V A;  2COL B;  3BUO B;  1H4B A;  2LAN A;  1BLQ A;  1SMG A;  2EHB A;  3EVU A;  4HSZ A;  1KCY A;  1W7I B;  1YUU A;  1QV1 A;  2Q4U A;  4A4B A;  5CSI A;  2MRD A;  2KI6 C;  3QRX A;  2ZFD A;  1DJI A;  4DIR A;  2LP3 A;  1WY9 A;  2NCO A;  2P6B B;  2ZRT A;  1W7J B;  3I5F C;  5F6T A;  1NCY A;  3I5F B;  3KHE A;  1Y0V H;  1PSR A;  1DT7 B;  2OS8 B;  2M7L A;  2KQY A;  1JBA A;  2BCB A;  4ORA B;  1BT6 A;  2JC2 A;  2L50 A;  1SRA A;  3BOW B;  1ZOT B;  2KQ6 A;  1B4C A;  1DJX A;  1KSM A;  4OR9 B;  1NWD A;  2KAY A;  4NQG A;  2KBI A;  2KFH A;  5JJG A;  1PK0 D;  1RTP 1;  3I5I C;  4MRY A;  3ICB A;  3I5I B;  1GQM A;  2ZN8 A;  3HX4 A;  4C0K A;  1S6I A;  1MF8 B;  1XFY O;  4C0J A;  2MA2 A;  3PAT A;  2G9B A;  1QLK A;  2M7N A;  4MEW A;  1TCO B;  3E3R A;  2CNP A;  1NP8 A;  1WRL A;  4GGF A;  4MRX A;  4AOM A;  2JUL A;  2AAO A;  3JTD C;  1SL8 A;  3JTD B;  1SR6 C;  2SCP A;  2OTG C;  2PRU A;  1MXE A;  1SR6 B;  2ZND A;  2OTG B;  2BE6 A;  4BY5 A;  1KK7 Y;  3GK1 A;  1SCV A;  4OCI A;  1YX7 A;  3NSL A;  1JUO A;  2JQ6 A;  2LVI A;  3KF9 A;  1SL9 A;  2OPO A;  1QVI Z;  1SW8 A;  2JTT A;  1OZS A;  3DVJ A;  2L4H A;  4I5N B;  3TDZ A;  5KSZ A;  2PAS A;  3KO0 A;  2LNK A;  3VRR A;  1F54 A;  1YUR A;  3K21 A;  3GK4 X;  3BUW B;  2K8M B;  1CM1 A;  3CWG A;  1J7O A;  1Y1U A;  2F33 A;  2G2B A;  2V53 A;  4MSP A;  1FBV A;  2JRF A;  3EK7 A;  3LL8 B;  4D1E A;  3TS5 C;  2MHH A;  5CSJ A;  5HLO A;  1J1D A;  1K90 D;  3TS5 B;  4IL1 A;  3OB2 B;  1QTX A;  4OVN F;  1Y1X A;  2Y5I A;  1ALV A;  1CDP A;  2LVK A;  1BF5 A;  1AUI B;  3EK8 A;  4WQ3 A;  2LCP A;  3KEV A;  3TDI A;  1X02 A;  1CDM A;  4C0L A;  1V1G A;  4OKH A;  1R2U A;  3VRQ A;  4I5L B;  1G8I A;  2L4I A;  1E8A A;  1NPQ A;  2DOQ A;  1MWN A;  2LHI A;  4I5K A;  1DF0 A;  3EKH A;  1J7Q A;  1UHN A;  3SG6 A;  3PFV A;  3D0Y A;  1M39 A;  4MBE A;  1S6J A;  2KYF A;  4AQJ A;  1M31 A;  3BOW A;  4CID A;  2ZRS A;  1B1G A;  3VGO A;  1YRU B;  4NDC A;  2RGI A;  1HQV A;  2ZN9 A;  3H4S E;  5JOL A;  2JXC A;  2BBM A;  5ER5 A;  1B8C A;  2L0P A;  4ORB B;  3SG5 A;  1BMO A;  1Q80 A;  2CBL A;  2JWW A;  1L2O C;  1SBJ A;  1WLZ A;  2JNX A;  2K7C A;  1L2O B;  2KFF A;  1YVL A;  1XVJ A;  1XFW O;  3BQ3 A;  1C7W A;  1JSA A;  2KI4 C;  1F8H A;  2LV7 A;  4YRU A;  2JXL A;  1BOC A;  2CT9 A;  3BXK A;  2BE4 A;  1SYM A;  2GV5 A;  1UWO A;  2KAV A;  1A2X A;  3DVE A;  3IQO A;  1YR5 A;  2BKI B;  1NSH A;  5KTY A;  4BY4 A;  1CMF A;  4P2Y B;  2BL0 C;  4N5X A;  2BL0 B;  2KGB C;  2ZKM X;  2F3Z A;  2E30 A;  2HF5 A;  4MLW A;  2BBN A;  1IJ6 A;  1QX7 A;  3BUN B;  4QJ4 B;  1DJY A;  2O60 A;  1QIW A;  1DJZ A;  4GNK B;  3NSK A;  3I5H C;  2K7D A;  4ZCV A;  1OE9 B;  1UHH A;  3I5H B;  1QV0 A;  5BPJ A;  1K9U A;  4USL A;  1YUT A;  2MJW B;  2LUC A;  3DVK A;  1UHI A;  5AFP A;  