3B7AA

Complex of s52a substituted droposphila lush protein with ethanol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVALMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b7aA00
3S0BA 3N7HA 4F7FA 2WCHA 3DZTA 3L47A 1TUJA 3NHIA 3PJIA 2WCKA 3DXLA 3B86A 2WCLA 3S0DA 3BFHA 3Q8IA 3NHTA 3RZSA 3D74A 1OOGA 3B6XA 3FE8A 1C3ZA 2QDIA 3L4LA 3B87A 3S0FA 2WCJA 3D75A 1LS8A 3BFAA 3CDNA 1T14A 3NGVA 1GM0A 1P28A 2WC5A 2QEVA 3R1OA 3CABA 4INXA 2WC6A 1C3YA 2QEOA 2L2CA 3R1PA 3B7AA 1OOFA 2WCMA 3L4AA 3K1EA 3CZ2A 1ORGA 2JPOA 3QMEA 3V2LA 3S0EA 1OOHA 3D78A 4OZDA 3BFBA 2H8VA 4PT1A 3DY9A 5EL2A 3B88A 2PQLA 1OOIX 2KPHA 1DQEA 3CZ0A 4INWA 2P71A 3DYEA 1QWVA 3D73A 3OGNA 4JD9A 3FE9A 3D76A 3R1VA 3BJHA 1OW4A 1TWOA 3FE6A 2FJYA 4FQTA 3R72A 5DICA 3S0GA 1XFRA 2QEBA 2P70A 3CZ1A 3D77A 2ERBA 2QEHA 3S0AA 2GTEA 3VB1A 3CYZA
chains in the Genus database with same CATH superfamily
4OV2A 1F8HA 2A4JA 2LE9B 2O60A 1TNWA 4YBHB 1J7RA 3VROA 4F7FA 1DGUA 3FWCA 4P5OE 2LUXA 5KTYA 1IJ6A 2VRGA 2WCKA 5FI2A 4DUQA 2WOSA 1RK9A 4JQ0D 2BCBA 3DXLA 4ORBB 1Y1UA 1J7PA 1QVIY 3SG4A 2L51A 2KLDA 4NQGA 1BG1A 3CZTX 2PVBA 1OZOA 3MSEB 3M0WA 1YVLA 3CWGA 3LCPC 4HSZA 1B7TZ 2WC8A 2CBLA 2BKIB 1BJFA 1TNXA 3HCMA 1DJXA 3UNWA 1UUSA 1NX1A 1YUSA 2GV5A 2MRDA 3EVRA 3RZSA 1OOGA 1XK4C 2EHBA 3B6XA 3FE8A 1PVAA 1CDNA 3EK4A 4PDZA 1DT7B 1YR5A 3WNXB 1MUXA 4YI8A 4YGEB 3NSIA 2JNXA 2K2FA 3DVEA 2Y4QA 4Q04A 1B7TY 3NGVA 2KI6C 2LMUA 2JWWA 1GM0A 5HKZA 1W9ZA 2BBMA 2KHNA 3PFVA 5D3OA 2I2RE 4C0KA 1UHIA 1CM1A 2JRFA 5HKYA 1PALA 1CNPA 2WC5A 2QEVA 2KI4C 3IQQA 5JOLA 1M31A 4JKTA 1JSAA 4XJKB 3VRNA 1CB1A 3R1OA 2LVJA 3VGOA 1KWOC 1RFJA 1UWOA 1ZUZA 1IH0A 5ER5A 1L2OB 1NUBA 3I5FC 2QEOA 2G9BA 3R1PA 3LK1A 2KYFA 2I7AA 2FJUB 5CSJA 1M63B 2BL0B 2M8UA 1UP5A 2CTNA 1TIZA 2L5YA 1ORGA 4MSPA 4D1EA 4YRUA 2CT9A 5DKNA 5J3XA 1QV0A 1SY9A 2BBNA 2JT8A 3S0EA 3AKBA 2KGRA 1NP8A 1KFXS 4R1EA 1YX8A 3SG6A 1CTRA 3BUOB 2JXCA 1CDLA 2MHHA 2KAXA 3BFBA 1OMDA 1W7JB 3KEVA 2WCFA 4PE7A 4PHNA 5D69A 5DKQA 2K7CA 2LHLA 3DY9A 1SW8A 2H61C 2DOQA 5F6TA 2CXJA 4I5NB 4MZJA 4QJ4B 1G4YR 1QATA 3GK1A 4AQJA 2M0RA 3SJSA 1HQVA 5KU1A 1IWQA 1S6IA 2KPHA 3CZ0A 2P71A 5BPJA 1CLBA 2PSRA 1KFUL 1Y6WA 2NLNA 1M39A 2K7BA 3D0YA 1QIWA 1R6PA 1OE9B 3TDUA 4ICBA 2MA2A 1YURA 3CR4X 1KSMA 1KK7Y 3FE6A 2KAYA 1A2XA 3TZ1A 2F2OA 2LMTA 2TN4A 3C1VA 4WQ3A 5HL1A 1CLMA 2HPSA 4A4CA 2LP3A 2F2PA 4CIDA 1CFCA 2KLEA 3KO0A 1V1GA 2K0JA 3EVVA 3O2PA 1A4PA 1XFRA 