1A75A

Whiting parvalbumin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
106
structure length
106
Chain Sequence
AGILADADCAAAVKACEAADSFSYKAFFAKCGLSGKSADDIKKAFVFIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWVALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Tertiary Structure of a Trp-Containing Parvalbumin from Whiting (Merlangius Merlangus). Description of the Hydrophobic Core
rcsb
molecule tags Calcium binding protein
total genus 36
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a75A00
3WHTB 1AJ5A 1K9UA 1KFXS 1S1EA 1SRAA 3LLEA 1QIWA 1W7JB 1NUBA 3FWBA 1IJ5A 5HKYA 2PVBA 1GGWA 3DVMA 4N1GA 1ALWA 1A75B 1XFUO 2KI6C 2SASA 4PE4A 4YRUA 1BOCA 3OX6A 2JULA 2K0JA 4L9MA 1YURA 1YR5A 2K7DA 1KFUS 1DT7B 2KAVA 1JF2A 2I94A 3OB2B 4ORAB 2FCEA 1ZOTB 1OE9B 1KFXL 1PRWA 2BCBA 1LKJA 1QXPA 1CFCA 3JTDC 1TCOB 2Y1MA 3IQQA 3IQOA 3O6BA 3TDIA 3BUNB 3C1VA 4JPZB 3BOWB 1J1EA 1QLSA 1KFUL 1KK7Z 2L50A 1OZOA 5PALA 1MQ1A 1FPWA 2JT0A 1SY9A 2I2RE 1LA3A 1JBAA 1CM4A 1JF0A 3D0YA 2F3YA 1B4CA 5I2LA 3DD4A 2KHNA 1QX2A 1SL8A 2BBNA 2LM5A 2EC6C 4OKHA 1RTP1 1IKUA 4F0ZB 3HCMA 1F4QA 3KO0A 2Q91A 2LCPA 2TN4A 1LA0A 1CM1A 4PE7A 2F8PA 4I5LB 1KSMA 3LK0A 4OV2A 4AQIA 1GGZA 1B7TZ 4WRIA 1CMGA 3E3RA 2K7BA 1Y1XA 1BMOA 3PALA 1BLQA 1S5GY 2BBMA 1MF8B 1BU3A 1WDCC 1OMVA 2KYFA 2KI4C 3AAJA 1QX7A 2HQWA 2F2PA 2JOJA 1UHKA 5KTYA 2LMTA 4BY4A 3PATA 1KK8C 5DKNA 2HF5A 4M2OA 2NCOA 4AQJA 1MR8A 1BJFA 2LLUA 3VRQA 1BODA 2AMIA 1U5IA 3I5FB 2F33A 4YGCB 5J3XA 2I18A 4N1FA 3NSIA 4WQ2A 1K93D 1S6IA 3WXAA 2ZFDA 2PASA 2GV5A 4MZLA 1KQMB 2BE4A 1TNXA 2LANA 1JFJA 4MZKA 3I5GC 1XK4A 1DVIA 1QTXA 2VRGA 1ODBA 3ICBA 1UP5A 1XVJA 4HSZA 1NYAA 4NDBA 1F71A 1QATA 1J1DA 1QX5B 2KI6D 1IG5A 2QPTA 3OP0A 3PLFB 1QV0A 2KOTA 4QJ5B 1GJYA 2K8MB 4OR9B 4ORBB 2JXCA 4GAOA 1C7VA 1ZFSA 1ZUZA 2KNEA 3O2PA 4NDDA 3JVTB 4MLWA 1X02A 1DJHA 2ZN8A 1EL4A 1PVAA 3AAKA 4N5XA 3SG2A 4PHKA 1UWOA 2E30A 2MA2A 3D0YB 1FI6A 2M7LA 4Q04A 3DVKA 1NX0A 4MRYA 2LVIA 1WLMA 1YVHA 1SCMB 2GGZA 2KAYA 3EK8A 4I5JA 5HLOA 3CR5X 2P6BB 3K21A 3GK1A 1MWNA 2JPTA 1YUUA 2I7AA 1CLBA 2KQ6A 1B9AA 4QJ3B 2M0RA 1SKTA 2WC8A 1CFDA 2L5XB 3RM1A 1WRLA 4MRXA 2JXLA 1W7IB 1BT6A 1XFYO 3OHMB 4DRWA 1WLZA 2OTGC 2M1KB 3JVTC 2BE6A 3WNXB 5CSJA 1SMGA 1K9KA 1NP8A 1XFXO 2EC6B 1UHNA 1SL7A 1DJGA 1N65A 5FYXA 2LMVA 1F70A 3F45A 2ZNDA 4YGBB 1XFZO 2Y5IA 3VRNA 5KSZA 1JWDA 1A4PA 1BR4B 1SCMC 1DJIA 1SL9A 3KHEA 1JFKA 2ZRTA 5IBWA 4ICBA 4E68A 3SG3A 2NLNA 2ZKMX 4NQGA 2LLSA 2LHIA 2JTTA 1WDCB 5CPVA 5AANA 2LMUA 4ZCUA 2KI4B 1V1GA 1TN4A 1PULA 1EG4A 1CDPA 1TNWA 2OS8C 5JJGA 3ZWHA 1NIWA 1CLLA 1TNPA 1J7QA 3LCPC 2Q4UA 3VROA 1KK8B 1SNLA 1JSAA 1MXEA 1CFPA 1K90D 1EG3A 1V1FA 3BXKA 1PK0D 2K7CA 2Y4QA 4YI9A 3EVUA 2LUCA 1YX7A 2K2AA 1DF0B 1EXRA 1ALVA 3IF7A 4ORCB 2MHHA 1OOJA 3NSKA 1CDNA 3DVJA 1FF1A 1B8CA 1F8HA 3VRPA 3I5GB 2EHBA 1YUSA 2LVKA 4GGFC 4MN0A 1FW4A 1M63B 1K9PA 1CTRA 1TIZA 2H61A 2KSPA 1UHHA 2K7OA 4P5OE 2LP3A 2ZN9A 1KWOC 1F55A 1XK4C 1B8LA 3BUWB 1UURA 2BECA 2BKHB 3SG7A 3WHUB 1OQPA 1NCZA 4FTGA 4XJKB 2B1UA 2LP2A 3TZ1A 1CLMA 1DJYA 1TCFA 3BUXB 5CSFA 4C0LA 1YVLA 5ER5A 2L0PA 1A03A 3PFVA 4R1EA 1PSBA 1WY9A 3PN7C 2KQYA 3KF9A 3TDZA 1QV1A 5HKZA 5I2OA 1RECA 2ZRSA 4C0JA 3DVEA 2IS9A 1RK9A 1AHRA 2WOSA 2L51A 1XYDA 2HQ8A 3A4UB 4CIDA 1F54A 3ZNIA 5AEQA 2MBXA 2CXJA 4PE1A 1XO5A 2LV7A 1N2DA 4DS7A 1OMRA 4QJ4B 5JOLA 1FI5A 1C07A 2L98A 2BL0C 2FCDA 2E6WA 2KGRA 5DKRA 5CSIA 4PALA 3NSOA 2JT8A 4I5NB 3KEVA 4U8DA 3CGAA 2M7NA 1OSAA 1S5GZ 1D1OA 1A2XA 3EKJA 5AXIA 3LK1A 2PSRA 3BOWA 1G8IA 1MHOA 1WRZA 1AVSA 2Y1NA 2OTGB 1B47A 3FWCA 1S6JA 2M9GA 4CLNA 2NCPA 3RLZA 1UUSA 3GK4X 3LL8B 5F6TA 1YTZC 5I8NA 1IRJA 2FOTA 4JWQA 4PHNA 1Y1UA 3VRRA 1DGVA 2KDHA 2F2OA 3CTNA 2HPSA 4GNKB 4HREE 4PE0A 3SG5A 1Y0VH 1K95A 2KBMA 1SCVA 2O60A 4MBEA 2COLB 1LINA 2NZ0A 2L4IA 2CBLA 1NSHA 1E8AA 1Y1AA 3TS5B 3FS7A 2LLTA 2AAOA 5ER4X 1QIVA 1Q80A 1DGUA 1J55A 2L2EA 