3A8R A;  4HRG A;  5IBW A;  2I7A A;  3NXA A;  1CLL A;  1DVI A;  1EXR A;  3CGA A;  1B47 A;  1FF1 A;  3EVV A;  5K89 A;  2KFG A;  1KWO C;  1S5G Z;  2PSR A;  3EKJ A;  5DKQ A;  1B7T Z;  1TOP A;  2HQW A;  2O5G A;  1DGV A;  1CDL A;  2QPT A;  1YTZ C;  2Y1N A;  1DF0 B;  5J3X A;  3OHM B;  1FI5 A;  3D0Y B;  2E6W A;  2BKH B;  3OX5 A;  1QLS A;  5I2Q A;  1EH2 A;  4FQO A;  1TNW A;  4M2Q A;  4ICB A;  1ODB A;  1IKU A;  4YGE B;  1PRW A;  2FCD A;  4L9M A;  4TNC A;  3VRP A;  5B8I B;  1LKJ A;  1TCF A;  2LUX A;  2LVJ A;  3VRO A;  4M2O A;  1K9P A;  1NIW A;  3AKA A;  4Q04 A;  3OB1 B;  1OZO A;  2KYC A;  5PAL A;  4N1F A;  2ISD A;  1DJH A;  3OP0 A;  4GAO A;  2MAZ A;  2F2O A;  1SCM C;  2IS9 A;  1SCM B;  1WRK A;  1QXP A;  2M1U A;  3I5G C;  1LIN A;  1WDC C;  2WCB A;  3I5G B;  3SG3 A;  4DCK A;  1MHO A;  1IWQ A;  1JFK A;  3PLF B;  1J7P A;  1G33 A;  3DD4 A;  1YUS A;  4PCW A;  3RM1 A;  1KFX L;  4PHK A;  1SY9 A;  2I18 A;  1RK9 A;  5ER4 X;  1NX1 A;  1AJ4 A;  3SJS A;  1CFP A;  1BR1 B;  1EG3 A;  4YGA A;  2F2P A;  4GUK A;  4YI9 A;  5AEQ A;  2EC6 C;  3LK1 A;  2EC6 B;  1DJW A;  1KFU S;  2F8P A;  4JQ0 D;  3SG2 A;  2L2E A;  1ZUZ A;  1NCZ A;  1Y6W A;  1XK4 C;  3WNX B;  2QAC A;  5TNC A;  1KFU L;  3TDU A;  1J7R A;  1M46 A;  3RLZ A;  2M9G A;  3PN7 C;  3PN7 B;  2L98 A;  2JPT A;  1K9K A;  1ZMZ A;  1S3P A;  4WQ2 A;  2JTZ A;  1VRK A;  1UHJ A;  2TN4 A;  1K8U A;  3DF0 A;  1EG4 A;  2JU0 A;  3O4Y A;  4CFR A;  4PE7 A;  1IQ5 A;  1KQM C;  1KQM B;  4ZCU A;  2M3W A;  5GQQ C;  4MZK A;  1MUX A;  3CLN A;  4DS7 A;  5HKY A;  1QJT A;  1TN4 A;  2SAS A;  2KI6 D;  2MLE C;  5HLV A;  2D8N A;  3PSR A;  1K2H A;  3NSO A;  1SPY A;  2NCP A;  4R1E A;  4YI8 A;  5KU1 A;  1LA0 A;  3CR5 X;  3PM8 A;  4DUQ A;  2LMU A;  3ZNI A;  1F4O A;  4NDD A;  1UHK A;  2GGZ A;  2KBM A;  4OV2 A;  4QJ3 B;  1U5I B;  1IG5 A;  2M0R A;  1F71 A;  4MZL A;  1NUB A;  1MR8 A;  1V1F A;  1QX2 A;  1NX0 A; 
#chains in the Genus database with same CATH topology
 4DRW A;  3O2P A;  1C07 A;  2LP2 A;  5HKW A;  1H8B A;  2R2I A;  2LVV A;  1AK8 A;  1LA3 A;  3CZ0 A;  3AKB A;  1YX8 A;  1K93 D;  1N2D A;  1OQP A;  2K2A A;  1BU3 A;  3CZT X;  4PHJ A;  2LAP A;  5D69 A;  3BFA A;  2KI4 B;  1G4Y R;  1DGU A;  2WCJ A;  3B6X A;  4M2P A;  2M29 A;  3ZWH A;  1TIZ A;  2NXQ A;  1N65 A;  2WOS A;  1NX3 A;  3S0F A;  5AAN A;  1QVI Y;  4PE0 A;  1BG1 A;  4YGC B;  5I8N A;  1NX2 A;  4INW A;  3VB1 A;  1AJ5 A;  2FCE A;  2H61 C;  2K2F A;  2GTE A;  2PMY A;  1F70 A;  3O6B A;  1KK8 C;  2WND A;  3KPX A;  5G08 A;  3FS7 A;  1DJG A;  3D78 A;  1CDN A;  1BJF A;  1Y1A A;  4XJK B;  1FPW A;  1M45 A;  2LLU A;  3DF0 B;  3EVR A;  2A4J A;  1XK4 A;  2K61 A;  1OOH A;  1WLM A;  3CZ1 A;  1XFX O;  1K94 A;  1SNL A;  1EL4 A;  1KK7 Z;  1OW4 A;  3JVT C;  1IQ3 A;  3SS3 