2MJWB

Structural insights into calcium bound s100p - v domain of the receptor for advanced glycation end products (rage) complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Structural insights into calcium-bound S100P and the V domain of the RAGE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mjwB00
2F3ZA 5HKZA 1BOCA 4DS7A 1MXLC 1BJFA 1SR6B 4UPGA 1LA3A 2AUCA 1X02A 3SG3A 1A29A 2LVIA 2PRUA 1SYMA 1M45A 2EC6B 2WCBA 5I8NA 2M8UA 3CTNA 1OSAA 2RGIA 1QATA 2JTTA 1KK7Y 1NX1A 1SPYA 1SL7A 3F45A 5GQQC 3TDUA 2WORA 1DJIA 1PSBA 3LCPC 2AAOA 1CMGA 1WY9A 2F2OA 1IJ5A 1HQVA 4ETOA 2SCPA 1NIWA 1F71A 2BE6A 5IBWA 1S36A 3TDZA 1QASA 2WC8A 5CSJA 5HYDA 1A2XA 2JPTA 4OVNF 1CM4A 1ZMZA 2D8NA 4CFRA 1FPWA 3DVMA 1G33A 2MAZA 1K8UA 1DJZA 1V1FA 4M2OA 1MXEA 1SCMC 2LMTA 5TNCA 4N1FA 3SG4A 3WNXB 2L5XB 4NDDA 1Y1AA 1YUUA 3GK1A 3TUYC 1UHIA 2Q91A 1CFFA 2LNKA 1D1OA 1LA0A 1C7WA 4I5JA 3DD4A 2COLB 1S6IA 2L51A 4MN0A 1MQ1A 1WLMA 2LV7A 1BU3A 1DGVA 5AEQA 1S6CA 4OR9B 2KBIA 3FWCA 2OS8B 2BCXA 3SJSA 2JT0A 1QV0A 5CSFA 2JZIA 3IQQA 1OOJA 1L7ZA 2LLTA 2KOTA 4CLNA 5K89A 2WOSA 1PVBA 2JULA 4YGDB 5CPVA 1E8AA 1TNWA 2PMYA 1J7RA 1CFDA 3SG6A 1DMOA 2ZRSA 1IRJA 3VRNA 3C1VA 5F6TA 1C07A 1FI5A 1IH0A 2JWWA 2Y1MA 1QTXA 2CNPA 2KGRA 2ZN8A 2LMUA 1OZOA 1WDCB 3NSLA 5JOLA 1GQMA 1WRZA 4MZKA 1FF1A 1EL4A 5HKWA 2JXCA 1JFJA 1MWNA 3PM8A 2PALA 4CIDA 1AUIB 2BECA 3EKHA 3K21A 1CM1A 3D0YA 1IGVA 3BUWB 2FCDA 1PVAA 5AANA 1DJWA 1LVCD 4ZCVA 2K2AA 3KF9A 1B7TZ 2NLNA 1B4CA 2KAVA 1SL8A 3CWGA 1UURA 1SMGA 4HRHA 1U5IA 4FTGA 1ALVA 2F33A 2SASA 3EVRA 3TS5C 4QJ5B 1Y0VH 3DF0B 1N2DA 1RECA 1SL9A 2F3YA 1RFJA 4C0LA 4P2YB 4MLWA 4HSZA 1IG5A 1UUSA 4MSPA 3EK7A 2DOQA 1OE9B 3CR4X 4D1EA 2JTZA 3FWBA 3ZWHA 3FS7A 1DVIA 1Y1XA 1YVHA 1YX7A 1M39A 5HLOA 1S3PA 1NSHA 1QV1A 1LKJA 1KK8B 1TN4A 4XYNA 1S6JA 1N65A 4WQ2A 4M2QA 3PN7B 4GBAA 2KI4B 2M7NA 3BOWB 5KU1A 1ALWA 1KFUL 1QIVA 1RWYA 3I5GC 1CDLA 3CLNA 3NSIA 3OX5A 2M7LA 2KQ6A 2FCEA 3LL8B 5CSIA 3WHTB 1BG1A 1B8RA 2WCEA 2BCBA 2CXJA 4PHMA 2LP2A 2HQWA 1FBVA 1B1GA 1M46A 5D7FA 1WLZA 2KNEA 4PE0A 1MUXA 5BPJA 1LINA 2CCMA 3AKBA 1TNPA 2CTNA 2KAXA 3I5IB 2V53A 1DGUA 2ISDA 1J7QA 1QIWA 1SRAA 1R6PA 1UHNA 4USLA 1MR8A 2LVKA 1CMFA 1SR6C 1TRFA 4MZJA 5HKYA 2E30A 1UP5A 2GV5A 1QLKA 1IJ6A 3SG7A 1FW4A 2K2FA 2OTGB 2KQYA 4DIRA 1ZFSA 2EC6C 4MVFA 3NSOA 2LUXA 1OMVA 5HLVA 4ORAB 1KWOB 1F4QA 2KSPA 4PE4A 4PDZA 1NX3A 1QX7A 1DJHA 2I7AA 1K9KA 2OTGC 1B7TY 2CBLA 1ZACA 3ZNIA 1PALA 1RK9A 1CFPA 1CTRA 1RTP1 1G4YR 2KBMA 1XFWO 1TOPA 1Q80A 3H4SE 1KWOC 3WXAA 1DT7B 1H8BA 4DRWA 1NWDA 3DF0A 1KSMA 1S5GY 5I2LA 3VRRA 3PLFB 2JC2A 3AAJA 5KTYA 3MSEB 1JFKA 2R2IA 1OMRA 5J3XA 1M31A 3TDIA 1CFCA 1JBAA 1VRKA 1L2OB 2E6WA 1PSRA 4QJ3B 4AOMA 1EJ3A 2JNFA 4JPZB 3I5FB 3SIAA 4L9MA 4I5LB 4NQGA 4DCKA 2K7OA 2OPOA 2QPTA 4PE7A 1DJXA 3A8RA 4ZCUA 1NCYA 3I5FC 3TZ1A 3FIAA 2M97A 1H4BA 1S26D 1M63B 1JF2A 2JRFA 3I5HB 1DJGA 2LAPA 3GOFA 4F0ZB 1FI6A 2ZNDA 1RROA 4GGNA 2LE9B 3O78A 4XJKB 1XVJA 3JVTB 2OS8C 3RLZA 1F54A 2H61C 4GFTA 4M2PA 4NDBA 4FQOA 1OZSA 2I2RE 1K95A 3JVTC 1YUTA 2G2BA 1J7PA 1B8LA 2KFHA 3CR5X 2K61A 4P5OE 3GK4X 5CSNA 5B8IB 1YURA 1JWDA 1K96A 2Y1NA 4ICBA 3SG5A 1WDCC 2BL0B 1KQVA 2Y5IA 1NUBA 1PK0D 2JT8A 2LANA 2MBXA 4N5XA 2BE4A 1YX8A 3SIBA 1K94A 2PVBA 1ZUZA 2BL0C 1XYDA 4A4CA 1TNQA 1XK4C 2JT3A 2MLFC 1KK7Z 2F8PA 4QJ4B 1S1EA 1AP4A 2L4IA 1NCZA 1UHHA 3HCMA 2M3WA 3CR2A 1NP8A 4BY5A 3OP0A 4N1GA 1XFZO 4GPLB 1SKTA 3D10A 4ORBB 3VROA 2M0RA 2MLEC 1V1GA 2WCFA 3BXKA 2KI6C 2PSRA 3ICBA 3NSKA 2LLUA 3EKJA 4GGFC 1BR1B 1GGZA 2L50A 3NXAA 2KFGA 4YI8A 1IQ3A 2NCOA 4GNKB 1KK8C 2K7CA 2LM5A 3AKAA 5AXIA 1K90D 2H61A 2K7BA 3PN7C 1Y1UA 2KI4C 1EG3A 1QX2A 3KO0A 1QLSA 2L4HA 1KFUS 3OB2B 4XJKA 3LLEA 1XFYO 1J7OA 1YRTB 2KGBC 2ZN9A 1DTLA 1QJTA 2A4JA 2HPSA 4OKHA 1ODBA 1KQMB 1CLLA 1QS7A 1QX5B 1WRLA 2PASA 4YBHB 4YGAA 4I5NB 2M29A 3VRQA 4WQ3A 3VGOA 1IKUA 1EXRA 2NZ0A 2B1UA 3BUOB 2KYFA 1R2UA 2K7DA 4HREE 2KFFA 2KHNA 3AAKA 1OQPA 2M1KB 3OX6A 1J1DA 2KYCA 1GJYA 1F8HA 1CDPA 1TTXA 5PALA 3I5IC 2AMIA 2LUCA 3IF7A 3IQOA 4MBEA 2IS9A 4YGEB 1NYAA 2M49B 2BKIB 3PSRA 2LCPA 3GK2A 1F4OA 1XK4A 2M1UA 2TN4A 1QXPA 1A75B 3HX4A 5DKNA 4PCWA 5I2OA 2HETA 1PRWA 2MHHA 1SNLA 5JJGA 2MRDA 1DF0B 3CGAA 1JC2A 1AJ4A 1RJVA 2BKHB 1J1EA 1UHKA 1WRKA 4MEWA 5ER4X 1J55A 4U8DA 1TIZA 3KHEA 1BF5A 2EGDA 3KEVA 1NX0A 4R1EA 4MRYA 1C7VA 4Q04A 2LHLA 1YTZC 4PHKA 4GGFA 1B8CA 1AK8A 3DVJA 2O5GA 3D0YB 4JQ0D 3PATA 1CKKA 1NX2A 1Y6WA 1JUOA 3KPXA 2LLSA 4OV2A 1YUSA 1L2OC 1SY9A 4ORCB 2F2PA 2JU0A 1XFVO 4YGBB 1AVSA 1UHJA 2EHBA 2ZRTA 3BOWA 1U5IB 4C0KA 2BBMA 1SCMB 2JQ6A 1CNPA 1SCVA 2LVVA 3TUYB 1W7JB 2BCAA 5I2QA 2QACA 2BBNA 3BUNB 3EK8A 3O2PA 2P6BB 1XFUO 1XFXO 3VRPA 1SK6D 1GGWA 3LK1A 2FOTA 3O4YA 3I5HC 1OMDA 3EVVA 1ZOTB 2JOJA 1PULA 1QVIZ 2VRGA 4PE1A 1BODA 4YGCB 1SBJA 2GGZA 4PALA 3M0WA 2MJWB 3DVKA 4GAOA 1F55A 4CFQA 5FYXA 5DKRA 1CDNA 2JNXA 5AFPA 1CB1A 1K9UA 2M9GA 3BUXB 3PALA 1NPQA 3BUMB 4TNCA 4JWQA 1CLBA 3E3RA 2CT9A 4GUKA 5G08A 4CPVA 1A75A 3OHMB 4YRUA 1DF0A 2NXQA 4C0JA 1NCXA 2LHIA 1MF8B 5KSZA 2KDHA 1AHRA 4E68A 1K93D 1B9AA 1N0YA 2G9BA 1UWOA 1TCOB 2ZKMX 4I5KA 2JXLA 2HF5A 2O60A 1KFXL 1LXFC 1YVLA 2K8MB 3EK4A 1DJYA 2Y4QA 4WRIA 3TS5B 2LP3A 2KI6D 2FJUB 1IWQA 3O6BA 1KFXS 1W7IB 1K9PA 2WNDA 2L0PA 2I94A 4PHJA 1KCYA 1S5GZ 4OCIA 1TCFA 3EVUA 4A4BA 1EH2A 1G8IA 1HT9A 2LVJA 2K0JA 4BY4A 1AJ5A 4AQJA 1A03A 1KSOA 3BYAA 5D69A 2L98A 2I18A 2ZFDA 1YR5A 3RM1A 3A4UB 1EG4A 2Q4UA 1BT6A 2LC5A 2ZNEA 2GGMA 1BLQA 3JTDB 4MRXA 1B47A 2NCPA 4IL1A 5AERA 1BMOA 2MA2A 3I5GB 1CDMA 4MZLA 1K2HA 5DKQA 2H2KA 3DVEA 1CLMA 1JSAA 1QVIY 4YI9A 3JTDC 3SG2A 1IQ5A 2L2EA 1BR4B 1A4PA 1YRUB 3CZTX 3OB1B 1MHOA 2KAYA 1KQMC 1SW8A 3WHUB 1TNXA 1XO5A 3CS1A 4NDCA 2HQ8A 3PFVA 1F70A 4PHNA 3BQ3A 5ER5A 1JF0A 4DUQA 2LMVA 4HRGA 4AQIA 3LK0A 3QRXA 1XA5A