1DMOA 1LXFC 2LV7A 1NWDA 2HQWA 4CFQA 3SS5A 1FI5A 3I5GC 2QEHA 1IIOA 4P2YB 3A8RA 3VB1A 3JTDC 3PM8A 3S0BA 3I5HC 1ZFSA 2JNFA 2M9GA 3L47A 4MN0A 1R2UA 4ORAB 2KI4B 2ZFDA 3NHIA 3SG7A 5I94A 1QX2A 5I2LA 1UHKA 1XK4A 2QPTA 3KF9A 1NX2A 3PN7C 1KWOB 4CLNA 1A29A 1ALWA 1N0YA 2JTZA 3EG5B 3I5FB 3IF7A 3IVTA 3S0DA 2AMIA 2LUCA 2NXQA 4PE0A 5GQQC 1JFKA 1U5IB 1UHHA 1G8IA 1TOPA 3NHTA 4U8DA 1ALVA 2E30A 2MLFC 3BXKA 1KQVA 1SMGA 1QVIZ 3D74A 1SBJA 3BOWB 1F4OA 1K95A 2K8MB 2QDIA 2LVIA 1QXPA 2IS9A 2SASA 2LLTA 2E6WA 3LK0A 3WHTB 4E68A 1B1GA 1SKTA 3D75A 1LS8A 2KSPA 1OMVA 1F4QA 2OPOA 1XFWO 5AANA 3EKHA 2JPTA 3D10A 5CSNA 3AKAA 4C0JA 2KDHA 2BE4A 1DJHA 3TS5B 1S5GY 3JVTC 4MVFA 1U5IA 2RGIA 3HX4A 4GFTA 4YGCB 1TTXA 2L4HA 3DVJA 3ZWHA 1M45A 3LLEA 4A4BA 4ORCB 1DGVA 1K90D 4XYNA 2ZN8A 1Z2CB 1K2HA 3DD4A 3O78A 3OBVA 4KYNA 1MF8B 2L2CA 1YUTA 3SS4A 4MEWA 1TNQA 2JT3A 4I5KA 4IJ7A 2LC5A 2WCMA 3GK4X 3L4AA 2QACA 3AAKA 3PSRA 3GOFA 2CNPA 1KQMC 3KPXA 3V2LA 1HT9A 2KFFA 3RLZA 3TDIA 1DJGA 2H8VA 1AUIB 2Y1MA 4PT1A 2JC2A 3VRQA 1X02A 1OSAA 3SIAA 2KBIA 2FCEA 3I5GB 1DEKA 1CMGA 3B88A 1GQMA 1CDMA 1K93D 2ZRTA 2PQLA 1BOCA 3JTDB 1SCVA 3I5HB 1YX7A 1SL7A 5TNCA 1DVIA 1F71A 2LMVA 4I5LB 4MRXA 3DYEA 1UHNA 1NIWA 3FWBA 5AEQA 1B47A 3DF0B 3PN7B 3EKJA 1H8BA 3D73A 2WCEA 2AAOA 2EC6C 4JD9A 1CM4A 3D76A 4HRGA 3IQOA 2M49B 5I2QA 1A03A 2Y5IA 3VRPA 1WRKA 2WNDA 2BNXA 1PSBA 3NSOA 4XJKA 1KFXL 2KAVA 3PM2A 5FI6A 1WRZA 5D7FA 5FYXA 2KBMA 3TUYC 5DICA 4USLA 1KK7Z 5IBWA 4OCIA 1C07A 3OB2B 4OVNF 1B9AA 1DTLA 3DF0A 1JWDA 1SR6C 1MHOA 1Y1AA 3CR5X 1K9KA 3CS1A 3TDZA 3ZNIA 1MR8A 1OZSA 2COLB 1IRJA 4GGFC 1BLQA 2Q4UA 4IL1A 4GAOA 2M1KB 2WCHA 3DZTA 3JVTB 1K8UA 1TUJA 2PALA 1YUUA 4NDCA 4NDBA 3OP0A 2PMYA 2KFGA 5JJGA 3KHEA 4PE4A 1IQ5A 2EGDA 1BT6A 2K60A 2I94A 1JBAA 1M46A 3B86A 1NX3A 1NCYA 3O4XA 2WCLA 1DJIA 3K21A 1J7QA 2MBXA 1OOJA 3QRXA 4MLWA 2P6BB 3BFHA 1F55A 5HYDA 2PRUA 4BY4A 2WORA 1J1EA 1KQMB 2K7DA 1C3ZA 1NCZA 1PRWA 1QIVA 1Y1XA 2HF5A 1XA5A 1DF0B 2GGMA 2JZIA 3L4LA 4ZCUA 4QJ5B 1JFJA 3I5IC 4ZCVA 1UHJA 4DCKA 1QASA 2JT0A 2NCPA 1NSHA 2LAPA 1XFYO 1J1DA 1T14A 2M7NA 4AOMA 4M2QA 4YI9A 2Q91A 5AERA 1TUZA 3ICBA 2NCOA 1FW4A 1P28A 1QS7A 1JF2A 1WRLA 1FF1A 2L5XB 1QX7A 5DKRA 1AVSA 1SSEB 3AAJA 2M97A 2V53A 2MLEC 3LL8B 3CABA 2ISDA 4INXA 2LLSA 4OR9B 5K89A 2M29A 1C7WA 2F8PA 2I18A 5PALA 4TNCA 1S5GZ 2EC6B 2SCPA 3B7AA 3O6BA 1DJWA 4WQ2A 1JUOA 2F3YA 4NDDA 5AXIA 1JF0A 5I2OA 1BODA 4UPGA 3CZ2A 4GPLB 2MAZA 