A;  1PVA A;  1FW4 A;  2Q91 A;  3AAK A;  3JVT B;  3FWB A;  3SG4 A;  1SL7 A;  1TRF A;  4CPV A;  3DVM A;  2LLT A;  1DTL A;  3WXA A;  1QIV A;  1KWO B;  2KPH A;  1TUZ A;  1K95 A;  3D74 A;  1ZAC A;  2JT8 A;  3F45 A;  4P5O E;  1NYA A;  1JF2 A;  1A75 A;  3D10 A;  2LHL A;  1TNQ A;  3C1V A;  2KNE A;  3CTN A;  2ZNE A;  1GGZ A;  2BCA A;  1CFD A;  4A4C A;  4MN0 A;  2KDH A;  2LE9 B;  2WC8 A;  1RWY A;  1TTX A;  4CFQ A;  1AP4 A;  4INX A;  4YBH B;  2KHN A;  3O78 A;  1CM4 A;  1AVS A;  1BR4 B;  1XA5 A;  2I2R E;  5DKN A;  4GGN A;  2B1U A;  2KSP A;  1REC A;  4ETO A;  1ZFS A;  3SG7 A;  4YGD B;  2QEO A;  3QME A;  1OMR A;  3FE8 A;  1AHR A;  1U5I A;  1MQ1 A;  4UPG A;  2KGR A;  3MSE B;  2OS8 C;  3BYA A;  1UUS A;  1YRT B;  1UUR A;  1B9A A;  2HET A;  3R72 A;  1KFX S;  1CLM A;  1CLB A;  2PAL A;  2MBX A;  3DY9 A;  3CR2 A;  1WDC B;  3CS1 A;  1Z4H A;  3HCM A;  2BNX A;  3LLE A;  3AAJ A;  1M63 B;  3A4U B;  2Y4Q A;  1PVB A;  1D1O A;  1IRJ A;  1T14 A;  2HPS A;  4N1G A;  2L2C A;  4I5J A;  1CKK A;  1NCX A;  1L7Z A;  4JPZ B;  2M1K B;  2KAX A;  3R1O A;  3DYE A;  4F0Z B;  2WCE A;  3B86 A;  2K7O A;  4QJ5 B;  3PJI A;  3IF7 A;  2FJU B;  3S0A A;  2M97 A;  1JC2 A;  1F55 A;  5HKZ A;  1XFV O;  1KQV A;  1QX5 B;  2H61 A;  1HT9 A;  1FI6 A;  1MXL C;  4PHM A;  2L5X B;  1B8R A;  4JKT A;  4JWQ A;  2LMV A;  1A29 A;  4PAL A;  4GBA A;  5AER A;  2K0J A;  1SK6 D;  1JWD A;  4XJK A;  2M8U A;  1OMD A;  3FIA A;  4PE1 A;  4E68 A;  1OSA A;  2VRG A;  2LM5 A;  4YGB B;  1QAT A;  2BCX A;  2BEC A;  3IQQ A;  4PHN A;  1A03 A;  2KOT A;  2GGM A;  1PAL A;  1A75 B;  1S5G Y;  3WHT B;  1B7T Y;  1QS7 A;  1SKT A;  3GOF A;  1ALW A;  3FWC A;  1B8L A;  3OX6 A;  5D7F A;  3CDN A;  1KSO A;  4PT1 A;  1F4Q A;  4XYN A;  1WRZ A;  5HYD A;  5I2O A;  1A4P A;  4FTG A;  2AUC A;  2BAP A;  2WCF A;  1J1E A;  1IGV A;  1S26 D;  2EGD A;  1S36 A;  2PVB A;  1XO5 A;  2WOR A;  2I94 A;  2H2K A;  1XFZ O;  2JT0 A;  1K96 A;  1XYD A;  2AMI A;  3CR4 X;  2JNF A;  3EG5 B;  1GGW A;  3PAL A;  4GPL B;  1JFJ A;  1SSE B;  1IH0 A;  5CSN A;  1CMG A;  1BOD A;  1CTR A;  2MLF C;  1DC1 A;  1CFC A;  2JOJ A;  4WRI A;  2L51 A;  1OMV A;  3BFH A;  5CSF A;  4CLN A;  1J55 A;  4GFT A;  2NLN A;  3D75 A;  3SS4 A;  2HQ8 A;  5AXI A;  1CB1 A;  1OOJ A;  3SIA A;  1R6P A;  1RRO A;  2JT3 A;  5I2L A;  1PUL A;  4HRE E;  4NDB A;  4PDZ A;  1IJ5 A;  1CFF A;  2M49 B;  2LLS A;  2H8V A;  3M0W A;  4GGF C;  5DKR A;  3SIB A;  1XFU O;  1PSB A;  1CNP A;  2FOT A;  1TNP A;  2LMT A;  2NZ0 A;  3WHU B;  4AQI A;  1GJY A;  3BUX B;  3VRN A;  5DIC A;  1OOI X;  4MZJ A;  3GK2 A;  4PE4 A;  3TUY C;  1EJ3 A;  1KK8 B;  3LK0 A;  2PYQ A;  3TUY B;  1RFJ A;  1JF0 A;  1UP5 A;  1S6C A;  2K7B A;  3BUM B;  4HRH A;  3TZ1 A;  1ORG A;  1QAS A;  2FJY A;  3Q8I A;  1TNX A;  