2MJWB

Structural insights into calcium bound s100p - v domain of the receptor for advanced glycation end products (rage) complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Structural insights into calcium-bound S100P and the V domain of the RAGE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mjwB00
1S6IA 1KK8B 3OP0A 1TNPA 1YUTA 5ER5A 1NPQA 4WQ2A 1LINA 5G08A 4GPLB 3PFVA 3VROA 1OE9B 3F45A 2M9GA 4MBEA 1L2OC 3BUOB 3SIAA 1RK9A 2JZIA 3M0WA 2COLB 1B8CA 3NXAA 1A2XA 1TNXA 3LLEA 4DCKA 3MSEB 2KQYA 2M1KB 1B8LA 4AQIA 2WC8A 4QJ4B 1OZSA 1IQ3A 3I5IB 1UHJA 1YX7A 2JOJA 1KK7Z 4CFRA 1QASA 1K94A 2VRGA 3CTNA 3QRXA 1ALWA 1NX2A 2Y5IA 3I5HC 2OPOA 1ALVA 2ZN9A 1DGVA 2LVVA 2K2AA 2LHIA 1U5IA 1MWNA 4A4BA 4HRGA 1K2HA 1XO5A 1XA5A 1Y6WA 2JT3A 1SBJA 5JOLA 2JT8A 1N65A 1UHHA 3BUNB 4GGFC 1B47A 2WOSA 1PSRA 1A29A 1NX3A 1TN4A 2K0JA 3CS1A 3OX5A 2H2KA 1KWOC 1XFVO 1YUSA 4BY5A 2G2BA 4GAOA 2BL0C 1QX2A 2KDHA 2K7DA 1A4PA 3JTDC 3IQQA 3OB1B 3HX4A 4C0KA 5I2LA 2NXQA 4MZJA 1TOPA 2SCPA 3SIBA 3VRQA 1K9KA 1MXLC 3TS5C 2IS9A 1B8RA 4CFQA 2F33A 5B8IB 1TTXA 1FI5A 1J7RA 1EJ3A 2LHLA 2H61C 2Y4QA 3WXAA 1OMDA 1KFXL 1F70A 1B9AA 3RLZA 1BF5A 3SG6A 1UUSA 2CT9A 2L4HA 3HCMA 2LC5A 1QTXA 1WDCC 2I94A 1FPWA 1LA0A 1WY9A 3FS7A 3VRNA 1K93D 1J7OA 1SCVA 3VGOA 1BU3A 2BE4A 4PE4A 2LUCA 1KFUL 2MA2A 1FBVA 2JU0A 4QJ3B 4GGNA 1A75A 4ORCB 3AAKA 4D1EA 3O6BA 1QIWA 1CFPA 1PK0D 2CBLA 1CKKA 1SR6C 2PRUA 3O2PA 2TN4A 2L0PA 2P6BB 1TNWA 3D0YA 1JUOA 2PVBA 1JF0A 2JXCA 3OHMB 1DJIA 4MRYA 3EVRA 2F2PA 2WORA 3I5FC 1L2OB 1K90D 1RTP1 1S26D 4UPGA 2WCFA 1CDNA 1HQVA 5DKRA 1XFUO 1WRKA 5IBWA 2K2FA 3PN7C 1NP8A 1YTZC 1NIWA 2LP2A 1Y1UA 2G9BA 1DJHA 1YRUB 1TIZA 4GGFA 1EG4A 1ZFSA 1SPYA 4JWQA 1SYMA 2B1UA 1OOJA 1S36A 1IKUA 3PM8A 3EKHA 4TNCA 5AERA 3BQ3A 3PATA 3FWBA 4PHNA 4XJKA 3SG7A 1C7WA 1RWYA 1SY9A 1ODBA 2L5XB 1KWOB 2JNFA 5ER4X 1F71A 2I18A 4ZCUA 2QPTA 1E8AA 1YVLA 1MUXA 2BL0B 1LXFC 4MZKA 5TNCA 2BE6A 3JVTC 3RM1A 2HF5A 3TS5B 4WQ3A 1KK7Y 2RGIA 1SL7A 4MN0A 3VRPA 2F3ZA 3CR4X 4YI8A 2NZ0A 1Y0VH 2LE9B 3A4UB 2M97A 1DJZA 1Q80A 2MAZA 1OQPA 4HREE 2LNKA 2ZKMX 3WNXB 1YRTB 4ORBB 4DUQA 2E6WA 4DIRA 3EVUA 2ZNDA 4GNKB 1CNPA 1SK6D 1M63B 1V1GA 1WDCB 2EC6C 1S3PA 2BKIB 4Q04A 1ZUZA 4YGCB 1BMOA 3A8RA 1JF2A 1XK4A 5K89A 3TUYC 1JFJA 1CLLA 3KF9A 1N0YA 5DKNA 2HQ8A 1CMFA 1K96A 1OZOA 2KBIA 4HSZA 1SR6B 2KBMA 2LANA 3VRRA 4F0ZB 1K9PA 1MHOA 1C07A 2BCXA 1IGVA 1WLZA 4PALA 5D7FA 1MR8A 1YURA 1H8BA 1KFXS 3I5FB 1PALA 3FIAA 1LKJA 1UHNA 3IF7A 5AXIA 2KOTA 2L51A 2MRDA 3EVVA 1BLQA 1JBAA 4YGEB 2JTTA 2KI4C 1XFZO 2KI6D 4FTGA 1EL4A 5HKZA 3PN7B 3KPXA 1W7IB 3EK7A 4MZLA 1JWDA 2JPTA 1JSAA 2LVKA 1J55A 2K7CA 2LLTA 3AAJA 4P2YB 2ZN8A 1QIVA 1S5GY 5AANA 2MBXA 1TNQA 1M31A 3WHUB 3CR5X 1CFCA 2OTGC 1NCXA 2M1UA 4C0JA 1AVSA 2EHBA 1NCYA 3NSOA 3O78A 5HLVA 1KCYA 2KGBC 4DRWA 4GFTA 1QXPA 3DF0A 4I5LB 4I5KA 1KQMC 1WLMA 1S5GZ 5KTYA 4JPZB 4DS7A 5HKYA 3CZTX 4M2QA 2PMYA 2HPSA 2KFFA 2Q91A 2CCMA 3SG4A 4BY4A 1C7VA 1SCMC 1JFKA 1J1EA 1XK4C 4CPVA 1WRZA 1NUBA 2F2OA 5CSFA 1K8UA 1NYAA 3BUWB 3I5GC 3JVTB 1R2UA 2NCPA 2FCDA 3IQOA 1CMGA 1NSHA 2NCOA 3FWCA 1YX8A 3C1VA 4XYNA 1CDLA 1K95A 1PVAA 3K21A 4N5XA 1D1OA 2O60A 4YGBB 3D0YB 1CDMA 1DJXA 1NWDA 1UURA 2O5GA 5D69A 5J3XA 4YRUA 1DJGA 1ZACA 1VRKA 4NDDA 5I8NA 3DVEA 4M2OA 1B4CA 4OR9B 1PSBA 1G33A 1M46A 1SL8A 1BT6A 5FYXA 2EC6B 2KNEA 3D10A 4YI9A 1ZMZA 2F3YA 3TUYB 1F54A 3I5HB 1HT9A 2Y1MA 1NX0A 1G4YR 3PALA 2KSPA 1MQ1A 2LAPA 4FQOA 1J7QA 1M45A 1XYDA 2K8MB 4MEWA 1BODA 1SMGA 2L98A 2LMUA 3OX6A 3PLFB 2ZRTA 1RFJA 4GBAA 3BXKA 1YUUA 1QV0A 2M7NA 4PE1A 5KU1A 1Y1XA 1EG3A 2LP3A 5PALA 2LMTA 2A4JA 2LV7A 1FF1A 3KEVA 2AUCA 1XFYO 2JWWA 3BYAA 4AOMA 1BG1A 4ORAB 3SG5A 2NLNA 2WNDA 2MLFC 3TZ1A 3JTDB 1DF0A 1IJ6A 2DOQA 2MHHA 2EGDA 3ZNIA 2OS8C 2WCEA 1W7JB 3GK1A 4GUKA 1EXRA 4PHKA 2KYCA 5AEQA 1UWOA 3BOWA 4ZCVA 5F6TA 5JJGA 1CB1A 5I2OA 3GK2A 1MF8B 1R6PA 4L9MA 2M7LA 1SW8A 5CSIA 2L50A 1QS7A 2OTGB 3DVKA 1J1DA 4YBHB 1PRWA 2LLUA 1XFWO 1GGWA 4MRXA 4M2PA 2LVJA 1X02A 2BCBA 1KSOA 2HETA 1S1EA 3SJSA 1A03A 3ZWHA 1CM4A 1QLSA 1RECA 4E68A 4YGDB 4PHJA 2JULA 1J7PA 1RROA 2LM5A 1ZOTB 2E30A 2PASA 3EK8A 2Q4UA 1SCMB 2JC2A 3EK4A 2BKHB 1UHKA 4I5NB 3DVJA 2I7AA 1DT7B 1AHRA 2LCPA 4ICBA 2ZFDA 3I5GB 1OSAA 2MJWB 2FJUB 4U8DA 1U5IB 2KYFA 2CTNA 4OKHA 4IL1A 3NSIA 2Y1NA 4P5OE 1QJTA 1DGUA 1QX5B 2AAOA 2HQWA 4USLA 5CPVA 1IH0A 1CFDA 2ZNEA 1IWQA 2F8PA 1OMRA 1KFUS 4AQJA 2LMVA 1LVCD 2FCEA 1S6CA 4NDBA 4PE7A 4R1EA 1Y1AA 1TCOB 2BBMA 3ICBA 3OB2B 2JRFA 1XFXO 3LK0A 2ZRSA 3DD4A 1SKTA 3LK1A 1BR4B 1F4OA 1OMVA 5KSZA 1SNLA 5HKWA 2JNXA 1BOCA 1NCZA 4CLNA 2GGMA 4NQGA 1PULA 3GOFA 5DKQA 1B7TY 3SG3A 2KFHA 5HLOA 2JQ6A 4QJ5B 1KK8C 2AMIA 3TDIA 3DF0B 2M0RA 3PSRA 1FI6A 1DJYA 1GQMA 1XVJA 3BUXB 5HYDA 3DVMA 1YR5A 2OS8B 2SASA 3EKJA 1DTLA 1K9UA 1RJVA 2BCAA 1B7TZ 2JT0A 4MSPA 1CTRA 1A75B 2LUXA 4ETOA 3I5IC 1L7ZA 2PSRA 1NX1A 3LCPC 4PDZA 2M3WA 3H4SE 3KO0A 4I5JA 2KHNA 1AUIB 4JQ0D 1CLMA 2I2RE 1CM1A 2BBNA 3AKAA 2FOTA 4NDCA 1S6JA 1PVBA 1M39A 3WHTB 2R2IA 2MLEC 2WCBA 4N1GA 3CWGA 3NSKA 1EH2A 2GV5A 2M29A 4OCIA 1IJ5A 4CIDA 2M8UA 2KI6C 4PCWA 1BR1B 1UHIA 1DMOA 3NSLA 2K7BA 4PHMA 3KHEA 3CGAA 1WRLA 1AK8A 1JC2A 2GGZA 2JTZA 2L2EA 2KGRA 1AJ5A 1TRFA 3CLNA 4MVFA 1B1GA 1KQVA 4HRHA 1IQ5A 2KAYA 2D8NA 4MLWA 1DVIA 4A4CA 5GQQC 1CFFA 1CLBA 2KFGA 2L4IA 1F4QA 1BJFA 1QLKA 3LL8B 1F8HA 2K61A 1GJYA 1H4BA 1KSMA 2K7OA 2JXLA 4PE0A 2ISDA 2BECA 1QATA 3TDZA 4OV2A 1IG5A 3E3RA 3TDUA 1CDPA 1AJ4A 2PALA 5BPJA 1LA3A 1QX7A 2KAVA 2KAXA 1FW4A 2KI4B 1TCFA 3AKBA 3GK4X 2KQ6A 4WRIA 1N2DA 3CR2A 4C0LA 1UP5A 1AP4A 4N1FA 1G8IA 4XJKB 5CSJA 2QACA 1QVIY 1DJWA 5CSNA 3O4YA 1SL9A 5I2QA 1QV1A 1GGZA 1DF0B 3SG2A 4OVNF 1F55A 1SRAA 3BOWB 1MXEA 1V1FA 4YGAA 2V53A 5AFPA 2CXJA 1QVIZ 1KQMB 2CNPA 2M49B 2LLSA 1IRJA 1YVHA 3BUMB 2LVIA 2H61A