1XVJA 1G33A 3QMEA 1XFUO 2KFHA 1S3PA 2HETA 4YGBB 3TUYB 1TRFA 4PHKA 3EK7A 2AUCA 1OMRA 4OZDA 3WHUB 2KYCA 3FS7A 1AHRA 1SR6B 3FIAA 3SG5A 1VRKA 2F3ZA 4CFRA 3DVMA 3OX6A 1PSRA 3A4UB 3BOWA 5EL2A 2H2KA 1SNLA 3BUMB 1SK6D 2L98A 1LVCD 1OOIX 1CMFA 5ER4X 1IG5A 1DQEA 2ZKMX 4DRWA 1S6JA 4INWA 3BUXB 4MRYA 1NYAA 2D8NA 1IQ3A 5FI7A 1XFVO 4GNKB 2ZNEA 1KK8C 5HKWA 4N1FA 2H61A 3PALA 3FE9A 3R1VA 2LANA 3BJHA 4PALA 1V1FA 3CLNA 1OW4A 1TWOA 1PK0D 2K7OA 4FQTA 1SRAA 4GGNA 1FI6A 1S36A 4C0LA 3R72A 1NX0A 4GGFA 1F54A 1IJ5A 1YRTB 1QTXA 2FCDA 3EK8A 3EVUA 4N1GA 1GGWA 4FQOA 1NPQA 1Y0VH 1QLSA 1WLZA 4MBEA 1KSOA 3S0GA 3I5IB 2QEBA 1YVHA 3NSLA 3D77A 1RJVA 2ERBA 1IKUA 5I8NA 2KOTA 1BR4B 1NCXA 1KCYA 1FPWA 1K9PA 2ZN9A 3S0AA 4HREE 3CYZA 2L0PA 1TNPA 1AK8A 1B8LA 2BAPA 1LA0A 2JTTA 3N7HA 1TCOB 3O4YA 1S1EA 2LLUA 1XO5A 3PJIA 1CFPA 1N2DA 1SL8A 1YTZC 1AP4A 1LA3A 2M3WA 2BECA 2G2BA 2LVVA 2ZNDA 2CCMA 1SCMC 1OQPA 2OS8B 1MXEA 2B1UA 3CTNA 3SG2A 5CSFA 2LCPA 3Q8IA 1SYMA 2LM5A 5B8IB 1IGVA 1WLMA 1YRUB 1EG3A 3H4SE 2JU0A 3B87A 1AJ4A 3CR2A 1WDCC 3PLFB 2K61A 3S0FA 3UO9A 1K9UA 2KQYA 2WCJA 1XFXO 3BFAA 4I5JA 2ZRSA 1PULA 4PHMA 3CDNA 2OTGC 4ETOA 1D1OA 2PYQA 3D0YB 1K94A 4OKHA 2JQ6A 1A75B 1CFFA 3RM1A 1PVBA 4JWQA 3E3RA 1DJZA 1W7IB 2WCBA 2LHIA 3F45A 3SIBA 2BE6A 1SPYA 3WXAA 2YGUA 4YGAA 1EJ3A 2L2EA 1MWNA 2M1UA 1UURA 4F0ZB 1DELA 2K2AA 1QX5B 2HQ8A 4CPVA 2WC6A 2JULA 2O5GA 1LINA 1KK8B 4WRIA 2M7LA 1C3YA 3BQ3A 1KFUS 1B4CA 3OX5A 2KQ6A 4GBAA 1GJYA 1Q80A 2PASA 1OOFA 1A75A 1XYDA 2BKHB 2JXLA 1DJYA 4DS7A 1DC1A 4HRHA 2LNKA 3K1EA 5CPVA 5AFPA 2JPOA 4QJ3B 3BUWB 1CFDA 2L4IA 3SG3A 5KSZA 4YGDB 1OOHA 2JOJA 3D78A 1CDPA 4PE1A 1B8CA 1RWYA 4FTGA 1SL9A 3SS3A 1Z4HA 1ZACA 1TN4A 1CLLA 1MXLC 2LVKA 3NSKA 1B8RA 3DVKA 1BF5A 3NXAA 1J7OA 1EL4A 1BMOA 1S6CA 2MJWB 1EG4A 4MZLA 1DF0A 1TCFA 2KGBC 2OS8C 2Y1NA 5HLVA 1ODBA 1E8AA 5HLOA 1JC2A 4M2PA 1GGZA 1ZOTB 5G08A 1K96A 1QWVA 4DIRA 2F33A 1LKJA 3BUNB 2NZ0A 1L2OC 2L50A 3VRRA 1EXRA 2BCXA 4MZKA 1EH2A 2FOTA 3OGNA 1SCMB 1QV1A 1H4BA 2LP2A 3BYAA 1AJ5A 2BL0C 2FJYA 2KI6D 1QLKA 4AQIA 2KNEA 1N65A 1QJTA 4PHJA 1J55A 1CKKA 3OB1B 1F70A 2BCAA 3GK2A 1BR1B 1FBVA 1WDCB 4GUKA 1RECA 4L9MA 4N5XA 1C7VA 1S26D 4JPZB 1RROA 2P70A 1MQ1A 3TS5C 3CZ1A 4PCWA 4M2OA 1BU3A 1L7ZA 2OTGB 1WY9A 2GGZA 3CGAA 4BY5A 2R2IA 1RTP1 3OHMB 3PATA 5CSIA 2GTEA 1XFZO 1ZMZA
chains in the Genus database with same CATH topology