3EK4 A;  3NSI A;  2Y1M A;  2CXJ A;  1YVH A;  1LVC D;  2LC5 A;  4ORC B;  1LXF C;  2F3Y A;  1DMO A;  2CTN A;  2CCM A;  5FYX A;  5CPV A;  1N0Y A;  3LCP C;  1S1E A;  3B88 A;  4U8D A;  4MVF A;  1RJV A;  2JZI A;  1C7V A;  3BJH A;  2COL B;  3BUO B;  1H4B A;  2LAN A;  1BLQ A;  1SMG A;  2EHB A;  3EVU A;  4HSZ A;  1KCY A;  1W7I B;  1YUU A;  1QV1 A;  3S0B A;  2Q4U A;  4A4B A;  3L4L A;  3V2L A;  2K60 A;  5CSI A;  2MRD A;  2KI6 C;  2WCK A;  3QRX A;  4IJ7 A;  2ZFD A;  1DJI A;  4DIR A;  2LP3 A;  5FI7 A;  1WY9 A;  2NCO A;  2P6B B;  2ZRT A;  3S0D A;  1W7J B;  3D76 A;  3I5F C;  5F6T A;  3UNW A;  1NCY A;  3I5F B;  3KHE A;  1Y0V H;  1PSR A;  1DT7 B;  3PM2 A;  2OS8 B;  2M7L A;  2KQY A;  1JBA A;  2BCB A;  4ORA B;  1BT6 A;  2JC2 A;  2L50 A;  3O4X A;  1SRA A;  3CZ2 A;  3BOW B;  1ZOT B;  2KQ6 A;  1B4C A;  1DJX A;  1KSM A;  4OR9 B;  3S0G A;  1NWD A;  2KAY A;  2WCM A;  4NQG A;  2KBI A;  2KFH A;  2WCH A;  5JJG A;  1PK0 D;  2WC6 A;  2QEB A;  1RTP 1;  2WCL A;  3CAB A;  3I5I C;  4MRY A;  3ICB A;  3I5I B;  2KLD A;  5HL1 A;  1GQM A;  3OBV A;  2ZN8 A;  3HX4 A;  4C0K A;  1S6I A;  1MF8 B;  1XFY O;  4C0J A;  3D73 A;  1DQE A;  2MA2 A;  3PAT A;  2G9B A;  1QLK A;  2M7N A;  4MEW A;  1TCO B;  3E3R A;  2CNP A;  1NP8 A;  1WRL A;  4GGF A;  4MRX A;  4AOM A;  2QDI A;  2JUL A;  2AAO A;  3JTD C;  1SL8 A;  3JTD B;  1SR6 C;  2SCP A;  2OTG C;  2PRU A;  1MXE A;  1SR6 B;  2ZND A;  2OTG B;  2BE6 A;  3FE6 A;  4BY5 A;  1KK7 Y;  3GK1 A;  1SCV A;  4OCI A;  1YX7 A;  3NSL A;  1IIO A;  1JUO A;  2JQ6 A;  2LVI A;  1DEL A;  3KF9 A;  1SL9 A;  2OPO A;  1QVI Z;  5I94 A;  1SW8 A;  2JTT A;  1OZS A;  3DVJ A;  2L4H A;  4I5N B;  3TDZ A;  5KSZ A;  2PAS A;  3KO0 A;  2LNK A;  3VRR A;  1F54 A;  1YUR A;  2YGU A;  3K21 A;  3GK4 X;  3BUW B;  2K8M B;  1CM1 A;  3CWG A;  1J7O A;  4KYN A;  1C3Z A;  1Y1U A;  2F33 A;  2G2B A;  1QWV A;  2V53 A;  4MSP A;  1FBV A;  2JRF A;  3EK7 A;  3LL8 B;  3DZT A;  4D1E A;  3L4A A;  3TS5 C;  2MHH A;  5CSJ A;  5HLO A;  1J1D A;  1K90 D;  3TS5 B;  4IL1 A;  3OB2 B;  1QTX A;  4OVN F;  3UO9 A;  1Y1X A;  2Y5I A;  1ALV A;  1CDP A;  2JPO A;  2LVK A;  1BF5 A;  1AUI B;  3EK8 A;  4WQ3 A;  2LCP A;  3KEV A;  3TDI A;  1X02 A;  1CDM A;  3L47 A;  4C0L A;  5EL2 A;  1V1G A;  4OKH A;  1R2U A;  3VRQ A;  4I5L B;  1G8I A;  2L4I A;  1E8A A;  1NPQ A;  2DOQ A;  2QEH A;  1MWN A;  2LHI A;  4I5K A;  1DF0 A;  3EKH A;  1J7Q A;  1UHN A;  3SG6 A;  3PFV A;  3NHT A;  3D0Y A;  1M39 A;  4MBE A;  1S6J A;  2KYF A;  3OGN A;  4AQJ A;  1M31 A;  3BOW A;  4CID A;  3N7H A;  2ZRS A;  1B1G A;  3VGO A;  1YRU B;  3DXL A;  4NDC A;  2RGI A;  1HQV A;  2ZN9 A;  3H4S E;  3K1E A;  5JOL A;  4F7F A;  2JXC A;  2BBM A;  3IVT A;  5ER5 A;  1B8C A;  2L0P A;  4ORB B;  3SG5 A;  1BMO A;  1Q80 A;  2CBL A;  2JWW A;  