3B7AA

Complex of s52a substituted droposphila lush protein with ethanol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
b'MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVALMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b7aA00
2QEBA 3BFHA 3CZ0A 3BFBA 1OOFA 2GTEA 3D78A 2WC5A 3N7HA 1C3ZA 2WC6A 2ERBA 3D76A 3NHTA 3R72A 1OOGA 3R1PA 3FE6A 2PQLA 3S0BA 2QEVA 3NHIA 3S0GA 3NGVA 4OZDA 2WCKA 3R1OA 2WCJA 1TUJA 3BJHA 1TWOA 3D75A 1C3YA 3CYZA 3B6XA 3S0DA 2WCMA 2WCHA 2QEHA 3R1VA 4FQTA 2QEOA 1ORGA 3V2LA 2WCLA 3DY9A 4JD9A 2QDIA 2L2CA 3DXLA 3D77A 4F7FA 3S0EA 3B88A 3L47A 3L4AA 3PJIA 3Q8IA 3S0AA 1LS8A 2JPOA 3DYEA 3CABA 1XFRA 3B87A 2P71A 3DZTA 3B86A 3D73A 1GM0A 3CDNA 5EL2A 1OOIX 1OW4A 3RZSA 3K1EA 4INWA 3CZ2A 3FE9A 3S0FA 3FE8A 4INXA 1DQEA 1P28A 2P70A 2FJYA 1OOHA 3CZ1A 3L4LA 3B7AA 1QWVA 3D74A 3QMEA 3VB1A 3BFAA 2H8VA 2KPHA 4PT1A 5DICA 1T14A 3OGNA
chains in the Genus database with same CATH superfamily
5GQQC 1UHHA 1FW4A 4OV2A 3RLZA 2K7DA 1JSAA 1ZUZA 3NSOA 3TZ1A 3A8RA 2JTTA 2MLFC 2WCFA 4CFQA 2I2RE 1YRTB 4A4BA 1C3ZA 1QATA 2PVBA 2ZN9A 4FTGA 5CSNA 1ZACA 1B7TY 2LUXA 1MXEA 1S6JA 1X02A 4KYNA 2M1UA 2L5YA 3I5GB 4PE7A 4PHKA 1SMGA 4YI8A 5KTYA 5FYXA 2SASA 1OOGA 1KSOA 2JQ6A 2A4JA 5TNCA 2MJWB 5JJGA 1A29A 3IQOA 2KQ6A 2M3WA 4PHJA 4USLA 1IRJA 1WY9A 3AKBA 2JULA 1CFFA 2PQLA 1C7WA 1FI6A 5I2QA 3OB1B 5CPVA 3VRPA 2JXLA 2MRDA 1IQ5A 1KFUS 2HQWA 2LP2A 2L98A 4NDDA 4OR9B 1NCZA 1CLLA 4HREE 5HKYA 1XFXO 3F45A 1TUJA 2LAPA 1TWOA 3NSIA 5IBWA 1CMFA 2KQYA 2JT0A 1KFUL 1QXPA 1BR1B 3C1VA 1YR5A 2BCBA 5D3OA 5PALA 2CBLA 3NXAA 3S0DA 3LLEA 3BOWA 2WCHA 1WLMA 3JTDB 2K0JA 1J7QA 1Q80A 2KFHA 1IJ6A 1TNWA 1DF0B 2L4IA 1MQ1A 1CDNA 3TDUA 4AQIA 1BMOA 2D8NA 2Q4UA 1B8RA 4OKHA 3I5IC 2GGZA 1FF1A 4MZJA 1K8UA 4YGCB 1AP4A 3DXLA 3KHEA 2FJUB 3D0YB 1W9ZA 4MVFA 1RFJA 3PLFB 3CR5X 3EK4A 2H61C 1NSHA 1PULA 1AK8A 1ALVA 1CDPA 1F4QA 4Q04A 1S5GZ 4ORCB 1S36A 1JF2A 4E68A 1A03A 1PSBA 1EG3A 3PJIA 3TDIA 3Q8IA 2Y4QA 2Y1MA 1XFYO 1G33A 2AUCA 1SL7A 2AMIA 3DF0B 1DJGA 1QV1A 3DVMA 3DZTA 3PALA 1GM0A 1R2UA 1SW8A 1S26D 2K2FA 4XJKA 1D1OA 5KU1A 1DJHA 5EL2A 1YUTA 1JBAA 1AJ4A 3OX6A 1KCYA 1JF0A 3WXAA 2BKHB 3O4XA 1OW4A 2JWWA 3WHUB 2M8UA 1OMDA 4OCIA 3SG5A 2KI6D 3EKHA 3GOFA 2MAZA 1K2HA 1L7ZA 1K9UA 1F71A 1W7JB 5J3XA 2HF5A 3O6BA 3CR4X 3CGAA 1TNQA 2F2OA 5HL1A 1JFJA 1QVIZ 1YVLA 1CFCA 1OOHA 2F2PA 4MZKA 1YURA 3SG3A 3I5HB 4MZLA 3QMEA 1BLQA 1M39A 1DEKA 4DCKA 4QJ3B 2H8VA 