2MJWB

Structural insights into calcium bound s100p - v domain of the receptor for advanced glycation end products (rage) complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
b'MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Structural insights into calcium-bound S100P and the V domain of the RAGE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 32
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mjwB00
4OR9B 2TN4A 1CTRA 4PE7A 1XYDA 1C7WA 1R2UA 3O78A 4JWQA 1Y1UA 4MZLA 1YR5A 4FQOA 1NX3A 1OE9B 2M7NA 4D1EA 1YUSA 2ZN9A 4QJ5B 1QVIY 4NDDA 3TDUA 5I2LA 1F70A 2H61A 2LMUA 3SIAA 5CSJA 3RM1A 5I2OA 3PM8A 1SMGA 4GPLB 2L2EA 3CLNA 3SG5A 3GK1A 3LL8B 4AOMA 1XA5A 1OMVA 4OCIA 3BOWB 4ZCUA 1JUOA 1YUTA 3LLEA 4ORAB 2KFFA 1M46A 1Y1XA 1NIWA 2PRUA 3EVUA 2NCPA 1PK0D 3JTDC 3FIAA 1NPQA 1J1EA 1LVCD 2I2RE 4I5KA 3CS1A 3I5GB 4YGAA 4CLNA 3TDIA 4GUKA 1DTLA 2BE4A 2GGMA 4BY4A 2BECA 2M9GA 2KNEA 2PSRA 1CNPA 1NYAA 2K0JA 2QACA 3OX6A 4ICBA 4UPGA 2KQYA 3I5GC 1RFJA 1EJ3A 2OS8C 1TCOB 3D0YA 2IS9A 4ORBB 1A29A 1M45A 1YRTB 2JZIA 5AERA 1J7OA 1IKUA 1F55A 3AAKA 2P6BB 2JTZA 5I2QA 1IG5A 3SG2A 1KFXS 2K61A 4MN0A 1L2OB 2WCBA 4DIRA 1QASA 5D69A 1K2HA 2JOJA 3LCPC 4GAOA 2JC2A 4YGBB 1BG1A 1R6PA 4CFRA 3OB2B 2KOTA 1JF2A 1DJHA 1MWNA 4P5OE 1A75B 1QLKA 5HLOA 1DJYA 1N2DA 2Y1MA 1WRLA 2JXLA 3MSEB 5FYXA 1QX5B 4DS7A 1AUIB 4PHKA 2L5XB 4M2PA 2ISDA 4MRXA 2A4JA 2G9BA 2ZNDA 5GQQC 2NXQA 1Q80A 1MF8B 3SG3A 3TUYC 1ZFSA 5CPVA 3EK8A 2F2PA 3PSRA 1RJVA 2O5GA 4YGEB 1XFWO 3VRPA 1V1GA 2G2BA 2JNXA 4PHJA 1IQ3A 4PE4A 1SR6B 2WOSA 1YVHA 4PE1A 2SASA 2E30A 1B8RA 1HQVA 1NCYA 1IWQA 3DVEA 1K9PA 2MLFC 1DGVA 1CLLA 3OHMB 4AQJA 1B9AA 5B8IB 2M1UA 2KGRA 3AKAA 1M39A 1NWDA 2PALA 1CLMA 1PSBA 1UURA 2K7CA 2MJWB 4YBHB 3TS5C 1MQ1A 2K7BA 2KYFA 4HSZA 4NQGA 5TNCA 4MZKA 1CDNA 3I5HB 1KSMA 3BXKA 1XFVO 1JSAA 5KTYA 1MHOA 3KEVA 4JPZB 4PHMA 2Q4UA 2K2FA 1NSHA 3K21A 5KSZA 1ALVA 4M2OA 2WCFA 1G4YR 3I5HC 1JFJA 1UP5A 2FCDA 1DJWA 3D10A 4MLWA 1SL9A 3C1VA 1AP4A 1S5GZ 4MSPA 2DOQA 1F54A 4OKHA 3HX4A 5D7FA 1SCMB 1AK8A 1ODBA 1U5IA 1SKTA 1LA3A 1CB1A 1WRZA 1QV1A 1J7RA 1S6IA 2M0RA 3DF0B 1TCFA 1G33A 1DT7B 2LVVA 1GGWA 1OOJA 3CR2A 1K95A 1EL4A 2OTGB 1QJTA 2SCPA 3CWGA 3ICBA 1ZOTB 1JF0A 2MHHA 1AJ4A 2Y5IA 2LV7A 1B47A 1WDCB 1KK8B 1UHNA 1N0YA 2KAXA 2LVJA 2KQ6A 2Q91A 2I94A 3PATA 4DCKA 4A4BA 4I5NB 1CFPA 1FPWA 1E8AA 1M63B 1RECA 4YI8A 3ZNIA 1XFYO 2F8PA 4I5LB 1YX8A 4PHNA 2K7OA 1CFCA 1WDCC 1S36A 3TDZA 4FTGA 3I5FB 2LHLA 1XFXO 1YTZC 2K8MB 2F33A 3O4YA 3JVTB 2HPSA 2JT8A 2L4IA 3BUNB 3HCMA 1CDMA 3PN7B 4HREE 4I5JA 1BMOA 1CFDA 1KSOA 4GGFA 3O2PA 1NCXA 3SJSA 2KI4B 1DF0A 2LCPA 4DUQA 1KQVA 2Y4QA 3SG6A 3KHEA 4ETOA 1RK9A 1KFXL 1PALA 2JU0A 1FI6A 1Y6WA 4P2YB 2HQWA 2M49B 1TOPA 3GK4X 1IRJA 2KI4C 2LNKA 3BUOB 5HYDA 2H61C 1KCYA 1IQ5A 1PRWA 3PFVA 4NDCA 1J55A 1NUBA 1K9UA 1DJGA 1KK7Z 2JQ6A 1IH0A 1RTP1 4N1GA 1EH2A 1KWOB 4MBEA 4C0LA 2LMTA 2KBIA 3EK4A 1B8LA 3AKBA 4DRWA 1ZACA 2L4HA 1KQMB 3SG7A 1IJ5A 1SRAA 3SIBA 2KFGA 1BF5A 2ZRTA 2BCXA 4F0ZB 1L2OC 5AXIA 2CTNA 1BODA 1NX0A 2LM5A 3D0YB 3DD4A 2ZFDA 2BE6A 3KF9A 1XFZO 1B1GA 1PULA 3NXAA 5HKWA 1WY9A 1TRFA 2MBXA 1CDLA 4N1FA 3FWCA 4HRGA 3F45A 4YGCB 1ALWA 1FI5A 1TTXA 5HKYA 1YVLA 1QATA 5CSNA 2PASA 3BUMB 3IQOA 5AFPA 1CDPA 2WC8A 2LVIA 1A03A 1RWYA 3H4SE 3VRNA 1QS7A 2CCMA 2MLEC 1SY9A 3IQQA 1K93D 5DKRA 4WQ3A 2ZRSA 3OP0A 1QIWA 2M8UA 1K96A 1S3PA 4CFQA 4C0JA 2LUCA 3BQ3A 1CKKA 1MXEA 1SR6C 1DJXA 2LP2A 1S6CA 2F2OA 2QPTA 4NDBA 4XJKA 2BKHB 3DVMA 5G08A 2BBNA 1Y0VH 2JWWA 4L9MA 1TN4A 5J3XA 1B7TZ 2B1UA 2L98A 2KSPA 2M3WA 2KFHA 1MXLC 1NCZA 3SG4A 1C7VA 1AJ5A 2JPTA 1QIVA 1KFUL 1XK4A 4MVFA 2JRFA 3LK0A 2LMVA 2PVBA 3PALA 1K9KA 4N5XA 4IL1A 2KGBC 2JTTA 2LC5A 2PMYA 3O6BA 5ER5A 1FBVA 2CBLA 1K8UA 1J7QA 2KHNA 1X02A 1KFUS 1W7JB 3PLFB 1AVSA 3NSOA 5ER4X 2NZ0A 1N65A 1Y1AA 1OMRA 1S1EA 1SK6D 1XO5A 2KAYA 4GFTA 1TNPA 4E68A 2LUXA 2ZN8A 2GGZA 1OZSA 2ZNEA 3I5IB 4Q04A 1AHRA 1SCMC 3VGOA 1EG4A 2EGDA 2F3YA 3GK2A 2AUCA 3IF7A 4HRHA 4GGNA 4PDZA 1OSAA 2BKIB 1QVIZ 1S5GY 1CFFA 4TNCA 1SL7A 2CT9A 2MA2A 2OTGC 3FWBA 2L50A 3BOWA 1SBJA 1XVJA 2WORA 1M31A 2LE9B 2R2IA 3BUWB 2HF5A 4CPVA 5BPJA 5K89A 1JBAA 1KK8C 1ZMZA 1U5IB 3RLZA 1DJZA 3E3RA 3EK7A 3DVJA 1QV0A 4MRYA 4U8DA 4GBAA 5PALA 4QJ4B 1PVBA 2LVKA 1CLBA 1DVIA 4A4CA 2NLNA 2O60A 3I5FC 5KU1A 3WHUB 3DVKA 3WNXB 3A8RA 2GV5A 2M1KB 1L7ZA 1SYMA 1UHIA 2BCAA 2VRGA 3JTDB 3JVTC 1F4QA 1LXFC 1YX7A 3AAJA 3PN7C 4JQ0D 1BR4B 3WHTB 1DGUA 5DKQA 2KI6C 3KO0A 4PE0A 5CSIA 1S26D 1DMOA 2LLSA 1JC2A 2EC6B 3EVVA 2LP3A 3CGAA 4WQ2A 1D1OA 1H8BA 3ZWHA 1UUSA 2M29A 2CXJA 2OS8B 2K7DA 2KBMA 1JWDA 3EKJA 1CM1A 4MZJA 1A4PA 2KDHA 5DKNA 4M2QA 2EC6C 1SW8A 1OMDA 1UHHA 2I7AA 1A75A 1DF0B 2LHIA 1GGZA 1LKJA 2JT3A 1IJ6A 1UWOA 1BJFA 2L51A 1NP8A 4MEWA 1B8CA 1NX2A 2V53A 3GOFA 2M7LA 5HLVA 1KWOC 1LA0A 2ZKMX 2CNPA 1LINA 2K2AA 4GGFC 2MRDA 5IBWA 1KK7Y 1KQMC 2L0PA 3M0WA 4OV2A 1BOCA 3NSIA 1J1DA 1NX1A 1OQPA 1S6JA 2OPOA 1FF1A 1OZOA 2AAOA 2Y1NA 1B4CA 1J7PA 2JNFA 3LK1A 3VRQA 1QXPA 1QX2A 4PALA 4XYNA 3KPXA 3A4UB 2HETA 1ZUZA 3CZTX 2LLUA 2JT0A 2KI6D 3BYAA 3FS7A 1QTXA 2BL0B 3NSLA 3TUYB 3VROA 1BLQA 2BCBA 5I8NA 1CMGA 4PCWA 5AANA 1VRKA 4YGDB 5JOLA 1MR8A 1SPYA 3TZ1A 1IGVA 1EXRA 2BL0C 1UHKA 2KAVA 1QX7A 3WXAA 4AQIA 1SL8A 3EVRA 3QRXA 1CMFA 1GJYA 1MUXA 1W7IB 2FCEA 3CR4X 4GNKB 2WNDA 5HKZA 4BY5A 1UHJA 1TIZA 1XFUO 1TNXA 2MAZA 2EHBA 2E6WA 1YURA 2AMIA 3OX5A 4YRUA 2LANA 4WRIA 1SNLA 1YUUA 1A2XA 1BT6A 2KYCA 2NCOA 1H4BA 3VRRA 1HT9A 2FOTA 2COLB 2F3ZA 4R1EA 1QLSA 1K94A 3BUXB 1DJIA 3TS5B 4OVNF 2H2KA 2HQ8A 1RROA 2M97A 2LLTA 1BR1B 1FW4A 1B7TY 1PSRA 4YI9A 1F8HA 2JXCA 2WCEA 4XJKB 1K90D 3DF0A 5CSFA 3OB1B 2LAPA 2BBMA 3CTNA 4C0KA 1TNQA 3CR5X 5JJGA 4CIDA 3NSKA 2JULA 1YRUB 1WLMA 1GQMA 2D8NA 3EKHA 4QJ3B 5F6TA 4ZCVA 1C07A 1F71A 1TNWA 1BU3A 1WRKA 2I18A 4ORCB 3I5IC 1CM4A 2RGIA 1JFKA 2FJUB 1G8IA 1EG3A 5AEQA 1PVAA 1SCVA 1WLZA 1XK4C 4USLA 1V1FA 1F4OA