1L2O C;  1SBJ A;  1WLZ A;  2JNX A;  2K7C A;  1L2O B;  1Z2C B;  3D77 A;  2KFF A;  1YVL A;  2L5Y A;  1XVJ A;  1XFW O;  3R1V A;  3BQ3 A;  1C7W A;  1JSA A;  2KI4 C;  1F8H A;  1GM0 A;  2LV7 A;  4YRU A;  2JXL A;  3BFB A;  2CT9 A;  1BOC A;  3BXK A;  2BE4 A;  1SYM A;  2GV5 A;  1UWO A;  2KAV A;  1A2X A;  3DVE A;  3IQO A;  1YR5 A;  2BKI B;  1NSH A;  5KTY A;  4BY4 A;  1CMF A;  3B7A A;  4P2Y B;  2BL0 C;  4N5X A;  2BL0 B;  3SS5 A;  2KGB C;  3FE9 A;  2ZKM X;  2F3Z A;  2E30 A;  3RZS A;  2KLE A;  2HF5 A;  4MLW A;  2BBN A;  1IJ6 A;  1QX7 A;  3B87 A;  3BUN B;  4QJ4 B;  1DJY A;  1OOG A;  1QIW A;  1DJZ A;  2O60 A;  4GNK B;  3NSK A;  3I5H C;  2K7D A;  4ZCV A;  1OE9 B;  1UHH A;  3I5H B;  1QV0 A;  5BPJ A;  1K9U A;  4USL A;  1YUT A;  2MJW B;  2LUC A;  3DVK A;  1UHI A;  5AFP A;  5FI2 A;  3A8R A;  4HRG A;  5IBW A;  1OOF A;  2I7A A;  3NXA A;  1CLL A;  1DVI A;  1DEK A;  1EXR A;  3CGA A;  1B47 A;  1FF1 A;  3EVV A;  5K89 A;  2KFG A;  1KWO C;  1S5G Z;  2PSR A;  3EKJ A;  1C3Y A;  5DKQ A;  1B7T Z;  1TOP A;  2HQW A;  2O5G A;  1DGV A;  1CDL A;  2QPT A;  1YTZ C;  2Y1N A;  1DF0 B;  5J3X A;  3OHM B;  1FI5 A;  3D0Y B;  2E6W A;  2BKH B;  4FQT A;  3OX5 A;  1QLS A;  5FI6 A;  5I2Q A;  2PQL A;  1W9Z A;  1EH2 A;  4FQO A;  1TNW A;  4M2Q A;  4ICB A;  1ODB A;  1IKU A;  4YGE B;  1PRW A;  2FCD A;  4L9M A;  4TNC A;  3VRP A;  5B8I B;  1LKJ A;  1TCF A;  1XFR A;  2LVJ A;  2LUX A;  4M2O A;  1K9P A;  1NIW A;  3AKA A;  1P28 A;  4Q04 A;  3VRO A;  3OB1 B;  1OZO A;  2KYC A;  4JD9 A;  4N1F A;  5PAL A;  2ISD A;  1LS8 A;  1DJH A;  3OP0 A;  4GAO A;  2MAZ A;  2F2O A;  1SCM C;  3NGV A;  2IS9 A;  1SCM B;  1WRK A;  1QXP A;  2M1U A;  3I5G C;  1LIN A;  1WDC C;  2WCB A;  3I5G B;  3SG3 A;  4DCK A;  1MHO A;  1IWQ A;  1JFK A;  3PLF B;  1J7P A;  1G33 A;  3DD4 A;  1YUS A;  4PCW A;  3RM1 A;  1KFX L;  4PHK A;  1SY9 A;  3S0E A;  2I18 A;  1RK9 A;  5ER4 X;  1NX1 A;  1AJ4 A;  3SJS A;  1CFP A;  1BR1 B;  1EG3 A;  4YGA A;  2F2P A;  4GUK A;  4YI9 A;  5AEQ A;  2EC6 C;  3LK1 A;  2EC6 B;  1DJW A;  1KFU S;  2F8P A;  4JQ0 D;  3SG2 A;  2L2E A;  1ZUZ A;  1NCZ A;  1Y6W A;  1XK4 C;  3WNX B;  2QAC A;  5TNC A;  1KFU L;  3TDU A;  1J7R A;  1M46 A;  3RLZ A;  2M9G A;  3PN7 C;  2QEV A;  2L98 A;  3PN7 B;  2JPT A;  1K9K A;  1ZMZ A;  1S3P A;  4WQ2 A;  2JTZ A;  1VRK A;  1UHJ A;  2TN4 A;  1K8U A;  3DF0 A;  1EG4 A;  2JU0 A;  3CYZ A;  3O4Y A;  4CFR A;  2P70 A;  1IQ5 A;  4PE7 A;  1KQM C;  1KQM B;  4OZD A;  1TUJ A;  2M3W A;  4ZCU A;  5GQQ C;  4MZK A;  1MUX A;  3CLN A;  4DS7 A;  5HKY A;  1QJT A;  1TN4 A;  2SAS A;  2KI6 D;  2MLE C;  5HLV A;  2D8N A;  3PSR A;  1K2H A;  3NSO A;  1SPY A;  3R1P A;  2ERB A;  2NCP A;  4R1E A;  4YI8 A;  5KU1 A;  1LA0 A;  3CR5 X;  3NHI A;  3PM8 A;  4DUQ A;  2LMU A;  3ZNI A;  1TWO A;  1F4O A;  4NDD A;  5D3O A;  1UHK A;  2GGZ A;  2P71 A;  2KBM A;  4OV2 A;  4QJ3 B;  1U5I B;  1IG5 A;  2M0R A;  2WC5 A;  4MZL A;  1F71 A;  1NUB A;  1MR8 A;  1V1F A;  1QX2 A;  1NX0 A; 
