2LV7A

Solution structure of ca2+-bound cabp7 n-terminal doman
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 7
publication title Solution NMR Structure of the Ca2+-bound N-terminal Domain of CaBP7: A REGULATOR OF GOLGI TRAFFICKING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lv7A00
3DF0A 1DJXA 1CDNA 2K0JA 1CLMA 2ZFDA 1OE9B 1B47A 2PALA 1MUXA 1WRZA 3CWGA 4XJKA 1HT9A 4P5OE 3NSOA 4PE1A 4M2OA 1ZUZA 2K7OA 1M45A 2LMUA 1ALWA 5IBWA 1RJVA 1NX3A 2B1UA 5FYXA 2BKIB 1DJWA 1OMRA 4QJ5B 2HQ8A 2K7DA 2LV7A 2MBXA 4F0ZB 1TOPA 2JPTA 2KI6D 1K96A 5BPJA 4OR9B 1M31A 1CKKA 1AJ4A 4WRIA 2GGZA 3EKHA 2LVIA 1WY9A 4I5NB 1MQ1A 1F54A 3VRQA 1DF0B 1SCMB 2L5XB 5J3XA 2KYCA 4HREE 1S6JA 1Y6WA 1AVSA 1DMOA 1TRFA 4U8DA 2KSPA 1YTZC 1UWOA 1SL7A 4CIDA 1QVIY 5AERA 1DJIA 4D1EA 3I5HC 2HF5A 2WCEA 4A4CA 1DGUA 1CM1A 1QX5B 1C7WA 5TNCA 1RROA 3TS5B 1XO5A 1OQPA 4N5XA 4PHMA 1ZACA 1BOCA 1L7ZA 1Y1UA 1IGVA 2KI6C 1UHNA 2GGMA 3O2PA 2M0RA 4WQ2A 1DT7B 1N2DA 1QTXA 1WRKA 2SASA 2WCFA 3I5HB 4USLA 3JTDB 4C0KA 2HQWA 2CBLA 3DVJA 1YX8A 2JXCA 1B7TY 4QJ3B 2RGIA 1KK8B 2JT8A 4PALA 3WHUB 3IF7A 1PALA 2DOQA 5PALA 2WCBA 3BQ3A 5DKQA 2K61A 1QX2A 2BBNA 2H61A 2Y4QA 1YRTB 1NUBA 3EVRA 3CS1A 4TNCA 1JBAA 3VROA 2H2KA 3OX5A 3I5GC 4Q04A 4YBHB 3SG2A 4AQJA 3I5FB 2FJUB 2KAXA 2KAYA 4MBEA 1B8RA 1BR4B 5GQQC 1RTP1 4PE7A 1CFPA 3M0WA 3OP0A 4ZCUA 2G2BA 2NLNA 1JF2A 5DKRA 3WHTB 1CMGA 3NSLA 2L4HA 1Q80A 1MR8A 3DVMA 3I5GB 4I5KA 3BUXB 4GAOA 1B4CA 1NWDA 2ZRTA 4YI9A 1EG3A 1PSRA 3C1VA 3PFVA 1ODBA 1JF0A 4GGNA 1ZOTB 1DJGA 4XJKB 1NSHA 3KO0A 4ZCVA 5JOLA 3VGOA 3CR5X 1L2OB 2JXLA 2K7CA 2M49B 2LVVA 4NDCA 3FS7A 3ZWHA 3A8RA 4GNKB 1F55A 5B8IB 1QLKA 1H4BA 1S5GZ 3SG3A 1YUSA 1YRUB 3PATA 1EG4A 3BOWB 1KSMA 2PASA 2M97A 2LC5A 4OVNF 1XFVO 1YUTA 4DCKA 1FI6A 2SCPA 1YVHA 1GGWA 2JTTA 1J7OA 1MWNA 3PM8A 4ICBA 2FOTA 1J7QA 1F4QA 3KHEA 1MXEA 2I2RE 4MN0A 4P2YB 1K94A 1CDLA 2PSRA 1JUOA 1EH2A 5HYDA 1FPWA 1TNPA 5F6TA 2WC8A 2LUCA 4XYNA 3TDUA 3KEVA 1N65A 2M1KB 4AQIA 1PVAA 1NCXA 1CB1A 1JFKA 4I5JA 1QATA 1U5IA 5CSNA 1WLZA 1FW4A 2V53A 4MVFA 2F33A 2VRGA 3EK7A 5CSJA 1TIZA 2K7BA 3AAKA 3BUMB 5I2QA 3OX6A 5AXIA 4NQGA 1KWOB 1VRKA 2MJWB 4AOMA 4YRUA 2ISDA 4ORBB 1OOJA 2MRDA 1K95A 1MF8B 1NCYA 4YGCB 1S36A 2KFHA 1J1EA 2LLUA 2ZKMX 5K89A 1H8BA 2KQ6A 1RK9A 1SCMC 1WRLA 2AMIA 1PRWA 3PALA 2F2OA 3PLFB 2L51A 1SR6C 1YURA 1SNLA 4HRHA 4DS7A 1IJ5A 1K9PA 1F4OA 1KK7Z 1M63B 2F2PA 3FWBA 2MA2A 4QJ4B 3TUYC 1LINA 4GGFC 2LVKA 3K21A 4NDBA 1C07A 3DD4A 2GV5A 1KFXS 2F3YA 2KFFA 1KCYA 3A4UB 3TS5C 4MRXA 2LP3A 1NX1A 5CSIA 1SR6B 3F45A 4ORAB 2QACA 1BJFA 3TUYB 2PRUA 2L0PA 1CDMA 3KPXA 1GQMA 1KFXL 1SCVA 3SG4A 1K9KA 1LKJA 1PSBA 5DKNA 4CLNA 1BU3A 2JU0A 3JTDC 3GOFA 1CTRA 4E68A 2JNFA 2KAVA 1QASA 2NZ0A 2KOTA 1KK8C 1K9UA 1PVBA 4CFQA 1KQMC 4MZJA 2KNEA 1A03A 2JULA 3NSIA 1B1GA 1SL9A 1CNPA 3TDZA 1A2XA 1J7RA 1WDCC 1G33A 2LNKA 3O78A 1SRAA 3AAJA 3I5FC 1IQ5A 1QX7A 1GGZA 2KQYA 2K2FA 3PSRA 1TNWA 1AP4A 1KQMB 1YVLA 2I7AA 2ZNEA 1PK0D 3BUNB 3TZ1A 2HETA 1XK4C 3QRXA 1J1DA 2NCPA 2O60A 1WDCB 2NCOA 1PULA 1V1FA 2R2IA 3CLNA 2M9GA 2LVJA 3D0YA 1QV1A 1JFJA 4MEWA 1XFZO 3CR2A 2NXQA 2JRFA 4BY4A 5AEQA 2JTZA 2O5GA 1QS7A 2WORA 1JSAA 3SG7A 4C0JA 4MRYA 1U5IB 2LLTA 4PE0A 1D1OA 1UURA 2QPTA 2KBMA 4N1GA 3BXKA 4R1EA 1Y1AA 1YX7A 1L2OC 2JOJA 1QIWA 4DUQA 3HCMA 3OB1B 3DF0B 4MZLA 2CNPA 1DTLA 5I2LA 2BCXA 1NX0A 1KFUL 5I2OA 3VRRA 1SKTA 1X02A 5HLVA 1R6PA 2BE4A 4JQ0D 1CLLA 4ETOA 1BG1A 2CXJA 1W7JB 2JZIA 2KHNA 1SL8A 3LK0A 4YGBB 3NXAA 3GK1A 4JWQA 2M1UA 4GFTA 2ZNDA 3O6BA 1LXFC 1RFJA 2KFGA 3GK4X 1K93D 3FIAA 4FTGA 1HQVA 2JT0A 1RECA 3MSEB 3IQOA 4MSPA 4GBAA 5HKZA 3BUOB 1FF1A 3LL8B 5I8NA 2OS8B 3WXAA 2COLB 2BBMA 1CM4A 1TN4A 1FBVA 2BCAA 1UHHA 2L98A 4WQ3A 1KWOC 1IRJA 1XYDA 1K90D 1OZSA 1ZFSA 3FWCA 1F70A 2AUCA 3ICBA 2Y5IA 1YUUA 4OV2A 2E30A 2JWWA 1S6IA 4CFRA 1QVIZ 4GUKA 5AANA 1S6CA 2KYFA 2L2EA 1A4PA 1K8UA 1NX2A 1SW8A 3H4SE 4M2QA 4UPGA 3DVKA 2H61C 2M8UA 1QJTA 2D8NA 1NYAA 1AUIB 2KI4B 2OPOA 3BYAA 3OHMB 1XVJA 1SMGA 4M2PA 1IWQA 1S26D 2MHHA 3DVEA 3SG5A 3WNXB 4MLWA 1F8HA 3VRPA 2MLEC 2PMYA 2LLSA 1J55A 1OZOA 4L9MA 1WLMA 1CFDA 4PDZA 1A29A 3D0YB 2M29A 1B7TZ 2Q4UA 1MXLC 3D10A 3BUWB 1KSOA 1XFYO 3EKJA 4YI8A 1E8AA 3SG6A 3LLEA 1S5GY 3I5IC 1BR1B 1BT6A 2CTNA 3AKAA 1IJ6A 1B8CA 1OSAA 2Y1NA 1TNQA 1XFXO 3GK2A 4I5LB 1M46A 4C0LA 1NPQA 1CDPA 2KDHA 1LA0A 3EK4A 3BOWA 1BODA 1K2HA 2JQ6A 3I5IB 1EXRA 2Q91A 3IQQA 4HRGA 4YGEB 2LANA 2BE6A 1W7IB 1S3PA 5ER4X 2JT3A 3VRNA 2K8MB 3CGAA 3KF9A 1C7VA 2MLFC 1SYMA 2KGRA 1UHJA 2IS9A 1XA5A 2HPSA 5KU1A 2F8PA 1RWYA 1ZMZA 1JWDA 3OB2B 2LMVA 1AHRA 1UHIA 5CPVA 2LHIA 1QXPA 3E3RA 3EVVA 3CR4X 2LE9B 4YGAA 1SK6D 1TTXA 1IH0A 1QV0A 1A75A 4DRWA 2LHLA 5HKWA 1IG5A 1NCZA 4YGDB 2L50A 3RM1A 2TN4A 1TNXA 1V1GA 3TDIA 1KFUS 2CT9A 2JC2A 3JVTC 1KK7Y 1B8LA 2EHBA 1AJ5A 1UP5A 1BLQA 3ZNIA 1IKUA 4CPVA 2WNDA 1NIWA 2A4JA 4N1FA 2L4IA 4IL1A 2FCEA 2AAOA 3CTNA 5ER5A 1SY9A 3PN7C 3SIAA 1CLBA 1FI5A 1CFCA 1SBJA 3JVTB 2JNXA 2KGBC 2E6WA 2LCPA 5G08A 3SJSA 1Y0VH 1QIVA 4DIRA 3CZTX 4A4BA 1DF0A 4OCIA 1QLSA 5KTYA 1NP8A 2ZN8A 1G8IA 3PN7B 5AFPA 2OS8C 2BECA 1DVIA 3NSKA 3LK1A 4GGFA 4PHKA 1DJYA 1Y1XA 1UUSA 1R2UA 2LMTA 4OKHA 1XFUO 2LP2A 2BCBA 5HLOA 4HSZA 1DJHA 2LUXA 1LVCD 2CCMA 1MHOA 3EVUA 1CFFA 1DGVA 1TCOB 3AKBA 2FCDA 2I94A 4NDDA 1DJZA 4PCWA 1TCFA 1J7PA 1M39A 2OTGC 1AK8A 3EK8A 2KI4C 4JPZB 5D7FA 5HKYA 2Y1MA 1EL4A 1GJYA 2EC6C 3RLZA 1KQVA 4PE4A 1F71A 4BY5A 2BKHB 4MZKA 2F3ZA 2PVBA 1LA3A 1G4YR 1UHKA 1XFWO 2G9BA 2BL0C 2OTGB 4ORCB 2K2AA 1CMFA 2ZRSA 1ALVA 2MAZA 1IQ3A 1SPYA 5CSFA 1YR5A 2KBIA 2EC6B 1OMDA 2WOSA 4PHJA 4PHNA 2ZN9A 3O4YA 4GPLB 1JC2A 1EJ3A 1BMOA 2EGDA 3LCPC 2LAPA 5D69A 2P6BB 2M7LA 1BF5A 1N0YA 2M7NA 5KSZA 1XK4A 4FQOA 2BL0B 1A75B 1S1EA 2I18A 3SIBA 1OMVA 2LM5A 3HX4A 5JJGA 2M3WA 1B9AA