chains in the Genus database with same CATH superfamily
1JSAA 2F3ZA 5HKZA 1BOCA 4DS7A 1OOGA 1MXLC 1BJFA 1SR6B 4UPGA 1LA3A 2AUCA 1X02A 3SG3A 1A29A 2L2CA 2LVIA 2PRUA 1SYMA 1M45A 2EC6B 2WCBA 5I8NA 2M8UA 1XFRA 1OSAA 2RGIA 3CTNA 5I94A 1QATA 2JTTA 1KK7Y 1NX1A 1SPYA 1SL7A 4IJ7A 3F45A 3R72A 4JD9A 5GQQC 3TDUA 2WORA 1DJIA 1PSBA 3LCPC 2AAOA 1CMGA 1WY9A 2F2OA 1IJ5A 1HQVA 4ETOA 2SCPA 1DQEA 2QEVA 1NIWA 1F71A 2BE6A 5IBWA 1S36A 3TDZA 1QASA 2WC8A 5CSJA 3BFAA 5HYDA 1A2XA 2JPTA 4OVNF 1CM4A 3BFBA 2BAPA 1ZMZA 2D8NA 3FE8A 4CFRA 1FPWA 3DVMA 1G33A 2MAZA 1K8UA 1DJZA 1V1FA 2H8VA 4M2OA 1MXEA 1SCMC 2LMTA 5TNCA 4N1FA 3SG4A 3WNXB 2L5XB 4NDDA 1Y1AA 1YUUA 3CABA 3GK1A 3TUYC 1UHIA 2Q91A 1CFFA 2LNKA 1D1OA 1LA0A 1C7WA 4I5JA 3DD4A 1QWVA 2COLB 1S6IA 2L51A 4MN0A 1MQ1A 2P70A 1WLMA 2LV7A 1BU3A 1DGVA 5AEQA 1S6CA 4OR9B 2KBIA 3FWCA 2OS8B 2BCXA 3SJSA 2JT0A 1QV0A 2WCLA 5CSFA 2JZIA 3IQQA 1OOJA 1L7ZA 2LLTA 2KOTA 4CLNA 5K89A 1W9ZA 2WOSA 1PVBA 2WC5A 4INXA 2JULA 4YGDB 5CPVA 1E8AA 1TNWA 3CZ1A 2PMYA 3S0EA 3OGNA 1J7RA 1CFDA 3SG6A 1DMOA 2ZRSA 1IRJA 2KPHA 3VRNA 3C1VA 5F6TA 1C07A 1FI5A 1IH0A 2JWWA 2Y1MA 1QTXA 4F7FA 2CNPA 2KGRA 2ZN8A 2LMUA 1OZOA 1WDCB 3NSLA 5JOLA 1GQMA 1OOFA 1WRZA 4MZKA 1FF1A 1EL4A 5HKWA 2JXCA 1JFJA 1MWNA 3PM8A 2PALA 4CIDA 1AUIB 2BECA 3EKHA 3K21A 3L4LA 1CM1A 3D0YA 1IGVA 3BUWB 2FCDA 1PVAA 5AANA 1DJWA 1LVCD 4ZCVA 2K2AA 3UO9A 3KF9A 1B7TZ 2NLNA 1B4CA 2KAVA 3B88A 1SL8A 3CWGA 1UURA 1OOIX 1SMGA 4HRHA 1U5IA 4FTGA 1TUJA 1ALVA 2F33A 2SASA 3EVRA 3TS5C 4QJ5B 1Y0VH 3DF0B 1N2DA 1RECA 1SL9A 2F3YA 1RFJA 4C0LA 4P2YB 4MLWA 4HSZA 1IG5A 1UUSA 4MSPA 3EK7A 2DOQA 1OE9B 3CR4X 4D1EA 2JTZA 2L5YA 3FWBA 3FS7A 3ZWHA 1DVIA 1YX7A 1Y1XA 1YVHA 1M39A 5HLOA 1S3PA 1NSHA 1QV1A 1LKJA 1KK8B 1TN4A 4JKTA 1S6JA 4XYNA 1N65A 3IVTA 3R1VA 4WQ2A 4M2QA 3PN7B 4GBAA 2KI4B 2M7NA 3BOWB 5KU1A 1ALWA 1KFUL 1QIVA 1RWYA 3I5GC 1CDLA 3CLNA 3NSIA 3OX5A 2M7LA 2KQ6A 2FCEA 3UNWA 3LL8B 5CSIA 3WHTB 1BG1A 1B8RA 2WCEA 2QEBA 2ERBA 2BCBA 2CXJA 4PHMA 2LP2A 2HQWA 1FBVA 3DZTA 1B1GA 1M46A 5D7FA 1WLZA 2KNEA 4PE0A 1MUXA 3DXLA 5BPJA 1LINA 2CCMA 3AKBA 1TNPA 3Q8IA 2CTNA 2KAXA 3I5IB 2V53A 1DGUA 2ISDA 1J7QA 1QIWA 1SRAA 1R6PA 1UHNA 4USLA 3EG5B 1MR8A 2LVKA 1CMFA 1SR6C 1TRFA 4MZJA 5HKYA 2E30A 1UP5A 2GV5A 1QLKA 1IJ6A 3SG7A 1FW4A 2K2FA 2OTGB 2KQYA 4DIRA 1ZFSA 1DC1A 2WC6A 2EC6C 1SSEB 3NSOA 4MVFA 2LUXA 1OMVA 5HLVA 4ORAB 1KWOB 1F4QA 2KSPA 2PQLA 4PE4A 4PDZA 5FI6A 1NX3A 1QX7A 1DJHA 2I7AA 1K9KA 2OTGC 3D75A 3V2LA 1B7TY 2CBLA 1ZACA 3ZNIA 1PALA 1RK9A 1CFPA 1CTRA 1RTP1 1G4YR 2KBMA 1XFWO 1TOPA 1Q80A 3H4SE 1KWOC 3WXAA 1DT7B 1H8BA 4DRWA 1NWDA 3DF0A 3DYEA 1KSMA 1S5GY 5I2LA 3VRRA 3PLFB 2JC2A 3AAJA 5KTYA 3MSEB 4INWA 1JFKA 2R2IA 1OMRA 5J3XA 1M31A 3TDIA 1CFCA 1JBAA 1VRKA 1L2OB 1TUZA 2E6WA 1PSRA 4QJ3B 4AOMA 1EJ3A 2JNFA 3FE6A 4JPZB 3I5FB 4KYNA 3SIAA 4L9MA 4I5LB 4NQGA 4DCKA 2K7OA 2OPOA 2QPTA 3NHTA 4PE7A 1C3YA 1DJXA 3A8RA 1OW4A 4ZCUA 1NCYA 3I5FC 3TZ1A 3FIAA 2M97A 1H4BA 1S26D 1M63B 4OZDA 3NGVA 1JF2A 2JRFA 3I5HB 1DJGA 2LAPA 3GOFA 4F0ZB 1FI6A 2ZNDA 1RROA 4GGNA 2FJYA 3CDNA 2LE9B 3O78A 4XJKB 3S0FA 1XVJA 3JVTB 1T14A 2OS8C 3RLZA 1F54A 2H61C 4GFTA 4M2PA 4NDBA 3D76A 1OZSA 4FQOA 2I2RE 1K95A 3JVTC 1YUTA 1DELA 2G2BA 4PT1A 2WCKA 1J7PA 1B8LA 2KFHA 3CR5X 2KLDA 2K61A 4P5OE 3GK4X 5CSNA 5B8IB 1YURA 1JWDA 1K96A 2Y1NA 2YGUA 4ICBA 3SG5A 1WDCC 2BL0B 1KQVA 2WCJA 2Y5IA 5D3OA 1NUBA 1PK0D 2JT8A 3D77A 2LANA 2MBXA 4N5XA 2BE4A 1YX8A 3SIBA 1K94A 2PVBA 1ZUZA 2BL0C 5EL2A 1XYDA 4A4CA 1TNQA 1XK4C 2JT3A 2MLFC 1KK7Z 2F8PA 3PM2A 1S1EA 3BJHA 4QJ4B 5FI2A 1AP4A 2L4IA 1NCZA 1UHHA 3HCMA 2M3WA 3CR2A 1NP8A 4BY5A 3OP0A 2P71A 4N1GA 1XFZO 4GPLB 1SKTA 3N7HA 3D10A 4ORBB 3VROA 2M0RA 2MLEC 1IIOA 1V1GA 2WCFA 1OOHA 3BXKA 2KI6C 2PSRA 3ICBA 2GTEA 3NSKA 4FQTA 2LLUA 3B6XA 3EKJA 4GGFC 1TWOA 1BR1B 1GGZA 2L50A 3NXAA 2KFGA 4YI8A 1IQ3A 2NCOA 1Z2CB 4GNKB 1KK8C 2K7CA 2LM5A 3AKAA 5AXIA 1K90D 1Z4HA 2H61A 1C3ZA 2K7BA 2KLEA 3PN7C 1Y1UA 2KI4C 1EG3A 1QX2A 3CZ0A 1QLSA 2L4HA 1KFUS 3KO0A 3OB2B 3LLEA 1XFYO 4XJKA 3S0GA 1J7OA 2QEOA 1YRTB 2KGBC 2ZN9A 1DTLA 1QJTA 2A4JA 2HPSA 4OKHA 1ODBA 1KQMB 1CLLA 1QS7A 1QX5B 1WRLA 2PASA 4YBHB 4YGAA 4I5NB 2M29A 3VRQA 3B86A 4WQ3A 3VGOA 1IKUA 1EXRA 3CZ2A 2NZ0A 2B1UA 3BUOB 2KYFA 1R2UA 2K7DA 4HREE 2KFFA 2KHNA 3AAKA 1OQPA 2M1KB 3OX6A 1J1DA 2KYCA 1GJYA 1F8HA 1CDPA 1TTXA 5PALA 3I5IC 2AMIA 2PYQA 2LUCA 3B87A 3IF7A 3IQOA 4MBEA 2IS9A 4YGEB 1NYAA 2M49B 2BKIB 3SS5A 3PSRA 2LCPA 3GK2A 1XK4A 1F4OA 2M1UA 2TN4A 1QXPA 1A75B 3HX4A 5DKNA 5FI7A 4PCWA 5I2OA 2HETA 1PRWA 2QDIA 2MHHA 1SNLA 5JJGA 2MRDA 1DF0B 3CGAA 3K1EA 1JC2A 1AJ4A 3S0DA 1RJVA 2BKHB 1J1EA 1UHKA 1WRKA 4MEWA 5ER4X 1J55A 4U8DA 1TIZA 3KHEA 1BF5A 1GM0A 2EGDA 3KEVA 1NX0A 3D73A 4R1EA 4MRYA 1C7VA 4Q04A 2LHLA 1YTZC 4PHKA 3B7AA 4GGFA 1B8CA 1AK8A 3DVJA 2O5GA 3D0YB 4JQ0D 3PATA 3D78A 1CKKA 1NX2A 1Y6WA 1JUOA 3KPXA 1ORGA 2LLSA 4OV2A 1YUSA 3NHIA 1L2OC 1SY9A 4ORCB 2F2PA 2JU0A 1XFVO 4YGBB 1AVSA 1UHJA 2EHBA 2ZRTA 3BOWA 1U5IB 4C0KA 3CYZA 2BBMA 1SCMB 2JQ6A 1CNPA 1P28A 1SCVA 2LVVA 3TUYB 1W7JB 2BCAA 3QMEA 5I2QA 3DY9A 2QACA 2K60A 2BBNA 3BUNB 3EK8A 3O2PA 2P6BB 1XFUO 1XFXO 3VRPA 1SK6D 1GGWA 3LK1A 