3B7AA

Complex of s52a substituted droposphila lush protein with ethanol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVALMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b7aA00
3R1VA 1OOIX 1P28A 2WCHA 3BFHA 2KPHA 1QWVA 2FJYA 1OOHA 4F7FA 3D76A 3NHTA 2WC6A 3D77A 1T14A 3DXLA 3OGNA 3B88A 3S0EA 3B87A 3CDNA 3DZTA 4INXA 2L2CA 2WCJA 2WC5A 4JD9A 3FE8A 2JPOA 2ERBA 5DICA 2H8VA 2GTEA 2WCMA 3K1EA 3B6XA 3D73A 3S0BA 1C3ZA 2P70A 3NGVA 3RZSA 3R72A 3CYZA 2WCLA 3QMEA 3B86A 3FE6A 3L4LA 2QEBA 3S0AA 1LS8A 3D78A 3D74A 3Q8IA 3R1PA 4INWA 1XFRA 3N7HA 1ORGA 3BFBA 2PQLA 2QDIA 3CZ2A 3D75A 2P71A 3DYEA 3PJIA 3FE9A 3BFAA 4FQTA 3B7AA 3R1OA 1DQEA 3L4AA 5EL2A 1GM0A 3CABA 3DY9A 1OOFA 3L47A 1OOGA 4PT1A 3S0FA 1C3YA 1TUJA 3S0DA 3NHIA 1OW4A 4OZDA 2QEVA 2QEOA 3BJHA 3VB1A 3S0GA 2QEHA 2WCKA 3V2LA 3CZ0A 1TWOA 3CZ1A
chains in the Genus database with same CATH superfamily
3I5GB 2PYQA 4ORAB 1QLKA 1YUUA 1OOIX 1NPQA 3DD4A 1SW8A 2WCHA 2Y5IA 2ZFDA 2AUCA 1XFXO 1OE9B 4GNKB 4PHJA 3O2PA 1XFWO 3KF9A 2M8UA 1F4OA 1DJZA 1SRAA 1PSRA 2RGIA 1WY9A 2EC6B 1M63B 1B7TY 3NHTA 3SG4A 3TDUA 1MF8B 3LLEA 2EGDA 5I2QA 1JC2A 3UO9A 3IVTA 1SY9A 2LNKA 1FPWA 2WC8A 1JFJA 1K9UA 1IJ5A 2LANA 3B87A 1A4PA 3CDNA 2GGZA 1KWOC 2MBXA 1NYAA 1K9PA 2BL0B 2BBNA 3WNXB 2GGMA 1TUZA 3PALA 1GGWA 2F2PA 1TNXA 1XK4C 1J7RA 1TTXA 2WC5A 1NCYA 2E6WA 4JD9A 2LMTA 1VRKA 1KK7Y 1SCMB 1PRWA 1BR4B 3AKAA 1QXPA 4OVNF 2Y1MA 4NDDA 1AUIB 1LA0A 1DTLA 1W7IB 4AQIA 5BPJA 2WCMA 3K1EA 3B6XA 1KQVA 4NQGA 2KYFA 1C3ZA 1YUSA 1Y6WA 4I5JA 2WCBA 5D3OA 2BCBA 5FI6A 1BU3A 1D1OA 1CFFA 1QASA 4PALA 3H4SE 1AK8A 4GAOA 3EKJA 3B86A 3CR5X 4WQ3A 2H61C 5HLVA 2BKHB 1WLZA 2M97A 5TNCA 3VGOA 3CTNA 3GK2A 5AXIA 1J7PA 1BJFA 1ZUZA 3D78A 2NCPA 3EG5B 4JKTA 1IWQA 2WCEA 4PE4A 3BFBA 2QACA 2QDIA 1PULA 1A75B 2G2BA 3D75A 2TN4A 3NSOA 1KWOB 1EXRA 1FI6A 1TNWA 4WRIA 2KYCA 3BFAA 3OBVA 1XA5A 2KAVA 3CZTX 1CB1A 1QVIZ 1YX7A 1CDNA 3EVRA 3B7AA 2JULA 3LL8B 3O4YA 1CDMA 2HQWA 1SMGA 2LP3A 3R1OA 1B1GA 3VRNA 2ZKMX 5EL2A 3VRRA 3CABA 1CMGA 1N65A 2JRFA 1M45A 1CLMA 1OOGA 4QJ3B 4N1GA 1OW4A 1DC1A 2K2FA 2AAOA 2K8MB 4DRWA 1SPYA 1YX8A 4YI8A 1CDPA 1CTRA 3EK4A 3DVMA 1DF0A 2JXLA 1DVIA 1M46A 2KI4C 1LINA 5AFPA 2A4JA 1AVSA 1EG3A 1FBVA 1SL7A 1G33A 2QEHA 1QX5B 4IJ7A 3NSKA 1Y1XA 1B47A 1XFUO 4L9MA 1YURA 1MWNA 1WRKA 4A4BA 1RWYA 1IQ3A 1K9KA 1B8RA 4P2YB 3OB1B 5F6TA 1YR5A 5IBWA 1PK0D 1JSAA 1U5IA 1ZFSA 1OZOA 1GJYA 1KFXS 1LVCD 1PVBA 2JZIA 