1SCMB 4IJ7A 5DICA 1NX0A 3NSKA 1K96A 1S6IA 1UWOA 2BL0B 1L2OB 2YGUA 1V1FA 1XFZO 2QACA 2QPTA 1SY9A 1QS7A 1Y1XA 1M63B 1KFXS 1NX1A 1H8BA 1B9AA 1Y1AA 4N1FA 1WRKA 2BCAA 1RECA 4CFRA 1UHJA 5BPJA 1S1EA 2LCPA 3JVTC 2FCEA 2TN4A 5HLOA 1K9KA 1K94A 1ZMZA 3CS1A 4GGFA 4M2PA 1MUXA 4QJ4B 2KI6C 2PMYA 3CR2A 2WC6A 3OBVA 2JT3A 3JVTB 1AHRA 1ODBA 4HRHA 2LVIA 1XVJA 1BODA 1S6CA 3PATA 5I2LA 1CNPA 3FE6A 2ZFDA 2B1UA 1F54A 1ZFSA 5AEQA 4HSZA 2HPSA 4GGFC 4OVNF 2LVVA 2IS9A 1N2DA 2QEVA 3BXKA 1WLZA 1DGVA 1XYDA 2WNDA 2LMTA 3SIBA 1QASA 4A4CA 1GGWA 1SR6C 4OZDA 1TNPA 3PFVA 3OX5A 2EC6C 4WQ3A 1EL4A 2WCKA 3IF7A 5AXIA 1Y0VH 3R1OA 1OOJA 2LNKA 2KBIA 2WCJA 1DELA 2P6BB 3D75A 1C3YA 2NCPA 3TUYC 2PSRA 3CYZA 3LK0A 3GK4X 5D7FA 1TCFA 1UHNA 1G4YR 1U5IB 1QX2A 1NYAA 2BE6A 3SG6A 3R1VA 1XA5A 4ORAB 4YRUA 1MHOA 1MXLC 3DD4A 4FQTA 2QEOA 3TS5C 1RJVA 1SL9A 1PK0D 1GGZA 2WCLA 3DVEA 1QV0A 3DY9A 1LA0A 2HETA 2QDIA 2L2CA 2BCXA 2F8PA 4JKTA 5HKZA 1CKKA 3D77A 3EVVA 4L9MA 2MBXA 3S0EA 1AVSA 1FPWA 3RM1A 3FWCA 2GV5A 3EK7A 2K7CA 4MN0A 4MRXA 1CDLA 1KQMC 2HQ8A 2CTNA 1VRKA 1FI5A 2K7BA 2E6WA 2BNXA 2JPTA 2KDHA 1K9PA 3CABA 3DYEA 2BAPA 4XYNA 5HYDA 1DJXA 3B86A 2NCOA 3D73A 3QRXA 5DKNA 2LHIA 3AAKA 1N65A 1SCVA 1BG1A 4JPZB 1XFWO 3CDNA 4I5JA 3NSLA 3WHTB 2JZIA 1MF8B 2CNPA 1UURA 2LP3A 5F6TA 2JTZA 3SS4A 3RZSA 3K1EA 2LC5A 3CZTX 4INWA 2M7NA 1NCXA 3FE9A 4ICBA 4F0ZB 3S0FA 3SG2A 4D1EA 1LKJA 4ZCUA 1QX7A 3VRQA 1YTZC 4CIDA 1Z2CB 1RROA 2M0RA 2OPOA 2ISDA 4NDBA 3SG4A 3SG7A 1IKUA 1SRAA 2P70A 2FJYA 3VRNA 2L4HA 3EVUA 1S5GY 3L4LA 4U8DA 1A4PA 3I5IB 1QWVA 3AAJA 1W7IB 1M45A 2JC2A 3LCPC 5FI6A 3D74A 2Y5IA 1KSMA 2E30A 4YI9A 1B8LA 4BY4A 2KPHA 4PT1A 1Y1UA 3BOWB 4N5XA 1DMOA 5JOLA 2H2KA 1BU3A 2LUCA 1XO5A 1S3PA 1XK4A 2QEBA 4WQ2A 3BYAA 2WCBA 4MLWA 3BFHA 1A75B 2JNXA 3A4UB 1OOFA 2JNFA 1TN4A 2JU0A 2GTEA 2MA2A 3D78A 1J7PA 2LHLA 2WC5A 1SYMA 2ZNDA 1YRUB 4MRYA 4GFTA 1PSRA 5FI7A 1AUIB 1BJFA 4PCWA 1NPQA 1QVIY 2WORA 4PALA 1B47A 3VRRA 1DT7B 3R72A 1GQMA 1UHIA 2G9BA 4C0JA 1MR8A 1DJIA 1EG4A 2CT9A 4HRGA 4TNCA 3BUXB 1RK9A 1R6PA 3PN7C 4XJKB 3UNWA 4QJ5B 2NZ0A 1CB1A 1F70A 3KO0A 3NHIA 4AOMA 2KAVA 1M31A 1IG5A 5FI2A 1EJ3A 4GUKA 5ER5A 3WNXB 3TDZA 2JOJA 1KK7Z 3PN7B 1SL8A 3I5FC 4MSPA 4PHNA 1IH0A 1KFXL 2OS8C 2KLEA 1V1GA 1J1DA 4ETOA 3OHMB 1K95A 3BJHA 2I7AA 2I18A 5DKQA 3BUNB 1BF5A 3PM8A 2PASA 3B6XA 1DTLA 5HKWA 2WCMA 2NLNA 2CCMA 4ORBB 2KSPA 1CDMA 2KI4C 2OTGC 2PYQA 1LINA 5CSJA 4PHMA 2LMUA 1ALWA 2KGRA 1IJ5A 