3S0BA 3N7HA 4F7FA 2WCHA 3DZTA 3L47A 1TUJA 3NHIA 3PJIA 2WCKA 3DXLA 3B86A 2WCLA 3S0DA 3BFHA 3Q8IA 3NHTA 3RZSA 3D74A 1OOGA 3B6XA 3FE8A 1C3ZA 2QDIA 3L4LA 3B87A 3S0FA 2WCJA 3D75A 1LS8A 3BFAA 3CDNA 1T14A 3NGVA 1GM0A 1P28A 2WC5A 2QEVA 3R1OA 3CABA 4INXA 2WC6A 1C3YA 2QEOA 2L2CA 3R1PA 3B7AA 1OOFA 2WCMA 3L4AA 3K1EA 3CZ2A 1ORGA 2JPOA 3QMEA 3V2LA 3S0EA 1OOHA 3D78A 4OZDA 3BFBA 2H8VA 4PT1A 3DY9A 5EL2A 3B88A 2PQLA 1OOIX 2KPHA 1DQEA 3CZ0A 4INWA 2P71A 3DYEA 1QWVA 3D73A 3OGNA 4JD9A 3FE9A 3D76A 3R1VA 3BJHA 1OW4A 1TWOA 3FE6A 2FJYA 4FQTA 3R72A 5DICA 3S0GA 1XFRA 2QEBA 2P70A 3CZ1A 3D77A 2ERBA 2QEHA 3S0AA 2GTEA 3VB1A 3CYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0B A;  3N7H A;  4F7F A;  2WCH A;  3DZT A;  3L47 A;  1TUJ A;  3NHI A;  3PJI A;  2WCK A;  3DXL A;  3B86 A;  2WCL A;  3S0D A;  3BFH A;  3Q8I A;  3NHT A;  3RZS A;  3D74 A;  1OOG A;  3B6X A;  3FE8 A;  1C3Z A;  2QDI A;  3L4L A;  3B87 A;  3S0F A;  2WCJ A;  3D75 A;  1LS8 A;  3BFA A;  3CDN A;  1T14 A;  3NGV A;  1GM0 A;  1P28 A;  2WC5 A;  2QEV A;  3R1O A;  3CAB A;  4INX A;  2WC6 A;  1C3Y A;  2QEO A;  2L2C A;  3R1P A;  3B7A A;  1OOF A;  2WCM A;  3L4A A;  3K1E A;  3CZ2 A;  1ORG A;  2JPO A;  3QME A;  3V2L A;  3S0E A;  1OOH A;  3D78 A;  4OZD A;  3BFB A;  2H8V A;  4PT1 A;  3DY9 A;  5EL2 A;  3B88 A;  2PQL A;  1OOI X;  2KPH A;  1DQE A;  3CZ0 A;  4INW A;  2P71 A;  3DYE A;  1QWV A;  3D73 A;  3OGN A;  4JD9 A;  3FE9 A;  3D76 A;  3R1V A;  3BJH A;  1OW4 A;  1TWO A;  3FE6 A;  2FJY A;  4FQT A;  3R72 A;  5DIC A;  3S0G A;  1XFR A;  2QEB A;  2P70 A;  3CZ1 A;  3D77 A;  2ERB A;  2QEH A;  3S0A A;  2GTE A;  3VB1 A;  3CYZ A; 
#chains in the Genus database with same CATH topology
 4OV2 A;  1F8H A;  2A4J A;  2LE9 B;  2O60 A;  1TNW A;  4YBH B;  1J7R A;  3VRO A;  4F7F A;  1DGU A;  3FWC A;  4P5O E;  2LUX A;  5KTY A;  1IJ6 A;  2VRG A;  2WCK A;  5FI2 A;  4DUQ A;  2WOS A;  1RK9 A;  4JQ0 D;  2BCB A;  3DXL A;  4ORB B;  1Y1U A;  1J7P A;  1QVI Y;  3SG4 A;  2L51 A;  2KLD A;  4NQG A;  1BG1 A;  3CZT X;  2PVB A;  1OZO A;  3MSE B;  3M0W A;  1YVL A;  3CWG A;  3LCP C;  4HSZ A;  1B7T Z;  2WC8 A;  2CBL A;  2BKI B;  1BJF A;  1TNX A;  3HCM A;  1DJX A;  3UNW A;  1UUS A;  1NX1 A;  1YUS A;  2GV5 A;  2MRD A;  3EVR A;  3RZS A;  1OOG A;  1XK4 C;  2EHB A;  3B6X A;  3FE8 A;  1PVA A;  1CDN A;  3EK4 A;  4PDZ A;  1DT7 B;  1YR5 A;  3WNX B;  1MUX A;  4YI8 A;  4YGE B;  3NSI A;  2JNX A;  2K2F A;  3DVE A;  2Y4Q A;  4Q04 A;  1B7T