2YGUA 3BQ3A 4C0LA 1CLBA 2B1UA 2JOJA 2L5YA 1J7OA 1ALWA 4MZJA 1UP5A 4TNCA 1NP8A 4YGEB 2KPHA 4PDZA 1OOHA 4XYNA 4ORCB 5DKNA 3PN7C 1KFUS 3O4XA 1BLQA 3NSLA 1JF2A 2Y4QA 3D76A 5CSFA 2CCMA 2KFGA 1XVJA 2M0RA 2KAYA 4ICBA 1UHHA 3EK8A 3RLZA 1T14A 2PVBA 3DXLA 4GFTA 3OGNA 4C0KA 1SKTA 3SG5A 5KTYA 3LK1A 5CSIA 1Y1AA 2F3ZA 1CM1A 4HRGA 1S6JA 5JOLA 1EJ3A 1UHIA 1NX3A 5K89A 2FCDA 2KI4B 1WRZA 2PMYA 1H8BA 2KGBC 2LUCA 2WCJA 2KI6D 1C07A 3VROA 3DF0B 2JPOA 1KK7Z 1CFCA 1WRLA 1YTZC 2JNFA 2L50A 3C1VA 4CFQA 1H4BA 2ERBA 5DICA 3CS1A 3OX5A 1NIWA 2GTEA 1IQ5A 3TDZA 1G8IA 3BYAA 3D73A 4ZCUA 4QJ4B 1DGVA 1OQPA 2BNXA 4N1FA 4I5NB 1RK9A 3SG2A 3SIBA 1V1FA 2PSRA 4QJ5B 1K93D 1NCXA 2LP2A 1ZMZA 2PASA 1XFZO 1A03A 2LVJA 1XFYO 1KCYA 2L0PA 1SL9A 2LM5A 1S6IA 3DVEA 2NXQA 3EVUA 3PN7B 1OMRA 2M3WA 1WDCC 1CDLA 2JT3A 5HKYA 4MN0A 5JJGA 3R1PA 1XFRA 4CLNA 3WHUB 1BMOA 1ORGA 1QIWA 2HQ8A 2PQLA 1FF1A 4USLA 4M2QA 3A4UB 3TS5C 3KPXA 3TZ1A 1IKUA 3OP0A 4M2PA 1K94A 2CBLA 2KAXA 4CPVA 3KEVA 1SSEB 4WQ2A 4U8DA 1OOJA 3BUOB 2EHBA 3BUMB 4DCKA 1TCFA 2COLB 2PRUA 1SYMA 1NUBA 2BKIB 1DJYA 4GUKA 2MHHA 2JWWA 2OS8C 1Z2CB 2LV7A 3GOFA 4MRYA 2LLSA 2P6BB 1DQEA 2ZN9A 1JF0A 2LLUA 4GGFA 1CFDA 1NWDA 3FWBA 1JWDA 2LCPA 1R6PA 3DY9A 5CPVA 4P5OE 1MXEA 3A8RA 1EL4A 1MUXA 1IGVA 3I5IC 4F0ZB 1J1DA 1WLMA 1AJ5A 1TRFA 3TDIA 1TUJA 3UNWA 2HF5A 2SASA 1YVLA 2KHNA 5B8IB 2KQ6A 5I2LA 1SK6D 2MRDA 1B9AA 2G9BA 2JTTA 2M7NA 1BT6A 1LKJA 2QEOA 3EKHA 1LXFC 4MBEA 3SG7A 1KSOA 3I5FC 3VB1A 1J7QA 2JTZA 2L4HA 3AKBA 1K8UA 2M1UA 1WDCB 1IH0A 2WOSA 1S3PA 1S5GZ 1A75A 2BAPA 3E3RA 1NCZA 3OB2B 4IL1A 1DMOA 1S1EA 4NDBA 3V2LA 2M29A 2BECA 3PM8A 3AAJA 3TS5B 1CFPA 1XK4A 5ER5A 5GQQC 2HETA 3R1VA 1UHNA 4CIDA 5HKWA 1A2XA 2FCEA 2Y1NA 1YRUB 1ODBA 5PALA 1P28A 4GGNA 1MXLC 1G4YR 1TOPA 4JWQA 4YRUA 2OS8B 2KI6C 1SCVA 2SCPA 4KYNA 5FI7A 2HPSA 3IF7A 2MA2A 1YVHA 2MJWB 3IQOA 4ORBB 1TNQA 2QPTA 3SS3A 1F71A 1BG1A 3EK7A 2WC6A 3D77A 2LE9B 3I5IB 4N5XA 3JTDC 2O60A 4FQOA 4UPGA 3S0EA 1DT7B 1DELA 2K61A 3MSEB 2CNPA 4MZLA 4INXA 2H61A 2LHLA 3CR4X 3TUYC 1DGUA 5I94A 1YUTA 1S6CA 3I5FB 1EH2A 1N0YA 1XO5A 5DKRA 1QLSA 1FW4A 2K2AA 2K7BA 4HREE 1B8LA 1QTXA 2H8VA 2LVVA 1CM4A 2K7DA 2L51A 2BBMA 2I7AA 3GK4X 3QRXA 2KGRA 3EVVA 1KFXL 4YGBB 4AQJA 1F8HA 1GQMA 2F33A 1B7TZ 1GGZA 2E30A 3NGVA 1KQMB 1KK8C 1ZOTB 2H2KA 2WCLA 2KBIA 1SBJA 3SIAA 1DJXA 1NX0A 2ISDA 1NX1A 2BE4A 3KO0A 1J1EA 1KFUL 1M31A 3FE6A 4XJKB 2JT8A 1QJTA 4DUQA 1DJHA 1BR1B 5I8NA 1QS7A 