1TNXA 4DUQA 3V2LA 2ZNEA 2OTGB 4JD9A 5AANA 4I5KA 2ZKMX 4I5NB 2BECA 3EK8A 1DC1A 2JXCA 1DJYA 3CWGA 5AERA 1WRLA 4N1GA 1SR6B 1UUSA 2PRUA 3L4AA 1CM1A 1DJZA 2EC6B 2M49B 2K60A 3SJSA 2GGMA 3HX4A 1YUUA 1XFRA 3B87A 1KWOC 2P71A 1QJTA 4DIRA 2AAOA 2F3YA 4YGBB 4CLNA 2L51A 2ZN8A 3SS3A 1EH2A 2VRGA 3TUYB 1CTRA 1UHKA 3HCMA 2L0PA 2LMVA 2BBMA 3VGOA 4PE1A 1FBVA 2KFGA 1KWOB 3I5GC 3CZ2A 4PE0A 1NCYA 4MBEA 4FQOA 3E3RA 5D69A 2BBNA 4GBAA 1BOCA 1HQVA 3FE8A 1HT9A 2F3ZA 1B7TZ 1DQEA 5I2OA 1P28A 1SKTA 2R2IA 3EKJA 3TS5B 4DRWA 1PVBA 1WDCC 2EGDA 1JWDA 2F33A 2KOTA 3KF9A 2NXQA 3O4YA 4C0LA 5HLVA 2L2EA 2FCDA 3VB1A 1SPYA 1CFPA 1CLBA 1B8CA 2MLEC 1TCOB 1WDCB 4PDZA 5I8NA 4CPVA 2BKIB 1KQMB 3OGNA 1BT6A 1DF0A 1SK6D 2LV7A 4P5OE 4P2YB 4WRIA 2M7LA 1K93D 1SSEB 2FOTA 3CZ0A 4JQ0D 2WCEA 1NP8A 4MEWA 1YVHA 1PALA 3BFBA 5G08A 1CFDA 3CTNA 4DS7A 1RWYA 4AQJA 3ZNIA 3DVJA 3N7HA 2DOQA 5B8IB 1MWNA 3D0YA 2Q91A 1QX5B 3BUMB 3UO9A 5KSZA 4ZCVA 3IQQA 1WRZA 1OZOA 2K7OA 2LE9B 5I94A 3KPXA 3JTDC 2ERBA 3D76A 2LM5A 3BUOB 3NHTA 4M2OA 1A2XA 1E8AA 1KQVA 2EHBA 2LANA 3FWBA 1G8IA 3R1PA 1CLMA 1TOPA 2H61A 1TIZA 2M29A 4NQGA 3SS5A 2K61A 1IQ3A 3DF0A 1KK8C 2LLSA 1JFKA 1OZSA 3BUWB 2SCPA 3IVTA 3S0BA 3EVRA 5K89A 1YX8A 2M9GA 2PALA 3S0GA 2BE4A 4C0KA 1A75A 1J1EA 3NGVA 1N0YA 1KK8B 1Y6WA 1F55A 2LLTA 2MHHA 2M1KB 1TUZA 2KNEA 5AFPA 3FS7A 3O2PA 1EXRA 1TTXA 1J7RA 1QIWA 4GAOA 2L5XB 4YGAA 3M0WA 3ZWHA 2KFFA 1XK4C 1NX2A 2LVKA 1SBJA 1OSAA 1J55A 3OP0A 3KEVA 1AJ5A 1JC2A 1SNLA 2Y1NA 2QEHA 4IL1A 3LK1A 1CM4A 1QLKA 2KYFA 1DVIA 3FIAA 1B1GA 1NX3A 3K21A 1ORGA 4BY5A 2LLUA 1QTXA 1CMGA 1PVAA 4M2QA 4UPGA 1KK7Y 3I5HC 1OMRA 1IWQA 1LA3A 4GNKB 2KLDA 4F7FA 2M97A 3B88A 3PSRA 1J7OA 3L47A 3ICBA 1SCMC 2KAYA 1XFUO 2KGBC 4GPLB 1Z4HA 1K90D 2BL0C 1L2OC 1PRWA 1YUSA 1YX7A 2L50A 5CSFA 1GJYA 3LL8B 1RTP1 4R1EA 3S0AA 3I5FB 1LXFC 1LS8A 2JPOA 2ZRSA 1IIOA 2O60A 2OS8B 3MSEB 1UP5A 1DJWA 2CXJA 2JT8A 2KBMA 2KHNA 1NWDA 3BQ3A 1DGUA 3GK1A 4I5LB 1C07A 1OMVA 3D10A 3PM2A 4YGDB 3SIAA 2RGIA 3GK2A 1LVCD 3H4SE 3OB2B 1OOIX 1H4BA 3VROA 4GGNA 1B4CA 2KI4B 1IGVA 2WOSA 3CLNA 1M46A 2KYCA 3DVKA 5DKRA 1F8HA 1QLSA 1F4OA 2G2BA 2JRFA 4INXA 5CSIA 2K8MB 4PE4A 4YGEB 5ER4X 2WC8A 4JWQA 3CZ1A 4YBHB 1XFVO 1JUOA 1NUBA 2V53A 3B7AA 1BR4B 1OQPA 1QIVA 1C7VA 1NIWA 1ZOTB 2KAXA 1TRFA 3BFAA 3AKAA 2I94A 1U5IA 3O78A 1OE9B 2O5GA 2COLB 4NDCA 2K2AA 3EG5B 1T14A 2ZRTA 2LVJA
chains in the Genus database with same CATH topology