chains in the Genus database with same CATH superfamily
1S6IA 1KK8B 3OP0A 1TNPA 1YUTA 5ER5A 1NPQA 4WQ2A 1LINA 5G08A 4GPLB 3PFVA 3VROA 1OE9B 3D74A 2M9GA 3F45A 1Z4HA 1L2OC 4MBEA 3BUOB 3SIAA 3UO9A 1RK9A 2JZIA 3DY9A 3M0WA 2COLB 1B8CA 3NXAA 1A2XA 1TNXA 3LLEA 4DCKA 3MSEB 2KQYA 2M1KB 1B8LA 4AQIA 2WC8A 4QJ4B 1OZSA 1IQ3A 3S0FA 3I5IB 1UHJA 1YX7A 2JOJA 1KK7Z 4CFRA 2QEOA 3PJIA 1QASA 1K94A 2VRGA 3CTNA 3QRXA 1ALWA 1NX2A 1GM0A 2Y5IA 3I5HC 2OPOA 1ALVA 2ZN9A 1DGVA 2LVVA 2K2AA 2LHIA 1U5IA 1MWNA 1T14A 2QEHA 4HRGA 4A4BA 1K2HA 1XO5A 1XA5A 1Y6WA 2JT3A 1SBJA 5JOLA 1XFRA 2JT8A 1N65A 1UHHA 3BUNB 4GGFC 1B47A 2WOSA 1PSRA 1A29A 1NX3A 1TN4A 2K0JA 2PYQA 3CS1A 3B7AA 3OX5A 2H2KA 1KWOC 1XFVO 1YUSA 4BY5A 2G2BA 4GAOA 2BL0C 1QX2A 2KDHA 2K7DA 1A4PA 3JTDC 3IQQA 3OB1B 3HX4A 4C0KA 5I2LA 2NXQA 4MZJA 1TOPA 2SCPA 3SIBA 3VRQA 1K9KA 1MXLC 3TS5C 3BFAA 2IS9A 3R72A 1B8RA 4CFQA 2F33A 1IIOA 5B8IB 1TTXA 1FI5A 1J7RA 3B6XA 1EJ3A 2LHLA 2H61C 2Y4QA 3WXAA 1OMDA 1KFXL 1F70A 1B9AA 3RLZA 1BF5A 3SG6A 1UUSA 2CT9A 1TUZA 2L4HA 3HCMA 2LC5A 1QTXA 1WDCC 2I94A 1FPWA 1LA0A 1WY9A 3FS7A 2WC5A 1K93D 3VRNA 1J7OA 1SCVA 3VGOA 1BU3A 3R1PA 2BE4A 3DZTA 4PE4A 2LUCA 1KFUL 2MA2A 1FBVA 2JU0A 4QJ3B 4GGNA 1A75A 4ORCB 3AAKA 4D1EA 3O6BA 1QIWA 1CFPA 1PK0D 2CBLA 1TWOA 1SR6C 2PRUA 3SS5A 3O2PA 2TN4A 1CKKA 2L0PA 2P6BB 1TNWA 3D0YA 1JUOA 2PVBA 1JF0A 2JXCA 3OHMB 1DJIA 4MRYA 3EVRA 2F2PA 1DQEA 2WORA 3I5FC 1L2OB 1K90D 3RZSA 1RTP1 1S26D 4UPGA 2WCFA 1CDNA 1HQVA 1C3ZA 5DKRA 1XFUO 1WRKA 5IBWA 2K2FA 5HL1A 3L47A 3PN7C 3B87A 1NP8A 3V2LA 1YTZC 1NIWA 2LP2A 1Y1UA 2G9BA 1DJHA 1YRUB 1TIZA 3IVTA 4GGFA 1EG4A 1ZFSA 1SPYA 4JWQA 3FE9A 3CYZA 1SYMA 2B1UA 1OOJA 1S36A 1IKUA 3PM8A 3EKHA 4TNCA 5AERA 3BQ3A 3PATA 3FWBA 4PHNA 4XJKA 1OOHA 1C7WA 1RWYA 1SY9A 1ODBA 2L5XB 3SG7A 1KWOB 2JNFA 5ER4X 1F71A 2I18A 4ZCUA 2QPTA 1E8AA 1YVLA 1MUXA 2BL0B 3NHTA 1LXFC 4MZKA 5TNCA 1OOGA 2BE6A 3JVTC 3RM1A 2HF5A 3TS5B 4WQ3A 1KK7Y 2RGIA 1SL7A 4MN0A 3VRPA 5FI2A 2F3ZA 3CR4X 4YI8A 2NZ0A 1Y0VH 2LE9B 3A4UB 2M97A 1DJZA 1Q80A 2MAZA 1OQPA 4HREE 2LNKA 2ZKMX 3S0AA 3WNXB 1YRTB 4ORBB 1TUJA 4DUQA 2E6WA 4DIRA 3EVUA 2ZNDA 4GNKB 1CNPA 1SK6D 1M63B 1V1GA 1WDCB 2EC6C 1S3PA 2BKIB 4Q04A 1P28A 1ZUZA 4YGCB 1BMOA 3A8RA 1JF2A 1XK4A 5K89A 3TUYC 1JFJA 1CLLA 3KF9A 5FI7A 1DC1A 1N0YA 2ERBA 5DKNA 2HQ8A 1CMFA 3D77A 1K96A 1OZOA 2KBIA 4HSZA 1SR6B 2KBMA 2LANA 3VRRA 4F0ZB 1K9PA 1MHOA 1C07A 2BCXA 1IGVA 1WLZA 4PALA 2GTEA 5D7FA 1MR8A 1YURA 5D3OA 1H8BA 1KFXS 3I5FB 1PALA 3FIAA 1LKJA 1UHNA 3IF7A 3BFHA 5AXIA 2KOTA 2L51A 2MRDA 3EVVA 3VB1A 1BLQA 1JBAA 2K60A 2JTTA 2KI4C 1XFZO 2KI6D 4FTGA 1EL4A 4YGEB 5HKZA 3PN7B 2WCHA 1W7IB 1LS8A 3EK7A 3KPXA 4MZLA 5FI6A 1JWDA 4IJ7A 2JPTA 1JSAA 1DEKA 2LVKA 1J55A 3B86A 2K7CA 2LLTA 3AAJA 3NHIA 2ZN8A 1QIVA 1S5GY 4P2YB 5AANA 2MBXA 3L4LA 1TNQA 1M31A 3WHUB 3CR5X 5EL2A 1CFCA 2OTGC 1NCXA 2M1UA 4C0JA 1AVSA 3CZ2A 3S0GA 2EHBA 1NCYA 3NSOA 3O78A 5HLVA 1KCYA 2P70A 2KGBC 4DRWA 4GFTA 1QXPA 3DF0A 4I5LB 4I5KA 1KQMC 1WLMA 3CZ1A 1S5GZ 1ORGA 3D76A 4JPZB 5KTYA 4DS7A 5HKYA 3BJHA 3QMEA 3UNWA 3CZTX 4M2QA 2PMYA 2HPSA 2KFFA 2Q91A 2CCMA 3SG4A 4BY4A 1C7VA 1SCMC 3DYEA 1JFKA 1J1EA 1XK4C 4CPVA 2WCMA 3S0DA 1WRZA 1NUBA 2F2OA 5CSFA 1K8UA 1NYAA 3BUWB 3I5GC 3JVTB 1R2UA 2NCPA 2FCDA 3IQOA 1CMGA 1OOIX 1NSHA 2NCOA 3FWCA 1YX8A 3C1VA 3R1OA 4XYNA 1CDLA 1K95A 1PVAA 3D78A 3K21A 4N5XA 1D1OA 2O60A 3R1VA 4YGBB 3D0YB 1CDMA 1DJXA 1NWDA 1UURA 2O5GA 5D69A 5J3XA 3PM2A 4YRUA 1DJGA 1ZACA 1VRKA 4NDDA 2JPOA 5I8NA 3DVEA 4M2OA 1B4CA 4OR9B 1PSBA 1G33A 1M46A 1SL8A 1BT6A 5FYXA 2EC6B 2KNEA 3D10A 4YI9A 1ZMZA 2F3YA 3TUYB 1F54A 3I5HB 1HT9A 2Y1MA 1NX0A 1G4YR 3PALA 2KSPA 1MQ1A 2LAPA 4FQOA 1J7QA 1M45A 1XYDA 2K8MB 3D75A 4MEWA 1BODA 1SMGA 2L98A 2LMUA 3OX6A 3PLFB 2ZRTA 1RFJA 4GBAA 2KLDA 3BXKA 1YUUA 1QV0A 2M7NA 3Q8IA 4PE1A 4F7FA 2KLEA 1Y1XA 1EG3A 2LP3A 5PALA 1Z2CB 2LMTA 5KU1A 2A4JA 2LV7A 1FF1A 3KEVA 2AUCA 1XFYO 2JWWA 1SSEB 3BYAA 4AOMA 4ORAB 1BG1A 1OOFA 3SG5A 2NLNA 2WNDA 2MLFC 3TZ1A 3JTDB 2WC6A 1DF0A 1IJ6A 2DOQA 2MHHA 2EGDA 3ZNIA 2OS8C 2WCEA 1W7JB 3GK1A 4GUKA 1DELA 1EXRA 2KYCA 4PHKA 1UWOA 3BOWA 2P71A 4ZCVA 5F6TA 5AEQA 5JJGA 1CB1A 5I2OA 3GK2A 1MF8B 1R6PA 4L9MA 2M7LA 1SW8A 5CSIA 2L50A 1QS7A 2OTGB 3DVKA 1J1DA 4YBHB 1PRWA 2LLUA 1XFWO 1GGWA 4MRXA 4M2PA 2LVJA 1X02A 4JKTA 1C3YA 2BCBA 1KSOA 2L5YA 2HETA 1S1EA 2YGUA 3SJSA 1A03A 3ZWHA 1CM4A 1QLSA 1RECA 4E68A 3BFBA 4YGDB 4PHJA 2JULA 1J7PA 1RROA 2LM5A 1ZOTB 2E30A 2PASA 4INXA 3EK8A 2Q4UA 1SCMB 2JC2A 3EG5B 3EK4A 3FE6A 3FE8A 2BKHB 1UHKA 2BNXA 3DVJA 4I5NB 2I7AA 1DT7B 1AHRA 2LCPA 4ICBA 3SS3A 2ZFDA 3I5GB 1OSAA 2MJWB 2FJUB 4U8DA 1U5IB 2KYFA 2CTNA 3OBVA 4OKHA 4IL1A 2QEVA 3NSIA 3D73A 2Y1NA 4JD9A 4P5OE 1QJTA 1DGUA 2WCJA 1QX5B 2AAOA 2HQWA 4USLA 5CPVA 1IH0A 1CFDA 2ZNEA 3NGVA 1IWQA 2F8PA 3CABA 1OMRA 1KFUS 3O4XA 4AQJA 2LMVA 4INWA 1LVCD 2FCEA 1S6CA 4NDBA 4PE7A 5DICA 4R1EA 2BAPA 1Y1AA 1TCOB 2BBMA 3ICBA 3OB2B 2JRFA 1XFXO 3LK0A 2ZRSA 3DD4A 1SKTA 3LK1A 1OW4A 1BR4B 1F4OA 1OMVA 3B88A 5KSZA 1SNLA 5HKWA 2JNXA 1BOCA 1NCZA 4CLNA 2GGMA 4NQGA 1PULA 3GOFA 5DKQA 2PQLA 1B7TY 3SG3A 2KFHA 5HLOA 2JQ6A 4QJ5B 1KK8C 2AMIA 3TDIA 3DF0B 2M0RA 3PSRA 3SS4A 