chains in the Genus database with same CATH superfamily
4OR9B 2TN4A 1CTRA 3R1VA 1XYDA 4PE7A 3SS5A 1DELA 1C7WA 1R2UA 3O78A 4JWQA 1Y1UA 4MZLA 1YR5A 2WC6A 4FQOA 1NX3A 1OE9B 2M7NA 4D1EA 1YUSA 2ZN9A 1OOIX 1QVIY 4NDDA 3TDUA 4QJ5B 4PT1A 5I2LA 1F70A 2H61A 2LMUA 3SIAA 5CSJA 3RM1A 5I2OA 3NHIA 3PM8A 1SMGA 3FE8A 4GPLB 1TUJA 2L2EA 3CLNA 3SG5A 3GK1A 3LL8B 4AOMA 1XA5A 1OMVA 4INWA 4OCIA 3BOWB 4ZCUA 1JUOA 1YUTA 3LLEA 4INXA 4ORAB 2KFFA 1M46A 1Y1XA 1NIWA 2PRUA 3EVUA 2NCPA 1PK0D 3JTDC 3FIAA 1NPQA 1J1EA 1LVCD 2I2RE 4I5KA 3CS1A 3I5GB 1GM0A 4YGAA 4CLNA 1Z2CB 3TDIA 4GUKA 3UO9A 1DTLA 2BE4A 2GGMA 4BY4A 2BECA 2M9GA 2KNEA 2PSRA 1CNPA 1NYAA 2K0JA 2QACA 3OX6A 4ICBA 4UPGA 2KQYA 3I5GC 1RFJA 2PYQA 1EJ3A 2OS8C 1TCOB 3D0YA 2BNXA 2IS9A 4ORBB 1A29A 1M45A 1YRTB 2JZIA 5DICA 5AERA 1J7OA 1IKUA 1F55A 3AAKA 2P6BB 2JTZA 5I2QA 1IG5A 3SG2A 1KFXS 3CDNA 1TUZA 2K61A 3BJHA 4MN0A 1L2OB 2WCBA 4DIRA 1QASA 5D69A 1K2HA 2JOJA 3LCPC 4GAOA 2JC2A 4YGBB 1BG1A 1R6PA 1XFRA 4CFRA 3OB2B 2KOTA 1JF2A 1DJHA 1MWNA 4P5OE 1A75B 1QLKA 5HLOA 1DJYA 1N2DA 2Y1MA 1WRLA 2JXLA 1C3YA 3OGNA 3MSEB 4FQTA 5FYXA 1QX5B 4DS7A 1AUIB 4PHKA 3EG5B 2L5XB 4M2PA 3CZ2A 2ISDA 4MRXA 2A4JA 2G9BA 2ZNDA 5GQQC 2NXQA 1Q80A 2KLDA 1MF8B 3SG3A 3TUYC 1ZFSA 5CPVA 3EK8A 2ERBA 2F2PA 3PSRA 1RJVA 2WCKA 2O5GA 4YGEB 1XFWO 3BFAA 1V1GA 2G2BA 2JNXA 4PHJA 2PQLA 3VRPA 1IQ3A 4PE4A 3D74A 1SR6B 2WOSA 1YVHA 4PE1A 2SASA 2E30A 2P71A 1B8RA 1HQVA 1NCYA 2WCHA 1IWQA 3DVEA 1C3ZA 1K9PA 2L5YA 2MLFC 1DGVA 1CLLA 3OHMB 4AQJA 1B9AA 5B8IB 2M1UA 2KGRA 3AKAA 1M39A 1NWDA 2PALA 1CLMA 1PSBA 1UURA 3DXLA 2K7CA 2MJWB 4YBHB 3TS5C 1MQ1A 2K7BA 2KYFA 4HSZA 4NQGA 5TNCA 1T14A 4MZKA 1CDNA 3I5HB 1KSMA 3BXKA 1XFVO 1JSAA 3PJIA 5KTYA 1MHOA 3CZ0A 3KEVA 4JPZB 4PHMA 2Q4UA 4KYNA 2K2FA 1NSHA 3K21A 5KSZA 1ALVA 4M2OA 2WCFA 1G4YR 3I5HC 1JFJA 1UP5A 2FCDA 3D78A 1DJWA 3D10A 4MLWA 1SL9A 2QEBA 3C1VA 1S5GZ 4MSPA 1AP4A 2DOQA 3JVTC 4OKHA 3HX4A 5D7FA 1F54A 1SCMB 1AK8A 1ODBA 1U5IA 1SKTA 1LA3A 1CB1A 1DQEA 1WRZA 1QV1A 1J7RA 1S6IA 2M0RA 3L4LA 2KLEA 3DF0B 1TCFA 1G33A 5EL2A 1DT7B 2LVVA 1GGWA 3BFBA 1OOJA 3CR2A 1K95A 1EL4A 2OTGB 1QJTA 2SCPA 3CWGA 3ICBA 1ZOTB 3K1EA 1JF0A 2MHHA 1AJ4A 2Y5IA 2LV7A 1B47A 1WDCB 2JPOA 1KK8B 1UHNA 1N0YA 2KAXA 2LVJA 1OW4A 2KQ6A 2Q91A 2I94A 3PATA 4DCKA 4A4BA 4I5NB 1CFPA 1FPWA 1E8AA 1M63B 1RECA 3N7HA 4YI8A 3ZNIA 1XFYO 2F8PA 4I5LB 3D76A 1YX8A 4PHNA 2K7OA 1CFCA 1WDCC 1S36A 3TDZA 4FTGA 3I5FB 2LHLA 1DEKA 3DYEA 1XFXO 1YTZC 2K8MB 2F33A 3O4YA 3JVTB 2HPSA 2JT8A 2L4IA 3BUNB 3HCMA 1CDMA 3PN7B 4HREE 4I5JA 1BMOA 1CFDA 1KSOA 4GGFA 3O2PA 1NCXA 5FI7A 3SJSA 2KI4B 1DF0A 1P28A 2LCPA 4DUQA 1KQVA 2Y4QA 3SG6A 3KHEA 3NHTA 4ETOA 1RK9A 1KFXL 1PALA 2JU0A 1FI6A 3BFHA 1Y6WA 4P2YB 2HQWA 2M49B 1SSEB 1TOPA 1IRJA 2KI4C 2LNKA 3BUOB 3B7AA 3GK4X 3QMEA 3VB1A 3O4XA 2H61C 1KCYA 1IQ5A 1PRWA 3PFVA 4NDCA 1J55A 1NUBA 1K9UA 1DJGA 1KK7Z 2JQ6A 1IH0A 1RTP1 4N1GA 1EH2A 3IVTA 1KWOB 4MBEA 4C0LA 2LMTA 3FE6A 2KBIA 3EK4A 1B8LA 3AKBA 4DRWA 1ZACA 2L4HA 1KQMB 3SG7A 1IJ5A 1SRAA 3SIBA 2KFGA 1BF5A 2ZRTA 2BCXA 1LS8A 4F0ZB 1L2OC 3B88A 5AXIA 1QWVA 2CTNA 1BODA 1NX0A 2LM5A 3D0YB 3DD4A 2ZFDA 2BE6A 3KF9A 1XFZO 2K60A 1PULA 2KPHA 3S0FA 4OZDA 3DZTA 3NXAA 5HKWA 1B1GA 1WY9A 1TRFA 2MBXA 3RZSA 1CDLA 4N1FA 3FWCA 4HRGA 3F45A 4YGCB 1ALWA 1FI5A 1TTXA 3CZ1A 5HKYA 1YVLA 3B6XA 1QATA 5CSNA 2PASA 3BUMB 3IQOA 5AFPA 1CDPA 2WC8A 2LVIA 1A03A 1RWYA 3H4SE 3VRNA 1IIOA 1QS7A 3V2LA 2CCMA 2MLEC 1SY9A 3IQQA 1K93D 5DKRA 4WQ3A 2ZRSA 3OP0A 1QIWA 1Z4HA 2M8UA 1K96A 3D77A 1S3PA 2BAPA 4CFQA 4C0JA 2LUCA 3BQ3A 1CKKA 1MXEA 1SR6C 1DJXA 2LP2A 1S6CA 2F2OA 2QPTA 4NDBA 3CYZA 2BKHB 4XJKA 3DVMA 5G08A 2BBNA 1Y0VH 5HL1A 3S0GA 2JWWA 3B86A 1TN4A 4L9MA 5J3XA 1B7TZ 2B1UA 2H8VA 2L98A 2KSPA 2M3WA 2KFHA 1MXLC 1NCZA 3SG4A 1C7VA 1AJ5A 2JPTA 1QIVA 1KFUL 1XK4A 4MVFA 2JRFA 3LK0A 3S0AA 2YGUA 2LMVA 2PVBA 3PALA 1K9KA 4N5XA 4IL1A 2KGBC 2JTTA 2L2CA 2LC5A 2FJYA 2PMYA 3O6BA 3R72A 4JD9A 1FBVA 5ER5A 2CBLA 1K8UA 2WCJA 2KHNA 1X02A 1J7QA 1KFUS 1W7JB 3PLFB 1AVSA 3NSOA 5ER4X 2NZ0A 1N65A 1Y1AA 1OMRA 1S1EA 1SK6D 1XO5A 2KAYA 4GFTA 1TNPA 4E68A 5HYDA 2LUXA 2ZN8A 2GGZA 1OZSA 2ZNEA 3I5IB 4Q04A 1AHRA 3Q8IA 1SCMC 3VGOA 2QEOA 3DY9A 1EG4A 3OBVA 2EGDA 2F3YA 3GK2A 2AUCA 3IF7A 4HRHA 4GGNA 4PDZA 1OSAA 2BKIB 1QVIZ 1S5GY 1CFFA 4TNCA 1SL7A 2CT9A 1TWOA 2MA2A 2OTGC 3FWBA 2L50A 3BOWA 1SBJA 1XVJA 2WORA 3S0DA 1M31A 2LE9B 2R2IA 3BUWB 2HF5A 4CPVA 5BPJA 5K89A 1JBAA 1KK8C 1ZMZA 1U5IB 3RLZA 1DJZA 2WCMA 3E3RA 3EK7A 3DVJA 1QV0A 4MRYA 4U8DA 3R1OA 4GBAA 5PALA 4QJ4B 1PVBA 2LVKA 1CLBA 1DVIA 4A4CA 2NLNA 2O60A 3CABA 3I5FC 5KU1A 3WHUB 3DVKA 3WNXB 3A8RA 2GV5A 2M1KB 1L7ZA 1SYMA 1UHIA 2BCAA 2QEVA 2VRGA 3JTDB 1F4QA 1LXFC 1YX7A 3AAJA 3PN7C 4JQ0D 3FE9A 1BR4B 3WHTB 1DGUA 5DKQA 2KI6C 3KO0A 4PE0A 5CSIA 1S26D 1DMOA 2LLSA 1JC2A 2EC6B 3EVVA 2LP3A 3CGAA 4WQ2A 1D1OA 1H8BA 2GTEA 1UUSA 2M29A 2CXJA 3ZWHA 2OS8B 2K7DA 2KBMA 3D73A 3EKJA 1JWDA 1CM1A 4MZJA 1A4PA 2KDHA 3S0BA 5DKNA 4M2QA 2EC6C 1SW8A 1OMDA 1UHHA 2I7AA 1A75A 1DF0B 2LHIA 1GGZA 1LKJA 1ORGA 2JT3A 1IJ6A 1UWOA 1BJFA 2L51A 