2QEBA 3BFHA 3CZ0A 3BFBA 1OOFA 2GTEA 3D78A 2WC5A 3N7HA 1C3ZA 2WC6A 2ERBA 3D76A 3NHTA 3R72A 1OOGA 3R1PA 3FE6A 2PQLA 3S0BA 2QEVA 3NHIA 3S0GA 3NGVA 4OZDA 2WCKA 3R1OA 2WCJA 1TUJA 3BJHA 1TWOA 3D75A 1C3YA 3CYZA 3B6XA 3S0DA 2WCMA 2WCHA 2QEHA 3R1VA 4FQTA 2QEOA 1ORGA 3V2LA 2WCLA 3DY9A 4JD9A 2QDIA 2L2CA 3DXLA 3D77A 4F7FA 3S0EA 3B88A 3L47A 3L4AA 3PJIA 3Q8IA 3S0AA 1LS8A 2JPOA 3DYEA 3CABA 1XFRA 3B87A 2P71A 3DZTA 3B86A 3D73A 1GM0A 3CDNA 5EL2A 1OOIX 1OW4A 3RZSA 3K1EA 4INWA 3CZ2A 3FE9A 3S0FA 3FE8A 4INXA 1DQEA 1P28A 2P70A 2FJYA 1OOHA 3CZ1A 3L4LA 3B7AA 1QWVA 3D74A 3QMEA 3VB1A 3BFAA 2H8VA 2KPHA 4PT1A 5DICA 1T14A 3OGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEB A;  3BFH A;  3CZ0 A;  3BFB A;  1OOF A;  2GTE A;  3D78 A;  2WC5 A;  3N7H A;  1C3Z A;  2WC6 A;  2ERB A;  3D76 A;  3NHT A;  3R72 A;  1OOG A;  3R1P A;  3FE6 A;  2PQL A;  3S0B A;  2QEV A;  3NHI A;  3S0G A;  3NGV A;  4OZD A;  2WCK A;  3R1O A;  2WCJ A;  1TUJ A;  3BJH A;  1TWO A;  3D75 A;  1C3Y A;  3CYZ A;  3B6X A;  3S0D A;  2WCM A;  2WCH A;  2QEH A;  3R1V A;  4FQT A;  2QEO A;  1ORG A;  3V2L A;  2WCL A;  3DY9 A;  4JD9 A;  2QDI A;  2L2C A;  3DXL A;  3D77 A;  4F7F A;  3S0E A;  3B88 A;  3L47 A;  3L4A A;  3PJI A;  3Q8I A;  3S0A A;  1LS8 A;  2JPO A;  3DYE A;  3CAB A;  1XFR A;  3B87 A;  2P71 A;  3DZT A;  3B86 A;  3D73 A;  1GM0 A;  3CDN A;  5EL2 A;  1OOI X;  1OW4 A;  3RZS A;  3K1E A;  4INW A;  3CZ2 A;  3FE9 A;  3S0F A;  3FE8 A;  4INX A;  1DQE A;  1P28 A;  2P70 A;  2FJY A;  1OOH A;  3CZ1 A;  3L4L A;  3B7A A;  1QWV A;  3D74 A;  3QME A;  3VB1 A;  3BFA A;  2H8V A;  2KPH A;  4PT1 A;  5DIC A;  1T14 A;  3OGN A; 
#chains in the Genus database with same CATH topology
 5GQQ C;  1UHH A;  1FW4 A;  4OV2 A;  3RLZ A;  2K7D A;  1JSA A;  1ZUZ A;  3NSO A;  3TZ1 A;  3A8R A;  2JTT A;  2MLF C;  2WCF A;  4CFQ A;  2I2R E;  1YRT B;  4A4B A;  1C3Z A;  1QAT A;  2PVB A;  2ZN9 A;  4FTG A;  5CSN A;  1ZAC A;  1B7T Y;  2LUX A;  1MXE A;  1S6J A;  1X02 A;  4KYN A;  2M1U A;  2L5Y A;  3I5G B;  4PE7 A;  4PHK A;  1SMG A;  4YI8 A;  5KTY A;  5FYX A;  2SAS A;  1OOG A;  1KSO A;  2JQ6 A;  2A4J A;  5TNC A;  2MJW B;  5JJG A;  1A29 A;  3IQO A;  2KQ6 A;  2M3W A;  4PHJ A;  4USL A;  1IRJ A;  1WY9 A;  3AKB A;  2JUL A;  1CFF A;  2PQL A;  1C7W A;  1FI6 A;  5I2Q A;  3OB1 B;  5CPV A;  3VRP A;  2JXL A;  2MRD A;  1IQ5 A;  1KFU S;  2HQW A;  2LP2 A;  2L98 A;  4NDD A;  4OR9 B;  1NCZ A;  1CLL A;  4HRE