chains in the Genus database with same CATH superfamily
3DF0A 1DJXA 1CDNA 2K0JA 1CLMA 2ZFDA 1OE9B 1B47A 2PALA 1MUXA 1WRZA 3CWGA 4XJKA 1HT9A 4P5OE 3NSOA 4PE1A 4M2OA 1ZUZA 2K7OA 1M45A 2LMUA 1ALWA 5IBWA 1RJVA 5I94A 1NX3A 1W9ZA 2B1UA 2BKIB 5FYXA 1DJWA 4JD9A 1OMRA 4QJ5B 2HQ8A 2K7DA 2LV7A 2MBXA 4F0ZB 1TOPA 2JPTA 2KI6D 2BNXA 1K96A 5BPJA 5HL1A 3CABA 4OR9B 1M31A 1CKKA 1AJ4A 4WRIA 2GGZA 3EKHA 2LVIA 1WY9A 4I5NB 1MQ1A 1F54A 3VRQA 1DF0B 1SCMB 2L5XB 3R1PA 5J3XA 2KYCA 4HREE 3DZTA 1S6JA 1Y6WA 1AVSA 1DMOA 1TRFA 4U8DA 2KSPA 1YTZC 1LS8A 1UWOA 1SL7A 4CIDA 1QVIY 2BAPA 3B88A 5AERA 1DJIA 4D1EA 3I5HC 2HF5A 2JPOA 2WCEA 1DGUA 1CM1A 1QX5B 1Z4HA 4A4CA 1C7WA 5TNCA 1RROA 3TS5B 1XO5A 1DC1A 1T14A 1OQPA 4N5XA 4PHMA 1ZACA 4M2PA 1BOCA 1L7ZA 1Y1UA 3DY9A 1IGVA 2KI6C 4FQTA 1UHNA 2GGMA 3O2PA 2M0RA 4WQ2A 1DT7B 1N2DA 1QTXA 1WRKA 2SASA 2WCFA 3I5HB 4USLA 3JTDB 4C0KA 2HQWA 2CBLA 3DVJA 1YX8A 2JXCA 1B7TY 4QJ3B 2RGIA 1KK8B 1DELA 2JT8A 3D75A 4PALA 3IF7A 3WHUB 1PALA 2DOQA 5PALA 2WCBA 3BQ3A 5DKQA 2K61A 1QX2A 2BBNA 2H61A 2Y4QA 1YRTB 1NUBA 3EVRA 3OBVA 3CS1A 4TNCA 1JBAA 3VROA 2H2KA 3OX5A 3I5GC 4Q04A 4YBHB 3SG2A 4AQJA 3I5FB 2FJUB 2KAXA 3QMEA 2KAYA 4MBEA 1B8RA 1BR4B 5GQQC 1RTP1 4PE7A 1CFPA 3M0WA 3OP0A 4ZCUA 2G2BA 2NLNA 1JF2A 5DKRA 3WHTB 1CMGA 1ORGA 2L4HA 3NSLA 1Q80A 1MR8A 3DVMA 3I5GB 4I5KA 3BUXB 4GAOA 1B4CA 4KYNA 1NWDA 2ZRTA 4YI9A 1EG3A 1PSRA 3C1VA 3PFVA 1ODBA 1JF0A 3L4AA 4GGNA 1ZOTB 1DJGA 4XJKB 1NSHA 3KO0A 4ZCVA 5JOLA 3VGOA 3CR5X 1L2OB 2JXLA 2K7CA 2M49B 2LVVA 4NDCA 3FS7A 3DYEA 4JKTA 3ZWHA 3A8RA 4GNKB 1F55A 5B8IB 1QLKA 1H4BA 1S5GZ 3SG3A 1YUSA 1YRUB 3PATA 1EG4A 3BOWB 1KSMA 2PASA 2M97A 2LC5A 4OVNF 1XFVO 1YUTA 4DCKA 1FI6A 2SCPA 1YVHA 3NGVA 2JTTA 1J7OA 1MWNA 1GGWA 3PM8A 4ICBA 2FOTA 1J7QA 3N7HA 1F4QA 3KHEA 1MXEA 2I2RE 4MN0A 4P2YB 1K94A 1CDLA 2PSRA 2K60A 1JUOA 1EH2A 5HYDA 1FPWA 1TNPA 5F6TA 2WC8A 2LUCA 1QWVA 4XYNA 3TDUA 3KEVA 1N65A 2M1KB 4AQIA 1PVAA 3S0FA 1NCXA 1CB1A 1JFKA 4I5JA 1QATA 1U5IA 5CSNA 1WLZA 1FW4A 2V53A 4MVFA 2F33A 2VRGA 3EK7A 5CSJA 1TIZA 2K7BA 3AAKA 3BUMB 5I2QA 3OX6A 5AXIA 4NQGA 1KWOB 1VRKA 2QDIA 2MJWB 4AOMA 4YRUA 2PYQA 2ISDA 4ORBB 1OOJA 2MRDA 1K95A 1OOIX 1MF8B 1NCYA 4YGCB 1S36A 2KFHA 1J1EA 2LLUA 1TUZA 2WCMA 2ZKMX 5K89A 1H8BA 2KQ6A 1OOHA 1RK9A 1SCMC 1WRLA 1PRWA 2AMIA 3PALA 2F2OA 3PLFB 2L51A 1SR6C 1YURA 1SNLA 3R1OA 4HRHA 4DS7A 1IJ5A 1K9PA 1F4OA 1KK7Z 1M63B 2F2PA 3FWBA 2MA2A 4QJ4B 3TUYC 1LINA 4GGFC 1SSEB 2LVKA 3D77A 3K21A 4NDBA 1C07A 3DD4A 2GV5A 1KFXS 3D76A 2F3YA 2KFFA 1KCYA 3A4UB 3TS5C 4MRXA 2LP3A 3PJIA 3IVTA 1NX1A 2WCJA 5CSIA 1SR6B 2WCLA 3Q8IA 3F45A 4ORAB 2QACA 1BJFA 3TUYB 2PRUA 2L0PA 1CDMA 3KPXA 3R72A 1GQMA 1KFXL 1SCVA 3SG4A 1K9KA 1LKJA 1PSBA 5DKNA 4CLNA 1BU3A 2JU0A 3JTDC 3GOFA 3R1VA 1CTRA 4E68A 2JNFA 2KAVA 1QASA 2NZ0A 2KOTA 1KK8C 1K9UA 1PVBA 4CFQA 1KQMC 4MZJA 2KNEA 1A03A 2JULA 3NSIA 1B1GA 2QEOA 1TUJA 1SL9A 3PM2A 1CNPA 3TDZA 1A2XA 1J7RA 1WDCC 1G33A 3S0BA 2LNKA 3O78A 1SRAA 3AAJA 3I5FC 1IQ5A 1QX7A 1GGZA 2KQYA 2P71A 3BFHA 2K2FA 3NHTA 1TNWA 3PSRA 1AP4A 1KQMB 1YVLA 2I7AA 2ZNEA 1PK0D 3BUNB 3TZ1A 2HETA 1XK4C 3QRXA 1J1DA 2NCPA 2O60A 1WDCB 2NCOA 1PULA 1V1FA 2R2IA 3CLNA 2M9GA 2LVJA 3D0YA 1QV1A 1JFJA 3DXLA 1XFZO 4MEWA 3CR2A 2NXQA 2JRFA 4BY4A 5AEQA 2JTZA 2O5GA 1QS7A 2WORA 5FI6A 1JSAA 3SG7A 4C0JA 4MRYA 1U5IB 2LLTA 2KLEA 2QEBA 1UURA 4PE0A 1D1OA 2QPTA 5FI7A 2KBMA 4N1GA 3BXKA 4R1EA 1Y1AA 1YX7A 1L2OC 2JOJA 1QIWA 4DUQA 3HCMA 3OB1B 3DF0B 4MZLA 2CNPA 1DTLA 5I2LA 2GTEA 2BCXA 1NX0A 1KFUL 3O4XA 5I2OA 3D74A 3CZ1A 1DEKA 3VRRA 1SKTA 1X02A 5HLVA 3UNWA 1R6PA 2BE4A 3B87A 2WC6A 3D73A 3FE6A 1CLLA 4JQ0D 4ETOA 2KPHA 1BG1A 2CXJA 3OGNA 1W7JB 2JZIA 2KHNA 1SL8A 3LK0A 4YGBB 2QEVA 3NXAA 3GK1A 4JWQA 2M1UA 4GFTA 2ZNDA 3O6BA 1LXFC 1RFJA 2KFGA 3GK4X 1K93D 3CZ0A 3FIAA 4FTGA 1HQVA 2JT0A 1RECA 2PQLA 3IQOA 3MSEB 4GBAA 4MSPA 1OOFA 5HKZA 3BUOB 3UO9A 3LL8B 1FF1A 5I8NA 2OS8B 3WXAA 2COLB 2BBMA 1CM4A 4INWA 1TN4A 1FBVA 1UHHA 2BCAA 2L98A 3FE9A 1KWOC 2WCKA 1IRJA 1XYDA 1K90D 1OZSA 1ZFSA 3FWCA 2WCHA 1F70A 2AUCA 4WQ3A 3ICBA 2Y5IA 1YUUA 4OV2A 2E30A 2JWWA 1S6IA 3S0EA 4PT1A 4CFRA 1QVIZ 3S0AA 4GUKA 5AANA 1S6CA 2KYFA 2L2EA 1A4PA 1K8UA 1NX2A 1SW8A 3H4SE 4M2QA 4UPGA 3CZ2A 3DVKA 3V2LA 4F7FA 2H61C 2M8UA 1QJTA 2D8NA 1NYAA 1AUIB 2KI4B 2OPOA 3B6XA 3BYAA 1XVJA 1SMGA 3OHMB 1IWQA 1S26D 2MHHA 3DVEA 3SG5A 3WNXB 4MLWA 1F8HA 1IIOA 3VRPA 2P70A 2MLEC 5D3OA 3CDNA 2PMYA 2LLSA 1J55A 1OZOA 4L9MA 1WLMA 1CFDA 4PDZA 3B7AA 1A29A 3D0YB 2M29A 1B7TZ 2Q4UA 3SS3A 1MXLC 3D10A 3BUWB 1KSOA 1XFYO 3EKJA 4YI8A 3B86A 1E8AA 2L2CA 3SG6A 3LLEA 1S5GY 3I5IC 1BR1B 1BT6A 2CTNA 3AKAA 1IJ6A 1B8CA 1OSAA 2Y1NA 1TNQA 1XFXO 1DQEA 3GK2A 4I5LB 1M46A 4C0LA 1NPQA 1CDPA 2KDHA 1LA0A 2H8VA 3BOWA 3EK4A 1TWOA 2JQ6A 3I5IB 1EXRA 1BODA 1K2HA 2Q91A 3IQQA 4HRGA 4YGEB 2LANA 2BE6A 1W7IB 1S3PA 5ER4X 4IJ7A 2JT3A 3VRNA 2K8MB 3CGAA 3KF9A 3D78A 1C7VA 2MLFC 1SYMA 2KGRA 1UHJA 2IS9A 1XA5A 2HPSA 3SS5A 5KU1A 2F8PA 1RWYA 1ZMZA 1JWDA 3OB2B 2LMVA 1AHRA 1UHIA 5CPVA 3RZSA 2LHIA 1QXPA 3E3RA 3EVVA 3VB1A 3CR4X 2LE9B 4YGAA 1SK6D 1TTXA 1IH0A 1QV0A 1A75A 4DRWA 2LHLA 5HKWA 1IG5A 1NCZA 4YGDB 1P28A 2L50A 2KLDA 3RM1A 2TN4A 1TNXA 1V1GA 3TDIA 1KFUS 2CT9A 2JC2A 3JVTC 1KK7Y 1B8LA 1C3ZA 2EHBA 1AJ5A 1UP5A 1BLQA 3ZNIA 1IKUA 4CPVA 5DICA 2WNDA 2WC5A 1NIWA 2A4JA 