2KSPA 3SJSA 3S0AA 2ZRTA 1AHRA 2MLEC 4YBHB 3Q8IA 3ZNIA 3BOWB 3FS7A 3LK0A 4INWA 4A4CA 3JTDB 1YRTB 2LMUA 2VRGA 2KLDA 4MEWA 4CFRA 2M9GA 4MLWA 3CZ2A 3SG3A 2Q4UA 2P71A 1HQVA 2V53A 3DF0A 3TUYB 2BCAA 1M39A 5I2OA 1L2OB 1A29A 5CSJA 1CMFA 1NSHA 1UUSA 1CNPA 2JNXA 2ZNDA 2M1KB 3BXKA 5HKZA 1CKKA 1TN4A 3WXAA 1DJWA 1PSBA 2DOQA 2Q91A 1GM0A 1OSAA 1ZACA 5AEQA 4PHKA 1AJ4A 1OOFA 3ZWHA 3L47A 1BOCA 2LLTA 4OCIA 4ETOA 2JC2A 3RM1A 4JPZB 3NHIA 1KK8B 1HT9A 1TIZA 2CT9A 1K95A 2L98A 2WCFA 1AP4A 2QEVA 3O6BA 2M7LA 2K7OA 2ZRSA 3CLNA 3BJHA 3OX6A 1R2UA 2LAPA 2L2EA 1PVAA 1X02A 1C7VA 2F2OA 1RFJA 2WCKA 1TNPA 5AERA 5DKQA 4BY4A 1OMDA 1SNLA 3PFVA 2OTGC 5G08A 2BE6A 4GPLB 1QV1A 1W7JB 4M2OA 1QIVA 1RTP1 2D8NA 1F4QA 4JQ0D 1JBAA 2KFFA 4PE0A 2GV5A 2KLEA 1V1GA 1TWOA 3HX4A 2FOTA 3CZ1A 2L4IA 4HSZA 3PATA 1QX7A 3CR2A 2MAZA 3VRQA 2KDHA 1PALA 3NXAA 1K90D 1JUOA 1IG5A 1XYDA 3BFHA 1LA3A 3SG6A 2WORA 1QWVA 2FJYA 4I5KA 4BY5A 2NZ0A 5D69A 5AANA 4F7FA 1F54A 1OMVA 1L7ZA 1RROA 4AOMA 2CXJA 5D7FA 2ZN8A 1UHKA 1K96A 3SS5A 1MR8A 3B88A 4YGCB 4R1EA 5HYDA 4OV2A 1Q80A 2AMIA 2I18A 1UURA 3DZTA 3PLFB 4DIRA 1F55A 3LCPC 4E68A 2OPOA 2L2CA 1Z4HA 3KHEA 4GBAA 5J3XA 3BUNB 3I5HC 3FWCA 1KQMC 3FE8A 1MHOA 1Y1UA 3SS4A 3FIAA 1SR6C 4MRXA 1IIOA 2OTGB 4PHNA 4PE7A 3OHMB 1KSMA 2FJUB 2LVIA 3BUXB 4PCWA 1FI5A 5KSZA 1N2DA 3JVTC 3S0BA 2KBMA 2KNEA 2KQYA 2P70A 4YGAA 3RZSA 2I2RE 2K7CA 3R72A 4PE1A 4YI9A 3CYZA 2F3YA 3F45A 1SL8A 4DS7A 5KU1A 2JPTA 1MQ1A 2LC5A 4I5LB 1F70A 3CWGA 1Y0VH 2JT0A 5ER4X 2K0JA 3QMEA 3D0YB 1ALVA 1JFKA 2O5GA 1K2HA 3PSRA 4D1EA 1L2OC 3VRPA 3L4LA 1UHJA 2NCOA 2KFHA 2QEBA 2NLNA 1DF0B 1LS8A 3D0YA 4ZCVA 1DJGA 3D74A 2K60A 3WHTB 1NX2A 1DEKA 4Q04A 1C7WA 1J55A 2JU0A 3N7HA 1XFVO 2WNDA 2IS9A 4OR9B 3DVKA 5FYXA 1S36A 2ZNEA 1RECA 3AAKA 3CGAA 3I5GC 1IRJA 1DJIA 3K21A 3DYEA 3PJIA 3FE9A 1RJVA 5CSNA 4FQTA 3O78A 5FI2A 3I5HB 1TCOB 3ICBA 1S5GY 1QVIY 2LVKA 1U5IB 3D10A 4FTGA 4PHMA 1SR6B 3L4AA 2PALA 1QV0A 5HL1A 2EC6C 3GK1A 3M0WA 1BF5A 1B8CA 4YGDB 1OZSA 3JVTB 1BODA 4PT1A 3S0FA 3DVJA 3S0DA 1C3YA 4OZDA 1S26D 1EG4A 2LMVA 1QX2A 2MLFC 4NDCA 4XJKA 2LHIA 3NSIA 4OKHA 2LUXA 1W9ZA 2BL0C 2I94A 4HRHA 2BCXA 4MVFA 3S0GA 1B4CA 3BOWA 1CLLA 1E8AA 3PM2A 1SCMC 2JQ6A 3HCMA 4MZKA 1UWOA 5HLOA 2KOTA 2CTNA 1IJ6A 1QATA 2R2IA 3BUWB 3CZ0A 4MSPA 3IQQA 2F8PA 4C0JA 4GGFC 2M49B 2L5XB 2JXCA
chains in the Genus database with same CATH topology