1Y6WA 3BYAA 3PM8A 3TDUA 3EVRA 1J7PA 1CMFA 1NX1A 2PALA 3BQ3A 4CFQA 1EH2A 5HYDA 2G9BA 2OS8B 1C7WA 4HRHA 2ISDA 5AFPA 3SJSA 3SIAA 4YBHB 1IGVA 3I5IC 1TOPA 1K8UA 1SR6C 1RROA 4UPGA 4M2QA 5I2QA 2BCAA 1QVIZ 2M97A 4P2YB 1J7OA 2JC2A 4ZCVA 1KK7Y 2KFGA 1UHIA 1YRUB 3EK4A 3TUYB 2KYCA 2WCBA 3A8RA 1PVBA 2JWWA 4DUQA 2JZIA 3DF0A 3CWGA 3MSEB 2WCEA 1IJ6A 3CR4X 1AUIB 1L2OC 1R6PA 2OPOA 3H4SE 1JC2A 1MUXA 1U5IB 1MXLC 3TS5C 1CKKA 2A4JA 2CNPA 2FJUB 1IQ5A 2MRDA 4YGAA 4IL1A 1KCYA 2MJWB 4DCKA 1QJTA 5BPJA 3O4YA 2O5GA 1AK8A 2RGIA 2M49B 1TTXA 1AP4A 1EJ3A 2EGDA 3BUOB 1YUTA 4HRGA 1K94A 1NPQA 1KWOB 3CR2A 1H4BA 2WORA 5K89A 3PSRA 1B7TY 2H61C 3CLNA 2MLFC 1PALA 3AKBA 3O78A 5D69A 1DTLA 1IQ3A 4A4CA 4GBAA 1NCXA 3PN7B 1CFFA 4D1EA 2V53A 3CS1A 3TUYC 2LAPA 4JQ0D 1NCYA 1S6CA 1H8BA 1TRFA 3OX5A 1CB1A 2LC5A 5DKQA 2M1UA 3AKAA 1M46A 1R2UA 5CSNA 1UHJA 2KFFA 4M2PA 1NX2A 1QS7A 2CT9A 4PCWA 4XYNA 1N0YA 4CFRA 2BL0B 1KSOA 1QLKA 4CPVA 1JUOA 1KQVA 5KU1A 1BR1B 1FBVA 3QRXA 1RFJA 5D7FA 1M39A 2H2KA 1PSRA 4PHJA 1A29A 4GPLB 1SPYA 3EK7A 4MSPA 1G4YR 3SG4A 1YX8A 2M3WA 1YRTB 2CCMA 2LVVA 3EKHA 3OB1B 1DJZA 2AUCA 5B8IB 1HT9A 1J7RA 1B1GA 1HQVA 2LNKA 2MAZA 3SIBA 1XA5A 3VGOA 1A75A 4USLA 3GOFA 2BCXA 5G08A 2BKIB 1LVCD 1AJ4A 4PDZA 4A4BA 1CNPA 1M45A 1ZACA 2D8NA 4MEWA 1QASA 1CDLA 1TNQA 3EVVA 1XFWO 2JQ6A 4ETOA 2PMYA 2JNFA 4OVNF 1CDMA 2M8UA 1OMDA 1SK6D 1F4OA 3DF0B 2JU0A 1OZSA 1S26D 1K96A 2KGBC 2L4HA 4WQ3A 2SCPA 2JTZA 3FIAA 4YI8A 4C0KA 4GGFA 2LE9B 1NWDA 2M29A 2LVJA 1B8RA 1DJWA 4BY5A 2KAXA 1G33A 3I5IB 1GQMA 1XFVO 4TNCA 4GGNA 3HX4A 4I5KA 2CTNA 1RJVA 1SR6B 4DIRA 3NXAA 4YGEB 1SYMA 1RWYA 2GGMA 3SG6A 2K2FA 2DOQA 2LUXA 4PHMA 5HKWA 2NXQA 3I5HB 5GQQC 3M0WA 1DJXA 1ZMZA 1IH0A 1L2OB 4OCIA 5AERA 1K2HA 3KPXA 3BUMB 2PRUA 1DF0A 1DMOA 1QVIY 1WRKA 1LXFC 1NX3A 1S3PA 2MLEC 4MZJA 3I5FC 2ZNEA 1M31A 2JRFA 5TNCA 1IWQA 2WCFA 2F3ZA 1BF5A 2WNDA 1L7ZA 5HLVA 4AOMA 2G2BA 1KQMC 2KFHA 4MVFA 2LHLA 4NDCA 1BG1A 3GK2A 2KBIA 1SW8A 4GFTA 2HETA 3NSLA 2JNXA 2JT3A 3JTDB 1VRKA 3D10A 4GUKA 4XJKA 2QACA 2R2IA 3CZTX 3I5HC 1S36A 1SBJA 2K61A 4FQOA 4YGDB
chains in the Genus database with same CATH superfamily
3WHTB 1AJ5A 1K9UA 1KFXS 1S1EA 1SRAA 3LLEA 1QIWA 1W7JB 1NUBA 3FWBA 1IJ5A 5HKYA 2PVBA 1GGWA 3DVMA 4N1GA 1ALWA 1A75B 1XFUO 2KI6C 2SASA 4PE4A 4YRUA 1BOCA 3OX6A 1QWVA 2JULA 2K0JA 2PYQA 1YURA 4L9MA 1YR5A 2K7DA 3UNWA 1KFUS 1DT7B 2KAVA 1JF2A 2I94A 3OB2B 4ORAB 2FCEA 1ZOTB 1OE9B 1KFXL 1PRWA 2BCBA 1LKJA 1QXPA 1CFCA 3JTDC 1TCOB 2Y1MA 3IQQA 3IQOA 3O6BA 3TDIA 5FI2A 3BUNB 3C1VA 4JPZB 2WCLA 3BOWB 1J1EA 3D78A 1QLSA 1KFUL 1KK7Z 2L50A 1OZOA 5PALA 1MQ1A 3FE9A 2JT0A 1SY9A 2I2RE 1FPWA 1LA3A 1JBAA 1CM4A 1JF0A 3D0YA 2F3YA 1B4CA 5I2LA 3DD4A 2KHNA 1QX2A 1SL8A 3UO9A 2QEOA 2BBNA 3B6XA 2LM5A 2EC6C 4OKHA 1RTP1 1IKUA 4F0ZB 3HCMA 3S0BA 1F4QA 3KO0A 2Q91A 2LCPA 2TN4A 5I2OA 1LA0A 1CM1A 3BFAA 3Q8IA 4PE7A 2F8PA 3R1PA 3RZSA 4I5LB 1KSMA 3LK0A 4OV2A 4AQIA 1GGZA 1B7TZ 4WRIA 1CMGA 3E3RA 2K7BA 1Y1XA 1BMOA 3PALA 1BLQA 3PJIA 1S5GY 1MF8B 1WDCC 1BU3A 2BBMA 1OMVA 3R1OA 2KYFA 2KI4C 3AAJA 1QX7A 2HQWA 3S0FA 2F2PA 2JOJA 1UHKA 5KTYA 2LMTA 4BY4A 3PATA 1KK8C 5DKNA 2HF5A 4M2OA 2NCOA 4AQJA 1MR8A 1BJFA 2LLUA 1DEKA 3VRQA 1BODA 2AMIA 1U5IA 3I5FB 2F33A 2P70A 4YGCB 5J3XA 2I18A 4N1FA 3NSIA 4WQ2A 1K93D 1S6IA 3WXAA 2ZFDA 2PASA 1TUZA 2GV5A 4MZLA 3EG5B 1KQMB 2BE4A 1TNXA 2LANA 2QDIA 1JFJA 3L47A 4MZKA 3I5GC 1XK4A 1DVIA 1QTXA 2VRGA 1ODBA 3ICBA 1UP5A 1XVJA 4HSZA 1NYAA 4NDBA 1F71A 1QATA 1J1DA 1QX5B 2KI6D 1IG5A 2QPTA 3OP0A 3PLFB 1QV0A 2KOTA 4QJ5B 1GJYA 2K8MB 4OR9B 4ORBB 2JXCA 4GAOA 1C7VA 1ZFSA 1ZUZA 2KNEA 3O2PA 4NDDA 3JVTB 4MLWA 1X02A 1DJHA 2ZN8A 1EL4A 1PVAA 3AAKA 4N5XA 3SG2A 4PHKA 1UWOA 2E30A 2MA2A 3D0YB 1FI6A 2M7LA 4Q04A 3B87A 2WCKA 3DVKA 1NX0A 4MRYA 2LVIA 3CZ2A 1WLMA 1YVHA 1SCMB 2GGZA 2KAYA 2L2CA 3EK8A 4I5JA 5HLOA 3CR5X 2P6BB 2QEHA 1DQEA 3K21A 1C3YA 1TWOA 3BFBA 3GK1A 1MWNA 2JPTA 1YUUA 2I7AA 