4N1FA 2L4IA 4IL1A 2FCEA 2AAOA 4OZDA 3CTNA 5ER5A 1SY9A 3PN7C 3SIAA 1CLBA 1FI5A 3L47A 1CFCA 1SBJA 3JVTB 2JNXA 2KGBC 2E6WA 2LCPA 3EG5B 5G08A 3SJSA 1Y0VH 1QIVA 4DIRA 3CZTX 4A4BA 1DF0A 4OCIA 1QLSA 5KTYA 2YGUA 3BJHA 1NP8A 3NHIA 2ZN8A 1GM0A 1XFRA 1G8IA 3PN7B 1OW4A 5AFPA 2OS8C 2BECA 1DVIA 3NSKA 3LK1A 4GGFA 4PHKA 1DJYA 1Y1XA 1UUSA 1R2UA 2LMTA 4OKHA 1XFUO 2LP2A 2BCBA 5HLOA 4HSZA 1DJHA 2LUXA 1LVCD 2CCMA 1MHOA 3EVUA 1CFFA 1DGVA 1TCOB 3AKBA 2FCDA 2I94A 4NDDA 1DJZA 4PCWA 1TCFA 1J7PA 1M39A 2OTGC 1AK8A 2L5YA 3EK8A 2KI4C 4JPZB 5D7FA 5HKYA 2Y1MA 1EL4A 1GJYA 2ERBA 3BFAA 2EC6C 3RLZA 5EL2A 1KQVA 4PE4A 1F71A 4BY5A 2BKHB 4MZKA 2F3ZA 2PVBA 1LA3A 1G4YR 1UHKA 1XFWO 2G9BA 3CYZA 3SS4A 3S0GA 2BL0C 2OTGB 1C3YA 4INXA 4ORCB 2K2AA 1CMFA 1OOGA 2ZRSA 1ALVA 2MAZA 1IQ3A 1SPYA 2FJYA 2QEHA 3FE8A 5CSFA 1YR5A 2KBIA 2EC6B 1OMDA 2WOSA 3BFBA 4PHJA 4PHNA 2ZN9A 3O4YA 3L4LA 4GPLB 1JC2A 1EJ3A 1BMOA 2EGDA 3LCPC 2LAPA 3K1EA 5D69A 2P6BB 2M7LA 1BF5A 1N0YA 2M7NA 5KSZA 1XK4A 4FQOA 2BL0B 1A75B 1S1EA 2I18A 3SIBA 1OMVA 2LM5A 3HX4A 5FI2A 3S0DA 2M3WA 1Z2CB 5JJGA 1B9AA
chains in the Genus database with same CATH topology
3DF0A 1DJXA 1CDNA 2K0JA 1CLMA 2ZFDA 1OE9B 1B47A 2PALA 1MUXA 1WRZA 3CWGA 4XJKA 1HT9A 4P5OE 3NSOA 4PE1A 4M2OA 1ZUZA 2K7OA 1M45A 2LMUA 1ALWA 5IBWA 1RJVA 1NX3A 2B1UA 5FYXA 2BKIB 1DJWA 1OMRA 4QJ5B 2HQ8A 2K7DA 2LV7A 2MBXA 4F0ZB 1TOPA 2JPTA 2KI6D 1K96A 5BPJA 4OR9B 1M31A 1CKKA 1AJ4A 4WRIA 2GGZA 3EKHA 2LVIA 1WY9A 4I5NB 1MQ1A 1F54A 3VRQA 1DF0B 1SCMB 2L5XB 5J3XA 2KYCA 4HREE 1S6JA 1Y6WA 1AVSA 1DMOA 1TRFA 4U8DA 2KSPA 1YTZC 1UWOA 1SL7A 4CIDA 1QVIY 5AERA 1DJIA 4D1EA 3I5HC 2HF5A 2WCEA 4A4CA 1DGUA 1CM1A 1QX5B 1C7WA 5TNCA 1RROA 3TS5B 1XO5A 1OQPA 4N5XA 4PHMA 1ZACA 1BOCA 1L7ZA 1Y1UA 1IGVA 2KI6C 1UHNA 2GGMA 3O2PA 2M0RA 4WQ2A 1DT7B 1N2DA 1QTXA 1WRKA 2SASA 2WCFA 3I5HB 4USLA 3JTDB 4C0KA 2HQWA 2CBLA 3DVJA 1YX8A 2JXCA 1B7TY 4QJ3B 2RGIA 1KK8B 2JT8A 4PALA 3WHUB 3IF7A 1PALA 2DOQA 5PALA 2WCBA 3BQ3A 5DKQA 2K61A 1QX2A 2BBNA 2H61A 2Y4QA 1YRTB 1NUBA 3EVRA 3CS1A 4TNCA 1JBAA 3VROA 2H2KA 3OX5A 3I5GC 4Q04A 4YBHB 3SG2A 4AQJA 3I5FB 2FJUB 2KAXA 2KAYA 4MBEA 1B8RA 1BR4B 5GQQC 1RTP1 4PE7A 1CFPA 3M0WA 3OP0A 4ZCUA 2G2BA 2NLNA 1JF2A 5DKRA 3WHTB 1CMGA 3NSLA 2L4HA 1Q80A 1MR8A 3DVMA 3I5GB 4I5KA 3BUXB 4GAOA 1B4CA 1NWDA 2ZRTA 4YI9A 1EG3A 1PSRA 3C1VA 3PFVA 1ODBA 1JF0A 4GGNA 1ZOTB 1DJGA 4XJKB 1NSHA 3KO0A 4ZCVA 5JOLA 3VGOA 3CR5X 1L2OB 2JXLA 2K7CA 2M49B 2LVVA 4NDCA 3FS7A 3ZWHA 3A8RA 4GNKB 1F55A 5B8IB 1QLKA 1H4BA 1S5GZ 3SG3A 1YUSA 1YRUB 3PATA 1EG4A 3BOWB 1KSMA 2PASA 2M97A 2LC5A 4OVNF 1XFVO 1YUTA 4DCKA 1FI6A 2SCPA 1YVHA 1GGWA 2JTTA 1J7OA 1MWNA 3PM8A 4ICBA 2FOTA 1J7QA 1F4QA 3KHEA 1MXEA 2I2RE 4MN0A 4P2YB 1K94A 1CDLA 2PSRA 1JUOA 1EH2A 5HYDA 1FPWA 1TNPA 5F6TA 2WC8A 2LUCA 4XYNA 3TDUA 3KEVA 1N65A 2M1KB 4AQIA 1PVAA 1NCXA 1CB1A 1JFKA 4I5JA 1QATA 1U5IA 5CSNA 1WLZA 1FW4A 2V53A 4MVFA 2F33A 2VRGA 3EK7A 5CSJA 1TIZA 2K7BA 3AAKA 3BUMB 5I2QA 3OX6A 5AXIA 4NQGA 1KWOB 1VRKA 2MJWB 4AOMA 4YRUA 2ISDA 4ORBB 1OOJA 2MRDA 1K95A 1MF8B 1NCYA 4YGCB 1S36A 2KFHA 1J1EA 2LLUA 2ZKMX 5K89A 1H8BA 2KQ6A 1RK9A 1SCMC 1WRLA 2AMIA 1PRWA 3PALA 2F2OA 3PLFB 2L51A 1SR6C 1YURA 1SNLA 4HRHA 4DS7A 1IJ5A 1K9PA 1F4OA 1KK7Z 1M63B 2F2PA 3FWBA 2MA2A 4QJ4B 3TUYC 1LINA 4GGFC 2LVKA 3K21A 4NDBA 1C07A 3DD4A 2GV5A 1KFXS 2F3YA 2KFFA 1KCYA 3A4UB 3TS5C 4MRXA 2LP3A 1NX1A 5CSIA 1SR6B 3F45A 4ORAB 2QACA 1BJFA 3TUYB 2PRUA 2L0PA 1CDMA 3KPXA 1GQMA 1KFXL 1SCVA 3SG4A 1K9KA 1LKJA 1PSBA 5DKNA 4CLNA 1BU3A 2JU0A 3JTDC 3GOFA 1CTRA 4E68A 2JNFA 2KAVA 1QASA 2NZ0A 2KOTA 1KK8C 1K9UA 1PVBA 4CFQA 1KQMC 4MZJA 2KNEA 1A03A 2JULA 3NSIA 1B1GA 1SL9A 1CNPA 3TDZA 1A2XA 1J7RA 1WDCC 1G33A 2LNKA 3O78A 1SRAA 3AAJA 3I5FC 1IQ5A 1QX7A 1GGZA 2KQYA 2K2FA 3PSRA 1TNWA 1AP4A 1KQMB 1YVLA 2I7AA 2ZNEA 1PK0D 3BUNB 3TZ1A 2HETA 1XK4C 3QRXA 1J1DA 2NCPA 2O60A 1WDCB 2NCOA 1PULA 1V1FA 2R2IA 3CLNA 2M9GA 2LVJA 3D0YA 1QV1A 1JFJA 4MEWA 1XFZO 3CR2A 2NXQA 2JRFA 4BY4A 5AEQA 2JTZA 2O5GA 1QS7A 2WORA 1JSAA 3SG7A 4C0JA 4MRYA 1U5IB 2LLTA 4PE0A 1D1OA 1UURA 2QPTA 2KBMA 4N1GA 3BXKA 4R1EA 1Y1AA 1YX7A 1L2OC 2JOJA 1QIWA 4DUQA 3HCMA 3OB1B 3DF0B 4MZLA 2CNPA 1DTLA 5I2LA 2BCXA 1NX0A 1KFUL 5I2OA 3VRRA 1SKTA 1X02A 5HLVA 1R6PA 2BE4A 4JQ0D 1CLLA 4ETOA 1BG1A 2CXJA 1W7JB 2JZIA 2KHNA 1SL8A 3LK0A 4YGBB 3NXAA 3GK1A 4JWQA 2M1UA 4GFTA 2ZNDA 3O6BA 1LXFC 1RFJA 2KFGA 3GK4X 1K93D 3FIAA 4FTGA 1HQVA 2JT0A 1RECA 3MSEB 3IQOA 4MSPA 4GBAA 5HKZA 3BUOB 1FF1A 3LL8B 5I8NA 2OS8B 3WXAA 2COLB 2BBMA 1CM4A 1TN4A 1FBVA 2BCAA 1UHHA 2L98A 4WQ3A 1KWOC 1IRJA 1XYDA 1K90D 1OZSA 1ZFSA 3FWCA 1F70A 2AUCA 3ICBA 2Y5IA 1YUUA 4OV2A 2E30A 2JWWA 1S6IA 4CFRA 1QVIZ 4GUKA 5AANA 1S6CA 2KYFA 2L2EA 1A4PA 1K8UA 1NX2A 1SW8A 3H4SE 4M2QA 4UPGA 3DVKA 2H61C 2M8UA 1QJTA 2D8NA 1NYAA 1AUIB 2KI4B 2OPOA 3BYAA 3OHMB 1XVJA 1SMGA 4M2PA 1IWQA 1S26D 2MHHA 3DVEA 3SG5A 3WNXB 4MLWA 1F8HA 3VRPA 2MLEC 2PMYA 2LLSA 1J55A 1OZOA 4L9MA 1WLMA 1CFDA 4PDZA 1A29A 3D0YB 2M29A 1B7TZ 2Q4UA 1MXLC 3D10A 3BUWB 1KSOA 1XFYO 3EKJA 4YI8A 1E8AA 3SG6A 3LLEA 1S5GY 3I5IC 1BR1B 1BT6A 2CTNA 3AKAA 1IJ6A 1B8CA 1OSAA 2Y1NA 1TNQA 1XFXO 3GK2A 4I5LB 1M46A 4C0LA 1NPQA 1CDPA 2KDHA 1LA0A 3EK4A 3BOWA 1BODA 1K2HA 2JQ6A 3I5IB 1EXRA 2Q91A 3IQQA 4HRGA 4YGEB 2LANA 2BE6A 1W7IB 1S3PA 5ER4X 2JT3A 3VRNA 2K8MB 3CGAA 3KF9A 1C7VA 2MLFC 1SYMA 2KGRA 1UHJA 2IS9A 1XA5A 2HPSA 5KU1A 2F8PA 1RWYA 1ZMZA 1JWDA 3OB2B 2LMVA 1AHRA 1UHIA 5CPVA 2LHIA 1QXPA 3E3RA 3EVVA 3CR4X 2LE9B 4YGAA 1SK6D 1TTXA 1IH0A 1QV0A 1A75A 4DRWA 2LHLA 5HKWA 