1FI6A 1DJYA 1GQMA 1XVJA 3BUXB 5HYDA 3DVMA 1YR5A 2OS8B 2SASA 3EKJA 1DTLA 1K9UA 1RJVA 2BCAA 1B7TZ 2JT0A 4MSPA 1CTRA 2QEBA 1A75B 2LUXA 4ETOA 3I5IC 1L7ZA 2PSRA 1NX1A 3LCPC 4PDZA 2M3WA 3H4SE 1W9ZA 3KO0A 4I5JA 3S0BA 2KHNA 1AUIB 4JQ0D 1CLMA 2I2RE 1CM1A 2BBNA 3AKAA 2FOTA 4NDCA 1S6JA 1PVBA 1M39A 2KPHA 2R2IA 2MLEC 2WCBA 4N1GA 3WHTB 3CWGA 3NSKA 1EH2A 2GV5A 2M29A 4OCIA 1IJ5A 4CIDA 2M8UA 5I94A 2KI6C 4OZDA 1BR1B 1UHIA 4PCWA 1DMOA 3NSLA 2K7BA 4PHMA 3KHEA 3CGAA 1WRLA 1AK8A 1JC2A 2GGZA 2JTZA 2L2EA 2KGRA 3S0EA 1AJ5A 1TRFA 3CLNA 4MVFA 1B1GA 1KQVA 4HRHA 1IQ5A 2KAYA 1QWVA 2D8NA 4MLWA 3CDNA 1DVIA 4A4CA 5GQQC 1CFFA 3L4AA 1CLBA 2KFGA 2L4IA 1F4QA 1BJFA 1QLKA 3LL8B 2H8VA 1F8HA 4KYNA 2K61A 1GJYA 1H4BA 1KSMA 2K7OA 2JXLA 4PE0A 2ISDA 2BECA 1QATA 3TDZA 2WCLA 4OV2A 1IG5A 3E3RA 3TDUA 1CDPA 3OGNA 1AJ4A 2PALA 5BPJA 1LA3A 1QX7A 2KAVA 2KAXA 1FW4A 4PT1A 3N7HA 2KI4B 1TCFA 3AKBA 3GK4X 2KQ6A 4WRIA 1N2DA 3CR2A 4C0LA 1UP5A 1AP4A 2FJYA 4N1FA 1G8IA 2L2CA 4FQTA 4XJKB 5CSJA 2QACA 1QVIY 3K1EA 1DJWA 2WCKA 5CSNA 3O4YA 1SL9A 5I2QA 1QV1A 1GGZA 1DF0B 3SG2A 4OVNF 3DXLA 1F55A 1SRAA 3BOWB 1MXEA 1V1FA 2QDIA 4YGAA 2V53A 5AFPA 2CXJA 3CZ0A 1QVIZ 1KQMB 2CNPA 2M49B 2LLSA 1IRJA 1YVHA 3BUMB 2LVIA 2H61A
chains in the Genus database with same CATH topology
1S6IA 1KK8B 3OP0A 1TNPA 1YUTA 5ER5A 1NPQA 4WQ2A 1LINA 5G08A 4GPLB 3PFVA 3VROA 1OE9B 3F45A 2M9GA 4MBEA 1L2OC 3BUOB 3SIAA 1RK9A 2JZIA 3M0WA 2COLB 1B8CA 3NXAA 1A2XA 1TNXA 3LLEA 4DCKA 3MSEB 2KQYA 2M1KB 1B8LA 4AQIA 2WC8A 4QJ4B 1OZSA 1IQ3A 3I5IB 1UHJA 1YX7A 2JOJA 1KK7Z 4CFRA 1QASA 1K94A 2VRGA 3CTNA 3QRXA 1ALWA 1NX2A 2Y5IA 3I5HC 2OPOA 1ALVA 2ZN9A 1DGVA 2LVVA 2K2AA 2LHIA 1U5IA 1MWNA 4A4BA 4HRGA 1K2HA 1XO5A 1XA5A 1Y6WA 2JT3A 1SBJA 5JOLA 2JT8A 1N65A 1UHHA 3BUNB 4GGFC 1B47A 2WOSA 1PSRA 1A29A 1NX3A 1TN4A 2K0JA 3CS1A 3OX5A 2H2KA 1KWOC 1XFVO 1YUSA 4BY5A 2G2BA 4GAOA 2BL0C 1QX2A 2KDHA 2K7DA 1A4PA 3JTDC 3IQQA 3OB1B 3HX4A 4C0KA 5I2LA 2NXQA 4MZJA 1TOPA 2SCPA 3SIBA 3VRQA 1K9KA 1MXLC 3TS5C 2IS9A 1B8RA 4CFQA 2F33A 5B8IB 1TTXA 1FI5A 1J7RA 1EJ3A 2LHLA 2H61C 2Y4QA 3WXAA 1OMDA 1KFXL 1F70A 1B9AA 3RLZA 1BF5A 3SG6A 1UUSA 2CT9A 2L4HA 3HCMA 2LC5A 1QTXA 1WDCC 2I94A 1FPWA 1LA0A 1WY9A 3FS7A 3VRNA 1K93D 1J7OA 1SCVA 3VGOA 1BU3A 2BE4A 4PE4A 2LUCA 1KFUL 2MA2A 1FBVA 2JU0A 4QJ3B 4GGNA 1A75A 4ORCB 3AAKA 4D1EA 3O6BA 1QIWA 1CFPA 1PK0D 2CBLA 1CKKA 1SR6C 2PRUA 3O2PA 2TN4A 2L0PA 2P6BB 1TNWA 3D0YA 1JUOA 2PVBA 1JF0A 2JXCA 3OHMB 1DJIA 4MRYA 3EVRA 2F2PA 2WORA 3I5FC 1L2OB 1K90D 1RTP1 1S26D 4UPGA 2WCFA 1CDNA 1HQVA 5DKRA 1XFUO 1WRKA 5IBWA 2K2FA 3PN7C 1NP8A 1YTZC 1NIWA 2LP2A 1Y1UA 2G9BA 1DJHA 1YRUB 1TIZA 4GGFA 1EG4A 1ZFSA 1SPYA 4JWQA 1SYMA 2B1UA 1OOJA 1S36A 1IKUA 3PM8A 3EKHA 4TNCA 5AERA 3BQ3A 3PATA 3FWBA 4PHNA 4XJKA 3SG7A 1C7WA 1RWYA 1SY9A 1ODBA 2L5XB 1KWOB 2JNFA 5ER4X 1F71A 2I18A 4ZCUA 2QPTA 1E8AA 1YVLA 1MUXA 2BL0B 1LXFC 4MZKA 5TNCA 2BE6A 3JVTC 3RM1A 2HF5A 3TS5B 4WQ3A 1KK7Y 2RGIA 1SL7A 4MN0A 3VRPA 2F3ZA 3CR4X 4YI8A 2NZ0A 1Y0VH 2LE9B 3A4UB 2M97A 1DJZA 1Q80A 2MAZA 1OQPA 4HREE 2LNKA 2ZKMX 3WNXB 1YRTB 4ORBB 4DUQA 2E6WA 4DIRA 3EVUA 2ZNDA 4GNKB 1CNPA 1SK6D 1M63B 1V1GA 1WDCB 2EC6C 1S3PA 2BKIB 4Q04A 1ZUZA 4YGCB 1BMOA 3A8RA 1JF2A 1XK4A 5K89A 3TUYC 1JFJA 1CLLA 3KF9A 1N0YA 5DKNA 2HQ8A 1CMFA 1K96A 1OZOA 2KBIA 4HSZA 1SR6B 2KBMA 2LANA 3VRRA 4F0ZB 1K9PA 1MHOA 1C07A 2BCXA 1IGVA 1WLZA 4PALA 5D7FA 1MR8A 1YURA 1H8BA 1KFXS 3I5FB 1PALA 3FIAA 1LKJA 1UHNA 3IF7A 5AXIA 2KOTA 2L51A 2MRDA 3EVVA 1BLQA 1JBAA 4YGEB 2JTTA 2KI4C 1XFZO 2KI6D 4FTGA 1EL4A 5HKZA 3PN7B 3KPXA 1W7IB 3EK7A 4MZLA 1JWDA 2JPTA 1JSAA 2LVKA 1J55A 2K7CA 2LLTA 3AAJA 4P2YB 2ZN8A 1QIVA 1S5GY 5AANA 2MBXA 1TNQA 1M31A 3WHUB 3CR5X 1CFCA 2OTGC 1NCXA 2M1UA 4C0JA 1AVSA 2EHBA 1NCYA 3NSOA 3O78A 5HLVA 1KCYA 2KGBC 4DRWA 4GFTA 1QXPA 3DF0A 4I5LB 4I5KA 1KQMC 1WLMA 1S5GZ 5KTYA 4JPZB 4DS7A 5HKYA 3CZTX 4M2QA 2PMYA 2HPSA 2KFFA 2Q91A 2CCMA 3SG4A 4BY4A 1C7VA 1SCMC 1JFKA 1J1EA 1XK4C 4CPVA 1WRZA 1NUBA 2F2OA 5CSFA 1K8UA 1NYAA 3BUWB 3I5GC 3JVTB 1R2UA 2NCPA 2FCDA 3IQOA 1CMGA 1NSHA 2NCOA 3FWCA 1YX8A 3C1VA 4XYNA 1CDLA 1K95A 1PVAA 3K21A 4N5XA 1D1OA 2O60A 4YGBB 3D0YB 1CDMA 1DJXA 1NWDA 1UURA 2O5GA 5D69A 5J3XA 4YRUA 1DJGA 1ZACA 1VRKA 4NDDA 5I8NA 3DVEA 4M2OA 1B4CA 4OR9B 1PSBA 1G33A 1M46A 1SL8A 1BT6A 5FYXA 2EC6B 2KNEA 3D10A 4YI9A 1ZMZA 2F3YA 3TUYB 1F54A 3I5HB 1HT9A 2Y1MA 1NX0A 1G4YR 3PALA 2KSPA 1MQ1A 2LAPA 4FQOA 1J7QA 1M45A 1XYDA 2K8MB 4MEWA 1BODA 1SMGA 2L98A 2LMUA 3OX6A 3PLFB 2ZRTA 1RFJA 4GBAA 3BXKA 1YUUA 1QV0A 2M7NA 4PE1A 5KU1A 1Y1XA 1EG3A 2LP3A 5PALA 2LMTA 2A4JA 2LV7A 1FF1A 3KEVA 2AUCA 1XFYO 2JWWA 3BYAA 4AOMA 1BG1A 4ORAB 3SG5A 2NLNA 2WNDA 2MLFC 3TZ1A 3JTDB 1DF0A 1IJ6A 2DOQA 2MHHA 2EGDA 3ZNIA 2OS8C 2WCEA 1W7JB 3GK1A 4GUKA 1EXRA 4PHKA 2KYCA 5AEQA 1UWOA 3BOWA 4ZCVA 5F6TA 5JJGA 1CB1A 5I2OA 3GK2A 1MF8B 1R6PA 4L9MA 2M7LA 1SW8A 5CSIA 2L50A 1QS7A 2OTGB 3DVKA 1J1DA 4YBHB 1PRWA 2LLUA 1XFWO 1GGWA 4MRXA 4M2PA 2LVJA 1X02A 2BCBA 1KSOA 2HETA 1S1EA 3SJSA 1A03A 3ZWHA 1CM4A 1QLSA 1RECA 4E68A 4YGDB 4PHJA 2JULA 1J7PA 1RROA 2LM5A 1ZOTB 2E30A 2PASA 3EK8A 2Q4UA 1SCMB 2JC2A 3EK4A 2BKHB 1UHKA 4I5NB 3DVJA 2I7AA 1DT7B 1AHRA 2LCPA 4ICBA 2ZFDA 3I5GB 1OSAA 2MJWB 2FJUB 4U8DA 1U5IB 2KYFA 2CTNA 4OKHA 4IL1A 3NSIA 2Y1NA 4P5OE 1QJTA 1DGUA 1QX5B 2AAOA 2HQWA 4USLA 5CPVA 1IH0A 1CFDA 2ZNEA 1IWQA 2F8PA 1OMRA 1KFUS 4AQJA 2LMVA 1LVCD 2FCEA 1S6CA 4NDBA 4PE7A 4R1EA 1Y1AA 1TCOB 2BBMA 3ICBA 3OB2B 2JRFA 1XFXO 3LK0A 2ZRSA 