3R1VA 1OOIX 1P28A 2WCHA 3BFHA 2KPHA 1QWVA 2FJYA 1OOHA 4F7FA 3D76A 3NHTA 2WC6A 3D77A 1T14A 3DXLA 3OGNA 3B88A 3S0EA 3B87A 3CDNA 3DZTA 4INXA 2L2CA 2WCJA 2WC5A 4JD9A 3FE8A 2JPOA 2ERBA 5DICA 2H8VA 2GTEA 2WCMA 3K1EA 3B6XA 3D73A 3S0BA 1C3ZA 2P70A 3NGVA 3RZSA 3R72A 3CYZA 2WCLA 3QMEA 3B86A 3FE6A 3L4LA 2QEBA 3S0AA 1LS8A 3D78A 3D74A 3Q8IA 3R1PA 4INWA 1XFRA 3N7HA 1ORGA 3BFBA 2PQLA 2QDIA 3CZ2A 3D75A 2P71A 3DYEA 3PJIA 3FE9A 3BFAA 4FQTA 3B7AA 3R1OA 1DQEA 3L4AA 5EL2A 1GM0A 3CABA 3DY9A 1OOFA 3L47A 1OOGA 4PT1A 3S0FA 1C3YA 1TUJA 3S0DA 3NHIA 1OW4A 4OZDA 2QEVA 2QEOA 3BJHA 3VB1A 3S0GA 2QEHA 2WCKA 3V2LA 3CZ0A 1TWOA 3CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1V A;  1OOI X;  1P28 A;  2WCH A;  3BFH A;  2KPH A;  1QWV A;  2FJY A;  1OOH A;  4F7F A;  3D76 A;  3NHT A;  2WC6 A;  3D77 A;  1T14 A;  3DXL A;  3OGN A;  3B88 A;  3S0E A;  3B87 A;  3CDN A;  3DZT A;  4INX A;  2L2C A;  2WCJ A;  2WC5 A;  4JD9 A;  3FE8 A;  2JPO A;  2ERB A;  5DIC A;  2H8V A;  2GTE A;  2WCM A;  3K1E A;  3B6X A;  3D73 A;  3S0B A;  1C3Z A;  2P70 A;  3NGV A;  3RZS A;  3R72 A;  3CYZ A;  2WCL A;  3QME A;  3B86 A;  3FE6 A;  3L4L A;  2QEB A;  3S0A A;  1LS8 A;  3D78 A;  3D74 A;  3Q8I A;  3R1P A;  4INW A;  1XFR A;  3N7H A;  1ORG A;  3BFB A;  2PQL A;  2QDI A;  3CZ2 A;  3D75 A;  2P71 A;  3DYE A;  3PJI A;  3FE9 A;  3BFA A;  4FQT A;  3B7A A;  3R1O A;  1DQE A;  3L4A A;  5EL2 A;  1GM0 A;  3CAB A;  3DY9 A;  1OOF A;  3L47 A;  1OOG A;  4PT1 A;  3S0F A;  1C3Y A;  1TUJ A;  3S0D A;  3NHI A;  1OW4 A;  4OZD A;  2QEV A;  2QEO A;  3BJH A;  3VB1 A;  3S0G A;  2QEH A;  2WCK A;  3V2L A;  3CZ0 A;  1TWO A;  3CZ1 A; 
#chains in the Genus database with same CATH topology
 3I5G B;  2PYQ A;  4ORA B;  1QLK A;  1YUU A;  1OOI X;  1NPQ A;  3DD4 A;  1SW8 A;  2WCH A;  2Y5I A;  2ZFD A;  2AUC A;  1XFX O;  1OE9 B;  4GNK B;  4PHJ A;  3O2P A;  1XFW O;  3KF9 A;  2M8U A;  1F4O A;  1DJZ A;  1SRA A;  1PSR A;  2RGI A;  1WY9 A;  2EC6 B;  1M63 B;  1B7T Y;  3NHT A;  3SG4 A;  3TDU A;  1MF8 B;  3LLE A;  2EGD A;  5I2Q A;  1JC2 A;  3UO9 A;  3IVT A;  1SY9 A;  2LNK A;  1FPW A;  2WC8 A;  1JFJ A;  1K9U A;  1IJ5 A;  2LAN A;  3B87 A;  1A4P A;  3CDN A;  2GGZ A;  1KWO C;  2MBX A;  1NYA A;  1K9P A;  2BL0 B;  2BBN A;  3WNX B;  2GGM A;  1TUZ A;  3PAL A;  1GGW A;  2F2P A;  1TNX A;  1XK4 C;  1J7R A;  1TTX A;  2WC5 A;  1NCY A;  2E6W A;  4JD9 A;  2LMT A;  1VRK A;  1KK7 Y;  1SCM B;  1PRW A;  1BR4 B;  3AKA A;  1QXP A;  4OVN