2FOTA 3O4YA 3I5HC 1OMDA 3EVVA 1ZOTB 2JOJA 1PULA 1QVIZ 2VRGA 4PE1A 1BODA 2BNXA 4YGCB 1SBJA 2GGZA 4PALA 3M0WA 2MJWB 3DVKA 4GAOA 1F55A 4CFQA 5FYXA 5DKRA 3SS3A 2JNXA 5AFPA 1CDNA 1CB1A 1K9UA 2M9GA 3BUXB 3PALA 1NPQA 3BUMB 4TNCA 4JWQA 1CLBA 3E3RA 2CT9A 1LS8A 4GUKA 5G08A 4CPVA 1A75A 3OHMB 4YRUA 1DF0A 2NXQA 4C0JA 1NCXA 2WCMA 2LHIA 1MF8B 5KSZA 2KDHA 3O4XA 1AHRA 3SS4A 4E68A 1K93D 1B9AA 1N0YA 2G9BA 1UWOA 1TCOB 2ZKMX 4I5KA 2JXLA 2HF5A 2O60A 1KFXL 3RZSA 1LXFC 1YVLA 2K8MB 2JPOA 3EK4A 1DJYA 2Y4QA 4WRIA 3TS5B 2LP3A 2KI6D 2FJUB 1IWQA 3O6BA 1KFXS 1W7IB 5HL1A 1K9PA 2WNDA 2L0PA 2I94A 3R1OA 4PHJA 5DICA 1KCYA 1S5GZ 4OCIA 1TCFA 3D74A 3EVUA 4A4BA 1EH2A 1G8IA 1HT9A 2LVJA 2K0JA 4BY4A 1AJ5A 4AQJA 1A03A 1KSOA 3OBVA 3S0AA 3BYAA 5D69A 2L98A 2I18A 2ZFDA 1YR5A 3RM1A 3A4UB 1EG4A 2Q4UA 1BT6A 2LC5A 2ZNEA 2GGMA 1BLQA 3JTDB 4MRXA 1B47A 2NCPA 4IL1A 3PJIA 5AERA 1DEKA 3S0BA 1BMOA 2MA2A 3I5GB 3L47A 1CDMA 4MZLA 1K2HA 5DKQA 2H2KA 3DVEA 1CLMA 3VB1A 1QVIY 2QEHA 4YI9A 3L4AA 2WCHA 3JTDC 3SG2A 1IQ5A 2L2EA 1BR4B 1A4PA 1YRUB 3CZTX 3OB1B 1MHOA 2KAYA 1KQMC 1SW8A 3WHUB 1TNXA 1XO5A 3CS1A 4NDCA 3FE9A 2HQ8A 3PFVA 1F70A 4PHNA 3BQ3A 5ER5A 1JF0A 4DUQA 2LMVA 3R1PA 3BFHA 4HRGA 3LK0A 4AQIA 3QRXA 1XA5A
chains in the Genus database with same CATH topology
2F3ZA 5HKZA 1BOCA 4DS7A 1MXLC 1BJFA 1SR6B 4UPGA 1LA3A 2AUCA 1X02A 3SG3A 1A29A 2LVIA 2PRUA 1SYMA 1M45A 2EC6B 2WCBA 5I8NA 2M8UA 3CTNA 1OSAA 2RGIA 1QATA 2JTTA 1KK7Y 1NX1A 1SPYA 1SL7A 3F45A 5GQQC 3TDUA 2WORA 1DJIA 1PSBA 3LCPC 2AAOA 1CMGA 1WY9A 2F2OA 1IJ5A 1HQVA 4ETOA 2SCPA 1NIWA 1F71A 2BE6A 5IBWA 1S36A 3TDZA 1QASA 2WC8A 5CSJA 5HYDA 1A2XA 2JPTA 4OVNF 1CM4A 1ZMZA 2D8NA 4CFRA 1FPWA 3DVMA 1G33A 2MAZA 1K8UA 1DJZA 1V1FA 4M2OA 1MXEA 1SCMC 2LMTA 5TNCA 4N1FA 3SG4A 3WNXB 2L5XB 4NDDA 1Y1AA 1YUUA 3GK1A 3TUYC 1UHIA 2Q91A 1CFFA 2LNKA 1D1OA 1LA0A 1C7WA 4I5JA 3DD4A 2COLB 1S6IA 2L51A 4MN0A 1MQ1A 1WLMA 2LV7A 1BU3A 1DGVA 5AEQA 1S6CA 4OR9B 2KBIA 3FWCA 2OS8B 2BCXA 3SJSA 2JT0A 1QV0A 5CSFA 2JZIA 3IQQA 1OOJA 1L7ZA 2LLTA 2KOTA 4CLNA 5K89A 2WOSA 1PVBA 2JULA 4YGDB 5CPVA 1E8AA 1TNWA 2PMYA 1J7RA 1CFDA 3SG6A 1DMOA 2ZRSA 1IRJA 3VRNA 3C1VA 5F6TA 1C07A 1FI5A 1IH0A 2JWWA 2Y1MA 1QTXA 2CNPA 2KGRA 2ZN8A 2LMUA 1OZOA 1WDCB 3NSLA 5JOLA 1GQMA 1WRZA 4MZKA 1FF1A 1EL4A 5HKWA 2JXCA 1JFJA 1MWNA 3PM8A 2PALA 4CIDA 1AUIB 2BECA 3EKHA 3K21A 1CM1A 3D0YA 1IGVA 3BUWB 2FCDA 1PVAA 5AANA 1DJWA 1LVCD 4ZCVA 2K2AA 3KF9A 1B7TZ 2NLNA 1B4CA 2KAVA 1SL8A 3CWGA 1UURA 1SMGA 4HRHA 1U5IA 4FTGA 1ALVA 2F33A 2SASA 3EVRA 3TS5C 4QJ5B 1Y0VH 3DF0B 1N2DA 1RECA 1SL9A 2F3YA 1RFJA 4C0LA 4P2YB 4MLWA 4HSZA 1IG5A 1UUSA 4MSPA 3EK7A 2DOQA 1OE9B 3CR4X 4D1EA 2JTZA 3FWBA 3ZWHA 3FS7A 1DVIA 1Y1XA 1YVHA 1YX7A 1M39A 5HLOA 1S3PA 1NSHA 1QV1A 1LKJA 1KK8B 1TN4A 4XYNA 1S6JA 1N65A 4WQ2A 4M2QA 3PN7B 4GBAA 2KI4B 2M7NA 3BOWB 5KU1A 1ALWA 1KFUL 1QIVA 1RWYA 3I5GC 1CDLA 3CLNA 3NSIA 3OX5A 2M7LA 2KQ6A 2FCEA 3LL8B 5CSIA 3WHTB 1BG1A 1B8RA 2WCEA 2BCBA 2CXJA 4PHMA 2LP2A 2HQWA 1FBVA 1B1GA 1M46A 5D7FA 1WLZA 2KNEA 4PE0A 1MUXA 5BPJA 1LINA 2CCMA 3AKBA 1TNPA 2CTNA 2KAXA 3I5IB 2V53A 1DGUA 2ISDA 1J7QA 1QIWA 1SRAA 1R6PA 1UHNA 4USLA 1MR8A 2LVKA 1CMFA 1SR6C 1TRFA 4MZJA 5HKYA 2E30A 1UP5A 2GV5A 1QLKA 1IJ6A 3SG7A 1FW4A 2K2FA 2OTGB 2KQYA 4DIRA 1ZFSA 2EC6C 4MVFA 3NSOA 2LUXA 1OMVA 5HLVA 4ORAB 1KWOB 1F4QA 2KSPA 4PE4A 4PDZA 1NX3A 1QX7A 1DJHA 2I7AA 1K9KA 2OTGC 1B7TY 2CBLA 1ZACA 3ZNIA 1PALA 1RK9A 1CFPA 1CTRA 1RTP1 1G4YR 2KBMA 1XFWO 1TOPA 1Q80A 3H4SE 1KWOC 3WXAA 1DT7B 1H8BA 4DRWA 1NWDA 3DF0A 1KSMA 1S5GY 5I2LA 3VRRA 3PLFB 2JC2A 3AAJA 5KTYA 3MSEB 1JFKA 2R2IA 1OMRA 5J3XA 1M31A 3TDIA 1CFCA 1JBAA 1VRKA 1L2OB 2E6WA 1PSRA 4QJ3B 4AOMA 1EJ3A 2JNFA 4JPZB 3I5FB 3SIAA 4L9MA 4I5LB 4NQGA 4DCKA 2K7OA 2OPOA 2QPTA 4PE7A 1DJXA 3A8RA 4ZCUA 1NCYA 3I5FC 3TZ1A 3FIAA 2M97A 1H4BA 1S26D 1M63B 1JF2A 2JRFA 3I5HB 1DJGA 2LAPA 3GOFA 4F0ZB 1FI6A 2ZNDA 1RROA 4GGNA 2LE9B 3O78A 4XJKB 1XVJA 3JVTB 2OS8C 3RLZA 1F54A 2H61C 4GFTA 4M2PA 4NDBA 4FQOA 1OZSA 2I2RE 1K95A 3JVTC 1YUTA 2G2BA 1J7PA 1B8LA 2KFHA 3CR5X 2K61A 4P5OE 3GK4X 5CSNA 5B8IB 1YURA 1JWDA 1K96A 2Y1NA 4ICBA 3SG5A 1WDCC 2BL0B 1KQVA 2Y5IA 1NUBA 1PK0D 2JT8A 2LANA 2MBXA 4N5XA 2BE4A 1YX8A 3SIBA 1K94A 2PVBA 1ZUZA 2BL0C 1XYDA 4A4CA 1TNQA 1XK4C 2JT3A 2MLFC 1KK7Z 2F8PA 4QJ4B 1S1EA 1AP4A 2L4IA 1NCZA 1UHHA 3HCMA 2M3WA 3CR2A 1NP8A 4BY5A 3OP0A 4N1GA 1XFZO 4GPLB 1SKTA 3D10A 4ORBB 3VROA 2M0RA 2MLEC 1V1GA 2WCFA 3BXKA 2KI6C 2PSRA 3ICBA 3NSKA 2LLUA 3EKJA 4GGFC 1BR1B 1GGZA 2L50A 3NXAA 2KFGA 4YI8A 1IQ3A 2NCOA 4GNKB 1KK8C 2K7CA 2LM5A 3AKAA 5AXIA 1K90D 2H61A 2K7BA 3PN7C 1Y1UA 2KI4C 1EG3A 1QX2A 3KO0A 1QLSA 2L4HA 1KFUS 3OB2B 4XJKA 3LLEA 1XFYO 1J7OA 1YRTB 2KGBC 2ZN9A 1DTLA 1QJTA 2A4JA 2HPSA 4OKHA 1ODBA 1KQMB 1CLLA 1QS7A 1QX5B 1WRLA 2PASA 4YBHB 4YGAA 4I5NB 2M29A 3VRQA 4WQ3A 3VGOA 1IKUA 1EXRA 2NZ0A 2B1UA 3BUOB 2KYFA 1R2UA 2K7DA 4HREE 2KFFA 2KHNA 3AAKA 1OQPA 2M1KB 3OX6A 1J1DA 2KYCA 1GJYA 1F8HA 1CDPA 1TTXA 5PALA 3I5IC 2AMIA 2LUCA 3IF7A 3IQOA 4MBEA 2IS9A 4YGEB 1NYAA 2M49B 2BKIB 3PSRA 2LCPA 3GK2A 1F4OA 1XK4A 2M1UA 2TN4A 1QXPA 1A75B 3HX4A 5DKNA 4PCWA 5I2OA 2HETA 1PRWA 2MHHA 1SNLA 5JJGA 2MRDA 1DF0B 3CGAA 1JC2A 1AJ4A 1RJVA 2BKHB 1J1EA 1UHKA 1WRKA 4MEWA 5ER4X 1J55A 4U8DA 1TIZA 3KHEA 1BF5A 2EGDA 3KEVA 1NX0A 4R1EA 4MRYA 1C7VA 4Q04A 2LHLA 1YTZC 4PHKA 4GGFA 1B8CA 1AK8A 3DVJA 2O5GA 3D0YB 4JQ0D 3PATA 1CKKA 1NX2A 1Y6WA 1JUOA 3KPXA 2LLSA 4OV2A 1YUSA 1L2OC 1SY9A 4ORCB 2F2PA 2JU0A 1XFVO 4YGBB 1AVSA 1UHJA 2EHBA 2ZRTA 3BOWA 1U5IB 4C0KA 2BBMA 1SCMB 2JQ6A 1CNPA 1SCVA 2LVVA 3TUYB 1W7JB 2BCAA 5I2QA 2QACA 2BBNA 3BUNB 3EK8A 3O2PA 2P6BB 1XFUO 1XFXO 3VRPA 1SK6D 1GGWA 3LK1A 2FOTA 3O4YA 3I5HC 1OMDA 3EVVA 1ZOTB 2JOJA 1PULA 1QVIZ 2VRGA 4PE1A 1BODA 4YGCB 1SBJA 2GGZA 4PALA 3M0WA 2MJWB 3DVKA 4GAOA 1F55A 4CFQA 5FYXA 5DKRA 1CDNA 2JNXA 5AFPA 1CB1A 1K9UA 2M9GA 3BUXB 3PALA 1NPQA 3BUMB 4TNCA 4JWQA 1CLBA 3E3RA 2CT9A 4GUKA 5G08A 4CPVA 1A75A 3OHMB 4YRUA 1DF0A 2NXQA 4C0JA 1NCXA 2LHIA 1MF8B 5KSZA 2KDHA 1AHRA 4E68A 1K93D 1B9AA 1N0YA 2G9BA 1UWOA 1TCOB 2ZKMX 4I5KA 2JXLA 2HF5A 2O60A 1KFXL 1LXFC 1YVLA 2K8MB 3EK4A 1DJYA 2Y4QA 4WRIA 3TS5B 2LP3A 2KI6D 2FJUB 1IWQA 3O6BA 1KFXS 1W7IB 1K9PA 2WNDA 2L0PA 2I94A 4PHJA 1KCYA 1S5GZ 4OCIA 1TCFA 3EVUA 4A4BA 1EH2A 1G8IA 1HT9A 2LVJA 2K0JA 4BY4A 1AJ5A 4AQJA 1A03A 1KSOA 3BYAA 5D69A 2L98A 2I18A 2ZFDA 1YR5A 3RM1A 3A4UB 1EG4A 2Q4UA 1BT6A 2LC5A 2ZNEA 2GGMA 1BLQA 3JTDB 4MRXA 1B47A 2NCPA 4IL1A 5AERA 1BMOA 2MA2A 3I5GB 1CDMA 4MZLA 1K2HA 5DKQA 2H2KA 3DVEA 1CLMA 1JSAA 1QVIY 4YI9A 3JTDC 3SG2A 1IQ5A 2L2EA 1BR4B 1A4PA 1YRUB 3CZTX 3OB1B 1MHOA 2KAYA 1KQMC 1SW8A 3WHUB 1TNXA 1XO5A 3CS1A 4NDCA 2HQ8A 3PFVA 1F70A 4PHNA 3BQ3A 5ER5A 1JF0A 4DUQA 2LMVA 4HRGA 4AQIA 3LK0A 3QRXA 1XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3Z A;  5HKZ A;  1BOC A;  4DS7 A;  1MXL C;  1BJF A;  1SR6 B;  4UPG A;  1LA3 A;  2AUC A;  1X02 A;  3SG3 A;  1A29 A;  2LVI A;  2PRU A;  1SYM A;  1M45 A;  2EC6 B;  2WCB A;  5I8N A;  2M8U A;  3CTN A;  1OSA A;  2RGI A;  1QAT A;  2JTT A;  1KK7 Y;  1NX1 A;  1SPY A;  1SL7 A;  3F45 A;  5GQQ C;  3TDU A;  2WOR A;  1DJI A;  1PSB A;  3LCP C;  2AAO A;  1CMG A;  1WY9 A;  2F2O A;  1IJ5 A;  1HQV A;  4ETO A;  2SCP A;  1NIW A;  1F71 A;  2BE6 A;  5IBW A;  1S36 A;  3TDZ A;  1QAS A;  2WC8 A;  5CSJ A;  5HYD A;  1A2X A;  2JPT A;  4OVN F;  1CM4 A;  1ZMZ A;  2D8N A;  4CFR A;  1FPW A;  3DVM A;  1G33 A;  2MAZ A;  1K8U A;  1DJZ A;  1V1F A;  4M2O A;  1MXE A;  1SCM C;  2LMT A;  5TNC A;  4N1F A;  3SG4 A;  3WNX B;  2L5X B;  4NDD A;  1Y1A A;  1YUU A;  3GK1 A;  3TUY C;  1UHI A;  2Q91 A;  1CFF A;  2LNK A;  1D1O A;  1LA0 A;  1C7W A;  4I5J A;  3DD4 A;  2COL B;  1S6I A;  2L51 A;  4MN0 A;  1MQ1 A;  1WLM A;  2LV7 A;  1BU3 A;  1DGV A;  5AEQ A;  1S6C A;  4OR9 B;  2KBI A;  3FWC A;  2OS8 B;  2BCX A;  3SJS A;  2JT0 A;  1QV0 A;  5CSF A;  2JZI A;  3IQQ A;  1OOJ A;  1L7Z A;  2LLT A;  2KOT A;  4CLN A;  5K89 A;  2WOS A;  1PVB A;  2JUL A;  4YGD B;  5CPV A;  1E8A A;  1TNW A;  2PMY A;  1J7R A;  1CFD A;  3SG6 A;  1DMO A;  2ZRS A;  1IRJ A;  3VRN A;  3C1V A;  5F6T A;  1C07 A;  1FI5 A;  1IH0 A;  2JWW A;  2Y1M A;  1QTX A;  2CNP A;  2KGR A;  2ZN8 A;  2LMU A;  1OZO A;  1WDC B;  3NSL A;  5JOL A;  1GQM A;  1WRZ A;  4MZK A;  1FF1 A;  1EL4 A;  5HKW A;  2JXC A;  1JFJ A;  1MWN A;  3PM8 A;  2PAL A;  4CID A;  1AUI B;  2BEC A;  3EKH A;  3K21 A;  1CM1 A;  3D0Y A;  1IGV A;  3BUW B;  2FCD A;  1PVA A;  5AAN A;  1DJW A;  1LVC D;  4ZCV A;  2K2A A;  3KF9 A;  1B7T Z;  2NLN A;  1B4C A;  2KAV A;  1SL8 A;  3CWG A;  1UUR A;  1SMG A;  4HRH A;  1U5I A;  4FTG A;  1ALV A;  2F33 A;  2SAS A;  3EVR A;  3TS5 C;  4QJ5 B;  1Y0V H;  3DF0 B;  1N2D A;  1REC A;  1SL9 A;  2F3Y A;  1RFJ A;  4C0L A;  4P2Y B;  4MLW A;  4HSZ A;  1IG5 A;  1UUS A;  4MSP A;  3EK7 A;  2DOQ A;  1OE9 B;  3CR4 X;  4D1E A;  2JTZ A;  3FWB A;  3ZWH A;  3FS7 A;  1DVI A;  1Y1X A;  1YVH A;  1YX7 A;  1M39 A;  5HLO A;  1S3P A;  1NSH A;  1QV1 A;  1LKJ A;  1KK8 B;  1TN4 A;  4XYN A;  1S6J A;  1N65 A;  4WQ2 A;  4M2Q A;  3PN7 B;  4GBA A;  2KI4 B;  2M7N A;  3BOW B;  5KU1 A;  1ALW A;  1KFU L;  1QIV A;  1RWY A;  3I5G C;  1CDL A;  3CLN A;  3NSI A;  3OX5 A;  2M7L A;  2KQ6 A;  2FCE A;  3LL8 B;  5CSI A;  3WHT B;  1BG1 A;  1B8R A;  2WCE A;  2BCB A;  2CXJ A;  4PHM A;  2LP2 A;  2HQW A;  1FBV A;  1B1G A;  1M46 A;  5D7F A;  1WLZ A;  2KNE A;  4PE0 A;  1MUX A;  5BPJ A;  1LIN A;  2CCM A;  3AKB A;  1TNP A;  2CTN A;  2KAX A;  3I5I B;  2V53 A;  1DGU A;  2ISD A;  1J7Q A;  1QIW A;  1SRA A;  1R6P A;  1UHN A;  4USL A;  1MR8 A;  2LVK A;  1CMF A;  1SR6 C;  1TRF A;  4MZJ A;  5HKY A;  2E30 A;  1UP5 A;  2GV5 A;  1QLK A;  1IJ6 A;  3SG7 A;  1FW4 A;  2K2F A;  2OTG B;  2KQY A;  4DIR A;  1ZFS A;  2EC6 C;  4MVF A;  3NSO A;  2LUX A;  1OMV A;  5HLV A;  4ORA B;  1KWO B;  1F4Q A;  2KSP A;  4PE4 A;  4PDZ A;  1NX3 A;  1QX7 A;  1DJH A;  2I7A A;  1K9K A;  2OTG C;  1B7T Y;  2CBL A;  1ZAC A;  3ZNI A;  1PAL A;  1RK9 A;  1CFP A;  1CTR A;  1RTP 1;  1G4Y R;  2KBM A;  1XFW O;  1TOP A;  1Q80 A;  3H4S E;  1KWO C;  3WXA A;  1DT7 B;  1H8B A;  4DRW A;  1NWD A;  3DF0 A;  1KSM A;  1S5G Y;  5I2L A;  3VRR A;  3PLF B;  2JC2 A;  3AAJ A;  5KTY A;  3MSE B;  1JFK A;  2R2I A;  1OMR A;  5J3X A;  1M31 A;  3TDI A;  1CFC A;  1JBA A;  1VRK A;  1L2O B;  2E6W A;  1PSR A;  4QJ3 B;  4AOM A;  1EJ3 A;  2JNF A;  4JPZ B;  3I5F B;  3SIA A;  4L9M A;  4I5L B;  4NQG A;  4DCK A;  2K7O A;  2OPO A;  2QPT A;  4PE7 A;  1DJX A;  3A8R A;  4ZCU A;  1NCY A;  3I5F C;  3TZ1 A;  3FIA A;  2M97 A;  1H4B A;  1S26 D;  1M63 B;  1JF2 A;  2JRF A;  3I5H B;  1DJG A;  2LAP A;  3GOF A;  4F0Z B;  1FI6 A;  2ZND A;  1RRO A;  4GGN A;  2LE9 B;  3O78 A;  4XJK B;  1XVJ A;  3JVT B;  2OS8 C;  3RLZ A;  1F54 A;  2H61 C;  4GFT A;  4M2P A;  4NDB A;  4FQO A;  1OZS A;  2I2R E;  1K95 A;  3JVT C;  1YUT A;  2G2B A;  1J7P A;  1B8L A;  2KFH A;  3CR5 X;  