3DD4A 1SKTA 3LK1A 1BR4B 1F4OA 1OMVA 5KSZA 1SNLA 5HKWA 2JNXA 1BOCA 1NCZA 4CLNA 2GGMA 4NQGA 1PULA 3GOFA 5DKQA 1B7TY 3SG3A 2KFHA 5HLOA 2JQ6A 4QJ5B 1KK8C 2AMIA 3TDIA 3DF0B 2M0RA 3PSRA 1FI6A 1DJYA 1GQMA 1XVJA 3BUXB 5HYDA 3DVMA 1YR5A 2OS8B 2SASA 3EKJA 1DTLA 1K9UA 1RJVA 2BCAA 1B7TZ 2JT0A 4MSPA 1CTRA 1A75B 2LUXA 4ETOA 3I5IC 1L7ZA 2PSRA 1NX1A 3LCPC 4PDZA 2M3WA 3H4SE 3KO0A 4I5JA 2KHNA 1AUIB 4JQ0D 1CLMA 2I2RE 1CM1A 2BBNA 3AKAA 2FOTA 4NDCA 1S6JA 1PVBA 1M39A 3WHTB 2R2IA 2MLEC 2WCBA 4N1GA 3CWGA 3NSKA 1EH2A 2GV5A 2M29A 4OCIA 1IJ5A 4CIDA 2M8UA 2KI6C 4PCWA 1BR1B 1UHIA 1DMOA 3NSLA 2K7BA 4PHMA 3KHEA 3CGAA 1WRLA 1AK8A 1JC2A 2GGZA 2JTZA 2L2EA 2KGRA 1AJ5A 1TRFA 3CLNA 4MVFA 1B1GA 1KQVA 4HRHA 1IQ5A 2KAYA 2D8NA 4MLWA 1DVIA 4A4CA 5GQQC 1CFFA 1CLBA 2KFGA 2L4IA 1F4QA 1BJFA 1QLKA 3LL8B 1F8HA 2K61A 1GJYA 1H4BA 1KSMA 2K7OA 2JXLA 4PE0A 2ISDA 2BECA 1QATA 3TDZA 4OV2A 1IG5A 3E3RA 3TDUA 1CDPA 1AJ4A 2PALA 5BPJA 1LA3A 1QX7A 2KAVA 2KAXA 1FW4A 2KI4B 1TCFA 3AKBA 3GK4X 2KQ6A 4WRIA 1N2DA 3CR2A 4C0LA 1UP5A 1AP4A 4N1FA 1G8IA 4XJKB 5CSJA 2QACA 1QVIY 1DJWA 5CSNA 3O4YA 1SL9A 5I2QA 1QV1A 1GGZA 1DF0B 3SG2A 4OVNF 1F55A 1SRAA 3BOWB 1MXEA 1V1FA 4YGAA 2V53A 5AFPA 2CXJA 1QVIZ 1KQMB 2CNPA 2M49B 2LLSA 1IRJA 1YVHA 3BUMB 2LVIA 2H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6I A;  1KK8 B;  3OP0 A;  1TNP A;  1YUT A;  5ER5 A;  1NPQ A;  4WQ2 A;  1LIN A;  5G08 A;  4GPL B;  3PFV A;  3VRO A;  1OE9 B;  3F45 A;  2M9G A;  4MBE A;  1L2O C;  3BUO B;  3SIA A;  1RK9 A;  2JZI A;  3M0W A;  2COL B;  1B8C A;  3NXA A;  1A2X A;  1TNX A;  3LLE A;  4DCK A;  3MSE B;  2KQY A;  2M1K B;  1B8L A;  4AQI A;  2WC8 A;  4QJ4 B;  1OZS A;  1IQ3 A;  3I5I B;  1UHJ A;  1YX7 A;  2JOJ A;  1KK7 Z;  4CFR A;  1QAS A;  1K94 A;  2VRG A;  3CTN A;  3QRX A;  1ALW A;  1NX2 A;  2Y5I A;  3I5H C;  2OPO A;  1ALV A;  2ZN9 A;  1DGV A;  2LVV A;  2K2A A;  2LHI A;  1U5I A;  1MWN A;  4A4B A;  4HRG A;  1K2H A;  1XO5 A;  1XA5 A;  1Y6W A;  2JT3 A;  1SBJ A;  5JOL A;  2JT8 A;  1N65 A;  1UHH A;  3BUN B;  4GGF C;  1B47 A;  2WOS A;  1PSR A;  1A29 A;  1NX3 A;  1TN4 A;  2K0J A;  3CS1 A;  3OX5 A;  2H2K A;  1KWO C;  1XFV O;  1YUS A;  4BY5 A;  2G2B A;  4GAO A;  2BL0 C;  1QX2 A;  2KDH A;  2K7D A;  1A4P A;  3JTD C;  3IQQ A;  3OB1 B;  3HX4 A;  4C0K A;  5I2L A;  2NXQ A;  4MZJ A;  1TOP A;  2SCP A;  3SIB A;  3VRQ A;  1K9K A;  1MXL C;  3TS5 C;  2IS9 A;  1B8R A;  4CFQ A;  2F33 A;  5B8I B;  1TTX A;  1FI5 A;  1J7R A;  1EJ3 A;  2LHL A;  2H61 C;  2Y4Q A;  3WXA A;  1OMD A;  1KFX L;  1F70 A;  1B9A A;  3RLZ A;  1BF5 A;  3SG6 A;  1UUS A;  2CT9 A;  2L4H A;  3HCM A;  2LC5 A;  1QTX A;  1WDC C;  2I94 A;  1FPW A;  1LA0 A;  1WY9 A;  3FS7 A;  3VRN A;  1K93 D;  1J7O A;  1SCV A;  3VGO A;  1BU3 A;  2BE4 A;  4PE4 A;  2LUC A;  1KFU L;  2MA2 A;  1FBV A;  2JU0 A;  4QJ3 B;  4GGN A;  1A75 A;  4ORC B;  3AAK A;  4D1E A;  3O6B A;  1QIW A;  1CFP A;  1PK0 D;  2CBL A;  1CKK A;  1SR6 C;  2PRU A;  3O2P A;  2TN4 A;  2L0P A;  2P6B B;  1TNW A;  3D0Y A;  1JUO A;  2PVB A;  1JF0 A;  2JXC A;  3OHM B;  1DJI A;  4MRY A;  3EVR A;  2F2P A;  2WOR A;  3I5F C;  1L2O B;  1K90 D;  1RTP 1;  1S26 D;  4UPG A;  2WCF A;  1CDN A;  1HQV A;  5DKR A;  1XFU O;  1WRK A;  5IBW A;  2K2F A;  3PN7 C;  1NP8 A;  1YTZ C;  1NIW A;  2LP2 A;  1Y1U A;  2G9B A;  1DJH A;  1YRU B;  1TIZ A;  4GGF A;  1EG4 A;  1ZFS A;  1SPY A;  4JWQ A;  1SYM A;  2B1U A;  1OOJ A;  1S36 A;  1IKU A;  3PM8 A;  3EKH A;  4TNC A;  5AER A;  3BQ3 A;  3PAT A;  3FWB A;  4PHN A;  4XJK A;  3SG7 A;  1C7W A;  1RWY A;  1SY9 A;  1ODB A;  2L5X B;  1KWO B;  2JNF A;  5ER4 X;  1F71 A;  2I18 A;  4ZCU A;  2QPT A;  1E8A A;  1YVL A;  1MUX A;  2BL0 B;  1LXF C;  4MZK A;  5TNC A;  2BE6 A;  3JVT C;  3RM1 A;  2HF5 A;  3TS5 B;  4WQ3 A;  1KK7 Y;  2RGI A;  1SL7 A;  4MN0 A;  3VRP A;  2F3Z A;  3CR4 X;  4YI8 A;  2NZ0 A;  1Y0V H;  2LE9 B;  3A4U B;  2M97 A;  1DJZ A;  1Q80 A;  2MAZ A;  1OQP A;  4HRE E;  2LNK A;  2ZKM X;  3WNX B;  1YRT B;  4ORB B;  4DUQ A;  2E6W A;  4DIR A;  3EVU A;  2ZND A;  4GNK B;  1CNP A;  1SK6 D;  1M63 B;  1V1G A;  1WDC B;  2EC6 C;  1S3P A;  2BKI B;  4Q04 A;  1ZUZ A;  4YGC B;  1BMO A;  3A8R A;  1JF2 A;  1XK4 A;  5K89 A;  3TUY C;  1JFJ A;  1CLL A;  3KF9 A;  1N0Y A;  5DKN A;  2HQ8 A;  1CMF A;  1K96 A;  1OZO A;  2KBI A;  4HSZ A;  1SR6 B;  2KBM A;  2LAN A;  3VRR A;  4F0Z B;  1K9P A;  1MHO A;  1C07 A;  2BCX A;  1IGV A;  1WLZ A;  4PAL A;  5D7F A;  1MR8 A;  1YUR A;  1H8B A;  1KFX S;  3I5F B;  1PAL A;  3FIA A;  1LKJ A;  1UHN A;  3IF7 A;  5AXI A;  2KOT A;  2L51 A;  2MRD A;  3EVV A;  1BLQ A;  1JBA A;  4YGE B;  2JTT A;  2KI4 C;  1XFZ O;  2KI6 D;  4FTG A;  1EL4 A;  5HKZ A;  3PN7 B;  3KPX A;  1W7I B;  3EK7 A;  4MZL A;  1JWD A;  2JPT A;  1JSA A;  2LVK A;  1J55 A;  2K7C A;  2LLT A;  3AAJ A;  4P2Y B;  2ZN8 A;  1QIV A;  1S5G Y;  5AAN A;  2MBX A;  1TNQ A;  1M31 A;  3WHU B;  3CR5 X;  1CFC A;  2OTG C;  1NCX A;  2M1U A;  4C0J A;  1AVS A;  2EHB A;  1NCY A;  3NSO A;  3O78 A;  5HLV A;  1KCY A;  2KGB C;  4DRW A;  4GFT A;  1QXP A;  3DF0 A;  4I5L B;  4I5K A;  1KQM C;  1WLM A;  1S5G Z;  5KTY A;  4JPZ B;  4DS7 A;  5HKY A;  3CZT X;  4M2Q A;  2PMY A;  2HPS A;  2KFF A;  2Q91 A;  2CCM A;  3SG4 A;  4BY4 A;  1C7V A;  1SCM C;  1JFK A;  1J1E A;  1XK4 C;  4CPV A;  1WRZ A;  1NUB A;  2F2O A;  5CSF A;  1K8U A;  1NYA A;  3BUW B;  3I5G C;  3JVT B;  1R2U A;  2NCP A;  2FCD A;  3IQO A;  1CMG A;  