F;  2Y1M A;  4NDD A;  1AUI B;  1LA0 A;  1DTL A;  1W7I B;  4AQI A;  5BPJ A;  2WCM A;  3K1E A;  3B6X A;  1KQV A;  4NQG A;  2KYF A;  1C3Z A;  1YUS A;  1Y6W A;  4I5J A;  2WCB A;  5D3O A;  2BCB A;  5FI6 A;  1BU3 A;  1D1O A;  1CFF A;  1QAS A;  4PAL A;  3H4S E;  1AK8 A;  4GAO A;  3EKJ A;  3B86 A;  3CR5 X;  4WQ3 A;  2H61 C;  5HLV A;  2BKH B;  1WLZ A;  2M97 A;  5TNC A;  3VGO A;  3CTN A;  3GK2 A;  5AXI A;  1J7P A;  1BJF A;  1ZUZ A;  3D78 A;  2NCP A;  3EG5 B;  4JKT A;  1IWQ A;  2WCE A;  4PE4 A;  3BFB A;  2QAC A;  2QDI A;  1PUL A;  1A75 B;  2G2B A;  3D75 A;  2TN4 A;  3NSO A;  1KWO B;  1EXR A;  1FI6 A;  1TNW A;  4WRI A;  2KYC A;  3BFA A;  3OBV A;  1XA5 A;  2KAV A;  3CZT X;  1CB1 A;  1QVI Z;  1YX7 A;  1CDN A;  3EVR A;  3B7A A;  2JUL A;  3LL8 B;  3O4Y A;  1CDM A;  2HQW A;  1SMG A;  2LP3 A;  3R1O A;  1B1G A;  3VRN A;  2ZKM X;  5EL2 A;  3VRR A;  3CAB A;  1CMG A;  1N65 A;  2JRF A;  1M45 A;  1CLM A;  1OOG A;  4QJ3 B;  4N1G A;  1OW4 A;  1DC1 A;  2K2F A;  2AAO A;  2K8M B;  4DRW A;  1SPY A;  1YX8 A;  4YI8 A;  1CDP A;  1CTR A;  3EK4 A;  3DVM A;  1DF0 A;  2JXL A;  1DVI A;  1M46 A;  2KI4 C;  1LIN A;  5AFP A;  2A4J A;  1AVS A;  1EG3 A;  1FBV A;  1SL7 A;  1G33 A;  2QEH A;  1QX5 B;  4IJ7 A;  3NSK A;  1Y1X A;  1B47 A;  1XFU O;  4L9M A;  1YUR A;  1MWN A;  1WRK A;  4A4B A;  1RWY A;  1IQ3 A;  1K9K A;  1B8R A;  4P2Y B;  3OB1 B;  5F6T A;  1YR5 A;  5IBW A;  1PK0 D;  1JSA A;  1U5I A;  1ZFS A;  1OZO A;  1GJY A;  1KFX S;  1LVC D;  1PVB A;  2JZI A;  2YGU A;  3BQ3 A;  4C0L A;  1CLB A;  2B1U A;  2JOJ A;  2L5Y A;  1J7O A;  1ALW A;  4MZJ A;  1UP5 A;  4TNC A;  1NP8 A;  4YGE B;  2KPH A;  4PDZ A;  1OOH A;  4XYN A;  4ORC B;  5DKN A;  3PN7 C;  1KFU S;  3O4X A;  1BLQ A;  3NSL A;  1JF2 A;  2Y4Q A;  3D76 A;  5CSF A;  2CCM A;  2KFG A;  1XVJ A;  2M0R A;  2KAY A;  4ICB A;  1UHH A;  3EK8 A;  3RLZ A;  1T14 A;  2PVB A;  3DXL A;  4GFT A;  3OGN A;  4C0K A;  1SKT A;  3SG5 A;  5KTY A;  3LK1 A;  5CSI A;  1Y1A A;  2F3Z A;  1CM1 A;  4HRG A;  1S6J A;  5JOL A;  1EJ3 A;  1UHI A;  1NX3 A;  5K89 A;  2FCD A;  2KI4 B;  1WRZ A;  2PMY A;  1H8B A;  2KGB C;  2LUC A;  2WCJ A;  2KI6 D;  1C07 A;  3VRO A;  3DF0 B;  2JPO A;  1KK7 Z;  1CFC A;  1WRL A;  1YTZ C;  2JNF A;  2L50 A;  3C1V A;  4CFQ A;  1H4B A;  2ERB A;  5DIC A;  3CS1 A;  3OX5 A;  1NIW A;  2GTE A;  1IQ5 A;  3TDZ A;  1G8I A;  3BYA A;  3D73 A;  4ZCU A;  4QJ4 B;  1DGV A;  