1IG5A 1NCZA 4YGDB 2L50A 3RM1A 2TN4A 1TNXA 1V1GA 3TDIA 1KFUS 2CT9A 2JC2A 3JVTC 1KK7Y 1B8LA 2EHBA 1AJ5A 1UP5A 1BLQA 3ZNIA 1IKUA 4CPVA 2WNDA 1NIWA 2A4JA 4N1FA 2L4IA 4IL1A 2FCEA 2AAOA 3CTNA 5ER5A 1SY9A 3PN7C 3SIAA 1CLBA 1FI5A 1CFCA 1SBJA 3JVTB 2JNXA 2KGBC 2E6WA 2LCPA 5G08A 3SJSA 1Y0VH 1QIVA 4DIRA 3CZTX 4A4BA 1DF0A 4OCIA 1QLSA 5KTYA 1NP8A 2ZN8A 1G8IA 3PN7B 5AFPA 2OS8C 2BECA 1DVIA 3NSKA 3LK1A 4GGFA 4PHKA 1DJYA 1Y1XA 1UUSA 1R2UA 2LMTA 4OKHA 1XFUO 2LP2A 2BCBA 5HLOA 4HSZA 1DJHA 2LUXA 1LVCD 2CCMA 1MHOA 3EVUA 1CFFA 1DGVA 1TCOB 3AKBA 2FCDA 2I94A 4NDDA 1DJZA 4PCWA 1TCFA 1J7PA 1M39A 2OTGC 1AK8A 3EK8A 2KI4C 4JPZB 5D7FA 5HKYA 2Y1MA 1EL4A 1GJYA 2EC6C 3RLZA 1KQVA 4PE4A 1F71A 4BY5A 2BKHB 4MZKA 2F3ZA 2PVBA 1LA3A 1G4YR 1UHKA 1XFWO 2G9BA 2BL0C 2OTGB 4ORCB 2K2AA 1CMFA 2ZRSA 1ALVA 2MAZA 1IQ3A 1SPYA 5CSFA 1YR5A 2KBIA 2EC6B 1OMDA 2WOSA 4PHJA 4PHNA 2ZN9A 3O4YA 4GPLB 1JC2A 1EJ3A 1BMOA 2EGDA 3LCPC 2LAPA 5D69A 2P6BB 2M7LA 1BF5A 1N0YA 2M7NA 5KSZA 1XK4A 4FQOA 2BL0B 1A75B 1S1EA 2I18A 3SIBA 1OMVA 2LM5A 3HX4A 5JJGA 2M3WA 1B9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF0 A;  1DJX A;  1CDN A;  2K0J A;  1CLM A;  2ZFD A;  1OE9 B;  1B47 A;  2PAL A;  1MUX A;  1WRZ A;  3CWG A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  4PE1 A;  4M2O A;  1ZUZ A;  2K7O A;  1M45 A;  2LMU A;  1ALW A;  5IBW A;  1RJV A;  1NX3 A;  2B1U A;  5FYX A;  2BKI B;  1DJW A;  1OMR A;  4QJ5 B;  2HQ8 A;  2K7D A;  2LV7 A;  2MBX A;  4F0Z B;  1TOP A;  2JPT A;  2KI6 D;  1K96 A;  5BPJ A;  4OR9 B;  1M31 A;  1CKK A;  1AJ4 A;  4WRI A;  2GGZ A;  3EKH A;  2LVI A;  1WY9 A;  4I5N B;  1MQ1 A;  1F54 A;  3VRQ A;  1DF0 B;  1SCM B;  2L5X B;  5J3X A;  2KYC A;  4HRE E;  1S6J A;  1Y6W A;  1AVS A;  1DMO A;  1TRF A;  4U8D A;  2KSP A;  1YTZ C;  1UWO A;  1SL7 A;  4CID A;  1QVI Y;  5AER A;  1DJI A;  4D1E A;  3I5H C;  2HF5 A;  2WCE A;  4A4C A;  1DGU A;  1CM1 A;  1QX5 B;  1C7W A;  5TNC A;  1RRO A;  3TS5 B;  1XO5 A;  1OQP A;  4N5X A;  4PHM A;  1ZAC A;  1BOC A;  1L7Z A;  1Y1U A;  1IGV A;  2KI6 C;  1UHN A;  2GGM A;  3O2P A;  2M0R A;  4WQ2 A;  1DT7 B;  1N2D A;  1QTX A;  1WRK A;  2SAS A;  2WCF A;  3I5H B;  4USL A;  3JTD B;  4C0K A;  2HQW A;  2CBL A;  3DVJ A;  1YX8 A;  2JXC A;  1B7T Y;  4QJ3 B;  2RGI A;  1KK8 B;  2JT8 A;  4PAL A;  3WHU B;  3IF7 A;  1PAL A;  2DOQ A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2K61 A;  1QX2 A;  2BBN A;  2H61 A;  2Y4Q A;  1YRT B;  1NUB A;  3EVR A;  3CS1 A;  4TNC A;  1JBA A;  3VRO A;  2H2K A;  3OX5 A;  3I5G C;  4Q04 A;  4YBH B;  3SG2 A;  4AQJ A;  3I5F B;  2FJU B;  2KAX A;  2KAY A;  4MBE A;  1B8R A;  1BR4 B;  5GQQ C;  1RTP 1;  4PE7 A;  1CFP A;  3M0W A;  3OP0 A;  4ZCU A;  2G2B A;  2NLN A;  1JF2 A;  5DKR A;  3WHT B;  1CMG A;  3NSL A;  2L4H A;  1Q80 A;  1MR8 A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  4GAO A;  1B4C A;  1NWD A;  2ZRT A;  4YI9 A;  1EG3 A;  1PSR A;  3C1V A;  3PFV A;  1ODB A;  1JF0 A;  4GGN A;  1ZOT B;  1DJG A;  4XJK B;  1NSH A;  3KO0 A;  4ZCV A;  5JOL A;  3VGO A;  3CR5 X;  1L2O B;  2JXL A;  2K7C A;  2M49 B;  2LVV A;  4NDC A;  3FS7 A;  3ZWH A;  3A8R A;  4GNK B;  1F55 A;  5B8I B;  1QLK A;  1H4B A;  1S5G Z;  3SG3 A;  1YUS A;  1YRU B;  3PAT A;  1EG4 A;  3BOW B;  1KSM A;  2PAS A;  2M97 A;  2LC5 A;  4OVN F;  1XFV O;  1YUT A;  4DCK A;  1FI6 A;  2SCP A;  1YVH A;  1GGW A;  2JTT A;  1J7O A;  1MWN A;  3PM8 A;  4ICB A;  2FOT A;  1J7Q A;  1F4Q A;  3KHE A;  1MXE A;  2I2R E;  4MN0 A;  4P2Y B;  1K94 A;  1CDL A;  2PSR A;  1JUO A;  1EH2 A;  5HYD A;  1FPW A;  1TNP A;  5F6T A;  2WC8 A;  2LUC A;  4XYN A;  3TDU A;  3KEV A;  1N65 A;  2M1K B;  4AQI A;  1PVA A;  1NCX A;  1CB1 A;  1JFK A;  4I5J A;  1QAT A;  1U5I A;  5CSN A;  1WLZ A;  1FW4 A;  2V53 A;  4MVF A;  2F33 A;  2VRG A;  3EK7 A;  5CSJ A;  1TIZ A;  2K7B A;  3AAK A;  3BUM B;  5I2Q A;  3OX6 A;  5AXI A;  4NQG A;  1KWO B;  1VRK A;  2MJW B;  4AOM A;  4YRU A;  2ISD A;  4ORB B;  1OOJ A;  2MRD A;  1K95 A;  1MF8 B;  1NCY A;  4YGC B;  1S36 A;  2KFH A;  1J1E A;  2LLU A;  2ZKM X;  5K89 A;  1H8B A;  2KQ6 A;  1RK9 A;  1SCM C;  1WRL A;  2AMI A;  1PRW A;  3PAL A;  2F2O A;  3PLF B;  2L51 A;  1SR6 C;  1YUR A;  1SNL A;  4HRH A;  4DS7 A;  1IJ5 A;  1K9P A;  1F4O A;  1KK7 Z;  1M63 B;  2F2P A;  3FWB A;  2MA2 A;  4QJ4 B;  3TUY C;  1LIN A;  4GGF C;  2LVK A;  3K21 A;  4NDB A;  1C07 A;  3DD4 A;  2GV5 A;  1KFX S;  2F3Y A;  2KFF A;  1KCY A;  3A4U B;  3TS5 C;  4MRX A;  2LP3 A;  1NX1 A;  5CSI A;  1SR6 B;  3F45 A;  4ORA B;  2QAC A;  1BJF A;  3TUY B;  2PRU A;  2L0P A;  1CDM A;  3KPX A;  1GQM A;  1KFX L;  1SCV A;  3SG4 A;  1K9K A;  1LKJ A;  1PSB A;  5DKN A;  4CLN A;  1BU3 A;  2JU0 A;  3JTD C;  3GOF A;  1CTR A;  4E68 A;  2JNF A;  2KAV A;  1QAS A;  2NZ0 A;  2KOT A;  1KK8 C;  1K9U A;  1PVB A;  4CFQ A;  1KQM C;  4MZJ A;  2KNE A;  1A03 A;  2JUL A;  3NSI A;  1B1G A;  1SL9 A;  1CNP A;  3TDZ A;  1A2X A;  1J7R A;  1WDC C;  1G33 A;  2LNK A;  3O78 A;  1SRA A;  3AAJ A;  3I5F C;  1IQ5 A;  1QX7 A;  1GGZ A;  2KQY A;  2K2F A;  3PSR A;  1TNW A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  2ZNE A;  1PK0 D;  3BUN B;  3TZ1 A;  2HET A;  1XK4 C;  3QRX A;  1J1D A;  2NCP A;  2O60 A;  1WDC B;  2NCO A;  1PUL A;  1V1F A;  2R2I A;  3CLN A;  2M9G A;  2LVJ A;  3D0Y A;  1QV1 A;  1JFJ A;  4MEW A;  1XFZ O;  3CR2 A;  2NXQ A;  2JRF A;  4BY4 A;  5AEQ A;  2JTZ A;  2O5G A;  1QS7 A;  2WOR A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1U5I