1NSH A;  2NCO A;  3FWC A;  1YX8 A;  3C1V A;  4XYN A;  1CDL A;  1K95 A;  1PVA A;  3K21 A;  4N5X A;  1D1O A;  2O60 A;  4YGB B;  3D0Y B;  1CDM A;  1DJX A;  1NWD A;  1UUR A;  2O5G A;  5D69 A;  5J3X A;  4YRU A;  1DJG A;  1ZAC A;  1VRK A;  4NDD A;  5I8N A;  3DVE A;  4M2O A;  1B4C A;  4OR9 B;  1PSB A;  1G33 A;  1M46 A;  1SL8 A;  1BT6 A;  5FYX A;  2EC6 B;  2KNE A;  3D10 A;  4YI9 A;  1ZMZ A;  2F3Y A;  3TUY B;  1F54 A;  3I5H B;  1HT9 A;  2Y1M A;  1NX0 A;  1G4Y R;  3PAL A;  2KSP A;  1MQ1 A;  2LAP A;  4FQO A;  1J7Q A;  1M45 A;  1XYD A;  2K8M B;  4MEW A;  1BOD A;  1SMG A;  2L98 A;  2LMU A;  3OX6 A;  3PLF B;  2ZRT A;  1RFJ A;  4GBA A;  3BXK A;  1YUU A;  1QV0 A;  2M7N A;  4PE1 A;  5KU1 A;  1Y1X A;  1EG3 A;  2LP3 A;  5PAL A;  2LMT A;  2A4J A;  2LV7 A;  1FF1 A;  3KEV A;  2AUC A;  1XFY O;  2JWW A;  3BYA A;  4AOM A;  1BG1 A;  4ORA B;  3SG5 A;  2NLN A;  2WND A;  2MLF C;  3TZ1 A;  3JTD B;  1DF0 A;  1IJ6 A;  2DOQ A;  2MHH A;  2EGD A;  3ZNI A;  2OS8 C;  2WCE A;  1W7J B;  3GK1 A;  4GUK A;  1EXR A;  4PHK A;  2KYC A;  5AEQ A;  1UWO A;  3BOW A;  4ZCV A;  5F6T A;  5JJG A;  1CB1 A;  5I2O A;  3GK2 A;  1MF8 B;  1R6P A;  4L9M A;  2M7L A;  1SW8 A;  5CSI A;  2L50 A;  1QS7 A;  2OTG B;  3DVK A;  1J1D A;  4YBH B;  1PRW A;  2LLU A;  1XFW O;  1GGW A;  4MRX A;  4M2P A;  2LVJ A;  1X02 A;  2BCB A;  1KSO A;  2HET A;  1S1E A;  3SJS A;  1A03 A;  3ZWH A;  1CM4 A;  1QLS A;  1REC A;  4E68 A;  4YGD B;  4PHJ A;  2JUL A;  1J7P A;  1RRO A;  2LM5 A;  1ZOT B;  2E30 A;  2PAS A;  3EK8 A;  2Q4U A;  1SCM B;  2JC2 A;  3EK4 A;  2BKH B;  1UHK A;  4I5N B;  3DVJ A;  2I7A A;  1DT7 B;  1AHR A;  2LCP A;  4ICB A;  2ZFD A;  3I5G B;  1OSA A;  2MJW B;  2FJU B;  4U8D A;  1U5I B;  2KYF A;  2CTN A;  4OKH A;  4IL1 A;  3NSI A;  2Y1N A;  4P5O E;  1QJT A;  1DGU A;  1QX5 B;  2AAO A;  2HQW A;  4USL A;  5CPV A;  1IH0 A;  1CFD A;  2ZNE A;  1IWQ A;  2F8P A;  1OMR A;  1KFU S;  4AQJ A;  2LMV A;  1LVC D;  2FCE A;  1S6C A;  4NDB A;  4PE7 A;  4R1E A;  1Y1A A;  1TCO B;  2BBM A;  3ICB A;  3OB2 B;  2JRF A;  1XFX O;  3LK0 A;  2ZRS A;  3DD4 A;  1SKT A;  3LK1 A;  1BR4 B;  1F4O A;  1OMV A;  5KSZ A;  1SNL A;  5HKW A;  2JNX A;  1BOC A;  1NCZ A;  4CLN A;  2GGM A;  4NQG A;  1PUL A;  3GOF A;  5DKQ A;  1B7T Y;  3SG3 A;  2KFH A;  5HLO A;  2JQ6 A;  4QJ5 B;  1KK8 C;  2AMI A;  3TDI A;  3DF0 B;  2M0R A;  3PSR A;  1FI6 A;  1DJY A;  1GQM A;  1XVJ A;  3BUX B;  5HYD A;  3DVM A;  1YR5 A;  2OS8 B;  2SAS A;  3EKJ A;  1DTL A;  1K9U A;  1RJV A;  2BCA A;  1B7T Z;  2JT0 A;  4MSP A;  1CTR A;  1A75 B;  2LUX A;  4ETO A;  3I5I C;  1L7Z A;  2PSR A;  1NX1 A;  3LCP C;  4PDZ A;  2M3W A;  3H4S E;  3KO0 A;  4I5J A;  2KHN A;  1AUI B;  4JQ0 D;  1CLM A;  2I2R E;  1CM1 A;  2BBN A;  3AKA A;  2FOT A;  4NDC A;  1S6J A;  1PVB A;  1M39 A;  3WHT B;  2R2I A;  2MLE C;  2WCB A;  4N1G A;  3CWG A;  3NSK A;  1EH2 A;  2GV5 A;  2M29 A;  4OCI A;  1IJ5 A;  4CID A;  2M8U A;  2KI6 C;  4PCW A;  1BR1 B;  1UHI A;  1DMO A;  3NSL A;  2K7B A;  4PHM A;  3KHE A;  3CGA A;  1WRL A;  1AK8 A;  1JC2 A;  2GGZ A;  2JTZ A;  2L2E A;  2KGR A;  1AJ5 A;  1TRF A;  3CLN A;  4MVF A;  1B1G A;  1KQV A;  4HRH A;  1IQ5 A;  2KAY A;  2D8N A;  4MLW A;  1DVI A;  4A4C A;  5GQQ C;  1CFF A;  1CLB A;  2KFG A;  2L4I A;  1F4Q A;  1BJF A;  1QLK A;  3LL8 B;  1F8H A;  2K61 A;  1GJY A;  1H4B A;  1KSM A;  2K7O A;  2JXL A;  4PE0 A;  2ISD A;  2BEC A;  1QAT A;  3TDZ A;  4OV2 A;  1IG5 A;  3E3R A;  3TDU A;  1CDP A;  1AJ4 A;  2PAL A;  5BPJ A;  1LA3 A;  1QX7 A;  2KAV A;  2KAX A;  1FW4 A;  2KI4 B;  1TCF A;  3AKB A;  3GK4 X;  2KQ6 A;  4WRI A;  1N2D A;  3CR2 A;  4C0L A;  1UP5 A;  1AP4 A;  4N1F A;  1G8I A;  4XJK B;  5CSJ A;  2QAC A;  1QVI Y;  1DJW A;  5CSN A;  3O4Y A;  1SL9 A;  5I2Q A;  1QV1 A;  1GGZ A;  1DF0 B;  3SG2 A;  4OVN F;  1F55 A;  1SRA A;  3BOW B;  1MXE A;  1V1F A;  4YGA A;  2V53 A;  5AFP A;  2CXJ A;  1QVI Z;  1KQM B;  2CNP A;  2M49 B;  2LLS A;  1IRJ A;  1YVH A;  3BUM B;  2LVI A;  2H61 A; 
#chains in the Genus database with same CATH topology
 1S6I A;  1KK8 B;  3OP0 A;  1TNP A;  1YUT A;  5ER5 A;  1NPQ A;  4WQ2 A;  1LIN A;  5G08 A;  4GPL B;  3PFV A;  3VRO A;  1OE9 B;  3D74 A;  2M9G A;  3F45 A;  1Z4H A;  1L2O C;  4MBE A;  3BUO B;  3SIA A;  3UO9 A;  1RK9 A;  2JZI A;  3DY9 A;  3M0W A;  2COL B;  1B8C A;  3NXA A;  1A2X A;  1TNX A;  3LLE A;  4DCK A;  3MSE B;  2KQY A;  2M1K B;  1B8L A;  4AQI A;  2WC8 A;  4QJ4 B;  1OZS A;  1IQ3 A;  3S0F A;  3I5I B;  1UHJ A;  1YX7 A;  2JOJ A;  1KK7 Z;  4CFR A;  2QEO A;  3PJI A;  1QAS A;  1K94 A;  2VRG A;  3CTN A;  3QRX A;  1ALW A;  1NX2 A;  1GM0 A;  2Y5I A;  3I5H C;  2OPO A;  1ALV A;  2ZN9 A;  1DGV A;  2LVV A;  2K2A A;  2LHI A;  1U5I A;  1MWN A;  1T14 A;  2QEH A;  4HRG A;  4A4B A;  1K2H A;  1XO5 A;  1XA5 A;  1Y6W A;  2JT3 A;  1SBJ A;  5JOL A;  1XFR A;  2JT8 A;  1N65 A;  1UHH A;  3BUN B;  4GGF C;  1B47 A;  2WOS A;  1PSR A;  1A29 A;  1NX3 A;  1TN4 A;  2K0J A;  2PYQ A;  3CS1 A;  3B7A A;  3OX5 A;  2H2K A;  1KWO C;  1XFV O;  1YUS A;  4BY5 A;  2G2B A;  4GAO A;  2BL0 C;  1QX2 A;  2KDH A;  2K7D A;  1A4P A;  3JTD C;  3IQQ A;  3OB1 B;  3HX4 A;  4C0K A;  5I2L A;  2NXQ A;  4MZJ A;  1TOP A;  2SCP A;  3SIB A;  3VRQ A;  1K9K A;  1MXL C;  3TS5 C;  3BFA A;  2IS9 A;  3R72 A;  1B8R A;  4CFQ A;  2F33 A;  1IIO A;  5B8I B;  1TTX A;  1FI5 A;  1J7R A;  3B6X A;  1EJ3 A;  2LHL A;  2H61 C;  2Y4Q A;  3WXA A;  