2K61 A;  4P5O E;  3GK4 X;  5CSN A;  5B8I B;  1YUR A;  1JWD A;  1K96 A;  2Y1N A;  4ICB A;  3SG5 A;  1WDC C;  2BL0 B;  1KQV A;  2Y5I A;  1NUB A;  1PK0 D;  2JT8 A;  2LAN A;  2MBX A;  4N5X A;  2BE4 A;  1YX8 A;  3SIB A;  1K94 A;  2PVB A;  1ZUZ A;  2BL0 C;  1XYD A;  4A4C A;  1TNQ A;  1XK4 C;  2JT3 A;  2MLF C;  1KK7 Z;  2F8P A;  4QJ4 B;  1S1E A;  1AP4 A;  2L4I A;  1NCZ A;  1UHH A;  3HCM A;  2M3W A;  3CR2 A;  1NP8 A;  4BY5 A;  3OP0 A;  4N1G A;  1XFZ O;  4GPL B;  1SKT A;  3D10 A;  4ORB B;  3VRO A;  2M0R A;  2MLE C;  1V1G A;  2WCF A;  3BXK A;  2KI6 C;  2PSR A;  3ICB A;  3NSK A;  2LLU A;  3EKJ A;  4GGF C;  1BR1 B;  1GGZ A;  2L50 A;  3NXA A;  2KFG A;  4YI8 A;  1IQ3 A;  2NCO A;  4GNK B;  1KK8 C;  2K7C A;  2LM5 A;  3AKA A;  5AXI A;  1K90 D;  2H61 A;  2K7B A;  3PN7 C;  1Y1U A;  2KI4 C;  1EG3 A;  1QX2 A;  3KO0 A;  1QLS A;  2L4H A;  1KFU S;  3OB2 B;  4XJK A;  3LLE A;  1XFY O;  1J7O A;  1YRT B;  2KGB C;  2ZN9 A;  1DTL A;  1QJT A;  2A4J A;  2HPS A;  4OKH A;  1ODB A;  1KQM B;  1CLL A;  1QS7 A;  1QX5 B;  1WRL A;  2PAS A;  4YBH B;  4YGA A;  4I5N B;  2M29 A;  3VRQ A;  4WQ3 A;  3VGO A;  1IKU A;  1EXR A;  2NZ0 A;  2B1U A;  3BUO B;  2KYF A;  1R2U A;  2K7D A;  4HRE E;  2KFF A;  2KHN A;  3AAK A;  1OQP A;  2M1K B;  3OX6 A;  1J1D A;  2KYC A;  1GJY A;  1F8H A;  1CDP A;  1TTX A;  5PAL A;  3I5I C;  2AMI A;  2LUC A;  3IF7 A;  3IQO A;  4MBE A;  2IS9 A;  4YGE B;  1NYA A;  2M49 B;  2BKI B;  3PSR A;  2LCP A;  3GK2 A;  1F4O A;  1XK4 A;  2M1U A;  2TN4 A;  1QXP A;  1A75 B;  3HX4 A;  5DKN A;  4PCW A;  5I2O A;  2HET A;  1PRW A;  2MHH A;  1SNL A;  5JJG A;  2MRD A;  1DF0 B;  3CGA A;  1JC2 A;  1AJ4 A;  1RJV A;  2BKH B;  1J1E A;  1UHK A;  1WRK A;  4MEW A;  5ER4 X;  1J55 A;  4U8D A;  1TIZ A;  3KHE A;  1BF5 A;  2EGD A;  3KEV A;  1NX0 A;  4R1E A;  4MRY A;  1C7V A;  4Q04 A;  2LHL A;  1YTZ C;  4PHK A;  4GGF A;  1B8C A;  1AK8 A;  3DVJ A;  2O5G A;  3D0Y B;  4JQ0 D;  3PAT A;  1CKK A;  1NX2 A;  1Y6W A;  1JUO A;  3KPX A;  2LLS A;  4OV2 A;  1YUS A;  1L2O C;  1SY9 A;  4ORC B;  2F2P A;  2JU0 A;  1XFV O;  4YGB B;  1AVS A;  1UHJ A;  2EHB A;  2ZRT A;  3BOW A;  1U5I B;  4C0K A;  2BBM A;  1SCM B;  2JQ6 A;  1CNP A;  1SCV A;  2LVV A;  3TUY B;  1W7J B;  2BCA A;  5I2Q A;  2QAC A;  2BBN A;  3BUN B;  3EK8 A;  3O2P A;  2P6B B;  1XFU O;  1XFX O;  3VRP A;  1SK6 D;  1GGW A;  3LK1 A;  2FOT A;  3O4Y A;  3I5H C;  1OMD A;  3EVV A;  1ZOT B;  2JOJ A;  1PUL A;  1QVI Z;  2VRG A;  4PE1 A;  1BOD A;  4YGC B;  1SBJ A;  2GGZ A;  4PAL A;  3M0W A;  2MJW B;  3DVK A;  4GAO A;  1F55 A;  4CFQ A;  5FYX A;  5DKR A;  1CDN A;  2JNX A;  5AFP A;  1CB1 A;  1K9U A;  2M9G A;  3BUX B;  3PAL A;  1NPQ A;  3BUM B;  4TNC A;  4JWQ A;  1CLB A;  3E3R A;  2CT9 A;  4GUK A;  5G08 A;  4CPV A;  1A75 A;  3OHM B;  4YRU A;  1DF0 A;  2NXQ A;  4C0J A;  1NCX A;  2LHI A;  1MF8 B;  5KSZ A;  2KDH A;  1AHR A;  4E68 A;  1K93 D;  1B9A A;  1N0Y A;  2G9B A;  1UWO A;  1TCO B;  2ZKM X;  4I5K A;  2JXL A;  2HF5 A;  2O60 A;  1KFX L;  1LXF C;  1YVL A;  2K8M B;  3EK4 A;  1DJY A;  2Y4Q A;  4WRI A;  3TS5 B;  2LP3 A;  2KI6 D;  2FJU B;  1IWQ A;  3O6B A;  1KFX S;  1W7I B;  1K9P A;  2WND A;  2L0P A;  2I94 A;  4PHJ A;  1KCY A;  1S5G Z;  4OCI A;  1TCF A;  3EVU A;  4A4B A;  1EH2 A;  1G8I A;  1HT9 A;  2LVJ A;  2K0J A;  4BY4 A;  1AJ5 A;  4AQJ A;  1A03 A;  1KSO A;  3BYA A;  5D69 A;  2L98 A;  2I18 A;  2ZFD A;  1YR5 A;  3RM1 A;  3A4U B;  1EG4 A;  2Q4U A;  1BT6 A;  2LC5 A;  2ZNE A;  2GGM A;  1BLQ A;  3JTD B;  4MRX A;  1B47 A;  2NCP A;  4IL1 A;  5AER A;  1BMO A;  2MA2 A;  3I5G B;  1CDM A;  4MZL A;  1K2H A;  5DKQ A;  2H2K A;  3DVE A;  1CLM A;  1JSA A;  1QVI Y;  4YI9 A;  3JTD C;  3SG2 A;  1IQ5 A;  2L2E A;  1BR4 B;  1A4P A;  1YRU B;  3CZT X;  3OB1 B;  1MHO A;  2KAY A;  1KQM C;  1SW8 A;  3WHU B;  1TNX A;  1XO5 A;  3CS1 A;  4NDC A;  2HQ8 A;  3PFV A;  1F70 A;  4PHN A;  3BQ3 A;  5ER5 A;  1JF0 A;  4DUQ A;  2LMV A;  4HRG A;  4AQI A;  3LK0 A;  3QRX A;  1XA5 A; 
#chains in the Genus database with same CATH topology
 1JSA A;  2F3Z A;  5HKZ A;  1BOC A;  4DS7 A;  1OOG A;  1MXL C;  1BJF A;  1SR6 B;  4UPG A;  1LA3 A;  2AUC A;  1X02 A;  3SG3 A;  1A29 A;  2L2C A;  2LVI A;  2PRU A;  1SYM A;  1M45 A;  2EC6 B;  2WCB A;  5I8N A;  2M8U A;  1XFR A;  1OSA A;  2RGI A;  3CTN A;  5I94 A;  1QAT A;  2JTT A;  1KK7 Y;  1NX1 A;  1SPY A;  1SL7 A;  4IJ7 A;  3F45 A;  3R72 A;  4JD9 A;  5GQQ C;  3TDU A;  2WOR A;  1DJI A;  1PSB A;  3LCP C;  2AAO A;  1CMG A;  1WY9 A;  2F2O A;  1IJ5 A;  1HQV A;  4ETO A;  2SCP A;  1DQE A;  2QEV A;  1NIW A;  1F71 A;  2BE6 A;  5IBW A;  1S36 A;  3TDZ A;  1QAS A;  2WC8 A;  5CSJ A;  3BFA A;  5HYD A;  1A2X A;  2JPT A;  4OVN F;  1CM4 A;  3BFB A;  2BAP A;  1ZMZ A;  2D8N A;  3FE8 A;  4CFR A;  1FPW A;  3DVM A;  1G33 A;  2MAZ A;  1K8U A;  1DJZ A;  1V1F A;  2H8V A;  4M2O A;  1MXE A;  1SCM C;  2LMT A;  5TNC A;  4N1F A;  3SG4 A;  3WNX B;  2L5X B;  4NDD A;  1Y1A A;  1YUU A;  3CAB A;  3GK1 A;  3TUY C;  1UHI A;  2Q91 A;  1CFF A;  2LNK A;  1D1O A;  1LA0 A;  1C7W A;  4I5J A;  3DD4 A;  1QWV A;  2COL B;  1S6I A;  2L51 A;  4MN0 A;  1MQ1 A;  2P70 A;  1WLM A;  2LV7 A;  1BU3 A;  1DGV A;  5AEQ A;  1S6C A;  4OR9 B;  2KBI A;  3FWC A;  2OS8 B;  2BCX A;  3SJS A;  2JT0 A;  1QV0 A;  2WCL A;  5CSF A;  2JZI A;  3IQQ A;  1OOJ A;  1L7Z A;  2LLT A;  2KOT A;  4CLN A;  5K89 A;  1W9Z A;  2WOS A;  1PVB A;  2WC5 A;  