B;  2LLT A;  4PE0 A;  1D1O A;  1UUR A;  2QPT A;  2KBM A;  4N1G A;  3BXK A;  4R1E A;  1Y1A A;  1YX7 A;  1L2O C;  2JOJ A;  1QIW A;  4DUQ A;  3HCM A;  3OB1 B;  3DF0 B;  4MZL A;  2CNP A;  1DTL A;  5I2L A;  2BCX A;  1NX0 A;  1KFU L;  5I2O A;  3VRR A;  1SKT A;  1X02 A;  5HLV A;  1R6P A;  2BE4 A;  4JQ0 D;  1CLL A;  4ETO A;  1BG1 A;  2CXJ A;  1W7J B;  2JZI A;  2KHN A;  1SL8 A;  3LK0 A;  4YGB B;  3NXA A;  3GK1 A;  4JWQ A;  2M1U A;  4GFT A;  2ZND A;  3O6B A;  1LXF C;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3FIA A;  4FTG A;  1HQV A;  2JT0 A;  1REC A;  3MSE B;  3IQO A;  4MSP A;  4GBA A;  5HKZ A;  3BUO B;  1FF1 A;  3LL8 B;  5I8N A;  2OS8 B;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  1TN4 A;  1FBV A;  2BCA A;  1UHH A;  2L98 A;  4WQ3 A;  1KWO C;  1IRJ A;  1XYD A;  1K90 D;  1OZS A;  1ZFS A;  3FWC A;  1F70 A;  2AUC A;  3ICB A;  2Y5I A;  1YUU A;  4OV2 A;  2E30 A;  2JWW A;  1S6I A;  4CFR A;  1QVI Z;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  2L2E A;  1A4P A;  1K8U A;  1NX2 A;  1SW8 A;  3H4S E;  4M2Q A;  4UPG A;  3DVK A;  2H61 C;  2M8U A;  1QJT A;  2D8N A;  1NYA A;  1AUI B;  2KI4 B;  2OPO A;  3BYA A;  3OHM B;  1XVJ A;  1SMG A;  4M2P A;  1IWQ A;  1S26 D;  2MHH A;  3DVE A;  3SG5 A;  3WNX B;  4MLW A;  1F8H A;  3VRP A;  2MLE C;  2PMY A;  2LLS A;  1J55 A;  1OZO A;  4L9M A;  1WLM A;  1CFD A;  4PDZ A;  1A29 A;  3D0Y B;  2M29 A;  1B7T Z;  2Q4U A;  1MXL C;  3D10 A;  3BUW B;  1KSO A;  1XFY O;  3EKJ A;  4YI8 A;  1E8A A;  3SG6 A;  3LLE A;  1S5G Y;  3I5I C;  1BR1 B;  1BT6 A;  2CTN A;  3AKA A;  1IJ6 A;  1B8C A;  1OSA A;  2Y1N A;  1TNQ A;  1XFX O;  3GK2 A;  4I5L B;  1M46 A;  4C0L A;  1NPQ A;  1CDP A;  2KDH A;  1LA0 A;  3EK4 A;  3BOW A;  1BOD A;  1K2H A;  2JQ6 A;  3I5I B;  1EXR A;  2Q91 A;  3IQQ A;  4HRG A;  4YGE B;  2LAN A;  2BE6 A;  1W7I B;  1S3P A;  5ER4 X;  2JT3 A;  3VRN A;  2K8M B;  3CGA A;  3KF9 A;  1C7V A;  2MLF C;  1SYM A;  2KGR A;  1UHJ A;  2IS9 A;  1XA5 A;  2HPS A;  5KU1 A;  2F8P A;  1RWY A;  1ZMZ A;  1JWD A;  3OB2 B;  2LMV A;  1AHR A;  1UHI A;  5CPV A;  2LHI A;  1QXP A;  3E3R A;  3EVV A;  3CR4 X;  2LE9 B;  4YGA A;  1SK6 D;  1TTX A;  1IH0 A;  1QV0 A;  1A75 A;  4DRW A;  2LHL A;  5HKW A;  1IG5 A;  1NCZ A;  4YGD B;  2L50 A;  3RM1 A;  2TN4 A;  1TNX A;  1V1G A;  3TDI A;  1KFU S;  2CT9 A;  2JC2 A;  3JVT C;  1KK7 Y;  1B8L A;  2EHB A;  1AJ5 A;  1UP5 A;  1BLQ A;  3ZNI A;  1IKU A;  4CPV A;  2WND A;  1NIW A;  2A4J A;  4N1F A;  2L4I A;  4IL1 A;  2FCE A;  2AAO A;  3CTN A;  5ER5 A;  1SY9 A;  3PN7 C;  3SIA A;  1CLB A;  1FI5 A;  1CFC A;  1SBJ A;  3JVT B;  2JNX A;  2KGB C;  2E6W A;  2LCP A;  5G08 A;  3SJS A;  1Y0V H;  1QIV A;  4DIR A;  3CZT X;  4A4B A;  1DF0 A;  4OCI A;  1QLS A;  5KTY A;  1NP8 A;  2ZN8 A;  1G8I A;  3PN7 B;  5AFP A;  2OS8 C;  2BEC A;  1DVI A;  3NSK A;  3LK1 A;  4GGF A;  4PHK A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  2LMT A;  4OKH A;  1XFU O;  2LP2 A;  2BCB A;  5HLO A;  4HSZ A;  1DJH A;  2LUX A;  1LVC D;  2CCM A;  1MHO A;  3EVU A;  1CFF A;  1DGV A;  1TCO B;  3AKB A;  2FCD A;  2I94 A;  4NDD A;  1DJZ A;  4PCW A;  1TCF A;  1J7P A;  1M39 A;  2OTG C;  1AK8 A;  3EK8 A;  2KI4 C;  4JPZ B;  5D7F A;  5HKY A;  2Y1M A;  1EL4 A;  1GJY A;  2EC6 C;  3RLZ A;  1KQV A;  4PE4 A;  1F71 A;  4BY5 A;  2BKH B;  4MZK A;  2F3Z A;  2PVB A;  1LA3 A;  1G4Y R;  1UHK A;  1XFW O;  2G9B A;  2BL0 C;  2OTG B;  4ORC B;  2K2A A;  1CMF A;  2ZRS A;  1ALV A;  2MAZ A;  1IQ3 A;  1SPY A;  5CSF A;  1YR5 A;  2KBI A;  2EC6 B;  1OMD A;  2WOS A;  4PHJ A;  4PHN A;  2ZN9 A;  3O4Y A;  4GPL B;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  3LCP C;  2LAP A;  5D69 A;  2P6B B;  2M7L A;  1BF5 A;  1N0Y A;  2M7N A;  5KSZ A;  1XK4 A;  4FQO A;  2BL0 B;  1A75 B;  1S1E A;  2I18 A;  3SIB A;  1OMV A;  2LM5 A;  3HX4 A;  5JJG A;  2M3W A;  1B9A A; 
#chains in the Genus database with same CATH topology
 3DF0 A;  1DJX A;  1CDN A;  2K0J A;  1CLM A;  2ZFD A;  1OE9 B;  1B47 A;  2PAL A;  1MUX A;  1WRZ A;  3CWG A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  4PE1 A;  4M2O A;  1ZUZ A;  2K7O A;  1M45 A;  2LMU A;  1ALW A;  5IBW A;  1RJV A;  5I94 A;  1NX3 A;  1W9Z A;  2B1U A;  2BKI B;  5FYX A;  1DJW A;  4JD9 A;  1OMR A;  4QJ5 B;  2HQ8 A;  2K7D A;  2LV7 A;  2MBX A;  4F0Z B;  1TOP A;  2JPT A;  2KI6 D;  2BNX A;  1K96 A;  5BPJ A;  5HL1 A;  3CAB A;  4OR9 B;  1M31 A;  1CKK A;  1AJ4 A;  4WRI A;  2GGZ A;  3EKH A;  2LVI A;  1WY9 A;  4I5N B;  1MQ1 A;  1F54 A;  3VRQ A;  1DF0 B;  1SCM B;  2L5X B;  3R1P A;  5J3X A;  2KYC A;  4HRE E;  3DZT A;  1S6J A;  1Y6W A;  1AVS A;  1DMO A;  1TRF A;  4U8D A;  2KSP A;  1YTZ C;  1LS8 A;  1UWO A;  1SL7 A;  4CID A;  1QVI Y;  2BAP A;  3B88 A;  5AER A;  1DJI A;  4D1E A;  3I5H C;  2HF5 A;  2JPO A;  2WCE A;  1DGU A;  1CM1 A;  1QX5 B;  1Z4H A;  4A4C A;  1C7W A;  5TNC A;  1RRO A;  3TS5 B;  1XO5 A;  1DC1 A;  1T14 A;  1OQP A;  4N5X A;  4PHM A;  1ZAC A;  4M2P A;  1BOC A;  1L7Z A;  1Y1U A;  3DY9 A;  1IGV A;  2KI6 C;  4FQT A;  1UHN A;  2GGM A;  3O2P A;  2M0R A;  4WQ2 A;  1DT7 B;  1N2D A;  1QTX A;  1WRK A;  2SAS A;  2WCF A;  3I5H B;  4USL A;  3JTD B;  4C0K A;  2HQW A;  2CBL A;  3DVJ A;  1YX8 A;  2JXC A;  1B7T Y;  4QJ3 B;  2RGI A;  1KK8 B;  1DEL A;  2JT8 A;  3D75 A;  4PAL A;  3IF7 A;  3WHU B;  1PAL A;  2DOQ A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2K61 A;  1QX2 A;  2BBN A;  2H61 A;  2Y4Q