E;  5HKY A;  1XFX O;  3F45 A;  1TUJ A;  2LAP A;  1TWO A;  3NSI A;  5IBW A;  1CMF A;  2KQY A;  2JT0 A;  1KFU L;  1QXP A;  1BR1 B;  3C1V A;  1YR5 A;  2BCB A;  5D3O A;  5PAL A;  2CBL A;  3NXA A;  3S0D A;  3LLE A;  3BOW A;  2WCH A;  1WLM A;  3JTD B;  2K0J A;  1J7Q A;  1Q80 A;  2KFH A;  1IJ6 A;  1TNW A;  1DF0 B;  2L4I A;  1MQ1 A;  1CDN A;  3TDU A;  4AQI A;  1BMO A;  2D8N A;  2Q4U A;  1B8R A;  4OKH A;  3I5I C;  2GGZ A;  1FF1 A;  4MZJ A;  1K8U A;  4YGC B;  1AP4 A;  3DXL A;  3KHE A;  2FJU B;  3D0Y B;  1W9Z A;  4MVF A;  1RFJ A;  3PLF B;  3CR5 X;  3EK4 A;  2H61 C;  1NSH A;  1PUL A;  1AK8 A;  1ALV A;  1CDP A;  1F4Q A;  4Q04 A;  1S5G Z;  4ORC B;  1S36 A;  1JF2 A;  4E68 A;  1A03 A;  1PSB A;  1EG3 A;  3PJI A;  3TDI A;  3Q8I A;  2Y4Q A;  2Y1M A;  1XFY O;  1G33 A;  2AUC A;  1SL7 A;  2AMI A;  3DF0 B;  1DJG A;  1QV1 A;  3DVM A;  3DZT A;  3PAL A;  1GM0 A;  1R2U A;  1SW8 A;  1S26 D;  2K2F A;  4XJK A;  1D1O A;  5KU1 A;  1DJH A;  5EL2 A;  1YUT A;  1JBA A;  1AJ4 A;  3OX6 A;  1KCY A;  1JF0 A;  3WXA A;  2BKH B;  3O4X A;  1OW4 A;  2JWW A;  3WHU B;  2M8U A;  1OMD A;  4OCI A;  3SG5 A;  2KI6 D;  3EKH A;  3GOF A;  2MAZ A;  1K2H A;  1L7Z A;  1K9U A;  1F71 A;  1W7J B;  5J3X A;  2HF5 A;  3O6B A;  3CR4 X;  3CGA A;  1TNQ A;  2F2O A;  5HL1 A;  1JFJ A;  1QVI Z;  1YVL A;  1CFC A;  1OOH A;  2F2P A;  4MZK A;  1YUR A;  3SG3 A;  3I5H B;  4MZL A;  3QME A;  1BLQ A;  1M39 A;  1DEK A;  4DCK A;  4QJ3 B;  2H8V A;  1SCM B;  4IJ7 A;  5DIC A;  1NX0 A;  3NSK A;  1K96 A;  1S6I A;  1UWO A;  2BL0 B;  1L2O B;  2YGU A;  1V1F A;  1XFZ O;  2QAC A;  2QPT A;  1SY9 A;  1QS7 A;  1Y1X A;  1M63 B;  1KFX S;  1NX1 A;  1H8B A;  1B9A A;  1Y1A A;  4N1F A;  1WRK A;  2BCA A;  1REC A;  4CFR A;  1UHJ A;  5BPJ A;  1S1E A;  2LCP A;  3JVT C;  2FCE A;  2TN4 A;  5HLO A;  1K9K A;  1K94 A;  1ZMZ A;  3CS1 A;  4GGF A;  4M2P A;  1MUX A;  4QJ4 B;  2KI6 C;  2PMY A;  3CR2 A;  2WC6 A;  3OBV A;  2JT3 A;  3JVT B;  1AHR A;  1ODB A;  4HRH A;  2LVI A;  1XVJ A;  1BOD A;  1S6C A;  3PAT A;  5I2L A;  1CNP A;  3FE6 A;  2ZFD A;  2B1U A;  1F54 A;  1ZFS A;  5AEQ A;  4HSZ A;  2HPS A;  4GGF C;  4OVN F;  2LVV A;  2IS9 A;  1N2D A;  2QEV A;  3BXK A;  1WLZ A;  1DGV A;  1XYD A;  2WND A;  2LMT A;  3SIB A;  1QAS A;  4A4C A;  1GGW A;  1SR6 C;  4OZD A;  1TNP A;  3PFV A;  3OX5 A;  2EC6 C;  4WQ3 A;  1EL4 A;  2WCK A;  3IF7 A;  5AXI A;  1Y0V H;  3R1O A;  1OOJ A;  2LNK