#chains in the Genus database with same CATH homology
 4DRW A;  3O2P A;  1C07 A;  2LP2 A;  5HKW A;  1H8B A;  2R2I A;  2LVV A;  1AK8 A;  1LA3 A;  3AKB A;  1YX8 A;  1K93 D;  1N2D A;  1OQP A;  2K2A A;  1BU3 A;  3CZT X;  4PHJ A;  2LAP A;  5D69 A;  2KI4 B;  1G4Y R;  1DGU A;  4M2P A;  3ZWH A;  2M29 A;  1TIZ A;  2NXQ A;  1N65 A;  2WOS A;  1NX3 A;  5AAN A;  1QVI Y;  4PE0 A;  1BG1 A;  4YGC B;  5I8N A;  1NX2 A;  1AJ5 A;  2FCE A;  2H61 C;  2K2F A;  2PMY A;  1F70 A;  3O6B A;  1KK8 C;  2WND A;  3KPX A;  5G08 A;  3FS7 A;  1DJG A;  1CDN A;  1BJF A;  1Y1A A;  4XJK B;  1FPW A;  1M45 A;  2LLU A;  3DF0 B;  3EVR A;  2A4J A;  1XK4 A;  2K61 A;  1WLM A;  1XFX O;  1K94 A;  1SNL A;  1EL4 A;  1KK7 Z;  3JVT C;  1IQ3 A;  1PVA A;  1FW4 A;  2Q91 A;  3AAK A;  3JVT B;  3FWB A;  3SG4 A;  1SL7 A;  1TRF A;  4CPV A;  3DVM A;  2LLT A;  1DTL A;  3WXA A;  1QIV A;  1KWO B;  4P5O E;  1K95 A;  1ZAC A;  2JT8 A;  3F45 A;  1NYA A;  1JF2 A;  1A75 A;  3D10 A;  2LHL A;  1TNQ A;  3C1V A;  2KNE A;  3CTN A;  2ZNE A;  1GGZ A;  2BCA A;  1CFD A;  4A4C A;  4MN0 A;  2KDH A;  2LE9 B;  2WC8 A;  1RWY A;  1TTX A;  4CFQ A;  1AP4 A;  4YBH B;  2KHN A;  3O78 A;  1CM4 A;  1AVS A;  1BR4 B;  1XA5 A;  2I2R E;  5DKN A;  4GGN A;  2B1U A;  2KSP A;  1REC A;  4ETO A;  1ZFS A;  3SG7 A;  4YGD B;  1OMR A;  1AHR A;  1U5I A;  1MQ1 A;  4UPG A;  2KGR A;  3MSE B;  2OS8 C;  3BYA A;  1UUS A;  1YRT B;  1UUR A;  1B9A A;  2HET A;  1KFX S;  1CLM A;  1CLB A;  2PAL A;  2MBX A;  3CR2 A;  1WDC B;  3CS1 A;  3HCM A;  3LLE A;  3AAJ A;  1M63 B;  3A4U B;  2Y4Q A;  1PVB A;  1D1O A;  1IRJ A;  2HPS A;  4N1G A;  4I5J A;  1CKK A;  1NCX A;  1L7Z A;  4JPZ B;  2M1K B;  2KAX A;  4F0Z B;  2WCE A;  2K7O A;  4QJ5 B;  3IF7 A;  2FJU B;  1JC2 A;  2M97 A;  1F55 A;  5HKZ A;  1XFV O;  1KQV A;  1QX5 B;  2H61 A;  1HT9 A;  1FI6 A;  1MXL C;  4PHM A;  2L5X B;  1B8R A;  4JWQ A;  2LMV A;  1A29 A;  4PAL A;  4GBA A;  5AER A;  2K0J A;  1SK6 D;  1JWD A;  4XJK A;  2M8U A;  1OMD A;  3FIA A;  4PE1 A;  4E68 A;  1OSA A;  2VRG A;  2LM5 A;  4YGB B;  1QAT A;  2BEC A;  2BCX A;  3IQQ A;  4PHN A;  1A03 A;  2KOT A;  2GGM A;  1PAL A;  1A75 B;  1S5G Y;  3WHT B;  1B7T Y;  1QS7 A;  1SKT A;  3GOF A;  1ALW A;  3FWC A;  1B8L A;  3OX6 A;  5D7F A;  4XYN A;  1KSO A;  1F4Q A;  1WRZ A;  5HYD A;  5I2O A;  1A4P A;  4FTG A;  2AUC A;  2WCF A;  1J1E A;  1IGV A;  1S26 D;  2EGD A;  1S36 A;  2PVB A;  1XO5 A;  2WOR A;  2I94 A;  2H2K A;  1XFZ O;  2JT0 A;  1K96 A;  1XYD A;  2AMI A;  3CR4 X;  2JNF A;  1GGW A;  3PAL A;  4GPL B;  1JFJ A;  1IH0 A;  5CSN A;  1CMG A;  1BOD A;  