1OMD A;  1KFX L;  1F70 A;  1B9A A;  3RLZ A;  1BF5 A;  3SG6 A;  1UUS A;  2CT9 A;  1TUZ A;  2L4H A;  3HCM A;  2LC5 A;  1QTX A;  1WDC C;  2I94 A;  1FPW A;  1LA0 A;  1WY9 A;  3FS7 A;  2WC5 A;  1K93 D;  3VRN A;  1J7O A;  1SCV A;  3VGO A;  1BU3 A;  3R1P A;  2BE4 A;  3DZT A;  4PE4 A;  2LUC A;  1KFU L;  2MA2 A;  1FBV A;  2JU0 A;  4QJ3 B;  4GGN A;  1A75 A;  4ORC B;  3AAK A;  4D1E A;  3O6B A;  1QIW A;  1CFP A;  1PK0 D;  2CBL A;  1TWO A;  1SR6 C;  2PRU A;  3SS5 A;  3O2P A;  2TN4 A;  1CKK A;  2L0P A;  2P6B B;  1TNW A;  3D0Y A;  1JUO A;  2PVB A;  1JF0 A;  2JXC A;  3OHM B;  1DJI A;  4MRY A;  3EVR A;  2F2P A;  1DQE A;  2WOR A;  3I5F C;  1L2O B;  1K90 D;  3RZS A;  1RTP 1;  1S26 D;  4UPG A;  2WCF A;  1CDN A;  1HQV A;  1C3Z A;  5DKR A;  1XFU O;  1WRK A;  5IBW A;  2K2F A;  5HL1 A;  3L47 A;  3PN7 C;  3B87 A;  1NP8 A;  3V2L A;  1YTZ C;  1NIW A;  2LP2 A;  1Y1U A;  2G9B A;  1DJH A;  1YRU B;  1TIZ A;  3IVT A;  4GGF A;  1EG4 A;  1ZFS A;  1SPY A;  4JWQ A;  3FE9 A;  3CYZ A;  1SYM A;  2B1U A;  1OOJ A;  1S36 A;  1IKU A;  3PM8 A;  3EKH A;  4TNC A;  5AER A;  3BQ3 A;  3PAT A;  3FWB A;  4PHN A;  4XJK A;  1OOH A;  1C7W A;  1RWY A;  1SY9 A;  1ODB A;  2L5X B;  3SG7 A;  1KWO B;  2JNF A;  5ER4 X;  1F71 A;  2I18 A;  4ZCU A;  2QPT A;  1E8A A;  1YVL A;  1MUX A;  2BL0 B;  3NHT A;  1LXF C;  4MZK A;  5TNC A;  1OOG A;  2BE6 A;  3JVT C;  3RM1 A;  2HF5 A;  3TS5 B;  4WQ3 A;  1KK7 Y;  2RGI A;  1SL7 A;  4MN0 A;  3VRP A;  5FI2 A;  2F3Z A;  3CR4 X;  4YI8 A;  2NZ0 A;  1Y0V H;  2LE9 B;  3A4U B;  2M97 A;  1DJZ A;  1Q80 A;  2MAZ A;  1OQP A;  4HRE E;  2LNK A;  2ZKM X;  3S0A A;  3WNX B;  1YRT B;  4ORB B;  1TUJ A;  4DUQ A;  2E6W A;  4DIR A;  3EVU A;  2ZND A;  4GNK B;  1CNP A;  1SK6 D;  1M63 B;  1V1G A;  1WDC B;  2EC6 C;  1S3P A;  2BKI B;  4Q04 A;  1P28 A;  1ZUZ A;  4YGC B;  1BMO A;  3A8R A;  1JF2 A;  1XK4 A;  5K89 A;  3TUY C;  1JFJ A;  1CLL A;  3KF9 A;  5FI7 A;  1DC1 A;  1N0Y A;  2ERB A;  5DKN A;  2HQ8 A;  1CMF A;  3D77 A;  1K96 A;  1OZO A;  2KBI A;  4HSZ A;  1SR6 B;  2KBM A;  2LAN A;  3VRR A;  4F0Z B;  1K9P A;  1MHO A;  1C07 A;  2BCX A;  1IGV A;  1WLZ A;  4PAL A;  2GTE A;  5D7F A;  1MR8 A;  1YUR A;  5D3O A;  1H8B A;  1KFX S;  3I5F B;  1PAL A;  3FIA A;  1LKJ A;  1UHN A;  3IF7 A;  3BFH A;  5AXI A;  2KOT A;  2L51 A;  2MRD A;  3EVV A;  3VB1 A;  1BLQ A;  1JBA A;  2K60 A;  2JTT A;  2KI4 C;  1XFZ O;  2KI6 D;  4FTG A;  1EL4 A;  4YGE B;  5HKZ A;  3PN7 B;  2WCH A;  1W7I B;  1LS8 A;  3EK7 A;  3KPX A;  4MZL A;  5FI6 A;  1JWD A;  4IJ7 A;  2JPT A;  1JSA A;  1DEK A;  2LVK A;  1J55 A;  3B86 A;  2K7C A;  2LLT A;  3AAJ A;  3NHI A;  2ZN8 A;  1QIV A;  1S5G Y;  4P2Y B;  5AAN A;  2MBX A;  3L4L A;  1TNQ A;  1M31 A;  3WHU B;  3CR5 X;  5EL2 A;  1CFC A;  2OTG C;  1NCX A;  2M1U A;  4C0J A;  1AVS A;  3CZ2 A;  3S0G A;  2EHB A;  1NCY A;  3NSO A;  3O78 A;  5HLV A;  1KCY A;  2P70 A;  2KGB C;  4DRW A;  4GFT A;  1QXP A;  3DF0 A;  4I5L B;  4I5K A;  1KQM C;  1WLM A;  3CZ1 A;  1S5G Z;  1ORG A;  3D76 A;  4JPZ B;  5KTY A;  4DS7 A;  5HKY A;  3BJH A;  3QME A;  3UNW A;  3CZT X;  4M2Q A;  2PMY A;  2HPS A;  2KFF A;  2Q91 A;  2CCM A;  3SG4 A;  4BY4 A;  1C7V A;  1SCM C;  3DYE A;  1JFK A;  1J1E A;  1XK4 C;  4CPV A;  2WCM A;  3S0D A;  1WRZ A;  1NUB A;  2F2O A;  5CSF A;  1K8U A;  1NYA A;  3BUW B;  3I5G C;  3JVT B;  1R2U A;  2NCP A;  2FCD A;  3IQO A;  1CMG A;  1OOI X;  1NSH A;  2NCO A;  3FWC A;  1YX8 A;  3C1V A;  3R1O A;  4XYN A;  1CDL A;  1K95 A;  1PVA A;  3D78 A;  3K21 A;  4N5X A;  1D1O A;  2O60 A;  3R1V A;  4YGB B;  3D0Y B;  1CDM A;  1DJX A;  1NWD A;  1UUR A;  2O5G A;  5D69 A;  5J3X A;  3PM2 A;  4YRU A;  1DJG A;  1ZAC A;  1VRK A;  4NDD A;  2JPO A;  5I8N A;  3DVE A;  4M2O A;  1B4C A;  4OR9 B;  1PSB A;  1G33 A;  1M46 A;  1SL8 A;  1BT6 A;  5FYX A;  2EC6 B;  2KNE A;  3D10 A;  4YI9 A;  1ZMZ A;  2F3Y A;  3TUY B;  1F54 A;  3I5H B;  1HT9 A;  2Y1M A;  1NX0 A;  1G4Y R;  3PAL A;  2KSP A;  1MQ1 A;  2LAP A;  4FQO A;  1J7Q A;  1M45 A;  1XYD A;  2K8M B;  3D75 A;  4MEW A;  1BOD A;  1SMG A;  2L98 A;  2LMU A;  3OX6 A;  3PLF B;  2ZRT A;  1RFJ A;  4GBA A;  2KLD A;  3BXK A;  1YUU A;  1QV0 A;  2M7N A;  3Q8I A;  4PE1 A;  4F7F A;  2KLE A;  1Y1X A;  1EG3 A;  2LP3 A;  5PAL A;  1Z2C B;  2LMT A;  5KU1 A;  2A4J A;  2LV7 A;  1FF1 A;  3KEV A;  2AUC A;  1XFY O;  2JWW A;  1SSE B;  3BYA A;  4AOM A;  4ORA B;  1BG1 A;  1OOF A;  3SG5 A;  2NLN A;  2WND A;  2MLF C;  3TZ1 A;  3JTD B;  2WC6 A;  1DF0 A;  1IJ6 A;  2DOQ A;  2MHH A;  2EGD A;  3ZNI A;  2OS8 C;  2WCE A;  1W7J B;  3GK1 A;  4GUK A;  1DEL A;  1EXR A;  2KYC A;  4PHK A;  1UWO A;  3BOW A;  2P71 A;  4ZCV A;  5F6T A;  5AEQ A;  5JJG A;  1CB1 A;  5I2O A;  3GK2 A;  1MF8 B;  1R6P A;  4L9M A;  2M7L A;  1SW8 A;  5CSI A;  2L50 A;  1QS7 A;  2OTG B;  3DVK A;  1J1D A;  4YBH B;  1PRW A;  2LLU A;  1XFW O;  1GGW A;  4MRX A;  4M2P A;  2LVJ A;  1X02 A;  4JKT A;  1C3Y A;  2BCB A;  1KSO A;  2L5Y A;  2HET A;  1S1E A;  2YGU A;  3SJS A;  1A03 A;  3ZWH A;  1CM4 A;  1QLS A;  1REC A;  4E68 A;  3BFB A;  4YGD B;  4PHJ A;  2JUL A;  1J7P A;  1RRO A;  2LM5 A;  1ZOT B;  2E30 A;  2PAS A;  4INX A;  3EK8 A;  2Q4U A;  1SCM B;  2JC2 A;  3EG5 B;  3EK4 A;  3FE6 A;  3FE8 A;  2BKH B;  1UHK A;  2BNX A;  3DVJ A;  4I5N B;  2I7A A;  1DT7 B;  1AHR A;  2LCP A;  4ICB A;  3SS3 A;  2ZFD A;  3I5G B;  1OSA A;  2MJW B;  2FJU B;  4U8D A;  1U5I B;  2KYF