A;  1YRT B;  1NUB A;  3EVR A;  3OBV A;  3CS1 A;  4TNC A;  1JBA A;  3VRO A;  2H2K A;  3OX5 A;  3I5G C;  4Q04 A;  4YBH B;  3SG2 A;  4AQJ A;  3I5F B;  2FJU B;  2KAX A;  3QME A;  2KAY A;  4MBE A;  1B8R A;  1BR4 B;  5GQQ C;  1RTP 1;  4PE7 A;  1CFP A;  3M0W A;  3OP0 A;  4ZCU A;  2G2B A;  2NLN A;  1JF2 A;  5DKR A;  3WHT B;  1CMG A;  1ORG A;  2L4H A;  3NSL A;  1Q80 A;  1MR8 A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  4GAO A;  1B4C A;  4KYN A;  1NWD A;  2ZRT A;  4YI9 A;  1EG3 A;  1PSR A;  3C1V A;  3PFV A;  1ODB A;  1JF0 A;  3L4A A;  4GGN A;  1ZOT B;  1DJG A;  4XJK B;  1NSH A;  3KO0 A;  4ZCV A;  5JOL A;  3VGO A;  3CR5 X;  1L2O B;  2JXL A;  2K7C A;  2M49 B;  2LVV A;  4NDC A;  3FS7 A;  3DYE A;  4JKT A;  3ZWH A;  3A8R A;  4GNK B;  1F55 A;  5B8I B;  1QLK A;  1H4B A;  1S5G Z;  3SG3 A;  1YUS A;  1YRU B;  3PAT A;  1EG4 A;  3BOW B;  1KSM A;  2PAS A;  2M97 A;  2LC5 A;  4OVN F;  1XFV O;  1YUT A;  4DCK A;  1FI6 A;  2SCP A;  1YVH A;  3NGV A;  2JTT A;  1J7O A;  1MWN A;  1GGW A;  3PM8 A;  4ICB A;  2FOT A;  1J7Q A;  3N7H A;  1F4Q A;  3KHE A;  1MXE A;  2I2R E;  4MN0 A;  4P2Y B;  1K94 A;  1CDL A;  2PSR A;  2K60 A;  1JUO A;  1EH2 A;  5HYD A;  1FPW A;  1TNP A;  5F6T A;  2WC8 A;  2LUC A;  1QWV A;  4XYN A;  3TDU A;  3KEV A;  1N65 A;  2M1K B;  4AQI A;  1PVA A;  3S0F A;  1NCX A;  1CB1 A;  1JFK A;  4I5J A;  1QAT A;  1U5I A;  5CSN A;  1WLZ A;  1FW4 A;  2V53 A;  4MVF A;  2F33 A;  2VRG A;  3EK7 A;  5CSJ A;  1TIZ A;  2K7B A;  3AAK A;  3BUM B;  5I2Q A;  3OX6 A;  5AXI A;  4NQG A;  1KWO B;  1VRK A;  2QDI A;  2MJW B;  4AOM A;  4YRU A;  2PYQ A;  2ISD A;  4ORB B;  1OOJ A;  2MRD A;  1K95 A;  1OOI X;  1MF8 B;  1NCY A;  4YGC B;  1S36 A;  2KFH A;  1J1E A;  2LLU A;  1TUZ A;  2WCM A;  2ZKM X;  5K89 A;  1H8B A;  2KQ6 A;  1OOH A;  1RK9 A;  1SCM C;  1WRL A;  1PRW A;  2AMI A;  3PAL A;  2F2O A;  3PLF B;  2L51 A;  1SR6 C;  1YUR A;  1SNL A;  3R1O A;  4HRH A;  4DS7 A;  1IJ5 A;  1K9P A;  1F4O A;  1KK7 Z;  1M63 B;  2F2P A;  3FWB A;  2MA2 A;  4QJ4 B;  3TUY C;  1LIN A;  4GGF C;  1SSE B;  2LVK A;  3D77 A;  3K21 A;  4NDB A;  1C07 A;  3DD4 A;  2GV5 A;  1KFX S;  3D76 A;  2F3Y A;  2KFF A;  1KCY A;  3A4U B;  3TS5 C;  4MRX A;  2LP3 A;  3PJI A;  3IVT A;  1NX1 A;  2WCJ A;  5CSI A;  1SR6 B;  2WCL A;  3Q8I A;  3F45 A;  4ORA B;  2QAC A;  1BJF A;  3TUY B;  2PRU A;  2L0P A;  1CDM A;  3KPX A;  3R72 A;  1GQM A;  1KFX L;  1SCV A;  3SG4 A;  1K9K A;  1LKJ A;  1PSB A;  5DKN A;  4CLN A;  1BU3 A;  2JU0 A;  3JTD C;  3GOF A;  3R1V A;  1CTR A;  4E68 A;  2JNF A;  2KAV A;  1QAS A;  2NZ0 A;  2KOT A;  1KK8 C;  1K9U A;  1PVB A;  4CFQ A;  1KQM C;  4MZJ A;  2KNE A;  1A03 A;  2JUL A;  3NSI A;  1B1G A;  2QEO A;  1TUJ A;  1SL9 A;  3PM2 A;  1CNP A;  3TDZ A;  1A2X A;  1J7R A;  1WDC C;  1G33 A;  3S0B A;  2LNK A;  3O78 A;  1SRA A;  3AAJ A;  3I5F C;  1IQ5 A;  1QX7 A;  1GGZ A;  2KQY A;  2P71 A;  3BFH A;  2K2F A;  3NHT A;  1TNW A;  3PSR A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  2ZNE A;  1PK0 D;  3BUN B;  3TZ1 A;  2HET A;  1XK4 C;  3QRX A;  1J1D A;  2NCP A;  2O60 A;  1WDC B;  2NCO A;  1PUL A;  1V1F A;  2R2I A;  3CLN A;  2M9G A;  2LVJ A;  3D0Y A;  1QV1 A;  1JFJ A;  3DXL A;  1XFZ O;  4MEW A;  3CR2 A;  2NXQ A;  2JRF A;  4BY4 A;  5AEQ A;  2JTZ A;  2O5G A;  1QS7 A;  2WOR A;  5FI6 A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1U5I B;  2LLT A;  2KLE A;  2QEB A;  1UUR A;  4PE0 A;  1D1O A;  2QPT A;  5FI7 A;  2KBM A;  4N1G A;  3BXK A;  4R1E A;  1Y1A A;  1YX7 A;  1L2O C;  2JOJ A;  1QIW A;  4DUQ A;  3HCM A;  3OB1 B;  3DF0 B;  4MZL A;  2CNP A;  1DTL A;  5I2L A;  2GTE A;  2BCX A;  1NX0 A;  1KFU L;  3O4X A;  5I2O A;  3D74 A;  3CZ1 A;  1DEK A;  3VRR A;  1SKT A;  1X02 A;  5HLV A;  3UNW A;  1R6P A;  2BE4 A;  3B87 A;  2WC6 A;  3D73 A;  3FE6 A;  1CLL A;  4JQ0 D;  4ETO A;  2KPH A;  1BG1 A;  2CXJ A;  3OGN A;  1W7J B;  2JZI A;  2KHN A;  1SL8 A;  3LK0 A;  4YGB B;  2QEV A;  3NXA A;  3GK1 A;  4JWQ A;  2M1U A;  4GFT A;  2ZND A;  3O6B A;  1LXF C;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3CZ0 A;  3FIA A;  4FTG A;  1HQV A;  2JT0 A;  1REC A;  2PQL A;  3IQO A;  3MSE B;  4GBA A;  4MSP A;  1OOF A;  5HKZ A;  3BUO B;  3UO9 A;  3LL8 B;  1FF1 A;  5I8N A;  2OS8 B;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  4INW A;  1TN4 A;  1FBV A;  1UHH A;  2BCA A;  2L98 A;  3FE9 A;  1KWO C;  2WCK A;  1IRJ A;  1XYD A;  1K90 D;  1OZS A;  1ZFS A;  3FWC A;  2WCH A;  1F70 A;  2AUC A;  4WQ3 A;  3ICB A;  2Y5I A;  1YUU A;  4OV2 A;  2E30 A;  2JWW A;  1S6I A;  3S0E A;  4PT1 A;  4CFR A;  1QVI Z;  3S0A A;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  2L2E A;  1A4P A;  1K8U A;  1NX2 A;  1SW8 A;  3H4S E;  4M2Q A;  4UPG A;  3CZ2 A;  3DVK A;  3V2L A;  4F7F A;  2H61 C;  2M8U A;  1QJT A;  2D8N A;  1NYA A;  1AUI B;  2KI4 B;  2OPO A;  3B6X A;  3BYA A;  1XVJ A;  1SMG A;  3OHM B;  1IWQ A;  1S26 D;  2MHH A;  3DVE A;  3SG5 A;  3WNX B;  4MLW A;  1F8H A;  1IIO A;  3VRP A;  2P70 A;  2MLE C;  5D3O A;  3CDN A;  2PMY A;  2LLS A;  1J55 A;  1OZO A;  4L9M A;  1WLM A;  1CFD A;  4PDZ A;  3B7A A;  1A29 A;  3D0Y B;  2M29 A;  1B7T Z;  2Q4U A;  3SS3 A;  1MXL C;  3D10 A;  3BUW B;  1KSO A;  1XFY O;  3EKJ A;  4YI8 A;  3B86 A;  1E8A A;  2L2C A;  3SG6 A;  3LLE A;  1S5G Y;  3I5I C;  1BR1 B;  1BT6 A;  2CTN A;  3AKA A;  1IJ6 A;  1B8C A;  1OSA A;  2Y1N A;  1TNQ A;  1XFX O;  1DQE A;  3GK2 A;  4I5L B;  1M46 A;  4C0L