1CLBA 2KQ6A 1B9AA 4QJ3B 2M0RA 1SKTA 2H8VA 2WC8A 1OOHA 1CFDA 2L5XB 3RM1A 1WRLA 4MRXA 2JXLA 1W7IB 1BT6A 1XFYO 3OHMB 4DRWA 3L4AA 1WLZA 2OTGC 2M1KB 3JVTC 2BE6A 2JPOA 2KLEA 3WNXB 5CSJA 1SMGA 1K9KA 1NP8A 1XFXO 2EC6B 1UHNA 3NGVA 2GTEA 1GM0A 1SL7A 1DJGA 1W9ZA 3S0EA 1N65A 5FYXA 2LMVA 1F70A 3F45A 2WC5A 2ZNDA 1XFZO 2Y5IA 4YGBB 3VRNA 5KSZA 1JWDA 1A4PA 1BR4B 1SCMC 1DJIA 2PQLA 1SL9A 3KHEA 1JFKA 2ZRTA 5IBWA 4ICBA 4E68A 3SG3A 2NLNA 2ZKMX 4NQGA 2LLSA 2LHIA 2JTTA 1WDCB 5CPVA 5AANA 2LMUA 4ZCUA 2KI4B 1V1GA 1TN4A 1PULA 1EG4A 1CDPA 1TNWA 2OS8C 5JJGA 3ZWHA 1NIWA 1CLLA 1TNPA 1J7QA 1OW4A 3LCPC 2Q4UA 4PT1A 1OOFA 3VROA 1KK8B 1SNLA 1JSAA 1MXEA 3B88A 1CFPA 1K90D 1EG3A 1V1FA 3BXKA 1PK0D 2K7CA 2Y4QA 4INXA 4YI9A 3FE6A 3EVUA 2LUCA 3OGNA 1YX7A 2K2AA 1DF0B 1EXRA 1ALVA 3IF7A 4ORCB 2QEVA 2MHHA 1OOJA 3NSKA 1CDNA 1P28A 3DVJA 1FF1A 1B8CA 1XFRA 1F8HA 3VRPA 3I5GB 3SS3A 2WC6A 2EHBA 1YUSA 2LVKA 3R72A 4GGFC 4MN0A 1FW4A 1M63B 1K9PA 1CTRA 1SSEB 1TIZA 2H61A 2KSPA 1UHHA 2K7OA 4P5OE 2LP3A 2ZN9A 1KWOC 1F55A 1XK4C 3B86A 1B8LA 3BUWB 1UURA 2BECA 1ORGA 2BKHB 3SG7A 3WHUB 1OQPA 1NCZA 4FTGA 4XJKB 5FI6A 2B1UA 2LP2A 3TZ1A 1DJYA 1CLMA 1TCFA 3BUXB 5CSFA 3SS4A 4C0LA 4IJ7A 1YVLA 5ER5A 2L0PA 1A03A 3PFVA 4R1EA 1PSBA 3DXLA 1WY9A 3PN7C 2QEBA 2KQYA 3KF9A 1Z2CB 1QV1A 4OZDA 5HKZA 3TDZA 1RECA 2ZRSA 4C0JA 3DVEA 2IS9A 1RK9A 1AHRA 2L5YA 2L51A 1XYDA 2WOSA 2HQ8A 3A4UB 4CIDA 1F54A 3ZNIA 5AEQA 2MBXA 2CXJA 4PE1A 1XO5A 2LV7A 3CZ0A 2WCMA 1N2DA 4DS7A 1OMRA 4QJ4B 5JOLA 1FI5A 1C07A 2L98A 2BL0C 2FCDA 5HL1A 2E6WA 2KGRA 5DKRA 3CYZA 3FE8A 5CSIA 4PALA 3NSOA 2JT8A 4I5NB 3KEVA 4U8DA 4F7FA 2WCJA 3CGAA 2M7NA 1OSAA 1S5GZ 1D1OA 1A2XA 3EKJA 5AXIA 3LK1A 2PSRA 3BOWA 1G8IA 1MHOA 5D3OA 1WRZA 1AVSA 2Y1NA 2OTGB 1B47A 3FWCA 1S6JA 2M9GA 4CLNA 2NCPA 2WCHA 3RLZA 1UUSA 3CZ1A 3GK4X 3LL8B 5F6TA 1YTZC 5I8NA 1IRJA 2FOTA 4JWQA 4PHNA 1Y1UA 3VRRA 5I94A 1DGVA 2KDHA 2F2OA 2YGUA 2HPSA 3CTNA 3N7HA 4GNKB 4HREE 1Y0VH 3B7AA 4PE0A 3SG5A 1K95A 2KBMA 1SCVA 2O60A 4MBEA 2COLB 1LINA 2NZ0A 2L4IA 2CBLA 2ERBA 1NSHA 1E8AA 2BAPA 1Y1AA 3TS5B 3FS7A 2LLTA 2AAOA 5ER4X 1QIVA 1Q80A 1DGUA 1J55A 2L2EA 1Y6WA 3BYAA 3PM8A 3TDUA 3EVRA 3VB1A 1CMFA 1J7PA 1NX1A 2PALA 3BQ3A 4CFQA 5EL2A 1EH2A 5HYDA 2G9BA 2OS8B 1C7WA 4HRHA 2ISDA 5AFPA 3SJSA 3S0GA 3SIAA 4YBHB 1IGVA 3I5IC 1TOPA 1K8UA 1SR6C 5DICA 1RROA 4UPGA 4M2QA 5I2QA 2BCAA 1QVIZ 2M97A 4P2YB 1J7OA 2JC2A 3QMEA 1KK7Y 2KFGA 1UHIA 1YRUB 3EK4A 4ZCVA 3TUYB 2KYCA 2WCBA 3A8RA 1PVBA 4FQTA 2JWWA 4DUQA 2JZIA 3DF0A 3CWGA 3MSEB 2WCEA 1IJ6A 3CR4X 1AUIB 1L2OC 1R6PA 2OPOA 3H4SE 1TUJA 1JC2A 3DYEA 1MUXA 1U5IB 1MXLC 3TS5C 1CKKA 2A4JA 2CNPA 2FJUB 2KPHA 1IQ5A 2MRDA 4YGAA 4IL1A 3V2LA 1KCYA 2MJWB 2P71A 1QJTA 4DCKA 5BPJA 3O4YA 2O5GA 1AK8A 2RGIA 2M49B 1TTXA 1AP4A 1EJ3A 2EGDA 3BUOB 1YUTA 4HRGA 1K94A 1NPQA 1KWOB 1Z4HA 3CR2A 4KYNA 2WORA 5K89A 3PSRA 1H4BA 3OBVA 1B7TY 2H61C 3CLNA 2MLFC 1PALA 3AKBA 3O78A 5D69A 1DTLA 3PM2A 1IQ3A 4A4CA 4GBAA 2BNXA 1NCXA 3R1VA 3PN7B 1CFFA 4D1EA 2KLDA 2V53A 3CS1A 3TUYC 2LAPA 4JQ0D 1NCYA 1S6CA 1H8BA 1TRFA 3OX5A 1CB1A 2LC5A 5DKQA 2M1UA 3AKAA 1M46A 1R2UA 3NHTA 5CSNA 1UHJA 2KFFA 4M2PA 1NX2A 1OOGA 1QS7A 2CT9A 4PCWA 1N0YA 4XYNA 3SS5A 1IIOA 4CFRA 2BL0B 1KSOA 1QLKA 4CPVA 1JUOA 1KQVA 5KU1A 1BR1B 3BJHA 1FBVA 3QRXA 1RFJA 3D73A 5D7FA 1M39A 2H2KA 1PSRA 4PHJA 3D77A 1LS8A 1A29A 4GPLB 1SPYA 3EK7A 4MSPA 5FI7A 1G4YR 3SG4A 1YX8A 2M3WA 1YRTB 2CCMA 2LVVA 3EKHA 3OB1B 1DJZA 2AUCA 5B8IB 1HT9A 1DC1A 1J7RA 1B1GA 1HQVA 2LNKA 3CDNA 2MAZA 3SIBA 1XA5A 3VGOA 1A75A 4USLA 3S0AA 3GOFA 2BCXA 5G08A 2BKIB 1LVCD 1AJ4A 4PDZA 4A4BA 1CNPA 1M45A 1ZACA 2D8NA 4MEWA 1QASA 1CDLA 1TNQA 3EVVA 1XFWO 2JQ6A 4JD9A 4ETOA 2PMYA 2JNFA 4OVNF 1CDMA 2M8UA 1OMDA 1SK6D 1F4OA 3DF0B 2JU0A 1OZSA 1S26D 1K96A 2KGBC 2L4HA 1T14A 4WQ3A 2SCPA 2JTZA 4INWA 3FIAA 4YI8A 4C0KA 3BFHA 4GGFA 2LE9B 1NWDA 2M29A 2LVJA 1B8RA 3IVTA 3O4XA 1DJWA 4BY5A 2KAXA 1G33A 3I5IB 1GQMA 