A;  2CTN A;  3OBV A;  4OKH A;  4IL1 A;  2QEV A;  3NSI A;  3D73 A;  2Y1N A;  4JD9 A;  4P5O E;  1QJT A;  1DGU A;  2WCJ A;  1QX5 B;  2AAO A;  2HQW A;  4USL A;  5CPV A;  1IH0 A;  1CFD A;  2ZNE A;  3NGV A;  1IWQ A;  2F8P A;  3CAB A;  1OMR A;  1KFU S;  3O4X A;  4AQJ A;  2LMV A;  4INW A;  1LVC D;  2FCE A;  1S6C A;  4NDB A;  4PE7 A;  5DIC A;  4R1E A;  2BAP A;  1Y1A A;  1TCO B;  2BBM A;  3ICB A;  3OB2 B;  2JRF A;  1XFX O;  3LK0 A;  2ZRS A;  3DD4 A;  1SKT A;  3LK1 A;  1OW4 A;  1BR4 B;  1F4O A;  1OMV A;  3B88 A;  5KSZ A;  1SNL A;  5HKW A;  2JNX A;  1BOC A;  1NCZ A;  4CLN A;  2GGM A;  4NQG A;  1PUL A;  3GOF A;  5DKQ A;  2PQL A;  1B7T Y;  3SG3 A;  2KFH A;  5HLO A;  2JQ6 A;  4QJ5 B;  1KK8 C;  2AMI A;  3TDI A;  3DF0 B;  2M0R A;  3PSR A;  3SS4 A;  1FI6 A;  1DJY A;  1GQM A;  1XVJ A;  3BUX B;  5HYD A;  3DVM A;  1YR5 A;  2OS8 B;  2SAS A;  3EKJ A;  1DTL A;  1K9U A;  1RJV A;  2BCA A;  1B7T Z;  2JT0 A;  4MSP A;  1CTR A;  2QEB A;  1A75 B;  2LUX A;  4ETO A;  3I5I C;  1L7Z A;  2PSR A;  1NX1 A;  3LCP C;  4PDZ A;  2M3W A;  3H4S E;  1W9Z A;  3KO0 A;  4I5J A;  3S0B A;  2KHN A;  1AUI B;  4JQ0 D;  1CLM A;  2I2R E;  1CM1 A;  2BBN A;  3AKA A;  2FOT A;  4NDC A;  1S6J A;  1PVB A;  1M39 A;  2KPH A;  2R2I A;  2MLE C;  2WCB A;  4N1G A;  3WHT B;  3CWG A;  3NSK A;  1EH2 A;  2GV5 A;  2M29 A;  4OCI A;  1IJ5 A;  4CID A;  2M8U A;  5I94 A;  2KI6 C;  4OZD A;  1BR1 B;  1UHI A;  4PCW A;  1DMO A;  3NSL A;  2K7B A;  4PHM A;  3KHE A;  3CGA A;  1WRL A;  1AK8 A;  1JC2 A;  2GGZ A;  2JTZ A;  2L2E A;  2KGR A;  3S0E A;  1AJ5 A;  1TRF A;  3CLN A;  4MVF A;  1B1G A;  1KQV A;  4HRH A;  1IQ5 A;  2KAY A;  1QWV A;  2D8N A;  4MLW A;  3CDN A;  1DVI A;  4A4C A;  5GQQ C;  1CFF A;  3L4A A;  1CLB A;  2KFG A;  2L4I A;  1F4Q A;  1BJF A;  1QLK A;  3LL8 B;  2H8V A;  1F8H A;  4KYN A;  2K61 A;  1GJY A;  1H4B A;  1KSM A;  2K7O A;  2JXL A;  4PE0 A;  2ISD A;  2BEC A;  1QAT A;  3TDZ A;  2WCL A;  4OV2 A;  1IG5 A;  3E3R A;  3TDU A;  1CDP A;  3OGN A;  1AJ4 A;  2PAL A;  5BPJ A;  1LA3 A;  1QX7 A;  2KAV A;  2KAX A;  1FW4 A;  4PT1 A;  3N7H A;  2KI4 B;  1TCF A;  3AKB A;  3GK4 X;  2KQ6 A;  4WRI A;  1N2D A;  3CR2 A;  4C0L A;  1UP5 A;  1AP4 A;  2FJY A;  4N1F A;  1G8I A;  2L2C A;  4FQT A;  4XJK B;  5CSJ A;  2QAC A;  1QVI Y;  3K1E A;  1DJW A;  2WCK A;  5CSN A;  3O4Y A;  1SL9 A;  5I2Q A;  1QV1 A;  1GGZ A;  1DF0 B;  3SG2 A;  4OVN F;  3DXL A;  1F55 A;  1SRA A;  3BOW B;  1MXE A;  1V1F A;  2QDI A;  4YGA A;  2V53 A;  5AFP A;  2CXJ A;  3CZ0 A;  1QVI Z;  1KQM B;  2CNP A;  2M49 B;  2LLS A;  1IRJ A;  1YVH A;  3BUM B;  2LVI A;  2H61 A; 
#chains in the Genus database with same CATH homology
 1S6I A;  1KK8 B;  3OP0 A;  1TNP A;  1YUT A;  5ER5 A;  1NPQ A;  4WQ2 A;  1LIN A;  5G08 A;  4GPL B;  3PFV A;  3VRO A;  1OE9 B;  3F45 A;  2M9G A;  4MBE A;  1L2O C;  3BUO B;  3SIA A;  1RK9 A;  2JZI A;  3M0W A;  2COL B;  1B8C A;  3NXA A;  1A2X A;  1TNX A;  3LLE A;  4DCK A;  3MSE B;  2KQY A;  2M1K B;  1B8L A;  4AQI A;  2WC8 A;  4QJ4 B;  1OZS A;  1IQ3 A;  3I5I B;  1UHJ A;  1YX7 A;  2JOJ A;  1KK7 Z;  4CFR A;  1QAS A;  1K94 A;  2VRG A;  3CTN A;  3QRX A;  1ALW A;  1NX2 A;  2Y5I A;  3I5H C;  2OPO A;  1ALV A;  2ZN9 A;  1DGV A;  2LVV A;  2K2A A;  2LHI A;  1U5I A;  1MWN A;  4A4B A;  4HRG A;  1K2H A;  1XO5 A;  1XA5 A;  1Y6W A;  2JT3 A;  1SBJ A;  5JOL A;  2JT8 A;  1N65 A;  1UHH A;  3BUN B;  4GGF C;  1B47 A;  2WOS A;  1PSR A;  1A29 A;  1NX3 A;  1TN4 A;  2K0J A;  3CS1 A;  3OX5 A;  2H2K A;  1KWO C;  1XFV O;  1YUS A;  4BY5 A;  2G2B A;  4GAO A;  2BL0 C;  1QX2 A;  2KDH A;  2K7D A;  1A4P A;  3JTD C;  3IQQ A;  3OB1 B;  3HX4 A;  4C0K A;  5I2L A;  2NXQ A;  4MZJ A;  1TOP A;  2SCP A;  3SIB A;  3VRQ A;  1K9K A;  1MXL C;  3TS5 C;  2IS9 A;  1B8R A;  4CFQ A;  2F33 A;  5B8I B;  1TTX A;  1FI5 A;  1J7R A;  1EJ3 A;  2LHL A;  2H61 C;  2Y4Q A;  3WXA A;  1OMD A;  1KFX L;  1F70 A;  1B9A A;  3RLZ A;  1BF5 A;  3SG6 A;  1UUS A;  2CT9 A;  2L4H A;  3HCM A;  2LC5 A;  1QTX A;  1WDC C;  2I94 A;  1FPW A;  1LA0 A;  1WY9 A;  3FS7 A;  3VRN A;  1K93 D;  1J7O A;  1SCV A;  3VGO A;  1BU3 A;  2BE4 A;  4PE4 A;  2LUC A;  1KFU L;  2MA2 A;  1FBV A;  2JU0 A;  4QJ3 B;  4GGN A;  1A75 A;  4ORC B;  3AAK A;  4D1E A;  3O6B A;  1QIW A;  1CFP A;  1PK0 D;  2CBL A;  1CKK A;  1SR6 C;  2PRU A;  3O2P A;  2TN4 A;  2L0P A;  2P6B B;  1TNW A;  3D0Y A;  1JUO A;  2PVB A;  1JF0 A;  2JXC A;  3OHM B;  1DJI A;  4MRY A;  3EVR A;  2F2P A;  2WOR A;  3I5F C;  1L2O B;  1K90 D;  1RTP 1;  1S26 D;  4UPG A;  2WCF A;  1CDN A;  1HQV A;  5DKR A;  1XFU O;  1WRK A;  5IBW A;  2K2F A;  3PN7 C;  1NP8 A;  1YTZ C;  1NIW A;  2LP2 A;  1Y1U A;  2G9B A;  1DJH A;  1YRU B;  1TIZ A;  4GGF A;  1EG4 A;  1ZFS A;  1SPY A;  4JWQ A;  1SYM A;  2B1U A;  1OOJ A;  1S36 A;  1IKU A;  3PM8 A;  3EKH A;  4TNC A;  5AER A;  3BQ3 A;  3PAT A;  3FWB A;  4PHN A;  4XJK A;  3SG7 A;  1C7W A;  1RWY A;  1SY9 A;  1ODB A;  2L5X B;  1KWO B;  2JNF A;  5ER4 X;  1F71 A;  2I18 A;  4ZCU A;  2QPT A;  1E8A A;  1YVL A;  1MUX A;  2BL0 B;  1LXF C;  4MZK A;  5TNC A;  2BE6 A;  3JVT C;  3RM1 A;  2HF5 A;  3TS5 B;  4WQ3 A;  1KK7 Y;  2RGI A;  1SL7 A;  4MN0 A;  3VRP A;  2F3Z A;  3CR4 X;  4YI8 A;  2NZ0 A;  1Y0V H;  2LE9 B;  3A4U B;  2M97 A;  1DJZ A;  1Q80 A;  2MAZ A;  1OQP A;  4HRE E;  2LNK A;  2ZKM X;  3WNX B;  1YRT B;  4ORB B;  4DUQ A;  2E6W A;  4DIR A;  3EVU A;  2ZND A;  4GNK B;  1CNP