A;  2KBI A;  2WCJ A;  1DEL A;  2P6B B;  3D75 A;  1C3Y A;  2NCP A;  3TUY C;  2PSR A;  3CYZ A;  3LK0 A;  3GK4 X;  5D7F A;  1TCF A;  1UHN A;  1G4Y R;  1U5I B;  1QX2 A;  1NYA A;  2BE6 A;  3SG6 A;  3R1V A;  1XA5 A;  4ORA B;  4YRU A;  1MHO A;  1MXL C;  3DD4 A;  4FQT A;  2QEO A;  3TS5 C;  1RJV A;  1SL9 A;  1PK0 D;  1GGZ A;  2WCL A;  3DVE A;  1QV0 A;  3DY9 A;  1LA0 A;  2HET A;  2QDI A;  2L2C A;  2BCX A;  2F8P A;  4JKT A;  5HKZ A;  1CKK A;  3D77 A;  3EVV A;  4L9M A;  2MBX A;  3S0E A;  1AVS A;  1FPW A;  3RM1 A;  3FWC A;  2GV5 A;  3EK7 A;  2K7C A;  4MN0 A;  4MRX A;  1CDL A;  1KQM C;  2HQ8 A;  2CTN A;  1VRK A;  1FI5 A;  2K7B A;  2E6W A;  2BNX A;  2JPT A;  2KDH A;  1K9P A;  3CAB A;  3DYE A;  2BAP A;  4XYN A;  5HYD A;  1DJX A;  3B86 A;  2NCO A;  3D73 A;  3QRX A;  5DKN A;  2LHI A;  3AAK A;  1N65 A;  1SCV A;  1BG1 A;  4JPZ B;  1XFW O;  3CDN A;  4I5J A;  3NSL A;  3WHT B;  2JZI A;  1MF8 B;  2CNP A;  1UUR A;  2LP3 A;  5F6T A;  2JTZ A;  3SS4 A;  3RZS A;  3K1E A;  2LC5 A;  3CZT X;  4INW A;  2M7N A;  1NCX A;  3FE9 A;  4ICB A;  4F0Z B;  3S0F A;  3SG2 A;  4D1E A;  1LKJ A;  4ZCU A;  1QX7 A;  3VRQ A;  1YTZ C;  4CID A;  1Z2C B;  1RRO A;  2M0R A;  2OPO A;  2ISD A;  4NDB A;  3SG4 A;  3SG7 A;  1IKU A;  1SRA A;  2P70 A;  2FJY A;  3VRN A;  2L4H A;  3EVU A;  1S5G Y;  3L4L A;  4U8D A;  1A4P A;  3I5I B;  1QWV A;  3AAJ A;  1W7I B;  1M45 A;  2JC2 A;  3LCP C;  5FI6 A;  3D74 A;  2Y5I A;  1KSM A;  2E30 A;  4YI9 A;  1B8L A;  4BY4 A;  2KPH A;  4PT1 A;  1Y1U A;  3BOW B;  4N5X A;  1DMO A;  5JOL A;  2H2K A;  1BU3 A;  2LUC A;  1XO5 A;  1S3P A;  1XK4 A;  2QEB A;  4WQ2 A;  3BYA A;  2WCB A;  4MLW A;  3BFH A;  1A75 B;  2JNX A;  3A4U B;  1OOF A;  2JNF A;  1TN4 A;  2JU0 A;  2GTE A;  2MA2 A;  3D78 A;  1J7P A;  2LHL A;  2WC5 A;  1SYM A;  2ZND A;  1YRU B;  4MRY A;  4GFT A;  1PSR A;  5FI7 A;  1AUI B;  1BJF A;  4PCW A;  1NPQ A;  1QVI Y;  2WOR A;  4PAL A;  1B47 A;  3VRR A;  1DT7 B;  3R72 A;  1GQM A;  1UHI A;  2G9B A;  4C0J A;  1MR8 A;  1DJI A;  1EG4 A;  2CT9 A;  4HRG A;  4TNC A;  3BUX B;  1RK9 A;  1R6P A;  3PN7 C;  4XJK B;  3UNW A;  4QJ5 B;  2NZ0 A;  1CB1 A;  1F70 A;  3KO0 A;  3NHI A;  4AOM A;  2KAV A;  1M31 A;  1IG5 A;  5FI2 A;  1EJ3 A;  4GUK A;  5ER5 A;  3WNX B;  3TDZ A;  2JOJ A;  1KK7 Z;  3PN7 B;  1SL8 A;  3I5F C;  4MSP A;  4PHN A;  1IH0 A;  1KFX L;  2OS8 C;  2KLE A;  1V1G A;  1J1D A;  4ETO A;  3OHM B;  1K95 A;  