1XFVO 4TNCA 3DY9A 3HX4A 4GGNA 2CTNA 1RJVA 1SR6B 4I5KA 4DIRA 3NXAA 4YGEB 2K60A 3K1EA 1SYMA 1RWYA 2GGMA 3SG6A 2K2FA 2DOQA 2LUXA 4PHMA 5HKWA 4JKTA 3L4LA 2NXQA 1DELA 3I5HB 5GQQC 3D76A 3M0WA 1DJXA 1ZMZA 1IH0A 1L2OB 4OCIA 5AERA 1K2HA 3KPXA 3BUMB 2PRUA 1DF0A 3NHIA 1DMOA 1C3ZA 1QVIY 1WRKA 1OOIX 1LXFC 1NX3A 1S3PA 3S0DA 2MLEC 4MZJA 3I5FC 2ZNEA 1M31A 2JRFA 5TNCA 1IWQA 2WCFA 2F3ZA 1BF5A 2WNDA 1L7ZA 3CABA 5HLVA 4AOMA 2G2BA 1KQMC 2KFHA 4MVFA 2LHLA 3D75A 4NDCA 1BG1A 3GK2A 2KBIA 1SW8A 4GFTA 3D74A 2HETA 3NSLA 2JNXA 2JT3A 3JTDB 1VRKA 2FJYA 3D10A 4GUKA 3DZTA 4XJKA 2QACA 2R2IA 3CZTX 3I5HC 1S36A 1SBJA 2K61A 4FQOA 4YGDB
chains in the Genus database with same CATH topology
3WHTB 1AJ5A 1K9UA 1KFXS 1S1EA 1SRAA 3LLEA 1QIWA 1W7JB 1NUBA 3FWBA 1IJ5A 5HKYA 2PVBA 1GGWA 3DVMA 4N1GA 1ALWA 1A75B 1XFUO 2KI6C 2SASA 4PE4A 4YRUA 1BOCA 3OX6A 2JULA 2K0JA 4L9MA 1YURA 1YR5A 2K7DA 1KFUS 1DT7B 2KAVA 1JF2A 2I94A 3OB2B 4ORAB 2FCEA 1ZOTB 1OE9B 1KFXL 1PRWA 2BCBA 1LKJA 1QXPA 1CFCA 3JTDC 1TCOB 2Y1MA 3IQQA 3IQOA 3O6BA 3TDIA 3BUNB 3C1VA 4JPZB 3BOWB 1J1EA 1QLSA 1KFUL 1KK7Z 2L50A 1OZOA 5PALA 1MQ1A 1FPWA 2JT0A 1SY9A 2I2RE 1LA3A 1JBAA 1CM4A 1JF0A 3D0YA 2F3YA 1B4CA 5I2LA 3DD4A 2KHNA 1QX2A 1SL8A 2BBNA 2LM5A 2EC6C 4OKHA 1RTP1 1IKUA 4F0ZB 3HCMA 1F4QA 3KO0A 2Q91A 2LCPA 2TN4A 1LA0A 1CM1A 4PE7A 2F8PA 4I5LB 1KSMA 3LK0A 4OV2A 4AQIA 1GGZA 1B7TZ 4WRIA 1CMGA 3E3RA 2K7BA 1Y1XA 1BMOA 3PALA 1BLQA 1S5GY 2BBMA 1MF8B 1BU3A 1WDCC 1OMVA 2KYFA 2KI4C 3AAJA 1QX7A 2HQWA 2F2PA 2JOJA 1UHKA 5KTYA 2LMTA 4BY4A 3PATA 1KK8C 5DKNA 2HF5A 4M2OA 2NCOA 4AQJA 1MR8A 1BJFA 2LLUA 3VRQA 1BODA 2AMIA 1U5IA 3I5FB 2F33A 4YGCB 5J3XA 2I18A 4N1FA 3NSIA 4WQ2A 1K93D 1S6IA 3WXAA 2ZFDA 2PASA 2GV5A 4MZLA 1KQMB 2BE4A 1TNXA 2LANA 1JFJA 4MZKA 3I5GC 1XK4A 1DVIA 1QTXA 2VRGA 1ODBA 3ICBA 1UP5A 1XVJA 4HSZA 1NYAA 4NDBA 1F71A 1QATA 1J1DA 1QX5B 2KI6D 1IG5A 2QPTA 3OP0A 3PLFB 1QV0A 2KOTA 4QJ5B 1GJYA 2K8MB 4OR9B 4ORBB 2JXCA 4GAOA 1C7VA 1ZFSA 1ZUZA 2KNEA 3O2PA 4NDDA 3JVTB 4MLWA 1X02A 1DJHA 2ZN8A 1EL4A 1PVAA 3AAKA 4N5XA 3SG2A 4PHKA 1UWOA 2E30A 2MA2A 3D0YB 1FI6A 2M7LA 4Q04A 3DVKA 1NX0A 4MRYA 2LVIA 1WLMA 1YVHA 1SCMB 2GGZA 2KAYA 3EK8A 4I5JA 5HLOA 3CR5X 2P6BB 3K21A 3GK1A 1MWNA 2JPTA 1YUUA 2I7AA 1CLBA 2KQ6A 1B9AA 4QJ3B 2M0RA 1SKTA 2WC8A 1CFDA 2L5XB 3RM1A 1WRLA 4MRXA 2JXLA 1W7IB 1BT6A 1XFYO 3OHMB 4DRWA 1WLZA 2OTGC 2M1KB 3JVTC 2BE6A 3WNXB 5CSJA 1SMGA 1K9KA 1NP8A 1XFXO 2EC6B 1UHNA 1SL7A 1DJGA 1N65A 5FYXA 2LMVA 1F70A 3F45A 2ZNDA 4YGBB 1XFZO 2Y5IA 3VRNA 5KSZA 1JWDA 1A4PA 1BR4B 1SCMC 1DJIA 1SL9A 3KHEA 1JFKA 2ZRTA 5IBWA 4ICBA 4E68A 3SG3A 2NLNA 2ZKMX 4NQGA 2LLSA 2LHIA 2JTTA 1WDCB 5CPVA 5AANA 2LMUA 4ZCUA 2KI4B 1V1GA 1TN4A 1PULA 1EG4A 1CDPA 1TNWA 2OS8C 5JJGA 3ZWHA 1NIWA 1CLLA 1TNPA 1J7QA 3LCPC 2Q4UA 3VROA 1KK8B 1SNLA 1JSAA 1MXEA 1CFPA 1K90D 1EG3A 1V1FA 3BXKA 1PK0D 2K7CA 2Y4QA 4YI9A 3EVUA 2LUCA 1YX7A 2K2AA 1DF0B 1EXRA 1ALVA 3IF7A 4ORCB 2MHHA 1OOJA 3NSKA 1CDNA 3DVJA 1FF1A 1B8CA 1F8HA 3VRPA 3I5GB 2EHBA 1YUSA 2LVKA 4GGFC 4MN0A 1FW4A 1M63B 1K9PA 1CTRA 1TIZA 2H61A 2KSPA 1UHHA 2K7OA 4P5OE 2LP3A 2ZN9A 1KWOC 1F55A 1XK4C 1B8LA 3BUWB 1UURA 2BECA 2BKHB 3SG7A 3WHUB 1OQPA 1NCZA 4FTGA 4XJKB 2B1UA 2LP2A 3TZ1A 1CLMA 1DJYA 1TCFA 3BUXB 5CSFA 4C0LA 1YVLA 5ER5A 2L0PA 1A03A 3PFVA 4R1EA 1PSBA 1WY9A 3PN7C 2KQYA 3KF9A 3TDZA 1QV1A 5HKZA 5I2OA 1RECA 2ZRSA 4C0JA 3DVEA 2IS9A 1RK9A 1AHRA 2WOSA 2L51A 1XYDA 2HQ8A 3A4UB 4CIDA 1F54A 3ZNIA 5AEQA 2MBXA 2CXJA 4PE1A 1XO5A 2LV7A 1N2DA 4DS7A 1OMRA 4QJ4B 5JOLA 1FI5A 1C07A 2L98A 2BL0C 2FCDA 2E6WA 2KGRA 5DKRA 5CSIA 4PALA 3NSOA 2JT8A 4I5NB 3KEVA 4U8DA 3CGAA 2M7NA 1OSAA 1S5GZ 1D1OA 1A2XA 3EKJA 5AXIA 3LK1A 2PSRA 3BOWA 1G8IA 1MHOA 1WRZA 1AVSA 2Y1NA 2OTGB 1B47A 3FWCA 1S6JA 2M9GA 4CLNA 2NCPA 3RLZA 1UUSA 3GK4X 3LL8B 5F6TA 1YTZC 5I8NA 1IRJA 2FOTA 4JWQA 4PHNA 1Y1UA 3VRRA 1DGVA 2KDHA 2F2OA 3CTNA 2HPSA 4GNKB 4HREE 4PE0A 3SG5A 1Y0VH 