A;  1NPQ A;  1CDP A;  2KDH A;  1LA0 A;  2H8V A;  3BOW A;  3EK4 A;  1TWO A;  2JQ6 A;  3I5I B;  1EXR A;  1BOD A;  1K2H A;  2Q91 A;  3IQQ A;  4HRG A;  4YGE B;  2LAN A;  2BE6 A;  1W7I B;  1S3P A;  5ER4 X;  4IJ7 A;  2JT3 A;  3VRN A;  2K8M B;  3CGA A;  3KF9 A;  3D78 A;  1C7V A;  2MLF C;  1SYM A;  2KGR A;  1UHJ A;  2IS9 A;  1XA5 A;  2HPS A;  3SS5 A;  5KU1 A;  2F8P A;  1RWY A;  1ZMZ A;  1JWD A;  3OB2 B;  2LMV A;  1AHR A;  1UHI A;  5CPV A;  3RZS A;  2LHI A;  1QXP A;  3E3R A;  3EVV A;  3VB1 A;  3CR4 X;  2LE9 B;  4YGA A;  1SK6 D;  1TTX A;  1IH0 A;  1QV0 A;  1A75 A;  4DRW A;  2LHL A;  5HKW A;  1IG5 A;  1NCZ A;  4YGD B;  1P28 A;  2L50 A;  2KLD A;  3RM1 A;  2TN4 A;  1TNX A;  1V1G A;  3TDI A;  1KFU S;  2CT9 A;  2JC2 A;  3JVT C;  1KK7 Y;  1B8L A;  1C3Z A;  2EHB A;  1AJ5 A;  1UP5 A;  1BLQ A;  3ZNI A;  1IKU A;  4CPV A;  5DIC A;  2WND A;  2WC5 A;  1NIW A;  2A4J A;  4N1F A;  2L4I A;  4IL1 A;  2FCE A;  2AAO A;  4OZD A;  3CTN A;  5ER5 A;  1SY9 A;  3PN7 C;  3SIA A;  1CLB A;  1FI5 A;  3L47 A;  1CFC A;  1SBJ A;  3JVT B;  2JNX A;  2KGB C;  2E6W A;  2LCP A;  3EG5 B;  5G08 A;  3SJS A;  1Y0V H;  1QIV A;  4DIR A;  3CZT X;  4A4B A;  1DF0 A;  4OCI A;  1QLS A;  5KTY A;  2YGU A;  3BJH A;  1NP8 A;  3NHI A;  2ZN8 A;  1GM0 A;  1XFR A;  1G8I A;  3PN7 B;  1OW4 A;  5AFP A;  2OS8 C;  2BEC A;  1DVI A;  3NSK A;  3LK1 A;  4GGF A;  4PHK A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  2LMT A;  4OKH A;  1XFU O;  2LP2 A;  2BCB A;  5HLO A;  4HSZ A;  1DJH A;  2LUX A;  1LVC D;  2CCM A;  1MHO A;  3EVU A;  1CFF A;  1DGV A;  1TCO B;  3AKB A;  2FCD A;  2I94 A;  4NDD A;  1DJZ A;  4PCW A;  1TCF A;  1J7P A;  1M39 A;  2OTG C;  1AK8 A;  2L5Y A;  3EK8 A;  2KI4 C;  4JPZ B;  5D7F A;  5HKY A;  2Y1M A;  1EL4 A;  1GJY A;  2ERB A;  3BFA A;  2EC6 C;  3RLZ A;  5EL2 A;  1KQV A;  4PE4 A;  1F71 A;  4BY5 A;  2BKH B;  4MZK A;  2F3Z A;  2PVB A;  1LA3 A;  1G4Y R;  1UHK A;  1XFW O;  2G9B A;  3CYZ A;  3SS4 A;  3S0G A;  2BL0 C;  2OTG B;  1C3Y A;  4INX A;  4ORC B;  2K2A A;  1CMF A;  1OOG A;  2ZRS A;  1ALV A;  2MAZ A;  1IQ3 A;  1SPY A;  2FJY A;  2QEH A;  3FE8 A;  5CSF A;  1YR5 A;  2KBI A;  2EC6 B;  1OMD A;  2WOS A;  3BFB A;  4PHJ A;  4PHN A;  2ZN9 A;  3O4Y A;  3L4L A;  4GPL B;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  3LCP C;  2LAP A;  3K1E A;  5D69 A;  2P6B B;  2M7L A;  1BF5 A;  1N0Y A;  2M7N A;  5KSZ A;  1XK4 A;  4FQO A;  2BL0 B;  1A75 B;  1S1E A;  2I18 A;  3SIB A;  1OMV A;  2LM5 A;  3HX4 A;  5FI2 A;  3S0D A;  2M3W A;  1Z2C B;  5JJG A;  1B9A A; 
#chains in the Genus database with same CATH homology
 3DF0 A;  1DJX A;  1CDN A;  2K0J A;  1CLM A;  2ZFD A;  1OE9 B;  1B47 A;  2PAL A;  1MUX A;  1WRZ A;  3CWG A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  4PE1 A;  4M2O A;  1ZUZ A;  2K7O A;  1M45 A;  2LMU A;  1ALW A;  5IBW A;  1RJV A;  1NX3 A;  2B1U A;  5FYX A;  2BKI B;  1DJW A;  1OMR A;  4QJ5 B;  2HQ8 A;  2K7D A;  2LV7 A;  2MBX A;  4F0Z B;  1TOP A;  2JPT A;  2KI6 D;  1K96 A;  5BPJ A;  4OR9 B;  1M31 A;  1CKK A;  1AJ4 A;  4WRI A;  2GGZ A;  3EKH A;  2LVI A;  1WY9 A;  4I5N B;  1MQ1 A;  1F54 A;  3VRQ A;  1DF0 B;  1SCM B;  2L5X B;  5J3X A;  2KYC A;  4HRE E;  1S6J A;  1Y6W A;  1AVS A;  1DMO A;  1TRF A;  4U8D A;  2KSP A;  1YTZ C;  1UWO A;  1SL7 A;  4CID A;  1QVI Y;  5AER A;  1DJI A;  4D1E A;  3I5H C;  2HF5 A;  2WCE A;  4A4C A;  1DGU A;  1CM1 A;  1QX5 B;  1C7W A;  5TNC A;  1RRO A;  3TS5 B;  1XO5 A;  1OQP A;  4N5X A;  4PHM A;  1ZAC A;  1BOC A;  1L7Z A;  1Y1U A;  1IGV A;  2KI6 C;  1UHN A;  2GGM A;  3O2P A;  2M0R A;  4WQ2 A;  1DT7 B;  1N2D A;  1QTX A;  1WRK A;  2SAS A;  2WCF A;  3I5H B;  4USL A;  3JTD B;  4C0K A;  2HQW A;  2CBL A;  3DVJ A;  1YX8 A;  2JXC A;  1B7T Y;  4QJ3 B;  2RGI A;  1KK8 B;  2JT8 A;  4PAL A;  3WHU B;  3IF7 A;  1PAL A;  2DOQ A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2K61 A;  1QX2 A;  2BBN A;  2H61 A;  2Y4Q A;  1YRT B;  1NUB A;  3EVR A;  3CS1 A;  4TNC A;  1JBA A;  3VRO A;  2H2K A;  3OX5 A;  3I5G C;  4Q04 A;  4YBH B;  3SG2 A;  4AQJ A;  3I5F B;  2FJU B;  2KAX A;  2KAY A;  4MBE A;  1B8R A;  1BR4 B;  5GQQ C;  1RTP 1;  4PE7 A;  1CFP A;  3M0W A;  3OP0 A;  4ZCU A;  2G2B A;  2NLN A;  1JF2 A;  5DKR A;  3WHT B;  1CMG A;  3NSL A;  2L4H A;  1Q80 A;  1MR8 A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  4GAO A;  1B4C A;  1NWD A;  2ZRT A;  4YI9 A;  1EG3 A;  1PSR A;  3C1V A;  3PFV A;  1ODB A;  1JF0 A;  4GGN A;  1ZOT B;  1DJG A;  4XJK B;  1NSH A;  3KO0 A;  4ZCV A;  5JOL A;  3VGO A;  3CR5 X;  1L2O B;  2JXL A;  2K7C A;  2M49 B;  2LVV A;  4NDC A;  3FS7 A;  3ZWH A;  3A8R A;  4GNK B;  1F55 A;  5B8I B;  1QLK A;  1H4B A;  1S5G Z;  3SG3 A;  1YUS A;  1YRU B;  3PAT A;  1EG4 A;  3BOW B;  1KSM A;  2PAS A;  2M97 A;  2LC5 A;  4OVN F;  1XFV O;  1YUT A;  4DCK A;  1FI6 A;  2SCP A;  1YVH A;  1GGW A;  2JTT A;  1J7O A;  1MWN A;  3PM8 A;  4ICB A;  2FOT A;  1J7Q A;  1F4Q A;  3KHE A;  1MXE A;  2I2R E;  4MN0 A;  4P2Y B;  1K94 A;  1CDL A;  2PSR A;  1JUO A;  1EH2 A;  5HYD A;  1FPW A;  1TNP A;  5F6T A;  2WC8 A;  2LUC A;  4XYN A;  3TDU A;  3KEV A;  1N65 A;  2M1K B;  4AQI A;  1PVA A;  1NCX A;  1CB1 A;  1JFK A;  4I5J A;  1QAT A;  1U5I A;  5CSN A;  1WLZ A;  1FW4 A;  2V53 A;  4MVF A;  2F33 A;  2VRG A;  3EK7 A;  5CSJ A;  1TIZ A;  2K7B A;  3AAK A;  3BUM B;  5I2Q A;  3OX6 A;  5AXI A;  4NQG A;  1KWO B;  1VRK A;  2MJW B;  4AOM A;  4YRU A;  2ISD A;  4ORB