3BJH A;  2I7A A;  2I18 A;  5DKQ A;  3BUN B;  1BF5 A;  3PM8 A;  2PAS A;  3B6X A;  1DTL A;  5HKW A;  2WCM A;  2NLN A;  2CCM A;  4ORB B;  2KSP A;  1CDM A;  2KI4 C;  2OTG C;  2PYQ A;  1LIN A;  5CSJ A;  4PHM A;  2LMU A;  1ALW A;  2KGR A;  1IJ5 A;  1TNX A;  4DUQ A;  3V2L A;  2ZNE A;  2OTG B;  4JD9 A;  5AAN A;  4I5K A;  2ZKM X;  4I5N B;  2BEC A;  3EK8 A;  1DC1 A;  2JXC A;  1DJY A;  3CWG A;  5AER A;  1WRL A;  4N1G A;  1SR6 B;  1UUS A;  2PRU A;  3L4A A;  1CM1 A;  1DJZ A;  2EC6 B;  2M49 B;  2K60 A;  3SJS A;  2GGM A;  3HX4 A;  1YUU A;  1XFR A;  3B87 A;  1KWO C;  2P71 A;  1QJT A;  4DIR A;  2AAO A;  2F3Y A;  4YGB B;  4CLN A;  2L51 A;  2ZN8 A;  3SS3 A;  1EH2 A;  2VRG A;  3TUY B;  1CTR A;  1UHK A;  3HCM A;  2L0P A;  2LMV A;  2BBM A;  3VGO A;  4PE1 A;  1FBV A;  2KFG A;  1KWO B;  3I5G C;  3CZ2 A;  4PE0 A;  1NCY A;  4MBE A;  4FQO A;  3E3R A;  5D69 A;  2BBN A;  4GBA A;  1BOC A;  1HQV A;  3FE8 A;  1HT9 A;  2F3Z A;  1B7T Z;  1DQE A;  5I2O A;  1P28 A;  1SKT A;  2R2I A;  3EKJ A;  3TS5 B;  4DRW A;  1PVB A;  1WDC C;  2EGD A;  1JWD A;  2F33 A;  2KOT A;  3KF9 A;  2NXQ A;  3O4Y A;  4C0L A;  5HLV A;  2L2E A;  2FCD A;  3VB1 A;  1SPY A;  1CFP A;  1CLB A;  1B8C A;  2MLE C;  1TCO B;  1WDC B;  4PDZ A;  5I8N A;  4CPV A;  2BKI B;  1KQM B;  3OGN A;  1BT6 A;  1DF0 A;  1SK6 D;  2LV7 A;  4P5O E;  4P2Y B;  4WRI A;  2M7L A;  1K93 D;  1SSE B;  2FOT A;  3CZ0 A;  4JQ0 D;  2WCE A;  1NP8 A;  4MEW A;  1YVH A;  1PAL A;  3BFB A;  5G08 A;  1CFD A;  3CTN A;  4DS7 A;  1RWY A;  4AQJ A;  3ZNI A;  3DVJ A;  3N7H A;  2DOQ A;  5B8I B;  1MWN A;  3D0Y A;  2Q91 A;  1QX5 B;  3BUM B;  3UO9 A;  5KSZ A;  4ZCV A;  3IQQ A;  1WRZ A;  1OZO A;  2K7O A;  2LE9 B;  5I94 A;  3KPX A;  3JTD C;  2ERB A;  3D76 A;  2LM5 A;  3BUO B;  3NHT A;  4M2O A;  1A2X A;  1E8A A;  1KQV A;  2EHB A;  2LAN A;  3FWB A;  1G8I A;  3R1P A;  1CLM A;  1TOP A;  2H61 A;  1TIZ A;  2M29 A;  4NQG A;  3SS5 A;  2K61 A;  1IQ3 A;  3DF0 A;  1KK8 C;  2LLS A;  1JFK A;  1OZS A;  3BUW B;  2SCP A;  3IVT A;  3S0B A;  3EVR A;  5K89 A;  1YX8 A;  2M9G A;  2PAL A;  3S0G A;  2BE4 A;  4C0K A;  1A75 A;  1J1E A;  3NGV A;  1N0Y A;  1KK8 B;  1Y6W A;  1F55 A;  2LLT A;  2MHH A;  2M1K B;  1TUZ A;  2KNE A;  5AFP A;  3FS7 A;  3O2P A;  1EXR A;  1TTX A;  1J7R A;  1QIW A;  4GAO A;  2L5X B;  4YGA A;  3M0W A;  3ZWH A;  2KFF A;  1XK4 C;  1NX2 A;  2LVK A;  1SBJ A;  1OSA A;  1J55 A;  3OP0 A;  3KEV