1CTR A;  2MLF C;  1CFC A;  2JOJ A;  4WRI A;  2L51 A;  1OMV A;  5CSF A;  4CLN A;  1J55 A;  4GFT A;  2NLN A;  2HQ8 A;  5AXI A;  1CB1 A;  1OOJ A;  3SIA A;  1R6P A;  1RRO A;  2JT3 A;  5I2L A;  1PUL A;  4HRE E;  4NDB A;  4PDZ A;  1IJ5 A;  1CFF A;  2M49 B;  2LLS A;  3M0W A;  4GGF C;  5DKR A;  3SIB A;  1XFU O;  1PSB A;  1CNP A;  2FOT A;  1TNP A;  2LMT A;  2NZ0 A;  3WHU B;  4AQI A;  1GJY A;  3BUX B;  3VRN A;  4MZJ A;  4PE4 A;  3GK2 A;  3TUY C;  1EJ3 A;  1KK8 B;  3LK0 A;  3TUY B;  1RFJ A;  1JF0 A;  1UP5 A;  1S6C A;  2K7B A;  3BUM B;  4HRH A;  3TZ1 A;  1QAS A;  1TNX A;  3EK4 A;  3NSI A;  2Y1M A;  2CXJ A;  1YVH A;  1LVC D;  2LC5 A;  4ORC B;  1LXF C;  2F3Y A;  1DMO A;  2CTN A;  2CCM A;  5FYX A;  5CPV A;  1N0Y A;  3LCP C;  1S1E A;  4U8D A;  4MVF A;  1RJV A;  2JZI A;  1C7V A;  2COL B;  3BUO B;  1H4B A;  2LAN A;  1BLQ A;  1SMG A;  2EHB A;  3EVU A;  4HSZ A;  1KCY A;  1W7I B;  1YUU A;  1QV1 A;  2Q4U A;  4A4B A;  5CSI A;  2MRD A;  2KI6 C;  3QRX A;  2ZFD A;  1DJI A;  4DIR A;  2LP3 A;  1WY9 A;  2NCO A;  2P6B B;  2ZRT A;  1W7J B;  3I5F C;  5F6T A;  1NCY A;  3I5F B;  3KHE A;  1Y0V H;  1PSR A;  1DT7 B;  2OS8 B;  2M7L A;  2KQY A;  1JBA A;  2BCB A;  4ORA B;  1BT6 A;  2JC2 A;  2L50 A;  1SRA A;  3BOW B;  1ZOT B;  2KQ6 A;  1B4C A;  1DJX A;  1KSM A;  4OR9 B;  1NWD A;  2KAY A;  4NQG A;  2KBI A;  2KFH A;  5JJG A;  1PK0 D;  1RTP 1;  3I5I C;  4MRY A;  3ICB A;  3I5I B;  1GQM A;  2ZN8 A;  3HX4 A;  4C0K A;  1S6I A;  1MF8 B;  1XFY O;  4C0J A;  2MA2 A;  3PAT A;  2G9B A;  1QLK A;  2M7N A;  4MEW A;  1TCO B;  3E3R A;  2CNP A;  1NP8 A;  1WRL A;  4GGF A;  4MRX A;  4AOM A;  2JUL A;  2AAO A;  3JTD C;  1SL8 A;  3JTD B;  1SR6 C;  2SCP A;  2OTG C;  2PRU A;  1MXE A;  1SR6 B;  2ZND A;  2OTG B;  2BE6 A;  4BY5 A;  1KK7 Y;  3GK1 A;  1SCV A;  4OCI A;  1YX7 A;  3NSL A;  1JUO A;  2JQ6 A;  2LVI A;  3KF9 A;  1SL9 A;  2OPO A;  1QVI Z;  1SW8 A;  2JTT A;  1OZS A;  3DVJ A;  2L4H A;  4I5N B;  3TDZ A;  5KSZ A;  2PAS A;  3KO0 A;  2LNK A;  3VRR A;  1F54 A;  1YUR A;  3K21 A;  3GK4 X;  3BUW B;  2K8M B;  1CM1 A;  3CWG A;  1J7O A;  1Y1U A;  2F33 A;  2G2B A;  2V53 A;  4MSP A;  1FBV A;  2JRF A;  3EK7 A;  3LL8 B;  4D1E A;  3TS5 C;  2MHH A;  5CSJ A;  5HLO A;  1J1D A;  1K90 D;  3TS5 B;  4IL1 A;  3OB2 B;  1QTX A;  4OVN F;  1Y1X A;  2Y5I A;  1ALV A;  1CDP A;  2LVK A;  1BF5 A;  1AUI B;  3EK8 A;  4WQ3 A;  2LCP A;  3KEV A;  3TDI A;  1X02 A;  1CDM A;  4C0L A;  1V1G A;  4OKH A;  1R2U A;  3VRQ A;  4I5L B;  1G8I A;  2L4I A;  1E8A A;  1NPQ A;  2DOQ A;  1MWN A;  2LHI A;  4I5K A;  1DF0 A;  3EKH A;  1J7Q A;  1UHN A;  3SG6 A;  3PFV A;  3D0Y A;  1M39 A;  4MBE A;  1S6J A;  2KYF A;  4AQJ A;  1M31 A;  3BOW A;  4CID A;  2ZRS A;  1B1G A;  3VGO A;  1YRU B;  4NDC A;  2RGI A;  1HQV A;  2ZN9 A;  