1OQP A;  2BNX A;  4N1F A;  4I5N B;  1RK9 A;  3SG2 A;  3SIB A;  1V1F A;  2PSR A;  4QJ5 B;  1K93 D;  1NCX A;  2LP2 A;  1ZMZ A;  2PAS A;  1XFZ O;  1A03 A;  2LVJ A;  1XFY O;  1KCY A;  2L0P A;  1SL9 A;  2LM5 A;  1S6I A;  3DVE A;  2NXQ A;  3EVU A;  3PN7 B;  1OMR A;  2M3W A;  1WDC C;  1CDL A;  2JT3 A;  5HKY A;  4MN0 A;  5JJG A;  3R1P A;  1XFR A;  4CLN A;  3WHU B;  1BMO A;  1ORG A;  1QIW A;  2HQ8 A;  2PQL A;  1FF1 A;  4USL A;  4M2Q A;  3A4U B;  3TS5 C;  3KPX A;  3TZ1 A;  1IKU A;  3OP0 A;  4M2P A;  1K94 A;  2CBL A;  2KAX A;  4CPV A;  3KEV A;  1SSE B;  4WQ2 A;  4U8D A;  1OOJ A;  3BUO B;  2EHB A;  3BUM B;  4DCK A;  1TCF A;  2COL B;  2PRU A;  1SYM A;  1NUB A;  2BKI B;  1DJY A;  4GUK A;  2MHH A;  2JWW A;  2OS8 C;  1Z2C B;  2LV7 A;  3GOF A;  4MRY A;  2LLS A;  2P6B B;  1DQE A;  2ZN9 A;  1JF0 A;  2LLU A;  4GGF A;  1CFD A;  1NWD A;  3FWB A;  1JWD A;  2LCP A;  1R6P A;  3DY9 A;  5CPV A;  4P5O E;  1MXE A;  3A8R A;  1EL4 A;  1MUX A;  1IGV A;  3I5I C;  4F0Z B;  1J1D A;  1WLM A;  1AJ5 A;  1TRF A;  3TDI A;  1TUJ A;  3UNW A;  2HF5 A;  2SAS A;  1YVL A;  2KHN A;  5B8I B;  2KQ6 A;  5I2L A;  1SK6 D;  2MRD A;  1B9A A;  2G9B A;  2JTT A;  2M7N A;  1BT6 A;  1LKJ A;  2QEO A;  3EKH A;  1LXF C;  4MBE A;  3SG7 A;  1KSO A;  3I5F C;  3VB1 A;  1J7Q A;  2JTZ A;  2L4H A;  3AKB A;  1K8U A;  2M1U A;  1WDC B;  1IH0 A;  2WOS A;  1S3P A;  1S5G Z;  1A75 A;  2BAP A;  3E3R A;  1NCZ A;  3OB2 B;  4IL1 A;  1DMO A;  1S1E A;  4NDB A;  3V2L A;  2M29 A;  2BEC A;  3PM8 A;  3AAJ A;  3TS5 B;  1CFP A;  1XK4 A;  5ER5 A;  5GQQ C;  2HET A;  3R1V A;  1UHN A;  4CID A;  5HKW A;  1A2X A;  2FCE A;  2Y1N A;  1YRU B;  1ODB A;  5PAL A;  1P28 A;  4GGN A;  1MXL C;  1G4Y R;  1TOP A;  4JWQ A;  4YRU A;  2OS8 B;  2KI6 C;  1SCV A;  2SCP A;  4KYN A;  5FI7 A;  2HPS A;  3IF7 A;  2MA2 A;  1YVH A;  2MJW B;  3IQO A;  4ORB B;  1TNQ A;  2QPT A;  3SS3 A;  1F71 A;  1BG1 A;  3EK7 A;  2WC6 A;  3D77 A;  2LE9 B;  3I5I B;  4N5X A;  3JTD C;  2O60 A;  4FQO A;  4UPG A;  3S0E A;  1DT7 B;  1DEL A;  2K61 A;  3MSE B;  2CNP A;  4MZL A;  4INX A;  2H61 A;  2LHL A;  3CR4 X;  3TUY C;  1DGU A;  5I94 A;  1YUT A;  1S6C A;  3I5F B;  1EH2 A;  1N0Y A;  1XO5 A;  5DKR A;  1QLS A;  1FW4 A;  2K2A A;  2K7B A;  4HRE E;  1B8L A;  1QTX A;  2H8V A;  2LVV A;  1CM4 A;  2K7D A;  2L51 A;  2BBM A;  2I7A A;  3GK4 X;  3QRX A;  2KGR A;  3EVV A;  1KFX L;  4YGB B;  4AQJ A;  1F8H