4INX A;  2JUL A;  4YGD B;  5CPV A;  1E8A A;  1TNW A;  3CZ1 A;  2PMY A;  3S0E A;  3OGN A;  1J7R A;  1CFD A;  3SG6 A;  1DMO A;  2ZRS A;  1IRJ A;  2KPH A;  3VRN A;  3C1V A;  5F6T A;  1C07 A;  1FI5 A;  1IH0 A;  2JWW A;  2Y1M A;  1QTX A;  4F7F A;  2CNP A;  2KGR A;  2ZN8 A;  2LMU A;  1OZO A;  1WDC B;  3NSL A;  5JOL A;  1GQM A;  1OOF A;  1WRZ A;  4MZK A;  1FF1 A;  1EL4 A;  5HKW A;  2JXC A;  1JFJ A;  1MWN A;  3PM8 A;  2PAL A;  4CID A;  1AUI B;  2BEC A;  3EKH A;  3K21 A;  3L4L A;  1CM1 A;  3D0Y A;  1IGV A;  3BUW B;  2FCD A;  1PVA A;  5AAN A;  1DJW A;  1LVC D;  4ZCV A;  2K2A A;  3UO9 A;  3KF9 A;  1B7T Z;  2NLN A;  1B4C A;  2KAV A;  3B88 A;  1SL8 A;  3CWG A;  1UUR A;  1OOI X;  1SMG A;  4HRH A;  1U5I A;  4FTG A;  1TUJ A;  1ALV A;  2F33 A;  2SAS A;  3EVR A;  3TS5 C;  4QJ5 B;  1Y0V H;  3DF0 B;  1N2D A;  1REC A;  1SL9 A;  2F3Y A;  1RFJ A;  4C0L A;  4P2Y B;  4MLW A;  4HSZ A;  1IG5 A;  1UUS A;  4MSP A;  3EK7 A;  2DOQ A;  1OE9 B;  3CR4 X;  4D1E A;  2JTZ A;  2L5Y A;  3FWB A;  3FS7 A;  3ZWH A;  1DVI A;  1YX7 A;  1Y1X A;  1YVH A;  1M39 A;  5HLO A;  1S3P A;  1NSH A;  1QV1 A;  1LKJ A;  1KK8 B;  1TN4 A;  4JKT A;  1S6J A;  4XYN A;  1N65 A;  3IVT A;  3R1V A;  4WQ2 A;  4M2Q A;  3PN7 B;  4GBA A;  2KI4 B;  2M7N A;  3BOW B;  5KU1 A;  1ALW A;  1KFU L;  1QIV A;  1RWY A;  3I5G C;  1CDL A;  3CLN A;  3NSI A;  3OX5 A;  2M7L A;  2KQ6 A;  2FCE A;  3UNW A;  3LL8 B;  5CSI A;  3WHT B;  1BG1 A;  1B8R A;  2WCE A;  2QEB A;  2ERB A;  2BCB A;  2CXJ A;  4PHM A;  2LP2 A;  2HQW A;  1FBV A;  3DZT A;  1B1G A;  1M46 A;  5D7F A;  1WLZ A;  2KNE A;  4PE0 A;  1MUX A;  3DXL A;  5BPJ A;  1LIN A;  2CCM A;  3AKB A;  1TNP A;  3Q8I A;  2CTN A;  2KAX A;  3I5I B;  2V53 A;  1DGU A;  2ISD A;  1J7Q A;  1QIW A;  1SRA A;  1R6P A;  1UHN A;  4USL A;  3EG5 B;  1MR8 A;  2LVK A;  1CMF A;  1SR6 C;  1TRF A;  4MZJ A;  5HKY A;  2E30 A;  1UP5 A;  2GV5 A;  1QLK A;  1IJ6 A;  3SG7 A;  1FW4 A;  2K2F A;  2OTG B;  2KQY A;  4DIR A;  1ZFS A;  1DC1 A;  2WC6 A;  2EC6 C;  1SSE B;  3NSO A;  4MVF A;  2LUX A;  1OMV A;  5HLV A;  4ORA B;  1KWO B;  1F4Q A;  2KSP A;  2PQL A;  4PE4 A;  4PDZ A;  5FI6 A;  1NX3 A;  1QX7 A;  1DJH A;  2I7A A;  1K9K A;  2OTG C;  3D75 A;  3V2L A;  1B7T Y;  2CBL A;  1ZAC A;  3ZNI A;  1PAL A;  1RK9 A;  1CFP A;  1CTR A;  1RTP 1;  1G4Y R;  2KBM A;  1XFW O;  1TOP A;  1Q80 A;  3H4S E;  1KWO C;  3WXA A;  1DT7 B;  1H8B A;  4DRW A;  1NWD A;  3DF0 A;  3DYE A;  1KSM A;  1S5G Y;  5I2L A;  3VRR A;  3PLF B;  2JC2 A;  3AAJ A;  5KTY A;  3MSE B;  4INW A;  1JFK A;  2R2I A;  1OMR A;  5J3X A;  1M31 A;  3TDI A;  1CFC A;  1JBA A;  1VRK A;  1L2O B;  1TUZ A;  2E6W A;  1PSR A;  4QJ3 B;  4AOM A;  1EJ3 A;  2JNF A;  3FE6 A;  4JPZ B;  3I5F B;  4KYN A;  3SIA A;  4L9M A;  4I5L B;  4NQG A;  4DCK A;  2K7O A;  2OPO A;  2QPT A;  3NHT A;  4PE7 A;  1C3Y A;  1DJX A;  3A8R A;  1OW4 A;  4ZCU A;  1NCY A;  3I5F C;  3TZ1 A;  3FIA A;  2M97 A;  1H4B A;  1S26 D;  1M63 B;  4OZD A;  3NGV A;  1JF2 A;  2JRF A;  3I5H B;  1DJG A;  2LAP A;  3GOF A;  4F0Z B;  1FI6 A;  2ZND A;  1RRO A;  4GGN A;  2FJY A;  3CDN A;  2LE9 B;  3O78 A;  4XJK B;  3S0F A;  1XVJ A;  3JVT B;  1T14 A;  2OS8 C;  3RLZ A;  1F54 A;  2H61 C;  4GFT A;  4M2P A;  4NDB A;  3D76 A;  1OZS A;  4FQO A;  2I2R E;  1K95 A;  3JVT C;  1YUT A;  1DEL A;  2G2B A;  4PT1 A;  2WCK A;  1J7P A;  1B8L A;  2KFH A;  3CR5 X;  2KLD A;  2K61 A;  4P5O E;  3GK4 X;  5CSN A;  5B8I B;  1YUR A;  1JWD A;  1K96 A;  2Y1N A;  2YGU A;  4ICB A;  3SG5 A;  1WDC C;  2BL0 B;  1KQV A;  2WCJ A;  2Y5I A;  5D3O A;  1NUB A;  1PK0 D;  2JT8 A;  3D77 A;  2LAN A;  2MBX A;  4N5X A;  2BE4 A;  1YX8 A;  3SIB A;  1K94 A;  2PVB A;  1ZUZ A;  2BL0 C;  5EL2 A;  1XYD A;  4A4C A;  1TNQ A;  1XK4 C;  2JT3 A;  2MLF C;  1KK7 Z;  2F8P A;  3PM2 A;  1S1E A;  3BJH A;  4QJ4 B;  5FI2 A;  1AP4 A;  2L4I A;  1NCZ A;  1UHH A;  3HCM A;  2M3W A;  3CR2 A;  1NP8 A;  4BY5 A;  3OP0 A;  2P71 A;  4N1G A;  1XFZ O;  4GPL B;  1SKT A;  3N7H A;  3D10 A;  4ORB B;  3VRO A;  2M0R A;  2MLE C;  1IIO A;  1V1G A;  2WCF A;  1OOH A;  3BXK A;  2KI6 C;  2PSR A;  3ICB A;  2GTE A;  3NSK A;  4FQT A;  2LLU A;  3B6X A;  3EKJ A;  4GGF C;  1TWO A;  1BR1 B;  1GGZ A;  2L50 A;  3NXA A;  2KFG A;  4YI8 A;  1IQ3 A;  2NCO A;  1Z2C B;  4GNK B;  1KK8 C;  2K7C A;  2LM5 A;  3AKA A;  5AXI A;  1K90 D;  1Z4H A;  2H61 A;  1C3Z A;  2K7B A;  2KLE A;  3PN7 C;  1Y1U A;  2KI4 C;  1EG3 A;  1QX2 A;  3CZ0 A;  1QLS A;  2L4H A;  1KFU S;  3KO0 A;  3OB2 B;  3LLE A;  1XFY O;  4XJK A;  3S0G A;  1J7O A;  2QEO A;  1YRT B;  2KGB C;  2ZN9 A;  1DTL A;  1QJT A;  2A4J A;  2HPS A;  4OKH A;  1ODB A;  1KQM B;  1CLL A;  1QS7 A;  1QX5 B;  1WRL A;  2PAS A;  4YBH B;  4YGA A;  4I5N B;  2M29 A;  3VRQ A;  3B86 A;  4WQ3 A;  3VGO A;  1IKU A;  1EXR A;  3CZ2 A;  2NZ0 A;  2B1U A;  3BUO B;  2KYF A;  1R2U A;  2K7D A;  4HRE E;  2KFF A;  2KHN A;  3AAK A;  1OQP A;  2M1K B;  3OX6 A;  1J1D A;  2KYC A;  1GJY A;  1F8H A;  1CDP A;  1TTX A;  5PAL A;  3I5I C;  2AMI A;  2PYQ A;  2LUC A;  3B87 A;  3IF7 A;  3IQO A;  4MBE A;  2IS9 A;  4YGE B;  1NYA A;  2M49 B;  2BKI B;  3SS5 A;  3PSR A;  2LCP A;  3GK2 A;  1XK4 A;  1F4O A;  2M1U A;  2TN4 A;  1QXP A;  1A75 B;  3HX4 A;  5DKN A;  5FI7 A;  4PCW A;  5I2O A;  2HET A;  1PRW A;  2QDI A;  2MHH A;  1SNL A;  5JJG A;  2MRD A;  1DF0 B;  3CGA A;  3K1E A;  1JC2 A;  1AJ4 A;  3S0D A;  1RJV A;  2BKH B;  1J1E