A;  1SK6 D;  1M63 B;  1V1G A;  1WDC B;  2EC6 C;  1S3P A;  2BKI B;  4Q04 A;  1ZUZ A;  4YGC B;  1BMO A;  3A8R A;  1JF2 A;  1XK4 A;  5K89 A;  3TUY C;  1JFJ A;  1CLL A;  3KF9 A;  1N0Y A;  5DKN A;  2HQ8 A;  1CMF A;  1K96 A;  1OZO A;  2KBI A;  4HSZ A;  1SR6 B;  2KBM A;  2LAN A;  3VRR A;  4F0Z B;  1K9P A;  1MHO A;  1C07 A;  2BCX A;  1IGV A;  1WLZ A;  4PAL A;  5D7F A;  1MR8 A;  1YUR A;  1H8B A;  1KFX S;  3I5F B;  1PAL A;  3FIA A;  1LKJ A;  1UHN A;  3IF7 A;  5AXI A;  2KOT A;  2L51 A;  2MRD A;  3EVV A;  1BLQ A;  1JBA A;  4YGE B;  2JTT A;  2KI4 C;  1XFZ O;  2KI6 D;  4FTG A;  1EL4 A;  5HKZ A;  3PN7 B;  3KPX A;  1W7I B;  3EK7 A;  4MZL A;  1JWD A;  2JPT A;  1JSA A;  2LVK A;  1J55 A;  2K7C A;  2LLT A;  3AAJ A;  4P2Y B;  2ZN8 A;  1QIV A;  1S5G Y;  5AAN A;  2MBX A;  1TNQ A;  1M31 A;  3WHU B;  3CR5 X;  1CFC A;  2OTG C;  1NCX A;  2M1U A;  4C0J A;  1AVS A;  2EHB A;  1NCY A;  3NSO A;  3O78 A;  5HLV A;  1KCY A;  2KGB C;  4DRW A;  4GFT A;  1QXP A;  3DF0 A;  4I5L B;  4I5K A;  1KQM C;  1WLM A;  1S5G Z;  5KTY A;  4JPZ B;  4DS7 A;  5HKY A;  3CZT X;  4M2Q A;  2PMY A;  2HPS A;  2KFF A;  2Q91 A;  2CCM A;  3SG4 A;  4BY4 A;  1C7V A;  1SCM C;  1JFK A;  1J1E A;  1XK4 C;  4CPV A;  1WRZ A;  1NUB A;  2F2O A;  5CSF A;  1K8U A;  1NYA A;  3BUW B;  3I5G C;  3JVT B;  1R2U A;  2NCP A;  2FCD A;  3IQO A;  1CMG A;  1NSH A;  2NCO A;  3FWC A;  1YX8 A;  3C1V A;  4XYN A;  1CDL A;  1K95 A;  1PVA A;  3K21 A;  4N5X A;  1D1O A;  2O60 A;  4YGB B;  3D0Y B;  1CDM A;  1DJX A;  1NWD A;  1UUR A;  2O5G A;  5D69 A;  5J3X A;  4YRU A;  1DJG A;  1ZAC A;  1VRK A;  4NDD A;  5I8N A;  3DVE A;  4M2O A;  1B4C A;  4OR9 B;  1PSB A;  1G33 A;  1M46 A;  1SL8 A;  1BT6 A;  5FYX A;  2EC6 B;  2KNE A;  3D10 A;  4YI9 A;  1ZMZ A;  2F3Y A;  3TUY B;  1F54 A;  3I5H B;  1HT9 A;  2Y1M A;  1NX0 A;  1G4Y R;  3PAL A;  2KSP A;  1MQ1 A;  2LAP A;  4FQO A;  1J7Q A;  1M45 A;  1XYD A;  2K8M B;  4MEW A;  1BOD A;  1SMG A;  2L98 A;  2LMU A;  3OX6 A;  3PLF B;  2ZRT A;  1RFJ A;  4GBA A;  3BXK A;  1YUU A;  1QV0 A;  2M7N A;  4PE1 A;  5KU1 A;  1Y1X A;  1EG3 A;  2LP3 A;  5PAL A;  2LMT A;  2A4J A;  2LV7 A;  1FF1 A;  3KEV A;  2AUC A;  1XFY O;  2JWW A;  3BYA A;  4AOM A;  1BG1 A;  4ORA B;  3SG5 A;  2NLN A;  2WND A;  2MLF C;  3TZ1 A;  3JTD B;  1DF0 A;  1IJ6 A;  2DOQ A;  2MHH A;  2EGD A;  3ZNI A;  2OS8 C;  2WCE A;  1W7J B;  3GK1 A;  4GUK A;  1EXR A;  4PHK A;  2KYC A;  5AEQ A;  1UWO A;  3BOW A;  4ZCV A;  5F6T A;  5JJG A;  1CB1 A;  5I2O A;  3GK2 A;  1MF8 B;  1R6P A;  4L9M A;  2M7L A;  1SW8 A;  5CSI A;  2L50 A;  1QS7 A;  2OTG B;  3DVK A;  1J1D A;  4YBH B;  1PRW A;  2LLU A;  1XFW O;  1GGW A;  4MRX A;  4M2P A;  2LVJ A;  1X02 A;  2BCB A;  1KSO A;  2HET A;  1S1E A;  3SJS A;  1A03 A;  3ZWH A;  1CM4 A;  1QLS A;  1REC A;  4E68 A;  4YGD B;  4PHJ A;  2JUL A;  1J7P A;  1RRO A;  2LM5 A;  1ZOT B;  2E30 A;  2PAS A;  3EK8 A;  2Q4U A;  1SCM B;  2JC2 A;  3EK4 A;  2BKH B;  1UHK A;  4I5N B;  3DVJ A;  2I7A A;  1DT7 B;  1AHR A;  2LCP A;  4ICB A;  2ZFD A;  3I5G B;  1OSA A;  2MJW B;  2FJU B;  4U8D A;  1U5I B;  2KYF A;  2CTN A;  4OKH A;  4IL1 A;  3NSI A;  2Y1N A;  4P5O E;  1QJT A;  1DGU A;  1QX5 B;  2AAO A;  2HQW A;  4USL A;  5CPV A;  1IH0 A;  1CFD A;  2ZNE A;  1IWQ A;  2F8P A;  1OMR A;  1KFU S;  4AQJ A;  2LMV A;  1LVC D;  2FCE A;  1S6C A;  4NDB A;  4PE7 A;  4R1E A;  1Y1A A;  1TCO B;  2BBM A;  3ICB A;  3OB2 B;  2JRF A;  1XFX O;  3LK0 A;  2ZRS A;  3DD4 A;  1SKT A;  3LK1 A;  1BR4 B;  1F4O A;  1OMV A;  5KSZ A;  1SNL A;  5HKW A;  2JNX A;  1BOC A;  1NCZ A;  4CLN A;  2GGM A;  4NQG A;  1PUL A;  3GOF A;  5DKQ A;  1B7T Y;  3SG3 A;  2KFH A;  5HLO A;  2JQ6 A;  4QJ5 B;  1KK8 C;  2AMI A;  3TDI A;  3DF0 B;  2M0R A;  3PSR A;  1FI6 A;  1DJY A;  1GQM A;  1XVJ A;  3BUX B;  5HYD A;  3DVM A;  1YR5 A;  2OS8 B;  2SAS A;  3EKJ A;  1DTL A;  1K9U A;  1RJV A;  2BCA A;  1B7T Z;  2JT0 A;  4MSP A;  1CTR A;  1A75 B;  2LUX A;  4ETO A;  3I5I C;  1L7Z A;  2PSR A;  1NX1 A;  3LCP C;  4PDZ A;  2M3W A;  3H4S E;  3KO0 A;  4I5J A;  2KHN A;  1AUI B;  4JQ0 D;  1CLM A;  2I2R E;  1CM1 A;  2BBN A;  3AKA A;  2FOT A;  4NDC A;  1S6J A;  1PVB A;  1M39 A;  3WHT B;  2R2I A;  2MLE C;  2WCB A;  4N1G A;  3CWG A;  3NSK A;  1EH2 A;  2GV5 A;  2M29 A;  4OCI A;  1IJ5 A;  4CID A;  2M8U A;  2KI6 C;  4PCW A;  1BR1 B;  1UHI A;  1DMO A;  3NSL A;  2K7B A;  4PHM A;  3KHE A;  3CGA A;  1WRL A;  1AK8 A;  1JC2 A;  2GGZ A;  2JTZ A;  2L2E A;  2KGR A;  1AJ5 A;  1TRF A;  3CLN A;  4MVF A;  1B1G A;  1KQV A;  4HRH A;  1IQ5 A;  2KAY A;  2D8N A;  4MLW A;  1DVI A;  4A4C A;  5GQQ C;  1CFF A;  1CLB A;  2KFG A;  2L4I A;  1F4Q A;  1BJF A;  1QLK A;  3LL8 B;  1F8H A;  2K61 A;  1GJY A;  1H4B A;  1KSM A;  2K7O A;  2JXL A;  4PE0 A;  2ISD A;  2BEC A;  1QAT A;  3TDZ A;  4OV2 A;  1IG5 A;  3E3R A;  3TDU A;  1CDP A;  1AJ4 A;  2PAL A;  5BPJ A;  1LA3 A;  1QX7 A;  2KAV A;  2KAX A;  1FW4 A;  2KI4 B;  1TCF A;  3AKB A;  3GK4 X;  2KQ6 A;  4WRI A;  1N2D A;  3CR2 A;  4C0L A;  1UP5 A;  1AP4 A;  4N1F A;  1G8I A;  4XJK B;  5CSJ A;  2QAC A;  1QVI Y;  1DJW A;  5CSN A;  3O4Y A;  1SL9 A;  5I2Q A;  1QV1 A;  1GGZ A;  1DF0 B;  3SG2 A;  4OVN F;  1F55 A;  1SRA A;  3BOW B;  1MXE A;  1V1F A;  4YGA A;  2V53 A;  5AFP A;  2CXJ A;  1QVI Z;  1KQM B;  2CNP A;  2M49 B;  2LLS A;  1IRJ A;  1YVH A;  3BUM B;  2LVI A;  2H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...