A;  1GQM A;  2F33 A;  1B7T Z;  1GGZ A;  2E30 A;  3NGV A;  1KQM B;  1KK8 C;  1ZOT B;  2H2K A;  2WCL A;  2KBI A;  1SBJ A;  3SIA A;  1DJX A;  1NX0 A;  2ISD A;  1NX1 A;  2BE4 A;  3KO0 A;  1J1E A;  1KFU L;  1M31 A;  3FE6 A;  4XJK B;  2JT8 A;  1QJT A;  4DUQ A;  1DJH A;  1BR1 B;  5I8N A;  1QS7 A;  2KSP A;  3SJS A;  3S0A A;  2ZRT A;  1AHR A;  2MLE C;  4YBH B;  3Q8I A;  3ZNI A;  3BOW B;  3FS7 A;  3LK0 A;  4INW A;  4A4C A;  3JTD B;  1YRT B;  2LMU A;  2VRG A;  2KLD A;  4MEW A;  4CFR A;  2M9G A;  4MLW A;  3CZ2 A;  3SG3 A;  2Q4U A;  2P71 A;  1HQV A;  2V53 A;  3DF0 A;  3TUY B;  2BCA A;  1M39 A;  5I2O A;  1L2O B;  1A29 A;  5CSJ A;  1CMF A;  1NSH A;  1UUS A;  1CNP A;  2JNX A;  2ZND A;  2M1K B;  3BXK A;  5HKZ A;  1CKK A;  1TN4 A;  3WXA A;  1DJW A;  1PSB A;  2DOQ A;  2Q91 A;  1GM0 A;  1OSA A;  1ZAC A;  5AEQ A;  4PHK A;  1AJ4 A;  1OOF A;  3ZWH A;  3L47 A;  1BOC A;  2LLT A;  4OCI A;  4ETO A;  2JC2 A;  3RM1 A;  4JPZ B;  3NHI A;  1KK8 B;  1HT9 A;  1TIZ A;  2CT9 A;  1K95 A;  2L98 A;  2WCF A;  1AP4 A;  2QEV A;  3O6B A;  2M7L A;  2K7O A;  2ZRS A;  3CLN A;  3BJH A;  3OX6 A;  1R2U A;  2LAP A;  2L2E A;  1PVA A;  1X02 A;  1C7V A;  2F2O A;  1RFJ A;  2WCK A;  1TNP A;  5AER A;  5DKQ A;  4BY4 A;  1OMD A;  1SNL A;  3PFV A;  2OTG C;  5G08 A;  2BE6 A;  4GPL B;  1QV1 A;  1W7J B;  4M2O A;  1QIV A;  1RTP 1;  2D8N A;  1F4Q A;  4JQ0 D;  1JBA A;  2KFF A;  4PE0 A;  2GV5 A;  2KLE A;  1V1G A;  1TWO A;  3HX4 A;  2FOT A;  3CZ1 A;  2L4I A;  4HSZ A;  3PAT A;  1QX7 A;  3CR2 A;  2MAZ A;  3VRQ A;  2KDH A;  1PAL A;  3NXA A;  1K90 D;  1JUO A;  1IG5 A;  1XYD A;  3BFH A;  1LA3 A;  3SG6 A;  2WOR A;  1QWV A;  2FJY A;  4I5K A;  4BY5 A;  2NZ0 A;  5D69 A;  5AAN A;  4F7F A;  1F54 A;  1OMV A;  1L7Z A;  1RRO A;  4AOM A;  2CXJ A;  5D7F A;  2ZN8 A;  1UHK A;  1K96 A;  3SS5 A;  1MR8 A;  3B88 A;  4YGC B;  4R1E A;  5HYD A;  4OV2 A;  1Q80 A;  2AMI A;  2I18 A;  1UUR A;  3DZT A;  3PLF B;  4DIR A;  1F55 A;  3LCP C;  4E68 A;  2OPO A;  2L2C A;  1Z4H A;  3KHE A;  4GBA A;  5J3X A;  3BUN B;  3I5H C;  3FWC A;  1KQM C;  3FE8 A;  1MHO A;  1Y1U A;  3SS4 A;  3FIA A;  1SR6 C;  4MRX A;  1IIO A;  2OTG B;  4PHN A;  4PE7 A;  3OHM B;  1KSM A;  2FJU B;  2LVI A;  3BUX B;  4PCW A;  1FI5 A;  5KSZ A;  1N2D A;  3JVT C;  3S0B A;  2KBM A;  2KNE A;  2KQY A;  2P70 A;  4YGA A;  3RZS A;  2I2R E;  2K7C A;  3R72 A;  4PE1 A;  4YI9 A;  3CYZ A;  2F3Y A;  