B;  1OOJ A;  2MRD A;  1K95 A;  1MF8 B;  1NCY A;  4YGC B;  1S36 A;  2KFH A;  1J1E A;  2LLU A;  2ZKM X;  5K89 A;  1H8B A;  2KQ6 A;  1RK9 A;  1SCM C;  1WRL A;  2AMI A;  1PRW A;  3PAL A;  2F2O A;  3PLF B;  2L51 A;  1SR6 C;  1YUR A;  1SNL A;  4HRH A;  4DS7 A;  1IJ5 A;  1K9P A;  1F4O A;  1KK7 Z;  1M63 B;  2F2P A;  3FWB A;  2MA2 A;  4QJ4 B;  3TUY C;  1LIN A;  4GGF C;  2LVK A;  3K21 A;  4NDB A;  1C07 A;  3DD4 A;  2GV5 A;  1KFX S;  2F3Y A;  2KFF A;  1KCY A;  3A4U B;  3TS5 C;  4MRX A;  2LP3 A;  1NX1 A;  5CSI A;  1SR6 B;  3F45 A;  4ORA B;  2QAC A;  1BJF A;  3TUY B;  2PRU A;  2L0P A;  1CDM A;  3KPX A;  1GQM A;  1KFX L;  1SCV A;  3SG4 A;  1K9K A;  1LKJ A;  1PSB A;  5DKN A;  4CLN A;  1BU3 A;  2JU0 A;  3JTD C;  3GOF A;  1CTR A;  4E68 A;  2JNF A;  2KAV A;  1QAS A;  2NZ0 A;  2KOT A;  1KK8 C;  1K9U A;  1PVB A;  4CFQ A;  1KQM C;  4MZJ A;  2KNE A;  1A03 A;  2JUL A;  3NSI A;  1B1G A;  1SL9 A;  1CNP A;  3TDZ A;  1A2X A;  1J7R A;  1WDC C;  1G33 A;  2LNK A;  3O78 A;  1SRA A;  3AAJ A;  3I5F C;  1IQ5 A;  1QX7 A;  1GGZ A;  2KQY A;  2K2F A;  3PSR A;  1TNW A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  2ZNE A;  1PK0 D;  3BUN B;  3TZ1 A;  2HET A;  1XK4 C;  3QRX A;  1J1D A;  2NCP A;  2O60 A;  1WDC B;  2NCO A;  1PUL A;  1V1F A;  2R2I A;  3CLN A;  2M9G A;  2LVJ A;  3D0Y A;  1QV1 A;  1JFJ A;  4MEW A;  1XFZ O;  3CR2 A;  2NXQ A;  2JRF A;  4BY4 A;  5AEQ A;  2JTZ A;  2O5G A;  1QS7 A;  2WOR A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1U5I B;  2LLT A;  4PE0 A;  1D1O A;  1UUR A;  2QPT A;  2KBM A;  4N1G A;  3BXK A;  4R1E A;  1Y1A A;  1YX7 A;  1L2O C;  2JOJ A;  1QIW A;  4DUQ A;  3HCM A;  3OB1 B;  3DF0 B;  4MZL A;  2CNP A;  1DTL A;  5I2L A;  2BCX A;  1NX0 A;  1KFU L;  5I2O A;  3VRR A;  1SKT A;  1X02 A;  5HLV A;  1R6P A;  2BE4 A;  4JQ0 D;  1CLL A;  4ETO A;  1BG1 A;  2CXJ A;  1W7J B;  2JZI A;  2KHN A;  1SL8 A;  3LK0 A;  4YGB B;  3NXA A;  3GK1 A;  4JWQ A;  2M1U A;  4GFT A;  2ZND A;  3O6B A;  1LXF C;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3FIA A;  4FTG A;  1HQV A;  2JT0 A;  1REC A;  3MSE B;  3IQO A;  4MSP A;  4GBA A;  5HKZ A;  3BUO B;  1FF1 A;  3LL8 B;  5I8N A;  2OS8 B;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  1TN4 A;  1FBV A;  2BCA A;  1UHH A;  2L98 A;  4WQ3 A;  1KWO C;  1IRJ A;  1XYD A;  1K90 D;  1OZS A;  1ZFS A;  3FWC A;  1F70 A;  2AUC A;  3ICB A;  2Y5I A;  1YUU A;  4OV2 A;  2E30 A;  2JWW A;  1S6I A;  4CFR A;  1QVI Z;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  2L2E A;  1A4P A;  1K8U A;  1NX2 A;  1SW8 A;  3H4S E;  4M2Q A;  4UPG A;  3DVK A;  2H61 C;  2M8U A;  1QJT A;  2D8N A;  1NYA A;  1AUI B;  2KI4 B;  2OPO A;  3BYA A;  3OHM B;  1XVJ A;  1SMG A;  4M2P A;  1IWQ A;  1S26 D;  2MHH A;  3DVE A;  3SG5 A;  3WNX B;  4MLW A;  1F8H A;  3VRP A;  2MLE C;  2PMY A;  2LLS A;  1J55 A;  1OZO A;  4L9M A;  1WLM A;  1CFD A;  4PDZ A;  1A29 A;  3D0Y B;  2M29 A;  1B7T Z;  2Q4U A;  1MXL C;  3D10 A;  3BUW B;  1KSO A;  1XFY O;  3EKJ A;  4YI8 A;  1E8A A;  3SG6 A;  3LLE A;  1S5G Y;  3I5I C;  1BR1 B;  1BT6 A;  2CTN A;  3AKA A;  1IJ6 A;  1B8C A;  1OSA A;  2Y1N A;  1TNQ A;  1XFX O;  3GK2 A;  4I5L B;  1M46 A;  4C0L A;  1NPQ A;  1CDP A;  2KDH A;  1LA0 A;  3EK4 A;  3BOW A;  1BOD A;  1K2H A;  2JQ6 A;  3I5I B;  1EXR A;  2Q91 A;  3IQQ A;  4HRG A;  4YGE B;  2LAN A;  2BE6 A;  1W7I B;  1S3P A;  5ER4 X;  2JT3 A;  3VRN A;  2K8M B;  3CGA A;  3KF9 A;  1C7V A;  2MLF C;  1SYM A;  2KGR A;  1UHJ A;  2IS9 A;  1XA5 A;  2HPS A;  5KU1 A;  2F8P A;  1RWY A;  1ZMZ A;  1JWD A;  3OB2 B;  2LMV A;  1AHR A;  1UHI A;  5CPV A;  2LHI A;  1QXP A;  3E3R A;  3EVV A;  3CR4 X;  2LE9 B;  4YGA A;  1SK6 D;  1TTX A;  1IH0 A;  1QV0 A;  1A75 A;  4DRW A;  2LHL A;  5HKW A;  1IG5 A;  1NCZ A;  4YGD B;  2L50 A;  3RM1 A;  2TN4 A;  1TNX A;  1V1G A;  3TDI A;  1KFU S;  2CT9 A;  2JC2 A;  3JVT C;  1KK7 Y;  1B8L A;  2EHB A;  1AJ5 A;  1UP5 A;  1BLQ A;  3ZNI A;  1IKU A;  4CPV A;  2WND A;  1NIW A;  2A4J A;  4N1F A;  2L4I A;  4IL1 A;  2FCE A;  2AAO A;  3CTN A;  5ER5 A;  1SY9 A;  3PN7 C;  3SIA A;  1CLB A;  1FI5 A;  1CFC A;  1SBJ A;  3JVT B;  2JNX A;  2KGB C;  2E6W A;  2LCP A;  5G08 A;  3SJS A;  1Y0V H;  1QIV A;  4DIR A;  3CZT X;  4A4B A;  1DF0 A;  4OCI A;  1QLS A;  5KTY A;  1NP8 A;  2ZN8 A;  1G8I A;  3PN7 B;  5AFP A;  2OS8 C;  2BEC A;  1DVI A;  3NSK A;  3LK1 A;  4GGF A;  4PHK A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  2LMT A;  4OKH A;  1XFU O;  2LP2 A;  2BCB A;  5HLO A;  4HSZ A;  1DJH A;  2LUX A;  1LVC D;  2CCM A;  1MHO A;  3EVU A;  1CFF A;  1DGV A;  1TCO B;  3AKB A;  2FCD A;  2I94 A;  4NDD A;  1DJZ A;  4PCW A;  1TCF A;  1J7P A;  1M39 A;  2OTG C;  1AK8 A;  3EK8 A;  2KI4 C;  4JPZ B;  5D7F A;  5HKY A;  2Y1M A;  1EL4 A;  1GJY A;  2EC6 C;  3RLZ A;  1KQV A;  4PE4 A;  1F71 A;  4BY5 A;  2BKH B;  4MZK A;  2F3Z A;  2PVB A;  1LA3 A;  1G4Y R;  1UHK A;  1XFW O;  2G9B A;  2BL0 C;  2OTG B;  4ORC B;  2K2A A;  1CMF A;  2ZRS A;  1ALV A;  2MAZ A;  1IQ3 A;  1SPY A;  5CSF A;  1YR5 A;  2KBI A;  2EC6 B;  1OMD A;  2WOS A;  4PHJ A;  4PHN A;  2ZN9 A;  3O4Y A;  4GPL B;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  3LCP C;  2LAP A;  5D69 A;  2P6B B;  2M7L A;  1BF5 A;  1N0Y A;  2M7N A;  5KSZ A;  1XK4 A;  4FQO A;  2BL0 B;  1A75 B;  1S1E A;  2I18 A;  3SIB A;  1OMV A;  2LM5 A;  3HX4 A;  5JJG A;  2M3W A;  1B9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...