1K95A 2KBMA 1SCVA 2O60A 4MBEA 2COLB 1LINA 2NZ0A 2L4IA 2CBLA 1NSHA 1E8AA 1Y1AA 3TS5B 3FS7A 2LLTA 2AAOA 5ER4X 1QIVA 1Q80A 1DGUA 1J55A 2L2EA 1Y6WA 3BYAA 3PM8A 3TDUA 3EVRA 1J7PA 1CMFA 1NX1A 2PALA 3BQ3A 4CFQA 1EH2A 5HYDA 2G9BA 2OS8B 1C7WA 4HRHA 2ISDA 5AFPA 3SJSA 3SIAA 4YBHB 1IGVA 3I5IC 1TOPA 1K8UA 1SR6C 1RROA 4UPGA 4M2QA 5I2QA 2BCAA 1QVIZ 2M97A 4P2YB 1J7OA 2JC2A 4ZCVA 1KK7Y 2KFGA 1UHIA 1YRUB 3EK4A 3TUYB 2KYCA 2WCBA 3A8RA 1PVBA 2JWWA 4DUQA 2JZIA 3DF0A 3CWGA 3MSEB 2WCEA 1IJ6A 3CR4X 1AUIB 1L2OC 1R6PA 2OPOA 3H4SE 1JC2A 1MUXA 1U5IB 1MXLC 3TS5C 1CKKA 2A4JA 2CNPA 2FJUB 1IQ5A 2MRDA 4YGAA 4IL1A 1KCYA 2MJWB 4DCKA 1QJTA 5BPJA 3O4YA 2O5GA 1AK8A 2RGIA 2M49B 1TTXA 1AP4A 1EJ3A 2EGDA 3BUOB 1YUTA 4HRGA 1K94A 1NPQA 1KWOB 3CR2A 1H4BA 2WORA 5K89A 3PSRA 1B7TY 2H61C 3CLNA 2MLFC 1PALA 3AKBA 3O78A 5D69A 1DTLA 1IQ3A 4A4CA 4GBAA 1NCXA 3PN7B 1CFFA 4D1EA 2V53A 3CS1A 3TUYC 2LAPA 4JQ0D 1NCYA 1S6CA 1H8BA 1TRFA 3OX5A 1CB1A 2LC5A 5DKQA 2M1UA 3AKAA 1M46A 1R2UA 5CSNA 1UHJA 2KFFA 4M2PA 1NX2A 1QS7A 2CT9A 4PCWA 4XYNA 1N0YA 4CFRA 2BL0B 1KSOA 1QLKA 4CPVA 1JUOA 1KQVA 5KU1A 1BR1B 1FBVA 3QRXA 1RFJA 5D7FA 1M39A 2H2KA 1PSRA 4PHJA 1A29A 4GPLB 1SPYA 3EK7A 4MSPA 1G4YR 3SG4A 1YX8A 2M3WA 1YRTB 2CCMA 2LVVA 3EKHA 3OB1B 1DJZA 2AUCA 5B8IB 1HT9A 1J7RA 1B1GA 1HQVA 2LNKA 2MAZA 3SIBA 1XA5A 3VGOA 1A75A 4USLA 3GOFA 2BCXA 5G08A 2BKIB 1LVCD 1AJ4A 4PDZA 4A4BA 1CNPA 1M45A 1ZACA 2D8NA 4MEWA 1QASA 1CDLA 1TNQA 3EVVA 1XFWO 2JQ6A 4ETOA 2PMYA 2JNFA 4OVNF 1CDMA 2M8UA 1OMDA 1SK6D 1F4OA 3DF0B 2JU0A 1OZSA 1S26D 1K96A 2KGBC 2L4HA 4WQ3A 2SCPA 2JTZA 3FIAA 4YI8A 4C0KA 4GGFA 2LE9B 1NWDA 2M29A 2LVJA 1B8RA 1DJWA 4BY5A 2KAXA 1G33A 3I5IB 1GQMA 1XFVO 4TNCA 4GGNA 3HX4A 4I5KA 2CTNA 1RJVA 1SR6B 4DIRA 3NXAA 4YGEB 1SYMA 1RWYA 2GGMA 3SG6A 2K2FA 2DOQA 2LUXA 4PHMA 5HKWA 2NXQA 3I5HB 5GQQC 3M0WA 1DJXA 1ZMZA 1IH0A 1L2OB 4OCIA 5AERA 1K2HA 3KPXA 3BUMB 2PRUA 1DF0A 1DMOA 1QVIY 1WRKA 1LXFC 1NX3A 1S3PA 2MLEC 4MZJA 3I5FC 2ZNEA 1M31A 2JRFA 5TNCA 1IWQA 2WCFA 2F3ZA 1BF5A 2WNDA 1L7ZA 5HLVA 4AOMA 2G2BA 1KQMC 2KFHA 4MVFA 2LHLA 4NDCA 1BG1A 3GK2A 2KBIA 1SW8A 4GFTA 2HETA 3NSLA 2JNXA 2JT3A 3JTDB 1VRKA 3D10A 4GUKA 4XJKA 2QACA 2R2IA 3CZTX 3I5HC 1S36A 1SBJA 2K61A 4FQOA 4YGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHT B;  1AJ5 A;  1K9U A;  1KFX S;  1S1E A;  1SRA A;  3LLE A;  1QIW A;  1W7J B;  1NUB A;  3FWB A;  1IJ5 A;  5HKY A;  2PVB A;  1GGW A;  3DVM A;  4N1G A;  1ALW A;  1A75 B;  1XFU O;  2KI6 C;  2SAS A;  4PE4 A;  4YRU A;  1BOC A;  3OX6 A;  2JUL A;  2K0J A;  4L9M A;  1YUR A;  1YR5 A;  2K7D A;  1KFU S;  1DT7 B;  2KAV A;  1JF2 A;  2I94 A;  3OB2 B;  4ORA B;  2FCE A;  1ZOT B;  1OE9 B;  1KFX L;  1PRW A;  2BCB A;  1LKJ A;  1QXP A;  1CFC A;  3JTD C;  1TCO B;  2Y1M A;  3IQQ A;  3IQO A;  3O6B A;  3TDI A;  3BUN B;  3C1V A;  4JPZ B;  3BOW B;  1J1E A;  1QLS A;  1KFU L;  1KK7 Z;  2L50 A;  1OZO A;  5PAL A;  1MQ1 A;  1FPW A;  2JT0 A;  1SY9 A;  2I2R E;  1LA3 A;  1JBA A;  1CM4 A;  1JF0 A;  3D0Y A;  2F3Y A;  1B4C A;  5I2L A;  3DD4 A;  2KHN A;  1QX2 A;  1SL8 A;  2BBN A;  2LM5 A;  2EC6 C;  4OKH A;  1RTP 1;  1IKU A;  4F0Z B;  3HCM A;  1F4Q A;  3KO0 A;  2Q91 A;  2LCP A;  2TN4 A;  1LA0 A;  1CM1 A;  4PE7 A;  2F8P A;  4I5L B;  1KSM A;  3LK0 A;  4OV2 A;  4AQI A;  1GGZ A;  1B7T Z;  4WRI A;  1CMG A;  3E3R A;  2K7B A;  1Y1X A;  1BMO A;  3PAL A;  1BLQ A;  1S5G Y;  2BBM A;  1MF8 B;  1BU3 A;  1WDC C;  1OMV A;  2KYF A;  2KI4 C;  3AAJ A;  1QX7 A;  2HQW A;  2F2P A;  2JOJ A;  1UHK A;  5KTY A;  2LMT A;  4BY4 A;  3PAT A;  1KK8 C;  5DKN A;  2HF5 A;  4M2O A;  2NCO A;  4AQJ A;  1MR8 A;  1BJF A;  2LLU A;  3VRQ A;  1BOD A;  2AMI A;  1U5I A;  3I5F B;  2F33 A;  4YGC B;  5J3X A;  2I18 A;  4N1F A;  3NSI A;  4WQ2 A;  1K93 D;  1S6I A;  3WXA A;  2ZFD A;  2PAS A;  2GV5 A;  4MZL A;  1KQM B;  2BE4 A;  1TNX A;  2LAN A;  1JFJ A;  4MZK A;  3I5G C;  1XK4 