A;  1UHK A;  1WRK A;  4MEW A;  5ER4 X;  1J55 A;  4U8D A;  1TIZ A;  3KHE A;  1BF5 A;  1GM0 A;  2EGD A;  3KEV A;  1NX0 A;  3D73 A;  4R1E A;  4MRY A;  1C7V A;  4Q04 A;  2LHL A;  1YTZ C;  4PHK A;  3B7A A;  4GGF A;  1B8C A;  1AK8 A;  3DVJ A;  2O5G A;  3D0Y B;  4JQ0 D;  3PAT A;  3D78 A;  1CKK A;  1NX2 A;  1Y6W A;  1JUO A;  3KPX A;  1ORG A;  2LLS A;  4OV2 A;  1YUS A;  3NHI A;  1L2O C;  1SY9 A;  4ORC B;  2F2P A;  2JU0 A;  1XFV O;  4YGB B;  1AVS A;  1UHJ A;  2EHB A;  2ZRT A;  3BOW A;  1U5I B;  4C0K A;  3CYZ A;  2BBM A;  1SCM B;  2JQ6 A;  1CNP A;  1P28 A;  1SCV A;  2LVV A;  3TUY B;  1W7J B;  2BCA A;  3QME A;  5I2Q A;  3DY9 A;  2QAC A;  2K60 A;  2BBN A;  3BUN B;  3EK8 A;  3O2P A;  2P6B B;  1XFU O;  1XFX O;  3VRP A;  1SK6 D;  1GGW A;  3LK1 A;  2FOT A;  3O4Y A;  3I5H C;  1OMD A;  3EVV A;  1ZOT B;  2JOJ A;  1PUL A;  1QVI Z;  2VRG A;  4PE1 A;  1BOD A;  2BNX A;  4YGC B;  1SBJ A;  2GGZ A;  4PAL A;  3M0W A;  2MJW B;  3DVK A;  4GAO A;  1F55 A;  4CFQ A;  5FYX A;  5DKR A;  3SS3 A;  2JNX A;  5AFP A;  1CDN A;  1CB1 A;  1K9U A;  2M9G A;  3BUX B;  3PAL A;  1NPQ A;  3BUM B;  4TNC A;  4JWQ A;  1CLB A;  3E3R A;  2CT9 A;  1LS8 A;  4GUK A;  5G08 A;  4CPV A;  1A75 A;  3OHM B;  4YRU A;  1DF0 A;  2NXQ A;  4C0J A;  1NCX A;  2WCM A;  2LHI A;  1MF8 B;  5KSZ A;  2KDH A;  3O4X A;  1AHR A;  3SS4 A;  4E68 A;  1K93 D;  1B9A A;  1N0Y A;  2G9B A;  1UWO A;  1TCO B;  2ZKM X;  4I5K A;  2JXL A;  2HF5 A;  2O60 A;  1KFX L;  3RZS A;  1LXF C;  1YVL A;  2K8M B;  2JPO A;  3EK4 A;  1DJY A;  2Y4Q A;  4WRI A;  3TS5 B;  2LP3 A;  2KI6 D;  2FJU B;  1IWQ A;  3O6B A;  1KFX S;  1W7I B;  5HL1 A;  1K9P A;  2WND A;  2L0P A;  2I94 A;  3R1O A;  4PHJ A;  5DIC A;  1KCY A;  1S5G Z;  4OCI A;  1TCF A;  3D74 A;  3EVU A;  4A4B A;  1EH2 A;  1G8I A;  1HT9 A;  2LVJ A;  2K0J A;  4BY4 A;  1AJ5 A;  4AQJ A;  1A03 A;  1KSO A;  3OBV A;  3S0A A;  3BYA A;  5D69 A;  2L98 A;  2I18 A;  2ZFD A;  1YR5 A;  3RM1 A;  3A4U B;  1EG4 A;  2Q4U A;  1BT6 A;  2LC5 A;  2ZNE A;  2GGM A;  1BLQ A;  3JTD B;  4MRX A;  1B47 A;  2NCP A;  4IL1 A;  3PJI A;  5AER A;  1DEK A;  3S0B A;  1BMO A;  2MA2 A;  3I5G B;  3L47 A;  1CDM A;  4MZL A;  1K2H A;  5DKQ A;  2H2K A;  3DVE A;  1CLM A;  3VB1 A;  1QVI Y;  2QEH A;  4YI9 A;  3L4A A;  2WCH A;  3JTD C;  3SG2 A;  1IQ5 A;  2L2E A;  1BR4 B;  1A4P A;  1YRU B;  3CZT X;  3OB1 B;  1MHO A;  2KAY A;  1KQM C;  1SW8 A;  3WHU B;  1TNX A;  1XO5 A;  3CS1 A;  4NDC A;  3FE9 A;  2HQ8 A;  3PFV A;  1F70 A;  4PHN A;  3BQ3 A;  5ER5 A;  1JF0 A;  4DUQ A;  2LMV A;  3R1P A;  3BFH A;  4HRG A;  3LK0 A;  4AQI A;  3QRX A;  1XA5 A; 
#chains in the Genus database with same CATH homology
 2F3Z A;  5HKZ A;  1BOC A;  4DS7 A;  1MXL C;  1BJF A;  1SR6 B;  4UPG A;  1LA3 A;  2AUC A;  1X02 A;  3SG3 A;  1A29 A;  2LVI A;  2PRU A;  1SYM A;  1M45 A;  2EC6 B;  2WCB A;  5I8N A;  2M8U A;  3CTN A;  1OSA A;  2RGI A;  1QAT A;  2JTT A;  1KK7 Y;  1NX1 A;  1SPY A;  1SL7 A;  3F45 A;  5GQQ C;  3TDU A;  2WOR A;  1DJI A;  1PSB A;  3LCP C;  2AAO A;  1CMG A;  1WY9 A;  2F2O A;  1IJ5 A;  1HQV A;  4ETO A;  2SCP A;  1NIW A;  1F71 A;  2BE6 A;  5IBW A;  1S36 A;  3TDZ A;  1QAS A;  2WC8 A;  5CSJ A;  5HYD A;  1A2X A;  2JPT A;  4OVN F;  1CM4 A;  1ZMZ A;  2D8N A;  4CFR A;  1FPW A;  3DVM A;  1G33 A;  2MAZ A;  1K8U A;  1DJZ A;  1V1F A;  4M2O A;  1MXE A;  1SCM C;  2LMT A;  5TNC A;  4N1F A;  3SG4 A;  3WNX B;  2L5X B;  4NDD A;  1Y1A A;  1YUU A;  3GK1 A;  3TUY C;  1UHI A;  2Q91 A;  1CFF A;  2LNK A;  1D1O A;  1LA0 A;  1C7W A;  4I5J A;  3DD4 A;  2COL B;  1S6I A;  2L51 A;  4MN0 A;  1MQ1 A;  1WLM A;  2LV7 A;  1BU3 A;  1DGV A;  5AEQ A;  1S6C A;  4OR9 B;  2KBI A;  3FWC A;  2OS8 B;  2BCX A;  3SJS A;  2JT0 A;  1QV0 A;  5CSF A;  2JZI A;  3IQQ A;  1OOJ A;  1L7Z A;  2LLT A;  2KOT A;  4CLN A;  5K89 A;  2WOS A;  1PVB A;  2JUL A;  4YGD B;  5CPV A;  1E8A A;  1TNW A;  2PMY A;  1J7R A;  1CFD A;  3SG6 A;  1DMO A;  2ZRS A;  1IRJ A;  3VRN A;  3C1V A;  5F6T A;  1C07 A;  1FI5 A;  1IH0 A;  2JWW A;  2Y1M A;  1QTX A;  2CNP A;  2KGR A;  2ZN8 A;  2LMU A;  1OZO A;  1WDC B;  3NSL A;  5JOL A;  1GQM A;  1WRZ A;  4MZK A;  1FF1 A;  1EL4 A;  5HKW A;  2JXC A;  1JFJ A;  1MWN A;  3PM8 A;  2PAL A;  4CID A;  1AUI B;  2BEC A;  3EKH A;  3K21 A;  1CM1 A;  3D0Y A;  1IGV A;  3BUW B;  2FCD A;  1PVA A;  5AAN A;  1DJW A;  1LVC D;  4ZCV A;  2K2A A;  3KF9 A;  1B7T Z;  2NLN A;  1B4C A;  2KAV A;  1SL8 A;  3CWG A;  1UUR A;  1SMG A;  4HRH A;  1U5I A;  4FTG A;  1ALV A;  2F33 A;  2SAS A;  3EVR A;  3TS5 C;  4QJ5 B;  1Y0V H;  3DF0 B;  1N2D A;  1REC A;  1SL9 A;  2F3Y A;  1RFJ A;  4C0L A;  4P2Y B;  4MLW A;  4HSZ A;  1IG5 A;  1UUS A;  4MSP A;  3EK7 A;  2DOQ A;  1OE9 B;  3CR4 X;  4D1E A;  2JTZ A;  3FWB A;  3ZWH A;  3FS7 A;  1DVI A;  1Y1X A;  1YVH A;  1YX7 A;  1M39 A;  5HLO A;  1S3P A;  1NSH A;  1QV1 A;  1LKJ A;  1KK8 B;  1TN4 A;  4XYN A;  1S6J A;  1N65 A;  4WQ2 A;  4M2Q A;  3PN7 B;  4GBA A;  2KI4 B;  2M7N A;  3BOW B;  5KU1 A;  1ALW A;  1KFU L;  1QIV A;  1RWY A;  3I5G C;  1CDL A;  3CLN A;  3NSI A;  3OX5 A;  2M7L A;  2KQ6 A;  2FCE A;  3LL8 B;  5CSI A;  3WHT B;  1BG1 A;  1B8R A;  2WCE A;  2BCB A;  2CXJ A;  4PHM A;  2LP2 A;  2HQW A;  1FBV A;  1B1G A;  1M46 A;  5D7F A;  1WLZ A;  2KNE A;  4PE0 A;  1MUX A;  5BPJ A;  1LIN A;  2CCM A;  3AKB A;  1TNP A;  2CTN A;  2KAX A;  3I5I B;  2V53 A;  1DGU A;  2ISD A;  1J7Q A;  1QIW A;  1SRA