A;  1AJ5 A;  1JC2 A;  1SNL A;  2Y1N A;  2QEH A;  4IL1 A;  3LK1 A;  1CM4 A;  1QLK A;  2KYF A;  1DVI A;  3FIA A;  1B1G A;  1NX3 A;  3K21 A;  1ORG A;  4BY5 A;  2LLU A;  1QTX A;  1CMG A;  1PVA A;  4M2Q A;  4UPG A;  1KK7 Y;  3I5H C;  1OMR A;  1IWQ A;  1LA3 A;  4GNK B;  2KLD A;  4F7F A;  2M97 A;  3B88 A;  3PSR A;  1J7O A;  3L47 A;  3ICB A;  1SCM C;  2KAY A;  1XFU O;  2KGB C;  4GPL B;  1Z4H A;  1K90 D;  2BL0 C;  1L2O C;  1PRW A;  1YUS A;  1YX7 A;  2L50 A;  5CSF A;  1GJY A;  3LL8 B;  1RTP 1;  4R1E A;  3S0A A;  3I5F B;  1LXF C;  1LS8 A;  2JPO A;  2ZRS A;  1IIO A;  2O60 A;  2OS8 B;  3MSE B;  1UP5 A;  1DJW A;  2CXJ A;  2JT8 A;  2KBM A;  2KHN A;  1NWD A;  3BQ3 A;  1DGU A;  3GK1 A;  4I5L B;  1C07 A;  1OMV A;  3D10 A;  3PM2 A;  4YGD B;  3SIA A;  2RGI A;  3GK2 A;  1LVC D;  3H4S E;  3OB2 B;  1OOI X;  1H4B A;  3VRO A;  4GGN A;  1B4C A;  2KI4 B;  1IGV A;  2WOS A;  3CLN A;  1M46 A;  2KYC A;  3DVK A;  5DKR A;  1F8H A;  1QLS A;  1F4O A;  2G2B A;  2JRF A;  4INX A;  5CSI A;  2K8M B;  4PE4 A;  4YGE B;  5ER4 X;  2WC8 A;  4JWQ A;  3CZ1 A;  4YBH B;  1XFV O;  1JUO A;  1NUB A;  2V53 A;  3B7A A;  1BR4 B;  1OQP A;  1QIV A;  1C7V A;  1NIW A;  1ZOT B;  2KAX A;  1TRF A;  3BFA A;  3AKA A;  2I94 A;  1U5I A;  3O78 A;  1OE9 B;  2O5G A;  2COL B;  4NDC A;  2K2A A;  3EG5 B;  1T14 A;  2ZRT A;  2LVJ A; 
#chains in the Genus database with same CATH homology
 2QEB A;  3BFH A;  3CZ0 A;  3BFB A;  1OOF A;  2GTE A;  3D78 A;  2WC5 A;  3N7H A;  1C3Z A;  2WC6 A;  2ERB A;  3D76 A;  3NHT A;  3R72 A;  1OOG A;  3R1P A;  3FE6 A;  2PQL A;  3S0B A;  2QEV A;  3NHI A;  3S0G A;  3NGV A;  4OZD A;  2WCK A;  3R1O A;  2WCJ A;  1TUJ A;  3BJH A;  1TWO A;  3D75 A;  1C3Y A;  3CYZ A;  3B6X A;  3S0D A;  2WCM A;  2WCH A;  2QEH A;  3R1V A;  4FQT A;  2QEO A;  1ORG A;  3V2L A;  2WCL A;  3DY9 A;  4JD9 A;  2QDI A;  2L2C A;  3DXL A;  3D77 A;  4F7F A;  3S0E A;  3B88 A;  3L47 A;  3L4A A;  3PJI A;  3Q8I A;  3S0A A;  1LS8 A;  2JPO A;  3DYE A;  3CAB A;  1XFR A;  3B87 A;  2P71 A;  3DZT A;  3B86 A;  3D73 A;  1GM0 A;  3CDN A;  5EL2 A;  1OOI X;  1OW4 A;  3RZS A;  3K1E A;  4INW A;  3CZ2 A;  3FE9 A;  3S0F A;  3FE8 A;  4INX A;  1DQE A;  1P28 A;  2P70 A;  2FJY A;  1OOH A;  3CZ1 A;  3L4L A;  3B7A A;  1QWV A;  3D74 A;  3QME A;  3VB1 A;  3BFA A;  2H8V A;  2KPH A;  4PT1 A;  5DIC A;  1T14 A;  3OGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...