A;  1DVI A;  1QTX A;  2VRG A;  1ODB A;  3ICB A;  1UP5 A;  1XVJ A;  4HSZ A;  1NYA A;  4NDB A;  1F71 A;  1QAT A;  1J1D A;  1QX5 B;  2KI6 D;  1IG5 A;  2QPT A;  3OP0 A;  3PLF B;  1QV0 A;  2KOT A;  4QJ5 B;  1GJY A;  2K8M B;  4OR9 B;  4ORB B;  2JXC A;  4GAO A;  1C7V A;  1ZFS A;  1ZUZ A;  2KNE A;  3O2P A;  4NDD A;  3JVT B;  4MLW A;  1X02 A;  1DJH A;  2ZN8 A;  1EL4 A;  1PVA A;  3AAK A;  4N5X A;  3SG2 A;  4PHK A;  1UWO A;  2E30 A;  2MA2 A;  3D0Y B;  1FI6 A;  2M7L A;  4Q04 A;  3DVK A;  1NX0 A;  4MRY A;  2LVI A;  1WLM A;  1YVH A;  1SCM B;  2GGZ A;  2KAY A;  3EK8 A;  4I5J A;  5HLO A;  3CR5 X;  2P6B B;  3K21 A;  3GK1 A;  1MWN A;  2JPT A;  1YUU A;  2I7A A;  1CLB A;  2KQ6 A;  1B9A A;  4QJ3 B;  2M0R A;  1SKT A;  2WC8 A;  1CFD A;  2L5X B;  3RM1 A;  1WRL A;  4MRX A;  2JXL A;  1W7I B;  1BT6 A;  1XFY O;  3OHM B;  4DRW A;  1WLZ A;  2OTG C;  2M1K B;  3JVT C;  2BE6 A;  3WNX B;  5CSJ A;  1SMG A;  1K9K A;  1NP8 A;  1XFX O;  2EC6 B;  1UHN A;  1SL7 A;  1DJG A;  1N65 A;  5FYX A;  2LMV A;  1F70 A;  3F45 A;  2ZND A;  4YGB B;  1XFZ O;  2Y5I A;  3VRN A;  5KSZ A;  1JWD A;  1A4P A;  1BR4 B;  1SCM C;  1DJI A;  1SL9 A;  3KHE A;  1JFK A;  2ZRT A;  5IBW A;  4ICB A;  4E68 A;  3SG3 A;  2NLN A;  2ZKM X;  4NQG A;  2LLS A;  2LHI A;  2JTT A;  1WDC B;  5CPV A;  5AAN A;  2LMU A;  4ZCU A;  2KI4 B;  1V1G A;  1TN4 A;  1PUL A;  1EG4 A;  1CDP A;  1TNW A;  2OS8 C;  5JJG A;  3ZWH A;  1NIW A;  1CLL A;  1TNP A;  1J7Q A;  3LCP C;  2Q4U A;  3VRO A;  1KK8 B;  1SNL A;  1JSA A;  1MXE A;  1CFP A;  1K90 D;  1EG3 A;  1V1F A;  3BXK A;  1PK0 D;  2K7C A;  2Y4Q A;  4YI9 A;  3EVU A;  2LUC A;  1YX7 A;  2K2A A;  1DF0 B;  1EXR A;  1ALV A;  3IF7 A;  4ORC B;  2MHH A;  1OOJ A;  3NSK A;  1CDN A;  3DVJ A;  1FF1 A;  1B8C A;  1F8H A;  3VRP A;  3I5G B;  2EHB A;  1YUS A;  2LVK A;  4GGF C;  4MN0 A;  1FW4 A;  1M63 B;  1K9P A;  1CTR A;  1TIZ A;  2H61 A;  2KSP A;  1UHH A;  2K7O A;  4P5O E;  2LP3 A;  2ZN9 A;  1KWO C;  1F55 A;  1XK4 C;  1B8L A;  3BUW B;  1UUR A;  2BEC A;  2BKH B;  3SG7 A;  3WHU B;  1OQP A;  1NCZ A;  4FTG A;  4XJK B;  2B1U A;  2LP2 A;  3TZ1 A;  1CLM A;  1DJY A;  1TCF A;  3BUX B;  5CSF A;  4C0L A;  1YVL A;  5ER5 A;  2L0P A;  1A03 A;  3PFV A;  4R1E A;  1PSB A;  1WY9 A;  3PN7 C;  2KQY A;  3KF9 A;  3TDZ A;  1QV1 A;  5HKZ A;  5I2O A;  1REC A;  2ZRS A;  4C0J A;  3DVE A;  2IS9 A;  1RK9 A;  1AHR A;  2WOS A;  2L51 A;  1XYD A;  2HQ8 A;  3A4U B;  4CID A;  1F54 A;  3ZNI A;  5AEQ A;  2MBX A;  2CXJ A;  4PE1 A;  1XO5 A;  2LV7 A;  1N2D A;  4DS7 A;  1OMR A;  4QJ4 B;  5JOL A;  1FI5 A;  1C07 A;  2L98 A;  2BL0 C;  2FCD A;  2E6W A;  2KGR A;  5DKR A;  5CSI A;  4PAL A;  3NSO A;  2JT8 A;  4I5N B;  3KEV A;  4U8D A;  3CGA A;  2M7N A;  1OSA A;  1S5G Z;  1D1O A;  1A2X A;  3EKJ A;  5AXI A;  3LK1 A;  2PSR A;  3BOW A;  1G8I A;  1MHO A;  1WRZ A;  1AVS A;  2Y1N A;  2OTG B;  1B47 A;  3FWC A;  1S6J A;  2M9G A;  4CLN A;  2NCP A;  3RLZ A;  1UUS A;  3GK4 X;  3LL8 B;  5F6T A;  1YTZ C;  5I8N A;  1IRJ A;  2FOT A;  4JWQ A;  4PHN A;  1Y1U A;  3VRR A;  1DGV A;  2KDH A;  2F2O A;  3CTN A;  2HPS A;  4GNK B;  4HRE E;  4PE0 A;  3SG5 A;  1Y0V H;  1K95 A;  2KBM A;  1SCV A;  2O60 A;  4MBE A;  2COL B;  1LIN A;  2NZ0 A;  2L4I A;  2CBL A;  1NSH A;  1E8A A;  1Y1A A;  3TS5 B;  3FS7 A;  2LLT A;  2AAO A;  5ER4 X;  1QIV A;  1Q80 A;  1DGU A;  1J55 A;  2L2E A;  1Y6W A;  3BYA A;  3PM8 A;  3TDU A;  3EVR A;  1J7P A;  1CMF A;  1NX1 A;  2PAL A;  3BQ3 A;  4CFQ A;  1EH2 A;  5HYD A;  2G9B A;  2OS8 B;  1C7W A;  4HRH A;  2ISD A;  5AFP A;  3SJS A;  3SIA A;  4YBH B;  1IGV A;  3I5I C;  1TOP A;  1K8U A;  1SR6 C;  1RRO A;  4UPG A;  4M2Q A;  5I2Q A;  2BCA A;  1QVI Z;  2M97 A;  4P2Y B;  1J7O A;  2JC2 A;  4ZCV A;  1KK7 Y;  2KFG A;  1UHI A;  1YRU B;  3EK4 A;  3TUY B;  2KYC A;  2WCB A;  3A8R A;  1PVB A;  2JWW A;  4DUQ A;  2JZI A;  3DF0 A;  