1NP8A 4MEWA 1B8CA 1NX2A 2V53A 3GOFA 2M7LA 4F7FA 5HLVA 1DC1A 1KWOC 1LA0A 2ZKMX 2CNPA 1LINA 2K2AA 4GGFC 2MRDA 5IBWA 1KK7Y 1KQMC 2L0PA 3B87A 3M0WA 4OV2A 1BOCA 4JKTA 3NSIA 5FI2A 2P70A 1J1DA 1NX1A 1OOHA 1OQPA 1S6JA 2OPOA 1FF1A 1OZOA 2AAOA 2Y1NA 1B4CA 1J7PA 2JNFA 3LK1A 3VRQA 1QXPA 1QX2A 4PALA 4XYNA 2QDIA 3KPXA 3A4UB 2HETA 1ZUZA 3CZTX 2LLUA 2JT0A 3S0EA 1OOFA 2KI6D 3BYAA 3NGVA 3UNWA 3FS7A 1QTXA 2BL0B 3NSLA 3TUYB 3VROA 1BLQA 2BCBA 5I8NA 1CMGA 4PCWA 5AANA 1VRKA 4YGDB 5JOLA 1MR8A 1SPYA 3TZ1A 1IGVA 1EXRA 2BL0C 1UHKA 2KAVA 1QX7A 3WXAA 4AQIA 3L47A 1SL8A 3EVRA 3QRXA 1CMFA 1GJYA 1MUXA 1W7IB 2FCEA 3CR4X 4GNKB 2WNDA 5HKZA 4BY5A 1UHJA 1TIZA 1XFUO 1TNXA 2MAZA 2EHBA 2E6WA 1YURA 2AMIA 2WC5A 3OX5A 4YRUA 2LANA 4WRIA 1SNLA 1YUUA 1A2XA 1BT6A 2KYCA 2NCOA 1H4BA 3VRRA 1HT9A 2FOTA 2COLB 2F3ZA 4R1EA 1QLSA 1K94A 3BUXB 1DJIA 3D75A 3TS5B 4OVNF 3SS4A 1OOGA 2H2KA 2HQ8A 1RROA 2M97A 2LLTA 1BR1B 1FW4A 1B7TY 1PSRA 4YI9A 3L4AA 2JXCA 2WCEA 4XJKB 1F8HA 1K90D 3DF0A 5CSFA 3OB1B 2LAPA 4IJ7A 2BBMA 2QEHA 3CTNA 3PM2A 5I94A 4C0KA 1TNQA 3CR5X 5JJGA 4CIDA 3NSKA 2JULA 1YRUB 1WLMA 1GQMA 2D8NA 3EKHA 4QJ3B 5F6TA 4ZCVA 3SS3A 5FI6A 1C07A 1F71A 1TNWA 1BU3A 1WRKA 2I18A 4ORCB 3I5IC 1CM4A 2RGIA 1JFKA 2FJUB 1G8IA 1EG3A 5AEQA 1PVAA 1SCVA 1WLZA 1XK4C 2WCLA 3R1PA 4USLA 1W9ZA 5D3OA 1V1FA 1F4OA
chains in the Genus database with same CATH topology
4OR9B 2TN4A 1CTRA 4PE7A 1XYDA 1C7WA 1R2UA 3O78A 4JWQA 1Y1UA 4MZLA 1YR5A 4FQOA 1NX3A 1OE9B 2M7NA 4D1EA 1YUSA 2ZN9A 4QJ5B 1QVIY 4NDDA 3TDUA 5I2LA 1F70A 2H61A 2LMUA 3SIAA 5CSJA 3RM1A 5I2OA 3PM8A 1SMGA 4GPLB 2L2EA 3CLNA 3SG5A 3GK1A 3LL8B 4AOMA 1XA5A 1OMVA 4OCIA 3BOWB 4ZCUA 1JUOA 1YUTA 3LLEA 4ORAB 2KFFA 1M46A 1Y1XA 1NIWA 2PRUA 3EVUA 2NCPA 1PK0D 3JTDC 3FIAA 1NPQA 1J1EA 1LVCD 2I2RE 4I5KA 3CS1A 3I5GB 4YGAA 4CLNA 3TDIA 4GUKA 1DTLA 2BE4A 2GGMA 4BY4A 2BECA 2M9GA 2KNEA 2PSRA 1CNPA 1NYAA 2K0JA 2QACA 3OX6A 4ICBA 4UPGA 2KQYA 3I5GC 1RFJA 1EJ3A 2OS8C 1TCOB 3D0YA 2IS9A 4ORBB 1A29A 1M45A 1YRTB 2JZIA 5AERA 1J7OA 1IKUA 1F55A 3AAKA 2P6BB 2JTZA 5I2QA 1IG5A 3SG2A 1KFXS 2K61A 4MN0A 1L2OB 2WCBA 4DIRA 1QASA 5D69A 1K2HA 2JOJA 3LCPC 4GAOA 2JC2A 4YGBB 1BG1A 1R6PA 4CFRA 3OB2B 2KOTA 1JF2A 1DJHA 1MWNA 4P5OE 1A75B 1QLKA 5HLOA 1DJYA 1N2DA 2Y1MA 1WRLA 2JXLA 3MSEB 5FYXA 1QX5B 4DS7A 1AUIB 4PHKA 2L5XB 4M2PA 2ISDA 4MRXA 2A4JA 2G9BA 2ZNDA 5GQQC 2NXQA 1Q80A 1MF8B 3SG3A 3TUYC 1ZFSA 5CPVA 3EK8A 2F2PA 3PSRA 1RJVA 2O5GA 4YGEB 1XFWO 3VRPA 1V1GA 2G2BA 2JNXA 4PHJA 1IQ3A 4PE4A 1SR6B 2WOSA 1YVHA 4PE1A 2SASA 2E30A 1B8RA 1HQVA 1NCYA 1IWQA 3DVEA 1K9PA 2MLFC 1DGVA 1CLLA 3OHMB 4AQJA 1B9AA 5B8IB 2M1UA 2KGRA 3AKAA 1M39A 1NWDA 2PALA 1CLMA 1PSBA 1UURA 2K7CA 2MJWB 4YBHB 3TS5C 1MQ1A 2K7BA 2KYFA 4HSZA 4NQGA 5TNCA 4MZKA 1CDNA 3I5HB 1KSMA 3BXKA 1XFVO 1JSAA 5KTYA 1MHOA 3KEVA 4JPZB 4PHMA 2Q4UA 2K2FA 1NSHA 3K21A 5KSZA 1ALVA 4M2OA 2WCFA 1G4YR 3I5HC 1JFJA 1UP5A 2FCDA 1DJWA 3D10A 4MLWA 1SL9A 3C1VA 1AP4A 1S5GZ 4MSPA 2DOQA 1F54A 4OKHA 3HX4A 5D7FA 1SCMB 1AK8A 1ODBA 1U5IA 1SKTA 1LA3A 1CB1A 1WRZA 1QV1A 1J7RA 1S6IA 2M0RA 3DF0B 1TCFA 1G33A 1DT7B 2LVVA 1GGWA 1OOJA 3CR2A 1K95A 1EL4A 2OTGB 1QJTA 2SCPA 3CWGA 3ICBA 1ZOTB 1JF0A 2MHHA 1AJ4A 2Y5IA 2LV7A 1B47A 1WDCB 1KK8B 1UHNA 1N0YA 2KAXA 2LVJA 2KQ6A 2Q91A 2I94A 3PATA 4DCKA 4A4BA 4I5NB 1CFPA 1FPWA 1E8AA 1M63B 1RECA 4YI8A 3ZNIA 1XFYO 2F8PA 4I5LB 1YX8A 4PHNA 2K7OA 1CFCA 1WDCC 1S36A 3TDZA 4FTGA 3I5FB 2LHLA 1XFXO 1YTZC 2K8MB 2F33A 3O4YA 3JVTB 2HPSA 2JT8A 2L4IA 3BUNB 3HCMA 1CDMA 3PN7B 4HREE 4I5JA 1BMOA 1CFDA 1KSOA 4GGFA 3O2PA 1NCXA 3SJSA 2KI4B 1DF0A 2LCPA 4DUQA 1KQVA 2Y4QA 3SG6A 3KHEA 4ETOA 1RK9A 1KFXL 1PALA 2JU0A 1FI6A 1Y6WA 4P2YB 2HQWA 2M49B 1TOPA 3GK4X 1IRJA 2KI4C 2LNKA 3BUOB 5HYDA 2H61C 1KCYA 1IQ5A 1PRWA 3PFVA 4NDCA 1J55A 1NUBA 1K9UA 1DJGA 1KK7Z 2JQ6A 1IH0A 1RTP1 4N1GA 1EH2A 1KWOB 4MBEA 4C0LA 2LMTA 2KBIA 3EK4A 1B8LA 3AKBA 4DRWA 1ZACA 2L4HA 1KQMB 3SG7A 1IJ5A 1SRAA 3SIBA 2KFGA 1BF5A 2ZRTA 2BCXA 4F0ZB 1L2OC 5AXIA 2CTNA 1BODA 1NX0A 2LM5A 3D0YB 3DD4A 2ZFDA 2BE6A 3KF9A 1XFZO 1B1GA 1PULA 3NXAA 5HKWA 1WY9A 1TRFA 2MBXA 1CDLA 4N1FA 3FWCA 4HRGA 3F45A 4YGCB 1ALWA 1FI5A 1TTXA 5HKYA 1YVLA 1QATA 5CSNA 2PASA 3BUMB 3IQOA 5AFPA 1CDPA 2WC8A 2LVIA 1A03A 1RWYA 3H4SE 3VRNA 1QS7A 2CCMA 2MLEC 1SY9A 3IQQA 1K93D 5DKRA 4WQ3A 2ZRSA 3OP0A 1QIWA 2M8UA 1K96A 1S3PA 4CFQA 4C0JA 2LUCA 3BQ3A 1CKKA 1MXEA 1SR6C 1DJXA 2LP2A 1S6CA 2F2OA 2QPTA 4NDBA 4XJKA 2BKHB 3DVMA 5G08A 2BBNA 1Y0VH 2JWWA 4L9MA 1TN4A 5J3XA 1B7TZ 2B1UA 2L98A 2KSPA 2M3WA 2KFHA 1MXLC 1NCZA 3SG4A 1C7VA 1AJ5A 2JPTA 1QIVA 1KFUL 1XK4A 4MVFA 2JRFA 3LK0A 2LMVA 2PVBA 3PALA 1K9KA 4N5XA 4IL1A 2KGBC 2JTTA 2LC5A 2PMYA 3O6BA 5ER5A 1FBVA 2CBLA 1K8UA 1J7QA 2KHNA 1X02A 1KFUS 1W7JB 3PLFB 1AVSA 3NSOA 5ER4X 2NZ0A 1N65A 1Y1AA 1OMRA 1S1EA 1SK6D 1XO5A 2KAYA 4GFTA 1TNPA 4E68A 2LUXA 2ZN8A 2GGZA 1OZSA 2ZNEA 3I5IB 4Q04A 1AHRA 1SCMC 3VGOA 1EG4A 2EGDA 2F3YA 3GK2A 2AUCA 3IF7A 4HRHA 4GGNA 4PDZA 1OSAA 2BKIB 1QVIZ 1S5GY 1CFFA 4TNCA 1SL7A 2CT9A 2MA2A 2OTGC 3FWBA 2L50A 3BOWA 1SBJA 1XVJA 2WORA 1M31A 2LE9B 2R2IA 3BUWB 2HF5A 4CPVA 5BPJA 5K89A 1JBAA 1KK8C 1ZMZA 1U5IB 3RLZA 1DJZA 3E3RA 3EK7A 3DVJA 1QV0A 4MRYA 4U8DA 4GBAA 5PALA 4QJ4B 1PVBA 2LVKA 1CLBA 1DVIA 4A4CA 2NLNA 2O60A 3I5FC 5KU1A 3WHUB 3DVKA 3WNXB 3A8RA 2GV5A 2M1KB 1L7ZA 1SYMA 1UHIA 2BCAA 2VRGA 3JTDB 3JVTC 1F4QA 1LXFC 1YX7A 3AAJA 3PN7C 4JQ0D 1BR4B 3WHTB 1DGUA 5DKQA 2KI6C 3KO0A 4PE0A 5CSIA 1S26D 1DMOA 2LLSA 1JC2A 2EC6B 3EVVA 2LP3A 3CGAA 4WQ2A 