A;  1R6P A;  1UHN A;  4USL A;  1MR8 A;  2LVK A;  1CMF A;  1SR6 C;  1TRF A;  4MZJ A;  5HKY A;  2E30 A;  1UP5 A;  2GV5 A;  1QLK A;  1IJ6 A;  3SG7 A;  1FW4 A;  2K2F A;  2OTG B;  2KQY A;  4DIR A;  1ZFS A;  2EC6 C;  4MVF A;  3NSO A;  2LUX A;  1OMV A;  5HLV A;  4ORA B;  1KWO B;  1F4Q A;  2KSP A;  4PE4 A;  4PDZ A;  1NX3 A;  1QX7 A;  1DJH A;  2I7A A;  1K9K A;  2OTG C;  1B7T Y;  2CBL A;  1ZAC A;  3ZNI A;  1PAL A;  1RK9 A;  1CFP A;  1CTR A;  1RTP 1;  1G4Y R;  2KBM A;  1XFW O;  1TOP A;  1Q80 A;  3H4S E;  1KWO C;  3WXA A;  1DT7 B;  1H8B A;  4DRW A;  1NWD A;  3DF0 A;  1KSM A;  1S5G Y;  5I2L A;  3VRR A;  3PLF B;  2JC2 A;  3AAJ A;  5KTY A;  3MSE B;  1JFK A;  2R2I A;  1OMR A;  5J3X A;  1M31 A;  3TDI A;  1CFC A;  1JBA A;  1VRK A;  1L2O B;  2E6W A;  1PSR A;  4QJ3 B;  4AOM A;  1EJ3 A;  2JNF A;  4JPZ B;  3I5F B;  3SIA A;  4L9M A;  4I5L B;  4NQG A;  4DCK A;  2K7O A;  2OPO A;  2QPT A;  4PE7 A;  1DJX A;  3A8R A;  4ZCU A;  1NCY A;  3I5F C;  3TZ1 A;  3FIA A;  2M97 A;  1H4B A;  1S26 D;  1M63 B;  1JF2 A;  2JRF A;  3I5H B;  1DJG A;  2LAP A;  3GOF A;  4F0Z B;  1FI6 A;  2ZND A;  1RRO A;  4GGN A;  2LE9 B;  3O78 A;  4XJK B;  1XVJ A;  3JVT B;  2OS8 C;  3RLZ A;  1F54 A;  2H61 C;  4GFT A;  4M2P A;  4NDB A;  4FQO A;  1OZS A;  2I2R E;  1K95 A;  3JVT C;  1YUT A;  2G2B A;  1J7P A;  1B8L A;  2KFH A;  3CR5 X;  2K61 A;  4P5O E;  3GK4 X;  5CSN A;  5B8I B;  1YUR A;  1JWD A;  1K96 A;  2Y1N A;  4ICB A;  3SG5 A;  1WDC C;  2BL0 B;  1KQV A;  2Y5I A;  1NUB A;  1PK0 D;  2JT8 A;  2LAN A;  2MBX A;  4N5X A;  2BE4 A;  1YX8 A;  3SIB A;  1K94 A;  2PVB A;  1ZUZ A;  2BL0 C;  1XYD A;  4A4C A;  1TNQ A;  1XK4 C;  2JT3 A;  2MLF C;  1KK7 Z;  2F8P A;  4QJ4 B;  1S1E A;  1AP4 A;  2L4I A;  1NCZ A;  1UHH A;  3HCM A;  2M3W A;  3CR2 A;  1NP8 A;  4BY5 A;  3OP0 A;  4N1G A;  1XFZ O;  4GPL B;  1SKT A;  3D10 A;  4ORB B;  3VRO A;  2M0R A;  2MLE C;  1V1G A;  2WCF A;  3BXK A;  2KI6 C;  2PSR A;  3ICB A;  3NSK A;  2LLU A;  3EKJ A;  4GGF C;  1BR1 B;  1GGZ A;  2L50 A;  3NXA A;  2KFG A;  4YI8 A;  1IQ3 A;  2NCO A;  4GNK B;  1KK8 C;  2K7C A;  2LM5 A;  3AKA A;  5AXI A;  1K90 D;  2H61 A;  2K7B A;  3PN7 C;  1Y1U A;  2KI4 C;  1EG3 A;  1QX2 A;  3KO0 A;  1QLS A;  2L4H A;  1KFU S;  3OB2 B;  4XJK A;  3LLE A;  1XFY O;  1J7O A;  1YRT B;  2KGB C;  2ZN9 A;  1DTL A;  1QJT A;  2A4J A;  2HPS A;  4OKH A;  1ODB A;  1KQM B;  1CLL A;  1QS7 A;  1QX5 B;  1WRL A;  2PAS A;  4YBH B;  4YGA A;  4I5N B;  2M29 A;  3VRQ A;  4WQ3 A;  3VGO A;  1IKU A;  1EXR A;  2NZ0 A;  2B1U A;  3BUO B;  2KYF A;  1R2U A;  2K7D A;  4HRE E;  2KFF A;  2KHN A;  3AAK A;  1OQP A;  2M1K B;  3OX6 A;  1J1D A;  2KYC A;  1GJY A;  1F8H A;  1CDP A;  1TTX A;  5PAL A;  3I5I C;  2AMI A;  2LUC A;  3IF7 A;  3IQO A;  4MBE A;  2IS9 A;  4YGE B;  1NYA A;  2M49 B;  2BKI B;  3PSR A;  2LCP A;  3GK2 A;  1F4O A;  1XK4 A;  2M1U A;  2TN4 A;  1QXP A;  1A75 B;  3HX4 A;  5DKN A;  4PCW A;  5I2O A;  2HET A;  1PRW A;  2MHH A;  1SNL A;  5JJG A;  2MRD A;  1DF0 B;  3CGA A;  1JC2 A;  1AJ4 A;  1RJV A;  2BKH B;  1J1E A;  1UHK A;  1WRK A;  4MEW A;  5ER4 X;  1J55 A;  4U8D A;  1TIZ A;  3KHE A;  1BF5 A;  2EGD A;  3KEV A;  1NX0 A;  4R1E A;  4MRY A;  1C7V A;  4Q04 A;  2LHL A;  1YTZ C;  4PHK A;  4GGF A;  1B8C A;  1AK8 A;  3DVJ A;  2O5G A;  3D0Y B;  4JQ0 D;  3PAT A;  1CKK A;  1NX2 A;  1Y6W A;  1JUO A;  3KPX A;  2LLS A;  4OV2 A;  1YUS A;  1L2O C;  1SY9 A;  4ORC B;  2F2P A;  2JU0 A;  1XFV O;  4YGB B;  1AVS A;  1UHJ A;  2EHB A;  2ZRT A;  3BOW A;  1U5I B;  4C0K A;  2BBM A;  1SCM B;  2JQ6 A;  1CNP A;  1SCV A;  2LVV A;  3TUY B;  1W7J B;  2BCA A;  5I2Q A;  2QAC A;  2BBN A;  3BUN B;  3EK8 A;  3O2P A;  2P6B B;  1XFU O;  1XFX O;  3VRP A;  1SK6 D;  1GGW A;  3LK1 A;  2FOT A;  3O4Y A;  3I5H C;  1OMD A;  3EVV A;  1ZOT B;  2JOJ A;  1PUL A;  1QVI Z;  2VRG A;  4PE1 A;  1BOD A;  4YGC B;  1SBJ A;  2GGZ A;  4PAL A;  3M0W A;  2MJW B;  3DVK A;  4GAO A;  1F55 A;  4CFQ A;  5FYX A;  5DKR A;  1CDN A;  2JNX A;  5AFP A;  1CB1 A;  1K9U A;  2M9G A;  3BUX B;  3PAL A;  1NPQ A;  3BUM B;  4TNC A;  4JWQ A;  1CLB A;  3E3R A;  2CT9 A;  4GUK A;  5G08 A;  4CPV A;  1A75 A;  3OHM B;  4YRU A;  1DF0 A;  2NXQ A;  4C0J A;  1NCX A;  2LHI A;  1MF8 B;  5KSZ A;  2KDH A;  1AHR A;  4E68 A;  1K93 D;  1B9A A;  1N0Y A;  2G9B A;  1UWO A;  1TCO B;  2ZKM X;  4I5K A;  2JXL A;  2HF5 A;  2O60 A;  1KFX L;  1LXF C;  1YVL A;  2K8M B;  3EK4 A;  1DJY A;  2Y4Q A;  4WRI A;  3TS5 B;  2LP3 A;  2KI6 D;  2FJU B;  1IWQ A;  3O6B A;  1KFX S;  1W7I B;  1K9P A;  2WND A;  2L0P A;  2I94 A;  4PHJ A;  1KCY A;  1S5G Z;  4OCI A;  1TCF A;  3EVU A;  4A4B A;  1EH2 A;  1G8I A;  1HT9 A;  2LVJ A;  2K0J A;  4BY4 A;  1AJ5 A;  4AQJ A;  1A03 A;  1KSO A;  3BYA A;  5D69 A;  2L98 A;  2I18 A;  2ZFD A;  1YR5 A;  3RM1 A;  3A4U B;  1EG4 A;  2Q4U A;  1BT6 A;  2LC5 A;  2ZNE A;  2GGM A;  1BLQ A;  3JTD B;  4MRX A;  1B47 A;  2NCP A;  4IL1 A;  5AER A;  1BMO A;  2MA2 A;  3I5G B;  1CDM A;  4MZL A;  1K2H A;  5DKQ A;  2H2K A;  3DVE A;  1CLM A;  1JSA A;  1QVI Y;  4YI9 A;  3JTD C;  3SG2 A;  1IQ5 A;  2L2E A;  1BR4 B;  1A4P A;  1YRU B;  3CZT X;  3OB1 B;  1MHO A;  2KAY A;  1KQM C;  1SW8 A;  3WHU B;  1TNX A;  1XO5 A;  3CS1 A;  4NDC A;  2HQ8 A;  3PFV A;  1F70 A;  4PHN A;  3BQ3 A;  5ER5 A;  1JF0 A;  4DUQ A;  2LMV A;  4HRG A;  4AQI A;  3LK0 A;  3QRX A;  1XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...