3CWG A;  3MSE B;  2WCE A;  1IJ6 A;  3CR4 X;  1AUI B;  1L2O C;  1R6P A;  2OPO A;  3H4S E;  1JC2 A;  1MUX A;  1U5I B;  1MXL C;  3TS5 C;  1CKK A;  2A4J A;  2CNP A;  2FJU B;  1IQ5 A;  2MRD A;  4YGA A;  4IL1 A;  1KCY A;  2MJW B;  4DCK A;  1QJT A;  5BPJ A;  3O4Y A;  2O5G A;  1AK8 A;  2RGI A;  2M49 B;  1TTX A;  1AP4 A;  1EJ3 A;  2EGD A;  3BUO B;  1YUT A;  4HRG A;  1K94 A;  1NPQ A;  1KWO B;  3CR2 A;  1H4B A;  2WOR A;  5K89 A;  3PSR A;  1B7T Y;  2H61 C;  3CLN A;  2MLF C;  1PAL A;  3AKB A;  3O78 A;  5D69 A;  1DTL A;  1IQ3 A;  4A4C A;  4GBA A;  1NCX A;  3PN7 B;  1CFF A;  4D1E A;  2V53 A;  3CS1 A;  3TUY C;  2LAP A;  4JQ0 D;  1NCY A;  1S6C A;  1H8B A;  1TRF A;  3OX5 A;  1CB1 A;  2LC5 A;  5DKQ A;  2M1U A;  3AKA A;  1M46 A;  1R2U A;  5CSN A;  1UHJ A;  2KFF A;  4M2P A;  1NX2 A;  1QS7 A;  2CT9 A;  4PCW A;  4XYN A;  1N0Y A;  4CFR A;  2BL0 B;  1KSO A;  1QLK A;  4CPV A;  1JUO A;  1KQV A;  5KU1 A;  1BR1 B;  1FBV A;  3QRX A;  1RFJ A;  5D7F A;  1M39 A;  2H2K A;  1PSR A;  4PHJ A;  1A29 A;  4GPL B;  1SPY A;  3EK7 A;  4MSP A;  1G4Y R;  3SG4 A;  1YX8 A;  2M3W A;  1YRT B;  2CCM A;  2LVV A;  3EKH A;  3OB1 B;  1DJZ A;  2AUC A;  5B8I B;  1HT9 A;  1J7R A;  1B1G A;  1HQV A;  2LNK A;  2MAZ A;  3SIB A;  1XA5 A;  3VGO A;  1A75 A;  4USL A;  3GOF A;  2BCX A;  5G08 A;  2BKI B;  1LVC D;  1AJ4 A;  4PDZ A;  4A4B A;  1CNP A;  1M45 A;  1ZAC A;  2D8N A;  4MEW A;  1QAS A;  1CDL A;  1TNQ A;  3EVV A;  1XFW O;  2JQ6 A;  4ETO A;  2PMY A;  2JNF A;  4OVN F;  1CDM A;  2M8U A;  1OMD A;  1SK6 D;  1F4O A;  3DF0 B;  2JU0 A;  1OZS A;  1S26 D;  1K96 A;  2KGB C;  2L4H A;  4WQ3 A;  2SCP A;  2JTZ A;  3FIA A;  4YI8 A;  4C0K A;  4GGF A;  2LE9 B;  1NWD A;  2M29 A;  2LVJ A;  1B8R A;  1DJW A;  4BY5 A;  2KAX A;  1G33 A;  3I5I B;  1GQM A;  1XFV O;  4TNC A;  4GGN A;  3HX4 A;  4I5K A;  2CTN A;  1RJV A;  1SR6 B;  4DIR A;  3NXA A;  4YGE B;  1SYM A;  1RWY A;  2GGM A;  3SG6 A;  2K2F A;  2DOQ A;  2LUX A;  4PHM A;  5HKW A;  2NXQ A;  3I5H B;  5GQQ C;  3M0W A;  1DJX A;  1ZMZ A;  1IH0 A;  1L2O B;  4OCI A;  5AER A;  1K2H A;  3KPX A;  3BUM B;  2PRU A;  1DF0 A;  1DMO A;  1QVI Y;  1WRK A;  1LXF C;  1NX3 A;  1S3P A;  2MLE C;  4MZJ A;  3I5F C;  2ZNE A;  1M31 A;  2JRF A;  5TNC A;  1IWQ A;  2WCF A;  2F3Z A;  1BF5 A;  2WND A;  1L7Z A;  5HLV A;  4AOM A;  2G2B A;  1KQM C;  2KFH A;  4MVF A;  2LHL A;  4NDC A;  1BG1 A;  3GK2 A;  2KBI A;  1SW8 A;  4GFT A;  2HET A;  3NSL A;  2JNX A;  2JT3 A;  3JTD B;  1VRK A;  3D10 A;  4GUK A;  4XJK A;  2QAC A;  2R2I A;  3CZT X;  3I5H C;  1S36 A;  1SBJ A;  2K61 A;  4FQO A;  4YGD B; 
#chains in the Genus database with same CATH topology
 3WHT B;  1AJ5 A;  1K9U A;  1KFX S;  1S1E A;  1SRA A;  3LLE A;  1QIW A;  1W7J B;  1NUB A;  3FWB A;  1IJ5 A;  5HKY A;  2PVB A;  1GGW A;  3DVM A;  4N1G A;  1ALW A;  1A75 B;  1XFU O;  2KI6 C;  2SAS A;  4PE4 A;  4YRU A;  1BOC A;  3OX6 A;  1QWV A;  2JUL A;  2K0J A;  2PYQ A;  1YUR A;  4L9M A;  1YR5 A;  2K7D A;  3UNW A;  1KFU S;  1DT7 B;  2KAV A;  1JF2 A;  2I94 A;  3OB2 B;  4ORA B;  2FCE A;  1ZOT B;  1OE9 B;  1KFX L;  1PRW A;  2BCB A;  1LKJ A;  1QXP A;  1CFC A;  3JTD C;  1TCO B;  2Y1M A;  3IQQ A;  3IQO A;  3O6B A;  3TDI A;  5FI2 A;  3BUN B;  3C1V A;  4JPZ B;  2WCL A;  3BOW B;  1J1E A;  3D78 A;  1QLS A;  1KFU L;  1KK7 Z;  2L50 A;  1OZO A;  5PAL A;  1MQ1 A;  3FE9 A;  2JT0 A;  1SY9 A;  2I2R E;  1FPW A;  1LA3 A;  1JBA A;  1CM4 A;  1JF0 A;  3D0Y A;  2F3Y A;  1B4C A;  5I2L A;  3DD4 A;  2KHN A;  1QX2 A;  1SL8 A;  3UO9 A;  2QEO A;  2BBN A;  3B6X A;  2LM5 A;  2EC6 C;  4OKH A;  1RTP 1;  1IKU A;  4F0Z B;  3HCM A;  3S0B A;  1F4Q A;  3KO0 A;  2Q91 A;  2LCP A;  2TN4 A;  5I2O A;  1LA0 A;  1CM1 A;  3BFA A;  3Q8I A;  4PE7 A;  2F8P A;  3R1P A;  3RZS A;  4I5L B;  1KSM A;  3LK0 A;  4OV2 A;  4AQI A;  1GGZ A;  1B7T Z;  4WRI A;  1CMG A;  3E3R A;  2K7B