1D1OA 1H8BA 3ZWHA 1UUSA 2M29A 2CXJA 2OS8B 2K7DA 2KBMA 1JWDA 3EKJA 1CM1A 4MZJA 1A4PA 2KDHA 5DKNA 4M2QA 2EC6C 1SW8A 1OMDA 1UHHA 2I7AA 1A75A 1DF0B 2LHIA 1GGZA 1LKJA 2JT3A 1IJ6A 1UWOA 1BJFA 2L51A 1NP8A 4MEWA 1B8CA 1NX2A 2V53A 3GOFA 2M7LA 5HLVA 1KWOC 1LA0A 2ZKMX 2CNPA 1LINA 2K2AA 4GGFC 2MRDA 5IBWA 1KK7Y 1KQMC 2L0PA 3M0WA 4OV2A 1BOCA 3NSIA 1J1DA 1NX1A 1OQPA 1S6JA 2OPOA 1FF1A 1OZOA 2AAOA 2Y1NA 1B4CA 1J7PA 2JNFA 3LK1A 3VRQA 1QXPA 1QX2A 4PALA 4XYNA 3KPXA 3A4UB 2HETA 1ZUZA 3CZTX 2LLUA 2JT0A 2KI6D 3BYAA 3FS7A 1QTXA 2BL0B 3NSLA 3TUYB 3VROA 1BLQA 2BCBA 5I8NA 1CMGA 4PCWA 5AANA 1VRKA 4YGDB 5JOLA 1MR8A 1SPYA 3TZ1A 1IGVA 1EXRA 2BL0C 1UHKA 2KAVA 1QX7A 3WXAA 4AQIA 1SL8A 3EVRA 3QRXA 1CMFA 1GJYA 1MUXA 1W7IB 2FCEA 3CR4X 4GNKB 2WNDA 5HKZA 4BY5A 1UHJA 1TIZA 1XFUO 1TNXA 2MAZA 2EHBA 2E6WA 1YURA 2AMIA 3OX5A 4YRUA 2LANA 4WRIA 1SNLA 1YUUA 1A2XA 1BT6A 2KYCA 2NCOA 1H4BA 3VRRA 1HT9A 2FOTA 2COLB 2F3ZA 4R1EA 1QLSA 1K94A 3BUXB 1DJIA 3TS5B 4OVNF 2H2KA 2HQ8A 1RROA 2M97A 2LLTA 1BR1B 1FW4A 1B7TY 1PSRA 4YI9A 1F8HA 2JXCA 2WCEA 4XJKB 1K90D 3DF0A 5CSFA 3OB1B 2LAPA 2BBMA 3CTNA 4C0KA 1TNQA 3CR5X 5JJGA 4CIDA 3NSKA 2JULA 1YRUB 1WLMA 1GQMA 2D8NA 3EKHA 4QJ3B 5F6TA 4ZCVA 1C07A 1F71A 1TNWA 1BU3A 1WRKA 2I18A 4ORCB 3I5IC 1CM4A 2RGIA 1JFKA 2FJUB 1G8IA 1EG3A 5AEQA 1PVAA 1SCVA 1WLZA 1XK4C 4USLA 1V1FA 1F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  2TN4 A;  1CTR A;  4PE7 A;  1XYD A;  1C7W A;  1R2U A;  3O78 A;  4JWQ A;  1Y1U A;  4MZL A;  1YR5 A;  4FQO A;  1NX3 A;  1OE9 B;  2M7N A;  4D1E A;  1YUS A;  2ZN9 A;  4QJ5 B;  1QVI Y;  4NDD A;  3TDU A;  5I2L A;  1F70 A;  2H61 A;  2LMU A;  3SIA A;  5CSJ A;  3RM1 A;  5I2O A;  3PM8 A;  1SMG A;  4GPL B;  2L2E A;  3CLN A;  3SG5 A;  3GK1 A;  3LL8 B;  4AOM A;  1XA5 A;  1OMV A;  4OCI A;  3BOW B;  4ZCU A;  1JUO A;  1YUT A;  3LLE A;  4ORA B;  2KFF A;  1M46 A;  1Y1X A;  1NIW A;  2PRU A;  3EVU A;  2NCP A;  1PK0 D;  3JTD C;  3FIA A;  1NPQ A;  1J1E A;  1LVC D;  2I2R E;  4I5K A;  3CS1 A;  3I5G B;  4YGA A;  4CLN A;  3TDI A;  4GUK A;  1DTL A;  2BE4 A;  2GGM A;  4BY4 A;  2BEC A;  2M9G A;  2KNE A;  2PSR A;  1CNP A;  1NYA A;  2K0J A;  2QAC A;  3OX6 A;  4ICB A;  4UPG A;  2KQY A;  3I5G C;  1RFJ A;  1EJ3 A;  2OS8 C;  1TCO B;  3D0Y A;  2IS9 A;  4ORB B;  1A29 A;  1M45 A;  1YRT B;  2JZI A;  5AER A;  1J7O A;  1IKU A;  1F55 A;  3AAK A;  2P6B B;  2JTZ A;  5I2Q A;  1IG5 A;  3SG2 A;  1KFX S;  2K61 A;  4MN0 A;  1L2O B;  2WCB A;  4DIR A;  1QAS A;  5D69 A;  1K2H A;  2JOJ A;  3LCP C;  4GAO A;  2JC2 A;  4YGB B;  1BG1 A;  1R6P A;  4CFR A;  3OB2 B;  2KOT A;  1JF2 A;  1DJH A;  1MWN A;  4P5O E;  1A75 B;  1QLK A;  5HLO A;  1DJY A;  1N2D A;  2Y1M A;  1WRL A;  2JXL A;  3MSE B;  5FYX A;  1QX5 B;  4DS7 A;  1AUI B;  4PHK A;  2L5X B;  4M2P A;  2ISD A;  4MRX A;  2A4J A;  2G9B A;  2ZND A;  5GQQ C;  2NXQ A;  1Q80 A;  1MF8 B;  3SG3 A;  3TUY C;  1ZFS A;  5CPV A;  3EK8 A;  2F2P A;  3PSR A;  1RJV A;  2O5G A;  4YGE B;  1XFW O;  3VRP A;  1V1G A;  2G2B A;  2JNX A;  4PHJ A;  1IQ3 A;  4PE4 A;  1SR6 B;  2WOS A;  1YVH A;  4PE1 A;  2SAS A;  2E30 A;  1B8R A;  1HQV A;  1NCY A;  1IWQ A;  3DVE A;  1K9P A;  2MLF C;  1DGV A;  1CLL A;  3OHM B;  4AQJ A;  1B9A A;  5B8I B;  2M1U A;  2KGR A;  3AKA A;  1M39 A;  1NWD A;  2PAL A;  1CLM A;  1PSB A;  1UUR A;  2K7C A;  2MJW B;  4YBH B;  3TS5 C;  1MQ1 A;  2K7B A;  2KYF A;  4HSZ A;  4NQG A;  5TNC A;  4MZK A;  1CDN A;  3I5H B;  1KSM A;  3BXK A;  1XFV O;  1JSA A;  5KTY A;  1MHO A;  3KEV A;  4JPZ B;  4PHM A;  2Q4U A;  2K2F A;  1NSH A;  3K21 A;  5KSZ A;  1ALV A;  4M2O A;  2WCF A;  1G4Y R;  3I5H C;  1JFJ A;  1UP5 A;  2FCD A;  1DJW A;  3D10 A;  4MLW A;  1SL9 A;  3C1V A;  1AP4 A;  1S5G Z;  4MSP A;  2DOQ A;  1F54 A;  4OKH A;  3HX4 A;  5D7F A;  1SCM B;  1AK8 A;  1ODB A;  1U5I A;  1SKT A;  1LA3 A;  1CB1 A;  1WRZ A;  1QV1 A;  1J7R A;  1S6I A;  2M0R A;  3DF0 B;  1TCF A;  1G33 A;  1DT7 B;  2LVV A;  1GGW A;  1OOJ A;  3CR2 A;  1K95 A;  1EL4 A;  2OTG B;  1QJT A;  2SCP A;  3CWG A;  3ICB A;  1ZOT B;  1JF0 A;  2MHH A;  1AJ4 A;  2Y5I A;  2LV7 A;  1B47 A;  1WDC B;  1KK8 B;  1UHN A;  1N0Y A;  2KAX A;  2LVJ A;  2KQ6 A;  2Q91 A;  2I94 A;  3PAT A;  4DCK A;  4A4B A;  4I5N B;  1CFP A;  1FPW A;  1E8A A;  1M63 B;  1REC A;  4YI8 A;  3ZNI A;  1XFY O;  2F8P A;  4I5L B;  1YX8 A;  4PHN A;  2K7O A;  1CFC A;  1WDC C;  1S36 A;  3TDZ A;  4FTG A;  3I5F B;  2LHL A;  1XFX O;  1YTZ C;  2K8M B;  2F33 A;  3O4Y A;  3JVT B;  2HPS A;  2JT8 A;  2L4I A;  3BUN B;  3HCM A;  1CDM A;  3PN7 B;  4HRE E;  4I5J A;  1BMO A;  1CFD A;  1KSO A;  4GGF A;  3O2P A;  1NCX A;  3SJS A;  2KI4 B;  1DF0 A;  2LCP A;  4DUQ A;  1KQV A;  2Y4Q A;  3SG6 A;  3KHE A;  4ETO A;  1RK9 A;  1KFX L;  1PAL A;  2JU0 A;  1FI6 A;  1Y6W A;  4P2Y B;  2HQW A;  2M49 B;  1TOP A;  3GK4 X;  1IRJ A;  2KI4 C;  2LNK A;  3BUO B;  5HYD A;  2H61 C;  1KCY A;  1IQ5 A;  1PRW A;  3PFV A;  4NDC A;  1J55 A;  1NUB A;  1K9U A;  1DJG A;  1KK7 Z;  2JQ6 A;  1IH0 A;  1RTP 1;  4N1G A;  1EH2 A;  1KWO B;  4MBE A;  4C0L A;  2LMT A;  2KBI A;  3EK4 A;  1B8L A;  3AKB A;  4DRW A;  1ZAC A;  2L4H A;  1KQM B;  3SG7 A;  1IJ5 A;  1SRA A;  3SIB A;  2KFG A;  1BF5 A;  2ZRT A;  2BCX A;  4F0Z B;  1L2O C;  5AXI A;  2CTN A;  1BOD A;  1NX0 A;  2LM5 A;  3D0Y B;  3DD4 A;  2ZFD A;  2BE6 A;  3KF9 A;  1XFZ O;  1B1G A;  1PUL A;  3NXA A;  5HKW A;  1WY9 A;  1TRF A;  2MBX A;  1CDL A;  4N1F A;  3FWC A;  4HRG