3F45 A;  1SL8 A;  4DS7 A;  5KU1 A;  2JPT A;  1MQ1 A;  2LC5 A;  4I5L B;  1F70 A;  3CWG A;  1Y0V H;  2JT0 A;  5ER4 X;  2K0J A;  3QME A;  3D0Y B;  1ALV A;  1JFK A;  2O5G A;  1K2H A;  3PSR A;  4D1E A;  1L2O C;  3VRP A;  3L4L A;  1UHJ A;  2NCO A;  2KFH A;  2QEB A;  2NLN A;  1DF0 B;  1LS8 A;  3D0Y A;  4ZCV A;  1DJG A;  3D74 A;  2K60 A;  3WHT B;  1NX2 A;  1DEK A;  4Q04 A;  1C7W A;  1J55 A;  2JU0 A;  3N7H A;  1XFV O;  2WND A;  2IS9 A;  4OR9 B;  3DVK A;  5FYX A;  1S36 A;  2ZNE A;  1REC A;  3AAK A;  3CGA A;  3I5G C;  1IRJ A;  1DJI A;  3K21 A;  3DYE A;  3PJI A;  3FE9 A;  1RJV A;  5CSN A;  4FQT A;  3O78 A;  5FI2 A;  3I5H B;  1TCO B;  3ICB A;  1S5G Y;  1QVI Y;  2LVK A;  1U5I B;  3D10 A;  4FTG A;  4PHM A;  1SR6 B;  3L4A A;  2PAL A;  1QV0 A;  5HL1 A;  2EC6 C;  3GK1 A;  3M0W A;  1BF5 A;  1B8C A;  4YGD B;  1OZS A;  3JVT B;  1BOD A;  4PT1 A;  3S0F A;  3DVJ A;  3S0D A;  1C3Y A;  4OZD A;  1S26 D;  1EG4 A;  2LMV A;  1QX2 A;  2MLF C;  4NDC A;  4XJK A;  2LHI A;  3NSI A;  4OKH A;  2LUX A;  1W9Z A;  2BL0 C;  2I94 A;  4HRH A;  2BCX A;  4MVF A;  3S0G A;  1B4C A;  3BOW A;  1CLL A;  1E8A A;  3PM2 A;  1SCM C;  2JQ6 A;  3HCM A;  4MZK A;  1UWO A;  5HLO A;  2KOT A;  2CTN A;  1IJ6 A;  1QAT A;  2R2I A;  3BUW B;  3CZ0 A;  4MSP A;  3IQQ A;  2F8P A;  4C0J A;  4GGF C;  2M49 B;  2L5X B;  2JXC A; 
#chains in the Genus database with same CATH homology
 3R1V A;  1OOI X;  1P28 A;  2WCH A;  3BFH A;  2KPH A;  1QWV A;  2FJY A;  1OOH A;  4F7F A;  3D76 A;  3NHT A;  2WC6 A;  3D77 A;  1T14 A;  3DXL A;  3OGN A;  3B88 A;  3S0E A;  3B87 A;  3CDN A;  3DZT A;  4INX A;  2L2C A;  2WCJ A;  2WC5 A;  4JD9 A;  3FE8 A;  2JPO A;  2ERB A;  5DIC A;  2H8V A;  2GTE A;  2WCM A;  3K1E A;  3B6X A;  3D73 A;  3S0B A;  1C3Z A;  2P70 A;  3NGV A;  3RZS A;  3R72 A;  3CYZ A;  2WCL A;  3QME A;  3B86 A;  3FE6 A;  3L4L A;  2QEB A;  3S0A A;  1LS8 A;  3D78 A;  3D74 A;  3Q8I A;  3R1P A;  4INW A;  1XFR A;  3N7H A;  1ORG A;  3BFB A;  2PQL A;  2QDI A;  3CZ2 A;  3D75 A;  2P71 A;  3DYE A;  3PJI A;  3FE9 A;  3BFA A;  4FQT A;  3B7A A;  3R1O A;  1DQE A;  3L4A A;  5EL2 A;  1GM0 A;  3CAB A;  3DY9 A;  1OOF A;  3L47 A;  1OOG A;  4PT1 A;  3S0F A;  1C3Y A;  1TUJ A;  3S0D A;  3NHI A;  1OW4 A;  4OZD A;  2QEV A;  2QEO A;  3BJH A;  3VB1 A;  3S0G A;  2QEH A;  2WCK A;  3V2L A;  3CZ0 A;  1TWO A;  3CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...