3H4S E;  5JOL A;  2JXC A;  2BBM A;  5ER5 A;  1B8C A;  2L0P A;  4ORB B;  3SG5 A;  1BMO A;  1Q80 A;  2CBL A;  2JWW A;  1L2O C;  1SBJ A;  1WLZ A;  2JNX A;  2K7C A;  1L2O B;  2KFF A;  1YVL A;  1XVJ A;  1XFW O;  3BQ3 A;  1C7W A;  1JSA A;  2KI4 C;  1F8H A;  2LV7 A;  4YRU A;  2JXL A;  1BOC A;  2CT9 A;  3BXK A;  2BE4 A;  1SYM A;  2GV5 A;  1UWO A;  2KAV A;  1A2X A;  3DVE A;  3IQO A;  1YR5 A;  2BKI B;  1NSH A;  5KTY A;  4BY4 A;  1CMF A;  4P2Y B;  2BL0 C;  4N5X A;  2BL0 B;  2KGB C;  2ZKM X;  2F3Z A;  2E30 A;  2HF5 A;  4MLW A;  2BBN A;  1IJ6 A;  1QX7 A;  3BUN B;  4QJ4 B;  1DJY A;  2O60 A;  1QIW A;  1DJZ A;  4GNK B;  3NSK A;  3I5H C;  2K7D A;  4ZCV A;  1OE9 B;  1UHH A;  3I5H B;  1QV0 A;  5BPJ A;  1K9U A;  4USL A;  1YUT A;  2MJW B;  2LUC A;  3DVK A;  1UHI A;  5AFP A;  3A8R A;  4HRG A;  5IBW A;  2I7A A;  3NXA A;  1CLL A;  1DVI A;  1EXR A;  3CGA A;  1B47 A;  1FF1 A;  3EVV A;  5K89 A;  2KFG A;  1KWO C;  1S5G Z;  2PSR A;  3EKJ A;  5DKQ A;  1B7T Z;  1TOP A;  2HQW A;  2O5G A;  1DGV A;  1CDL A;  2QPT A;  1YTZ C;  2Y1N A;  1DF0 B;  5J3X A;  3OHM B;  1FI5 A;  3D0Y B;  2E6W A;  2BKH B;  3OX5 A;  1QLS A;  5I2Q A;  1EH2 A;  4FQO A;  1TNW A;  4M2Q A;  4ICB A;  1ODB A;  1IKU A;  4YGE B;  1PRW A;  2FCD A;  4L9M A;  4TNC A;  3VRP A;  5B8I B;  1LKJ A;  1TCF A;  2LUX A;  2LVJ A;  3VRO A;  4M2O A;  1K9P A;  1NIW A;  3AKA A;  4Q04 A;  3OB1 B;  1OZO A;  2KYC A;  5PAL A;  4N1F A;  2ISD A;  1DJH A;  3OP0 A;  4GAO A;  2MAZ A;  2F2O A;  1SCM C;  2IS9 A;  1SCM B;  1WRK A;  1QXP A;  2M1U A;  3I5G C;  1LIN A;  1WDC C;  2WCB A;  3I5G B;  3SG3 A;  4DCK A;  1MHO A;  1IWQ A;  1JFK A;  3PLF B;  1J7P A;  1G33 A;  3DD4 A;  1YUS A;  4PCW A;  3RM1 A;  1KFX L;  4PHK A;  1SY9 A;  2I18 A;  1RK9 A;  5ER4 X;  1NX1 A;  1AJ4 A;  3SJS A;  1CFP A;  1BR1 B;  1EG3 A;  4YGA A;  2F2P A;  4GUK A;  4YI9 A;  5AEQ A;  2EC6 C;  3LK1 A;  2EC6 B;  1DJW A;  1KFU S;  2F8P A;  4JQ0 D;  3SG2 A;  2L2E A;  1ZUZ A;  1NCZ A;  1Y6W A;  1XK4 C;  3WNX B;  2QAC A;  5TNC A;  1KFU L;  3TDU A;  1J7R A;  1M46 A;  3RLZ A;  2M9G A;  3PN7 C;  3PN7 B;  2L98 A;  2JPT A;  1K9K A;  1ZMZ A;  1S3P A;  4WQ2 A;  2JTZ A;  1VRK A;  1UHJ A;  2TN4 A;  1K8U A;  3DF0 A;  1EG4 A;  2JU0 A;  3O4Y A;  4CFR A;  4PE7 A;  1IQ5 A;  1KQM C;  1KQM B;  4ZCU A;  2M3W A;  5GQQ C;  4MZK A;  1MUX A;  3CLN A;  4DS7 A;  5HKY A;  1QJT A;  1TN4 A;  2SAS A;  2KI6 D;  2MLE C;  5HLV A;  2D8N A;  3PSR A;  1K2H A;  3NSO A;  1SPY A;  2NCP A;  4R1E A;  4YI8 A;  5KU1 A;  1LA0 A;  3CR5 X;  3PM8 A;  4DUQ A;  2LMU A;  3ZNI A;  1F4O A;  4NDD A;  1UHK A;  2GGZ A;  2KBM A;  4OV2 A;  4QJ3 B;  1U5I B;  1IG5 A;  2M0R A;  1F71 A;  4MZL A;  1NUB A;  1MR8 A;  1V1F A;  1QX2 A;  1NX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...