A;  3F45 A;  4YGC B;  1ALW A;  1FI5 A;  1TTX A;  5HKY A;  1YVL A;  1QAT A;  5CSN A;  2PAS A;  3BUM B;  3IQO A;  5AFP A;  1CDP A;  2WC8 A;  2LVI A;  1A03 A;  1RWY A;  3H4S E;  3VRN A;  1QS7 A;  2CCM A;  2MLE C;  1SY9 A;  3IQQ A;  1K93 D;  5DKR A;  4WQ3 A;  2ZRS A;  3OP0 A;  1QIW A;  2M8U A;  1K96 A;  1S3P A;  4CFQ A;  4C0J A;  2LUC A;  3BQ3 A;  1CKK A;  1MXE A;  1SR6 C;  1DJX A;  2LP2 A;  1S6C A;  2F2O A;  2QPT A;  4NDB A;  4XJK A;  2BKH B;  3DVM A;  5G08 A;  2BBN A;  1Y0V H;  2JWW A;  4L9M A;  1TN4 A;  5J3X A;  1B7T Z;  2B1U A;  2L98 A;  2KSP A;  2M3W A;  2KFH A;  1MXL C;  1NCZ A;  3SG4 A;  1C7V A;  1AJ5 A;  2JPT A;  1QIV A;  1KFU L;  1XK4 A;  4MVF A;  2JRF A;  3LK0 A;  2LMV A;  2PVB A;  3PAL A;  1K9K A;  4N5X A;  4IL1 A;  2KGB C;  2JTT A;  2LC5 A;  2PMY A;  3O6B A;  5ER5 A;  1FBV A;  2CBL A;  1K8U A;  1J7Q A;  2KHN A;  1X02 A;  1KFU S;  1W7J B;  3PLF B;  1AVS A;  3NSO A;  5ER4 X;  2NZ0 A;  1N65 A;  1Y1A A;  1OMR A;  1S1E A;  1SK6 D;  1XO5 A;  2KAY A;  4GFT A;  1TNP A;  4E68 A;  2LUX A;  2ZN8 A;  2GGZ A;  1OZS A;  2ZNE A;  3I5I B;  4Q04 A;  1AHR A;  1SCM C;  3VGO A;  1EG4 A;  2EGD A;  2F3Y A;  3GK2 A;  2AUC A;  3IF7 A;  4HRH A;  4GGN A;  4PDZ A;  1OSA A;  2BKI B;  1QVI Z;  1S5G Y;  1CFF A;  4TNC A;  1SL7 A;  2CT9 A;  2MA2 A;  2OTG C;  3FWB A;  2L50 A;  3BOW A;  1SBJ A;  1XVJ A;  2WOR A;  1M31 A;  2LE9 B;  2R2I A;  3BUW B;  2HF5 A;  4CPV A;  5BPJ A;  5K89 A;  1JBA A;  1KK8 C;  1ZMZ A;  1U5I B;  3RLZ A;  1DJZ A;  3E3R A;  3EK7 A;  3DVJ A;  1QV0 A;  4MRY A;  4U8D A;  4GBA A;  5PAL A;  4QJ4 B;  1PVB A;  2LVK A;  1CLB A;  1DVI A;  4A4C A;  2NLN A;  2O60 A;  3I5F C;  5KU1 A;  3WHU B;  3DVK A;  3WNX B;  3A8R A;  2GV5 A;  2M1K B;  1L7Z A;  1SYM A;  1UHI A;  2BCA A;  2VRG A;  3JTD B;  3JVT C;  1F4Q A;  1LXF C;  1YX7 A;  3AAJ A;  3PN7 C;  4JQ0 D;  1BR4 B;  3WHT B;  1DGU A;  5DKQ A;  2KI6 C;  3KO0 A;  4PE0 A;  5CSI A;  1S26 D;  1DMO A;  2LLS A;  1JC2 A;  2EC6 B;  3EVV A;  2LP3 A;  3CGA A;  4WQ2 A;  1D1O A;  1H8B A;  3ZWH A;  1UUS A;  2M29 A;  2CXJ A;  2OS8 B;  2K7D A;  2KBM A;  1JWD A;  3EKJ A;  1CM1 A;  4MZJ A;  1A4P A;  2KDH A;  5DKN A;  4M2Q A;  2EC6 C;  1SW8 A;  1OMD A;  1UHH A;  2I7A A;  1A75 A;  1DF0 B;  2LHI A;  1GGZ A;  1LKJ A;  2JT3 A;  1IJ6 A;  1UWO A;  1BJF A;  2L51 A;  1NP8 A;  4MEW A;  1B8C A;  1NX2 A;  2V53 A;  3GOF A;  2M7L A;  5HLV A;  1KWO C;  1LA0 A;  2ZKM X;  2CNP A;  1LIN A;  2K2A A;  4GGF C;  2MRD A;  5IBW A;  1KK7 Y;  1KQM C;  2L0P A;  3M0W A;  4OV2 A;  1BOC A;  3NSI A;  1J1D A;  1NX1 A;  1OQP A;  1S6J A;  2OPO A;  1FF1 A;  1OZO A;  2AAO A;  2Y1N A;  1B4C A;  1J7P A;  2JNF A;  3LK1 A;  3VRQ A;  1QXP A;  1QX2 A;  4PAL A;  4XYN A;  3KPX A;  3A4U B;  2HET A;  1ZUZ A;  3CZT X;  2LLU A;  2JT0 A;  2KI6 D;  3BYA A;  3FS7 A;  1QTX A;  2BL0 B;  3NSL A;  3TUY B;  3VRO A;  1BLQ A;  2BCB A;  5I8N A;  1CMG A;  4PCW A;  5AAN A;  1VRK A;  4YGD B;  5JOL A;  1MR8 A;  1SPY A;  3TZ1 A;  1IGV A;  1EXR A;  2BL0 C;  1UHK A;  2KAV A;  1QX7 A;  3WXA A;  4AQI A;  1SL8 A;  3EVR A;  3QRX A;  1CMF A;  1GJY A;  1MUX A;  1W7I B;  2FCE A;  3CR4 X;  4GNK B;  2WND A;  5HKZ A;  4BY5 A;  1UHJ A;  1TIZ A;  1XFU O;  1TNX A;  2MAZ A;  2EHB A;  2E6W A;  1YUR A;  2AMI A;  3OX5 A;  4YRU A;  2LAN A;  4WRI A;  1SNL A;  1YUU A;  1A2X A;  1BT6 A;  2KYC A;  2NCO A;  1H4B A;  3VRR A;  1HT9 A;  2FOT A;  2COL B;  2F3Z A;  4R1E A;  1QLS A;  1K94 A;  3BUX B;  1DJI A;  3TS5 B;  4OVN F;  2H2K A;  2HQ8 A;  1RRO A;  2M97 A;  2LLT A;  1BR1 B;  1FW4 A;  1B7T Y;  1PSR A;  4YI9 A;  1F8H A;  2JXC A;  2WCE A;  4XJK B;  1K90 D;  3DF0 A;  5CSF A;  3OB1 B;  2LAP A;  2BBM A;  3CTN A;  4C0K A;  1TNQ A;  3CR5 X;  5JJG A;  4CID A;  3NSK A;  2JUL A;  1YRU B;  1WLM A;  1GQM A;  2D8N A;  3EKH A;  4QJ3 B;  5F6T A;  4ZCV A;  1C07 A;  1F71 A;  1TNW A;  1BU3 A;  1WRK A;  2I18 A;  4ORC B;  3I5I C;  1CM4 A;  2RGI A;  1JFK A;  2FJU B;  1G8I A;  1EG3 A;  5AEQ A;  1PVA A;  1SCV A;  1WLZ A;  1XK4 C;  4USL A;  1V1F A;  1F4O A; 
#chains in the Genus database with same CATH topology
 4OR9 B;  2TN4 A;  1CTR A;  3R1V A;  1XYD A;  4PE7 A;  3SS5 A;  1DEL A;  1C7W A;  1R2U A;  3O78 A;  4JWQ A;  1Y1U A;  4MZL A;  1YR5 A;  2WC6 A;  4FQO A;  1NX3 A;  1OE9 B;  2M7N A;  4D1E A;  1YUS A;  2ZN9 A;  1OOI X;  1QVI Y;  4NDD A;  3TDU A;  4QJ5 B;  4PT1 A;  5I2L A;  1F70 A;  2H61 A;  2LMU A;  3SIA A;  5CSJ A;  3RM1 A;  5I2O A;  3NHI A;  3PM8 A;  1SMG A;  3FE8 A;  4GPL B;  1TUJ A;  2L2E A;  3CLN A;  3SG5 A;  3GK1 A;  3LL8 B;  4AOM A;  1XA5 A;  1OMV A;  4INW A;  4OCI A;  3BOW B;  4ZCU A;  1JUO A;  1YUT A;  3LLE A;  4INX A;  4ORA B;  2KFF A;  1M46 A;  1Y1X A;  1NIW A;  2PRU A;  3EVU A;  2NCP A;  1PK0 D;  3JTD C;  3FIA A;  1NPQ A;  1J1E A;  1LVC D;  2I2R E;  4I5K A;  3CS1 A;  3I5G B;  1GM0 A;  4YGA A;  4CLN A;  1Z2C B;  3TDI A;  4GUK A;  3UO9 A;  1DTL A;  2BE4 A;  2GGM A;  4BY4 A;  2BEC A;  2M9G A;  2KNE A;  2PSR A;  1CNP A;  1NYA A;  2K0J A;  2QAC A;  3OX6 A;  4ICB A;  4UPG A;  2KQY A;  3I5G C;  1RFJ A;  2PYQ A;  1EJ3 A;  2OS8 C;  1TCO B;  3D0Y A;  2BNX A;  2IS9 A;  4ORB B;  1A29 A;  1M45 A;  1YRT B;  2JZI A;  5DIC A;  5AER A;  1J7O A;  1IKU A;  1F55 A;  3AAK A;  2P6B B;  2JTZ A;  5I2Q A;  1IG5 A;  3SG2 A;  1KFX S;  3CDN A;  1TUZ A;  2K61 A;  3BJH A;  4MN0 A;  1L2O B;  2WCB A;  4DIR A;  1QAS A;  5D69 A;  1K2H A;  2JOJ A;  3LCP C;  4GAO A;  2JC2 A;  4YGB B;  1BG1 A;  1R6P A;  1XFR A;  4CFR A;  3OB2 B;  2KOT A;  1JF2 A;  1DJH A;  1MWN A;  4P5O E;  1A75 B;  1QLK A;  5HLO A;  1DJY A;  1N2D A;  2Y1M A;  1WRL A;  2JXL A;  1C3Y A;  3OGN A;  3MSE B;  4FQT A;  5FYX A;  1QX5 B;  4DS7 A;  1AUI B;  4PHK A;  3EG5 B;  2L5X B;  4M2P A;  3CZ2 A;  2ISD A;  4MRX A;  2A4J A;  2G9B A;  2ZND A;  5GQQ C;  2NXQ A;  1Q80 A;  2KLD A;  1MF8 B;  3SG3 A;  3TUY C;  1ZFS A;  5CPV A;  3EK8 A;  2ERB A;  2F2P A;  3PSR A;  1RJV A;  2WCK A;  2O5G A;  4YGE B;  1XFW O;  3BFA A;  1V1G A;  2G2B A;  2JNX A;  4PHJ A;  2PQL A;  3VRP A;  1IQ3 A;  4PE4 A;  3D74 A;  1SR6 B;  2WOS A;  1YVH A;  4PE1 A;  2SAS A;  2E30 A;  2P71 A;  1B8R A;  1HQV A;  1NCY A;  2WCH A;  1IWQ A;  3DVE A;  1C3Z A;  1K9P A;  2L5Y A;  2MLF C;  1DGV A;  1CLL A;  3OHM B;  4AQJ A;  1B9A A;  5B8I B;  2M1U A;  2KGR A;  3AKA A;  1M39 A;  1NWD A;  2PAL A;  1CLM A;  1PSB A;  1UUR A;  3DXL A;  2K7C A;  2MJW B;  4YBH B;  3TS5 C;  1MQ1 A;  2K7B A;  2KYF A;  4HSZ A;  4NQG A;  5TNC A;  1T14 A;  4MZK A;  1CDN A;  3I5H B;  1KSM A;  3BXK A;  1XFV O;  1JSA A;  3PJI A;  5KTY A;  1MHO A;  3CZ0 A;  3KEV A;  4JPZ B;  4PHM A;  2Q4U A;  4KYN A;  2K2F A;  1NSH A;  3K21 A;  5KSZ A;  1ALV A;  4M2O A;  2WCF A;  1G4Y R;  3I5H C;  1JFJ A;  1UP5 A;  2FCD A;  3D78 A;  1DJW A;  3D10 A;  4MLW A;  1SL9 A;  2QEB A;  3C1V A;  1S5G Z;  4MSP A;  1AP4 A;  2DOQ A;  3JVT C;  4OKH A;  3HX4 A;  5D7F A;  1F54 A;  1SCM B;  1AK8 A;  1ODB A;  1U5I A;  1SKT A;  1LA3 A;  1CB1 A;  1DQE A;  1WRZ A;  1QV1 A;  1J7R A;  1S6I A;  2M0R A;  3L4L A;  2KLE A;  3DF0 B;  1TCF A;  1G33 A;  5EL2 A;  1DT7 B;  2LVV A;  1GGW A;  3BFB A;  1OOJ A;  3CR2 A;  1K95 A;  1EL4 A;  2OTG B;  1QJT A;  2SCP A;  3CWG A;  3ICB A;  1ZOT B;  3K1E A;  1JF0 A;  2MHH A;  1AJ4 A;  2Y5I A;  2LV7 A;  1B47 A;  1WDC B;  2JPO A;  1KK8 B;  1UHN A;  1N0Y A;  2KAX A;  2LVJ A;  1OW4 A;  2KQ6 A;  2Q91 A;  2I94 A;  3PAT A;  4DCK A;  4A4B A;  4I5N B;  1CFP A;  1FPW A;  1E8A A;  1M63 B;  1REC A;  3N7H A;  4YI8 A;  3ZNI A;  1XFY O;  2F8P A;  4I5L B;  3D76 A;  1YX8 A;  4PHN A;  2K7O A;  1CFC A;  1WDC C;  1S36 A;  3TDZ A;  4FTG A;  3I5F B;  2LHL A;  1DEK A;  3DYE A;  1XFX O;  1YTZ C;  2K8M B;  2F33 A;  3O4Y A;  3JVT B;  2HPS A;  2JT8 A;  2L4I A;  3BUN B;  3HCM A;  1CDM A;  3PN7 B;  4HRE E;  4I5J A;  1BMO A;  1CFD A;  1KSO A;  4GGF A;  3O2P A;  1NCX A;  5FI7 A;  3SJS A;  2KI4 B;  1DF0 A;  1P28 A;  2LCP A;  4DUQ A;  1KQV A;  2Y4Q A;  3SG6 A;  3KHE A;  3NHT A;  4ETO A;  1RK9 A;  1KFX L;  1PAL A;  2JU0 A;  1FI6 A;  3BFH A;  1Y6W A;  4P2Y B;  2HQW A;  2M49 B;  1SSE B;  1TOP A;  1IRJ A;  2KI4 C;  2LNK A;  3BUO B;  3B7A A;  3GK4 X;  3QME A;  3VB1 A;  3O4X A;  2H61 C;  1KCY A;  1IQ5 A;  1PRW A;  3PFV A;  4NDC A;  1J55 A;  1NUB A;  1K9U A;  1DJG A;  1KK7 Z;  2JQ6 A;  1IH0 A;  1RTP 1;  4N1G A;  1EH2 A;  3IVT A;  1KWO B;  4MBE A;  4C0L A;  2LMT A;  3FE6 A;  2KBI A;  3EK4 A;  1B8L A;  3AKB A;  4DRW A;  1ZAC A;  2L4H A;  1KQM B;  3SG7 A;  1IJ5 A;  1SRA A;  3SIB A;  2KFG A;  1BF5 A;  2ZRT A;  2BCX A;  1LS8 A;  4F0Z B;  1L2O C;  3B88 A;  5AXI A;  1QWV A;  2CTN A;  1BOD A;  1NX0 A;  2LM5 A;  3D0Y B;  3DD4 A;  2ZFD A;  2BE6 A;  3KF9 A;  1XFZ O;  2K60 A;  1PUL A;  2KPH A;  3S0F A;  4OZD A;  3DZT A;  3NXA A;  5HKW A;  1B1G A;  1WY9 A;  1TRF A;  2MBX A;  3RZS A;  1CDL A;  4N1F A;  3FWC A;  4HRG A;  3F45 A;  4YGC B;  1ALW A;  1FI5 A;  1TTX A;  3CZ1 A;  5HKY A;  1YVL A;  3B6X A;  1QAT A;  5CSN A;  2PAS A;  3BUM B;  3IQO A;  5AFP A;  1CDP A;  2WC8 A;  2LVI A;  1A03 A;  1RWY A;  3H4S E;  3VRN A;  1IIO A;  1QS7 A;  3V2L A;  2CCM A;  2MLE C;  1SY9 A;  3IQQ A;  1K93 D;  5DKR A;  4WQ3 A;  2ZRS A;  3OP0 A;  1QIW A;  1Z4H A;  2M8U A;  1K96 A;  3D77 A;  1S3P A;  2BAP A;  4CFQ A;  4C0J A;  2LUC A;  3BQ3 A;  1CKK A;  1MXE A;  1SR6 C;  1DJX A;  2LP2 A;  1S6C A;  2F2O A;  2QPT A;  4NDB A;  3CYZ A;  2BKH B;  4XJK A;  3DVM A;  5G08 A;  2BBN A;  1Y0V H;  5HL1 A;  3S0G A;  2JWW A;  3B86 A;  1TN4 A;  4L9M A;  5J3X A;  1B7T Z;  2B1U A;  2H8V A;  2L98 A;  2KSP A;  2M3W A;  2KFH A;  1MXL C;  1NCZ A;  3SG4 A;  1C7V A;  1AJ5 A;  2JPT A;  1QIV A;  1KFU L;  1XK4 A;  4MVF A;  2JRF A;  3LK0 A;  3S0A A;  2YGU A;  2LMV A;  2PVB A;  3PAL A;  1K9K A;  4N5X A;  4IL1 A;  2KGB C;  2JTT A;  2L2C A;  2LC5 A;  2FJY A;  2PMY A;  3O6B A;  3R72 A;  4JD9 A;  1FBV A;  5ER5 A;  2CBL A;  1K8U A;  2WCJ A;  2KHN A;  1X02 A;  1J7Q A;  1KFU S;  1W7J B;  3PLF B;  1AVS A;  3NSO A;  5ER4 X;  2NZ0 A;  1N65 A;  1Y1A A;  1OMR A;  1S1E A;  1SK6 D;  1XO5 A;  2KAY A;  4GFT A;  1TNP A;  4E68 A;  5HYD A;  2LUX A;  2ZN8 A;  2GGZ A;  1OZS A;  2ZNE A;  3I5I B;  4Q04 A;  1AHR A;  3Q8I A;  1SCM C;  3VGO A;  2QEO A;  3DY9 A;  1EG4 A;  3OBV A;  2EGD A;  2F3Y A;  3GK2 A;  2AUC A;  3IF7 A;  4HRH A;  4GGN A;  4PDZ A;  1OSA A;  2BKI B;  1QVI Z;  1S5G Y;  1CFF A;  4TNC A;  1SL7 A;  2CT9 A;  1TWO A;  2MA2 A;  2OTG C;  3FWB A;  2L50 A;  3BOW A;  1SBJ A;  1XVJ A;  2WOR A;  3S0D A;  1M31 A;  2LE9 B;  2R2I A;  3BUW B;  2HF5 A;  4CPV A;  5BPJ A;  5K89 A;  1JBA A;  1KK8 C;  1ZMZ A;  1U5I B;  3RLZ A;  1DJZ A;  2WCM A;  3E3R A;  3EK7 A;  3DVJ A;  1QV0 A;  4MRY A;  4U8D A;  3R1O A;  4GBA A;  5PAL A;  4QJ4 B;  1PVB A;  2LVK A;  1CLB A;  1DVI A;  4A4C A;  2NLN A;  2O60 A;  3CAB A;  3I5F C;  5KU1 A;  3WHU B;  3DVK