Y;  3NGV A;  2KI6 C;  2LMU A;  2JWW A;  1GM0 A;  5HKZ A;  1W9Z A;  2BBM A;  2KHN A;  3PFV A;  5D3O A;  2I2R E;  4C0K A;  1UHI A;  1CM1 A;  2JRF A;  5HKY A;  1PAL A;  1CNP A;  2WC5 A;  2QEV A;  2KI4 C;  3IQQ A;  5JOL A;  1M31 A;  4JKT A;  1JSA A;  4XJK B;  3VRN A;  1CB1 A;  3R1O A;  2LVJ A;  3VGO A;  1KWO C;  1RFJ A;  1UWO A;  1ZUZ A;  1IH0 A;  5ER5 A;  1L2O B;  1NUB A;  3I5F C;  2QEO A;  2G9B A;  3R1P A;  3LK1 A;  2KYF A;  2I7A A;  2FJU B;  5CSJ A;  1M63 B;  2BL0 B;  2M8U A;  1UP5 A;  2CTN A;  1TIZ A;  2L5Y A;  1ORG A;  4MSP A;  4D1E A;  4YRU A;  2CT9 A;  5DKN A;  5J3X A;  1QV0 A;  1SY9 A;  2BBN A;  2JT8 A;  3S0E A;  3AKB A;  2KGR A;  1NP8 A;  1KFX S;  4R1E A;  1YX8 A;  3SG6 A;  1CTR A;  3BUO B;  2JXC A;  1CDL A;  2MHH A;  2KAX A;  3BFB A;  1OMD A;  1W7J B;  3KEV A;  2WCF A;  4PE7 A;  4PHN A;  5D69 A;  5DKQ A;  2K7C A;  2LHL A;  3DY9 A;  1SW8 A;  2H61 C;  2DOQ A;  5F6T A;  2CXJ A;  4I5N B;  4MZJ A;  4QJ4 B;  1G4Y R;  1QAT A;  3GK1 A;  4AQJ A;  2M0R A;  3SJS A;  1HQV A;  5KU1 A;  1IWQ A;  1S6I A;  2KPH A;  3CZ0 A;  2P71 A;  5BPJ A;  1CLB A;  2PSR A;  1KFU L;  1Y6W A;  2NLN A;  1M39 A;  2K7B A;  3D0Y A;  1QIW A;  1R6P A;  1OE9 B;  3TDU A;  4ICB A;  2MA2 A;  1YUR A;  3CR4 X;  1KSM A;  1KK7 Y;  3FE6 A;  2KAY A;  1A2X A;  3TZ1 A;  2F2O A;  2LMT A;  2TN4 A;  3C1V A;  4WQ3 A;  5HL1 A;  1CLM A;  2HPS A;  4A4C A;  2LP3 A;  2F2P A;  4CID A;  1CFC A;  2KLE A;  3KO0 A;  1V1G A;  2K0J A;  3EVV A;  3O2P A;  1A4P A;  1XFR A;  1DMO A;  1LXF C;  2LV7 A;  1NWD A;  2HQW A;  4CFQ A;  3SS5 A;  1FI5 A;  3I5G C;  2QEH A;  1IIO A;  4P2Y B;  3A8R A;  3VB1 A;  3JTD C;  3PM8 A;  3S0B A;  3I5H C;  1ZFS A;  2JNF A;  2M9G A;  3L47 A;  4MN0 A;  1R2U A;  4ORA B;  2KI4 B;  2ZFD A;  3NHI A;  3SG7 A;  5I94 A;  1QX2 A;  5I2L A;  1UHK A;  1XK4 A;  2QPT A;  3KF9 A;  1NX2 A;  3PN7 C;  1KWO B;  4CLN A;  1A29 A;  1ALW A;  1N0Y A;  2JTZ A;  3EG5 B;  3I5F B;  3IF7 A;  3IVT A;  3S0D A;  2AMI A;  2LUC A;  2NXQ A;  4PE0 A;  5GQQ C;  1JFK A;  1U5I B;  1UHH A;  1G8I A;  1TOP A;  3NHT A;  4U8D A;  1ALV A;  2E30 A;  2MLF C;  3BXK A;  1KQV A;  1SMG A;  1QVI Z;  3D74 A;  1SBJ A;  3BOW B;  1F4O A;  1K95 A;  2K8M B;  2QDI A;  2LVI A;  1QXP A;  2IS9 A;  2SAS A;  2LLT A;  2E6W A;  3LK0 A;  3WHT B;  4E68 A;  1B1G A;  1SKT A;  3D75 A;  1LS8 A;  2KSP A;  1OMV A;  1F4Q A;  2OPO A;  1XFW O;  5AAN A;  3EKH A;  