A;  3WNX B;  3A8R A;  2GV5 A;  2M1K B;  1L7Z A;  1SYM A;  1UHI A;  2BCA A;  2QEV A;  2VRG A;  3JTD B;  1F4Q A;  1LXF C;  1YX7 A;  3AAJ A;  3PN7 C;  4JQ0 D;  3FE9 A;  1BR4 B;  3WHT B;  1DGU A;  5DKQ A;  2KI6 C;  3KO0 A;  4PE0 A;  5CSI A;  1S26 D;  1DMO A;  2LLS A;  1JC2 A;  2EC6 B;  3EVV A;  2LP3 A;  3CGA A;  4WQ2 A;  1D1O A;  1H8B A;  2GTE A;  1UUS A;  2M29 A;  2CXJ A;  3ZWH A;  2OS8 B;  2K7D A;  2KBM A;  3D73 A;  3EKJ A;  1JWD A;  1CM1 A;  4MZJ A;  1A4P A;  2KDH A;  3S0B A;  5DKN A;  4M2Q A;  2EC6 C;  1SW8 A;  1OMD A;  1UHH A;  2I7A A;  1A75 A;  1DF0 B;  2LHI A;  1GGZ A;  1LKJ A;  1ORG A;  2JT3 A;  1IJ6 A;  1UWO A;  1BJF A;  2L51 A;  1NP8 A;  4MEW A;  1B8C A;  1NX2 A;  2V53 A;  3GOF A;  2M7L A;  4F7F A;  5HLV A;  1DC1 A;  1KWO C;  1LA0 A;  2ZKM X;  2CNP A;  1LIN A;  2K2A A;  4GGF C;  2MRD A;  5IBW A;  1KK7 Y;  1KQM C;  2L0P A;  3B87 A;  3M0W A;  4OV2 A;  1BOC A;  4JKT A;  3NSI A;  5FI2 A;  2P70 A;  1J1D A;  1NX1 A;  1OOH A;  1OQP A;  1S6J A;  2OPO A;  1FF1 A;  1OZO A;  2AAO A;  2Y1N A;  1B4C A;  1J7P A;  2JNF A;  3LK1 A;  3VRQ A;  1QXP A;  1QX2 A;  4PAL A;  4XYN A;  2QDI A;  3KPX A;  3A4U B;  2HET A;  1ZUZ A;  3CZT X;  2LLU A;  2JT0 A;  3S0E A;  1OOF A;  2KI6 D;  3BYA A;  3NGV A;  3UNW A;  3FS7 A;  1QTX A;  2BL0 B;  3NSL A;  3TUY B;  3VRO A;  1BLQ A;  2BCB A;  5I8N A;  1CMG A;  4PCW A;  5AAN A;  1VRK A;  4YGD B;  5JOL A;  1MR8 A;  1SPY A;  3TZ1 A;  1IGV A;  1EXR A;  2BL0 C;  1UHK A;  2KAV A;  1QX7 A;  3WXA A;  4AQI A;  3L47 A;  1SL8 A;  3EVR A;  3QRX A;  1CMF A;  1GJY A;  1MUX A;  1W7I B;  2FCE A;  3CR4 X;  4GNK B;  2WND A;  5HKZ A;  4BY5 A;  1UHJ A;  1TIZ A;  1XFU O;  1TNX A;  2MAZ A;  2EHB A;  2E6W A;  1YUR A;  2AMI A;  2WC5 A;  3OX5 A;  4YRU A;  2LAN A;  4WRI A;  1SNL A;  1YUU A;  1A2X A;  1BT6 A;  2KYC A;  2NCO A;  1H4B A;  3VRR A;  1HT9 A;  2FOT A;  2COL B;  2F3Z A;  4R1E A;  1QLS A;  1K94 A;  3BUX B;  1DJI A;  3D75 A;  3TS5 B;  4OVN F;  3SS4 A;  1OOG A;  2H2K A;  2HQ8 A;  1RRO A;  2M97 A;  2LLT A;  1BR1 B;  1FW4 A;  1B7T Y;  1PSR A;  4YI9 A;  3L4A A;  2JXC A;  2WCE A;  4XJK B;  1F8H A;  1K90 D;  3DF0 A;  5CSF A;  3OB1 B;  2LAP A;  4IJ7 A;  2BBM A;  2QEH A;  3CTN A;  3PM2 A;  5I94 A;  4C0K A;  1TNQ A;  3CR5 X;  5JJG A;  4CID A;  3NSK A;  2JUL A;  1YRU B;  1WLM A;  1GQM A;  2D8N A;  3EKH A;  4QJ3 B;  5F6T A;  4ZCV A;  3SS3 A;  5FI6 A;  1C07 A;  1F71 A;  1TNW A;  1BU3 A;  1WRK A;  2I18 A;  4ORC B;  3I5I C;  1CM4 A;  2RGI A;  1JFK A;  2FJU B;  1G8I A;  1EG3 A;  5AEQ A;  1PVA A;  1SCV A;  1WLZ A;  1XK4 C;  2WCL A;  3R1P A;  4USL A;  1W9Z A;  5D3O A;  1V1F A;  1F4O A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  2TN4 A;  1CTR A;  4PE7 A;  1XYD A;  1C7W A;  1R2U A;  3O78 A;  4JWQ A;  1Y1U A;  4MZL A;  1YR5 A;  4FQO A;  1NX3 A;  1OE9 B;  2M7N A;  4D1E A;  1YUS A;  2ZN9 A;  4QJ5 B;  1QVI Y;  4NDD A;  3TDU A;  5I2L A;  1F70 A;  2H61 A;  2LMU A;  3SIA A;  5CSJ A;  3RM1 A;  5I2O A;  3PM8 A;  1SMG A;  4GPL B;  2L2E A;  3CLN A;  3SG5 A;  3GK1 A;  3LL8 B;  4AOM A;  1XA5 A;  1OMV A;  4OCI A;  3BOW B;  4ZCU A;  1JUO A;  1YUT A;  3LLE A;  4ORA B;  2KFF A;  1M46 A;  1Y1X A;  1NIW A;  2PRU A;  3EVU A;  2NCP A;  1PK0 D;  3JTD C;  3FIA A;  1NPQ A;  1J1E A;  1LVC D;  2I2R E;  4I5K A;  3CS1 A;  3I5G B;  4YGA A;  4CLN A;  3TDI A;  4GUK A;  1DTL A;  2BE4 A;  2GGM A;  4BY4 A;  2BEC A;  2M9G A;  2KNE A;  2PSR A;  1CNP A;  1NYA A;  2K0J A;  2QAC A;  3OX6 A;  4ICB A;  4UPG A;  2KQY A;  3I5G C;  1RFJ A;  1EJ3 A;  2OS8 C;  1TCO B;  3D0Y A;  2IS9 A;  4ORB B;  1A29 A;  1M45 A;  1YRT B;  2JZI A;  5AER A;  1J7O A;  1IKU A;  1F55 A;  3AAK A;  2P6B B;  2JTZ A;  5I2Q A;  1IG5 A;  3SG2 A;  1KFX S;  2K61 A;  4MN0 A;  1L2O B;  2WCB A;  4DIR A;  1QAS A;  5D69 A;  1K2H A;  2JOJ A;  3LCP C;  4GAO A;  2JC2 A;  4YGB B;  1BG1 A;  1R6P A;  4CFR A;  3OB2 B;  2KOT A;  1JF2 A;  1DJH A;  1MWN A;  4P5O E;  1A75 B;  1QLK A;  5HLO A;  1DJY A;  1N2D A;  2Y1M A;  1WRL A;  2JXL A;  3MSE B;  5FYX A;  1QX5 B;  4DS7 A;  1AUI B;  4PHK A;  2L5X B;  4M2P A;  2ISD A;  4MRX A;  2A4J A;  2G9B A;  2ZND A;  5GQQ C;  2NXQ A;  1Q80 A;  1MF8 B;  3SG3 A;  3TUY C;  1ZFS A;  5CPV A;  3EK8 A;  2F2P A;  3PSR A;  1RJV A;  2O5G A;  4YGE B;  1XFW O;  3VRP A;  1V1G A;  2G2B A;  2JNX A;  4PHJ A;  1IQ3 A;  4PE4 A;  1SR6 B;  2WOS A;  1YVH A;  4PE1 A;  2SAS A;  2E30 A;  1B8R A;  1HQV A;  1NCY A;  1IWQ A;  3DVE A;  1K9P A;  2MLF C;  1DGV A;  1CLL A;  3OHM B;  4AQJ A;  1B9A A;  5B8I B;  2M1U A;  2KGR A;  3AKA A;  1M39 A;  1NWD A;  2PAL A;  1CLM A;  1PSB A;  1UUR A;  2K7C A;  2MJW B;  4YBH B;  3TS5 C;  1MQ1 A;  2K7B A;  2KYF A;  4HSZ A;  4NQG A;  5TNC A;  4MZK A;  1CDN A;  3I5H B;  1KSM A;  3BXK A;  1XFV O;  1JSA A;  5KTY A;  1MHO A;  3KEV A;  4JPZ B;  4PHM A;  2Q4U A;  2K2F A;  1NSH A;  3K21 A;  5KSZ A;  1ALV A;  4M2O A;  2WCF A;  1G4Y R;  3I5H C;  1JFJ A;  1UP5 A;  2FCD A;  1DJW A;  3D10 A;  4MLW A;  1SL9 A;  3C1V A;  1AP4 A;  1S5G Z;  4MSP A;  2DOQ A;  1F54 A;  4OKH A;  3HX4 A;  5D7F A;  1SCM B;  1AK8 A;  1ODB A;  1U5I A;  1SKT A;  1LA3 A;  1CB1 A;  1WRZ A;  1QV1 A;  1J7R A;  1S6I A;  2M0R A;  3DF0 B;  1TCF A;  1G33 A;  1DT7 B;  2LVV A;  1GGW A;  1OOJ A;  3CR2 A;  1K95 A;  1EL4 A;  2OTG B;  1QJT A;  2SCP A;  3CWG A;  3ICB A;  1ZOT B;  1JF0 A;  2MHH A;  1AJ4 A;  2Y5I A;  2LV7 A;  1B47 A;  1WDC B;  