2JPT A;  3D10 A;  5CSN A;  3AKA A;  4C0J A;  2KDH A;  2BE4 A;  1DJH A;  3TS5 B;  1S5G Y;  3JVT C;  4MVF A;  1U5I A;  2RGI A;  3HX4 A;  4GFT A;  4YGC B;  1TTX A;  2L4H A;  3DVJ A;  3ZWH A;  1M45 A;  3LLE A;  4A4B A;  4ORC B;  1DGV A;  1K90 D;  4XYN A;  2ZN8 A;  1Z2C B;  1K2H A;  3DD4 A;  3O78 A;  3OBV A;  4KYN A;  1MF8 B;  2L2C A;  1YUT A;  3SS4 A;  4MEW A;  1TNQ A;  2JT3 A;  4I5K A;  4IJ7 A;  2LC5 A;  2WCM A;  3GK4 X;  3L4A A;  2QAC A;  3AAK A;  3PSR A;  3GOF A;  2CNP A;  1KQM C;  3KPX A;  3V2L A;  1HT9 A;  2KFF A;  3RLZ A;  3TDI A;  1DJG A;  2H8V A;  1AUI B;  2Y1M A;  4PT1 A;  2JC2 A;  3VRQ A;  1X02 A;  1OSA A;  3SIA A;  2KBI A;  2FCE A;  3I5G B;  1DEK A;  1CMG A;  3B88 A;  1GQM A;  1CDM A;  1K93 D;  2ZRT A;  2PQL A;  1BOC A;  3JTD B;  1SCV A;  3I5H B;  1YX7 A;  1SL7 A;  5TNC A;  1DVI A;  1F71 A;  2LMV A;  4I5L B;  4MRX A;  3DYE A;  1UHN A;  1NIW A;  3FWB A;  5AEQ A;  1B47 A;  3DF0 B;  3PN7 B;  3EKJ A;  1H8B A;  3D73 A;  2WCE A;  2AAO A;  2EC6 C;  4JD9 A;  1CM4 A;  3D76 A;  4HRG A;  3IQO A;  2M49 B;  5I2Q A;  1A03 A;  2Y5I A;  3VRP A;  1WRK A;  2WND A;  2BNX A;  1PSB A;  3NSO A;  4XJK A;  1KFX L;  2KAV A;  3PM2 A;  5FI6 A;  1WRZ A;  5D7F A;  5FYX A;  2KBM A;  3TUY C;  5DIC A;  4USL A;  1KK7 Z;  5IBW A;  4OCI A;  1C07 A;  3OB2 B;  4OVN F;  1B9A A;  1DTL A;  3DF0 A;  1JWD A;  1SR6 C;  1MHO A;  1Y1A A;  3CR5 X;  1K9K A;  3CS1 A;  3TDZ A;  3ZNI A;  1MR8 A;  1OZS A;  2COL B;  1IRJ A;  4GGF C;  1BLQ A;  2Q4U A;  4IL1 A;  4GAO A;  2M1K B;  2WCH A;  3DZT A;  3JVT B;  1K8U A;  1TUJ A;  2PAL A;  1YUU A;  4NDC A;  4NDB A;  3OP0 A;  2PMY A;  2KFG A;  5JJG A;  3KHE A;  4PE4 A;  1IQ5 A;  2EGD A;  1BT6 A;  2K60 A;  2I94 A;  1JBA A;  1M46 A;  3B86 A;  1NX3 A;  1NCY A;  3O4X A;  2WCL A;  1DJI A;  3K21 A;  1J7Q A;  2MBX A;  1OOJ A;  3QRX A;  4MLW A;  2P6B B;  3BFH A;  1F55 A;  5HYD A;  2PRU A;  4BY4 A;  2WOR A;  1J1E A;  1KQM B;  2K7D A;  1C3Z A;  1NCZ A;  1PRW A;  1QIV A;  1Y1X A;  2HF5 A;  1XA5 A;  1DF0 B;  2GGM A;  2JZI A;  3L4L A;  4ZCU A;  4QJ5 B;  1JFJ A;  3I5I C;  4ZCV A;  1UHJ A;  4DCK A;  1QAS A;  2JT0 A;  2NCP A;  1NSH A;  2LAP A;  1XFY O;  1J1D A;  1T14 A;  2M7N A;  4AOM A;  4M2Q A;  4YI9 A;  2Q91 A;  5AER A;  1TUZ A;  3ICB A;  2NCO A;  1FW4 A;  1P28 A;  1QS7 A;  1JF2 A;  1WRL A;  1FF1 A;  2L5X B;  1QX7 A;  5DKR A;  1AVS A;  1SSE B;  3AAJ A;  2M97 A;  2V53 