1KK8 B;  1UHN A;  1N0Y A;  2KAX A;  2LVJ A;  2KQ6 A;  2Q91 A;  2I94 A;  3PAT A;  4DCK A;  4A4B A;  4I5N B;  1CFP A;  1FPW A;  1E8A A;  1M63 B;  1REC A;  4YI8 A;  3ZNI A;  1XFY O;  2F8P A;  4I5L B;  1YX8 A;  4PHN A;  2K7O A;  1CFC A;  1WDC C;  1S36 A;  3TDZ A;  4FTG A;  3I5F B;  2LHL A;  1XFX O;  1YTZ C;  2K8M B;  2F33 A;  3O4Y A;  3JVT B;  2HPS A;  2JT8 A;  2L4I A;  3BUN B;  3HCM A;  1CDM A;  3PN7 B;  4HRE E;  4I5J A;  1BMO A;  1CFD A;  1KSO A;  4GGF A;  3O2P A;  1NCX A;  3SJS A;  2KI4 B;  1DF0 A;  2LCP A;  4DUQ A;  1KQV A;  2Y4Q A;  3SG6 A;  3KHE A;  4ETO A;  1RK9 A;  1KFX L;  1PAL A;  2JU0 A;  1FI6 A;  1Y6W A;  4P2Y B;  2HQW A;  2M49 B;  1TOP A;  3GK4 X;  1IRJ A;  2KI4 C;  2LNK A;  3BUO B;  5HYD A;  2H61 C;  1KCY A;  1IQ5 A;  1PRW A;  3PFV A;  4NDC A;  1J55 A;  1NUB A;  1K9U A;  1DJG A;  1KK7 Z;  2JQ6 A;  1IH0 A;  1RTP 1;  4N1G A;  1EH2 A;  1KWO B;  4MBE A;  4C0L A;  2LMT A;  2KBI A;  3EK4 A;  1B8L A;  3AKB A;  4DRW A;  1ZAC A;  2L4H A;  1KQM B;  3SG7 A;  1IJ5 A;  1SRA A;  3SIB A;  2KFG A;  1BF5 A;  2ZRT A;  2BCX A;  4F0Z B;  1L2O C;  5AXI A;  2CTN A;  1BOD A;  1NX0 A;  2LM5 A;  3D0Y B;  3DD4 A;  2ZFD A;  2BE6 A;  3KF9 A;  1XFZ O;  1B1G A;  1PUL A;  3NXA A;  5HKW A;  1WY9 A;  1TRF A;  2MBX A;  1CDL A;  4N1F A;  3FWC A;  4HRG A;  3F45 A;  4YGC B;  1ALW A;  1FI5 A;  1TTX A;  5HKY A;  1YVL A;  1QAT A;  5CSN A;  2PAS A;  3BUM B;  3IQO A;  5AFP A;  1CDP A;  2WC8 A;  2LVI A;  1A03 A;  1RWY A;  3H4S E;  3VRN A;  1QS7 A;  2CCM A;  2MLE C;  1SY9 A;  3IQQ A;  1K93 D;  5DKR A;  4WQ3 A;  2ZRS A;  3OP0 A;  1QIW A;  2M8U A;  1K96 A;  1S3P A;  4CFQ A;  4C0J A;  2LUC A;  3BQ3 A;  1CKK A;  1MXE A;  1SR6 C;  1DJX A;  2LP2 A;  1S6C A;  2F2O A;  2QPT A;  4NDB A;  4XJK A;  2BKH B;  3DVM A;  5G08 A;  2BBN A;  1Y0V H;  2JWW A;  4L9M A;  1TN4 A;  5J3X A;  1B7T Z;  2B1U A;  2L98 A;  2KSP A;  2M3W A;  2KFH A;  1MXL C;  1NCZ A;  3SG4 A;  1C7V A;  1AJ5 A;  2JPT A;  1QIV A;  1KFU L;  1XK4 A;  4MVF A;  2JRF A;  3LK0 A;  2LMV A;  2PVB A;  3PAL A;  1K9K A;  4N5X A;  4IL1 A;  2KGB C;  2JTT A;  2LC5 A;  2PMY A;  3O6B A;  5ER5 A;  1FBV A;  2CBL A;  1K8U A;  1J7Q A;  2KHN A;  1X02 A;  1KFU S;  1W7J B;  3PLF B;  1AVS A;  3NSO A;  5ER4 X;  2NZ0 A;  1N65 A;  1Y1A A;  1OMR A;  1S1E A;  1SK6 D;  1XO5 A;  2KAY A;  4GFT A;  1TNP A;  4E68 A;  2LUX A;  2ZN8 A;  2GGZ A;  1OZS A;  2ZNE A;  3I5I B;  4Q04 A;  1AHR A;  1SCM C;  3VGO A;  1EG4 A;  2EGD A;  2F3Y A;  3GK2 A;  2AUC A;  3IF7 A;  4HRH A;  4GGN A;  4PDZ A;  1OSA A;  2BKI B;  1QVI Z;  1S5G Y;  1CFF A;  4TNC A;  1SL7 A;  2CT9 A;  2MA2 A;  2OTG C;  3FWB A;  2L50 A;  3BOW A;  1SBJ A;  1XVJ A;  2WOR A;  1M31 A;  2LE9 B;  2R2I A;  3BUW B;  2HF5 A;  4CPV A;  5BPJ A;  5K89 A;  1JBA A;  1KK8 C;  1ZMZ A;  1U5I B;  3RLZ A;  1DJZ A;  3E3R A;  3EK7 A;  3DVJ A;  1QV0 A;  4MRY A;  4U8D A;  4GBA A;  5PAL A;  4QJ4 B;  1PVB A;  2LVK A;  1CLB A;  1DVI A;  4A4C A;  2NLN A;  2O60 A;  3I5F C;  5KU1 A;  3WHU B;  3DVK A;  3WNX B;  3A8R A;  2GV5 A;  2M1K B;  1L7Z A;  1SYM A;  1UHI A;  2BCA A;  2VRG A;  3JTD B;  3JVT C;  1F4Q A;  1LXF C;  1YX7 A;  3AAJ A;  3PN7 C;  4JQ0 D;  1BR4 B;  3WHT B;  1DGU A;  5DKQ A;  2KI6 C;  3KO0 A;  4PE0 A;  5CSI A;  1S26 D;  1DMO A;  2LLS A;  1JC2 A;  2EC6 B;  3EVV A;  2LP3 A;  3CGA A;  4WQ2 A;  1D1O A;  1H8B A;  3ZWH A;  1UUS A;  2M29 A;  2CXJ A;  2OS8 B;  2K7D A;  2KBM A;  1JWD A;  3EKJ A;  1CM1 A;  4MZJ A;  1A4P A;  2KDH A;  5DKN A;  4M2Q A;  2EC6 C;  1SW8 A;  1OMD A;  1UHH A;  2I7A A;  1A75 A;  1DF0 B;  2LHI A;  1GGZ A;  1LKJ A;  2JT3 A;  1IJ6 A;  1UWO A;  1BJF A;  2L51 A;  1NP8 A;  4MEW A;  1B8C A;  1NX2 A;  2V53 A;  3GOF A;  2M7L A;  5HLV A;  1KWO C;  1LA0 A;  2ZKM X;  2CNP A;  1LIN A;  2K2A A;  4GGF C;  2MRD A;  5IBW A;  1KK7 Y;  1KQM C;  2L0P A;  3M0W A;  4OV2 A;  1BOC A;  3NSI A;  1J1D A;  1NX1 A;  1OQP A;  1S6J A;  2OPO A;  1FF1 A;  1OZO A;  2AAO A;  2Y1N A;  1B4C A;  1J7P A;  2JNF A;  3LK1 A;  3VRQ A;  1QXP A;  1QX2 A;  4PAL A;  4XYN A;  3KPX A;  3A4U B;  2HET A;  1ZUZ A;  3CZT X;  2LLU A;  2JT0 A;  2KI6 D;  3BYA A;  3FS7 A;  1QTX A;  2BL0 B;  3NSL A;  3TUY B;  3VRO A;  1BLQ A;  2BCB A;  5I8N A;  1CMG A;  4PCW A;  5AAN A;  1VRK A;  4YGD B;  5JOL A;  1MR8 A;  1SPY A;  3TZ1 A;  1IGV A;  1EXR A;  2BL0 C;  1UHK A;  2KAV A;  1QX7 A;  3WXA A;  4AQI A;  1SL8 A;  3EVR A;  3QRX A;  1CMF A;  1GJY A;  1MUX A;  1W7I B;  2FCE A;  3CR4 X;  4GNK B;  2WND A;  5HKZ A;  4BY5 A;  1UHJ A;  1TIZ A;  1XFU O;  1TNX A;  2MAZ A;  2EHB A;  2E6W A;  1YUR A;  2AMI A;  3OX5 A;  4YRU A;  2LAN A;  4WRI A;  1SNL A;  1YUU A;  1A2X A;  1BT6 A;  2KYC A;  2NCO A;  1H4B A;  3VRR A;  1HT9 A;  2FOT A;  2COL B;  2F3Z A;  4R1E A;  1QLS A;  1K94 A;  3BUX B;  1DJI A;  3TS5 B;  4OVN F;  2H2K A;  2HQ8 A;  1RRO A;  2M97 A;  2LLT A;  1BR1 B;  1FW4 A;  1B7T Y;  1PSR A;  4YI9 A;  1F8H A;  2JXC A;  2WCE A;  4XJK B;  1K90 D;  3DF0 A;  5CSF A;  3OB1 B;  2LAP A;  2BBM A;  3CTN A;  4C0K A;  1TNQ A;  3CR5 X;  5JJG A;  4CID A;  3NSK A;  2JUL A;  1YRU B;  1WLM A;  1GQM A;  2D8N A;  3EKH A;  4QJ3 B;  5F6T A;  4ZCV A;  1C07 A;  1F71 A;  1TNW A;  1BU3 A;  1WRK A;  2I18 A;  4ORC B;  3I5I C;  1CM4 A;  2RGI A;  1JFK A;  2FJU B;  1G8I A;  1EG3 A;  5AEQ A;  1PVA A;  1SCV A;  1WLZ A;  1XK4 C;  4USL A;  1V1F A;  1F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...