A;  2MLE C;  3LL8 B;  3CAB A;  2ISD A;  4INX A;  2LLS A;  4OR9 B;  5K89 A;  2M29 A;  1C7W A;  2F8P A;  2I18 A;  5PAL A;  4TNC A;  1S5G Z;  2EC6 B;  2SCP A;  3B7A A;  3O6B A;  1DJW A;  4WQ2 A;  1JUO A;  2F3Y A;  4NDD A;  5AXI A;  1JF0 A;  5I2O A;  1BOD A;  4UPG A;  3CZ2 A;  4GPL B;  2MAZ A;  1XVJ A;  1G33 A;  3QME A;  1XFU O;  2KFH A;  1S3P A;  2HET A;  4YGB B;  3TUY B;  1TRF A;  4PHK A;  3EK7 A;  2AUC A;  1OMR A;  4OZD A;  3WHU B;  2KYC A;  3FS7 A;  1AHR A;  1SR6 B;  3FIA A;  3SG5 A;  1VRK A;  2F3Z A;  4CFR A;  3DVM A;  3OX6 A;  1PSR A;  3A4U B;  3BOW A;  5EL2 A;  2H2K A;  1SNL A;  3BUM B;  1SK6 D;  2L98 A;  1LVC D;  1OOI X;  1CMF A;  5ER4 X;  1IG5 A;  1DQE A;  2ZKM X;  4DRW A;  1S6J A;  4INW A;  3BUX B;  4MRY A;  1NYA A;  2D8N A;  1IQ3 A;  5FI7 A;  1XFV O;  4GNK B;  2ZNE A;  1KK8 C;  5HKW A;  4N1F A;  2H61 A;  3PAL A;  3FE9 A;  3R1V A;  2LAN A;  3BJH A;  4PAL A;  1V1F A;  3CLN A;  1OW4 A;  1TWO A;  1PK0 D;  2K7O A;  4FQT A;  1SRA A;  4GGN A;  1FI6 A;  1S36 A;  4C0L A;  3R72 A;  1NX0 A;  4GGF A;  1F54 A;  1IJ5 A;  1YRT B;  1QTX A;  2FCD A;  3EK8 A;  3EVU A;  4N1G A;  1GGW A;  4FQO A;  1NPQ A;  1Y0V H;  1QLS A;  1WLZ A;  4MBE A;  1KSO A;  3S0G A;  3I5I B;  2QEB A;  1YVH A;  3NSL A;  3D77 A;  1RJV A;  2ERB A;  1IKU A;  5I8N A;  2KOT A;  1BR4 B;  1NCX A;  1KCY A;  1FPW A;  1K9P A;  2ZN9 A;  3S0A A;  4HRE E;  3CYZ A;  2L0P A;  1TNP A;  1AK8 A;  1B8L A;  2BAP A;  1LA0 A;  2JTT A;  3N7H A;  1TCO B;  3O4Y A;  1S1E A;  2LLU A;  1XO5 A;  3PJI A;  1CFP A;  1N2D A;  1SL8 A;  1YTZ C;  1AP4 A;  1LA3 A;  2M3W A;  2BEC A;  2G2B A;  2LVV A;  2ZND A;  2CCM A;  1SCM C;  1OQP A;  2OS8 B;  1MXE A;  2B1U A;  3CTN A;  3SG2 A;  5CSF A;  2LCP A;  3Q8I A;  1SYM A;  2LM5 A;  5B8I B;  1IGV A;  1WLM A;  1YRU B;  1EG3 A;  3H4S E;  2JU0 A;  3B87 A;  1AJ4 A;  3CR2 A;  1WDC C;  3PLF B;  2K61 A;  3S0F A;  3UO9 A;  1K9U A;  2KQY A;  2WCJ A;  1XFX O;  3BFA A;  4I5J A;  2ZRS A;  1PUL A;  4PHM A;  3CDN A;  2OTG C;  4ETO A;  1D1O A;  2PYQ A;  3D0Y B;  1K94 A;  4OKH A;  2JQ6 A;  1A75 B;  1CFF A;  3RM1 A;  1PVB A;  4JWQ A;  3E3R A;  1DJZ A;  1W7I B;  2WCB A;  2LHI A;  3F45 A;  3SIB A;  2BE6 A;  1SPY A;  3WXA A;  2YGU A;  4YGA A;  1EJ3 A;  2L2E A;  1MWN A;  2M1U A;  1UUR A;  4F0Z B;  1DEL A;  2K2A A;  1QX5 B;  2HQ8 A;  4CPV A;  2WC6 A;  2JUL A;  2O5G A;  1LIN A;  1KK8 B;  4WRI A;  2M7L A;  1C3Y A;  3BQ3 A;  1KFU S;  1B4C A;  3OX5 A;  2KQ6 A;  4GBA A;  1GJY A;  1Q80 A;  2PAS A;  1OOF A;  1A75 A;  1XYD A;  2BKH B;  2JXL A;  1DJY A;  4DS7 A;  1DC1 A;  4HRH A;  2LNK A;  3K1E A;  5CPV A;  5AFP A;  2JPO A;  4QJ3 B;  3BUW B;  1CFD A;  2L4I A;  3SG3 A;  5KSZ A;  4YGD B;  1OOH A;  2JOJ A;  3D78 A;  1CDP A;  4PE1 A;  1B8C A;  1RWY A;  4FTG A;  1SL9 A;  3SS3 A;  1Z4H A;  1ZAC A;  1TN4 A;  1CLL A;  1MXL C;  2LVK A;  3NSK A;  1B8R A;  3DVK A;  1BF5 A;  3NXA A;  1J7O A;  1EL4 A;  1BMO A;  1S6C A;  2MJW B;  1EG4 A;  4MZL A;  1DF0 A;  1TCF A;  2KGB C;  2OS8 C;  2Y1N A;  5HLV A;  1ODB A;  1E8A A;  5HLO A;  1JC2 A;  4M2P A;  1GGZ A;  1ZOT B;  5G08 A;  1K96 A;  1QWV A;  4DIR A;  2F33 A;  1LKJ A;  3BUN B;  2NZ0 A;  1L2O C;  2L50 A;  3VRR A;  1EXR A;  2BCX A;  4MZK A;  1EH2 A;  2FOT A;  3OGN A;  1SCM B;  1QV1 A;  1H4B A;  2LP2 A;  3BYA A;  1AJ5 A;  2BL0 C;  2FJY A;  2KI6 D;  1QLK A;  4AQI A;  2KNE A;  1N65 A;  1QJT A;  4PHJ A;  1J55 A;  1CKK A;  3OB1 B;  1F70 A;  2BCA A;  3GK2 A;  1BR1 B;  1FBV A;  1WDC B;  4GUK A;  1REC A;  4L9M A;  4N5X A;  1C7V A;  1S26 D;  4JPZ B;  1RRO A;  2P70 A;  1MQ1 A;  3TS5 C;  3CZ1 A;  4PCW A;  4M2O A;  1BU3 A;  1L7Z A;  2OTG B;  1WY9 A;  2GGZ A;  3CGA A;  4BY5 A;  2R2I A;  1RTP 1;  3OHM B;  3PAT A;  5CSI A;  2GTE A;  1XFZ O;  1ZMZ A; 
#chains in the Genus database with same CATH homology
 3S0B A;  3N7H A;  4F7F A;  2WCH A;  3DZT A;  3L47 A;  1TUJ A;  3NHI A;  3PJI A;  2WCK A;  3DXL A;  3B86 A;  2WCL A;  3S0D A;  3BFH A;  3Q8I A;  3NHT A;  3RZS A;  3D74 A;  1OOG A;  3B6X A;  3FE8 A;  1C3Z A;  2QDI A;  3L4L A;  3B87 A;  3S0F A;  2WCJ A;  3D75 A;  1LS8 A;  3BFA A;  3CDN A;  1T14 A;  3NGV A;  1GM0 A;  1P28 A;  2WC5 A;  2QEV A;  3R1O A;  3CAB A;  4INX A;  2WC6 A;  1C3Y A;  2QEO A;  2L2C A;  3R1P A;  3B7A A;  1OOF A;  2WCM A;  3L4A A;  3K1E A;  3CZ2 A;  1ORG A;  2JPO A;  3QME A;  3V2L A;  3S0E A;  1OOH A;  3D78 A;  4OZD A;  3BFB A;  2H8V A;  4PT1 A;  3DY9 A;  5EL2 A;  3B88 A;  2PQL A;  1OOI X;  2KPH A;  1DQE A;  3CZ0 A;  4INW A;  2P71 A;  3DYE A;  1QWV A;  3D73 A;  3OGN A;  4JD9 A;  3FE9 A;  3D76 A;  3R1V A;  3BJH A;  1OW4 A;  1TWO A;  3FE6 A;  2FJY A;  4FQT A;  3R72 A;  5DIC A;  3S0G A;  1XFR A;  2QEB A;  2P70 A;  3CZ1 A;  3D77 A;  2ERB A;  2QEH A;  3S0A A;  2GTE A;  3VB1 A;  3CYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...