A;  1Y1X A;  1BMO A;  3PAL A;  1BLQ A;  3PJI A;  1S5G Y;  1MF8 B;  1WDC C;  1BU3 A;  2BBM A;  1OMV A;  3R1O A;  2KYF A;  2KI4 C;  3AAJ A;  1QX7 A;  2HQW A;  3S0F A;  2F2P A;  2JOJ A;  1UHK A;  5KTY A;  2LMT A;  4BY4 A;  3PAT A;  1KK8 C;  5DKN A;  2HF5 A;  4M2O A;  2NCO A;  4AQJ A;  1MR8 A;  1BJF A;  2LLU A;  1DEK A;  3VRQ A;  1BOD A;  2AMI A;  1U5I A;  3I5F B;  2F33 A;  2P70 A;  4YGC B;  5J3X A;  2I18 A;  4N1F A;  3NSI A;  4WQ2 A;  1K93 D;  1S6I A;  3WXA A;  2ZFD A;  2PAS A;  1TUZ A;  2GV5 A;  4MZL A;  3EG5 B;  1KQM B;  2BE4 A;  1TNX A;  2LAN A;  2QDI A;  1JFJ A;  3L47 A;  4MZK A;  3I5G C;  1XK4 A;  1DVI A;  1QTX A;  2VRG A;  1ODB A;  3ICB A;  1UP5 A;  1XVJ A;  4HSZ A;  1NYA A;  4NDB A;  1F71 A;  1QAT A;  1J1D A;  1QX5 B;  2KI6 D;  1IG5 A;  2QPT A;  3OP0 A;  3PLF B;  1QV0 A;  2KOT A;  4QJ5 B;  1GJY A;  2K8M B;  4OR9 B;  4ORB B;  2JXC A;  4GAO A;  1C7V A;  1ZFS A;  1ZUZ A;  2KNE A;  3O2P A;  4NDD A;  3JVT B;  4MLW A;  1X02 A;  1DJH A;  2ZN8 A;  1EL4 A;  1PVA A;  3AAK A;  4N5X A;  3SG2 A;  4PHK A;  1UWO A;  2E30 A;  2MA2 A;  3D0Y B;  1FI6 A;  2M7L A;  4Q04 A;  3B87 A;  2WCK A;  3DVK A;  1NX0 A;  4MRY A;  2LVI A;  3CZ2 A;  1WLM A;  1YVH A;  1SCM B;  2GGZ A;  2KAY A;  2L2C A;  3EK8 A;  4I5J A;  5HLO A;  3CR5 X;  2P6B B;  2QEH A;  1DQE A;  3K21 A;  1C3Y A;  1TWO A;  3BFB A;  3GK1 A;  1MWN A;  2JPT A;  1YUU A;  2I7A A;  1CLB A;  2KQ6 A;  1B9A A;  4QJ3 B;  2M0R A;  1SKT A;  2H8V A;  2WC8 A;  1OOH A;  1CFD A;  2L5X B;  3RM1 A;  1WRL A;  4MRX A;  2JXL A;  1W7I B;  1BT6 A;  1XFY O;  3OHM B;  4DRW A;  3L4A A;  1WLZ A;  2OTG C;  2M1K B;  3JVT C;  2BE6 A;  2JPO A;  2KLE A;  3WNX B;  5CSJ A;  1SMG A;  1K9K A;  1NP8 A;  1XFX O;  2EC6 B;  1UHN A;  3NGV A;  2GTE A;  1GM0 A;  1SL7 A;  1DJG A;  1W9Z A;  3S0E A;  1N65 A;  5FYX A;  2LMV A;  1F70 A;  3F45 A;  2WC5 A;  2ZND A;  1XFZ O;  2Y5I A;  4YGB B;  3VRN A;  5KSZ A;  1JWD A;  1A4P A;  1BR4 B;  1SCM C;  1DJI A;  2PQL A;  1SL9 A;  3KHE A;  1JFK A;  2ZRT A;  5IBW A;  4ICB A;  4E68 A;  3SG3 A;  2NLN A;  2ZKM X;  4NQG A;  2LLS A;  2LHI A;  2JTT A;  1WDC B;  5CPV A;  5AAN A;  2LMU A;  4ZCU A;  2KI4 B;  1V1G A;  1TN4 A;  1PUL A;  1EG4 A;  1CDP A;  1TNW A;  2OS8 C;  5JJG A;  3ZWH A;  1NIW A;  1CLL A;  1TNP A;  1J7Q A;  1OW4 A;  3LCP C;  2Q4U A;  4PT1 A;  1OOF A;  3VRO A;  1KK8 B;  1SNL A;  1JSA A;  1MXE A;  3B88 A;  1CFP A;  1K90 D;  1EG3 A;  1V1F A;  3BXK A;  1PK0 D;  2K7C A;  2Y4Q A;  4INX A;  4YI9 A;  3FE6 A;  3EVU A;  2LUC A;  3OGN A;  1YX7 A;  2K2A A;  1DF0 B;  1EXR A;  1ALV A;  3IF7 A;  4ORC B;  2QEV A;  2MHH A;  1OOJ A;  3NSK A;  1CDN A;  1P28 A;  3DVJ A;  1FF1 A;  1B8C A;  1XFR A;  1F8H A;  3VRP A;  3I5G B;  3SS3 A;  2WC6 A;  2EHB A;  1YUS A;  2LVK A;  3R72 A;  4GGF C;  4MN0 A;  1FW4 A;  1M63 B;  1K9P A;  1CTR A;  1SSE B;  1TIZ A;  2H61 A;  2KSP A;  1UHH A;  2K7O A;  4P5O E;  2LP3 A;  2ZN9 A;  1KWO C;  1F55 A;  1XK4 C;  3B86 A;  1B8L A;  3BUW B;  1UUR A;  2BEC A;  1ORG A;  2BKH B;  3SG7 A;  3WHU B;  1OQP A;  1NCZ A;  4FTG A;  4XJK B;  5FI6 A;  2B1U A;  2LP2 A;  3TZ1 A;  1DJY A;  1CLM A;  1TCF A;  3BUX B;  5CSF A;  3SS4 A;  4C0L A;  4IJ7 A;  1YVL A;  5ER5 A;  2L0P A;  1A03 A;  3PFV A;  4R1E A;  1PSB A;  3DXL A;  1WY9 A;  3PN7 C;  2QEB A;  2KQY A;  3KF9 A;  1Z2C B;  1QV1 A;  4OZD A;  5HKZ A;  3TDZ A;  1REC A;  2ZRS A;  4C0J A;  3DVE A;  2IS9 A;  1RK9 A;  1AHR A;  2L5Y A;  2L51 A;  1XYD A;  2WOS A;  2HQ8 A;  3A4U B;  4CID A;  1F54 A;  3ZNI A;  5AEQ A;  2MBX A;  2CXJ A;  4PE1 A;  1XO5 A;  2LV7 A;  3CZ0 A;  2WCM A;  1N2D A;  4DS7 A;  1OMR A;  4QJ4 B;  5JOL A;  1FI5 A;  1C07 A;  2L98 A;  2BL0 C;  2FCD A;  5HL1 A;  2E6W A;  2KGR A;  5DKR A;  3CYZ A;  3FE8 A;  5CSI A;  4PAL A;  3NSO A;  2JT8 A;  4I5N B;  3KEV A;  4U8D A;  4F7F A;  2WCJ A;  3CGA A;  2M7N A;  1OSA A;  1S5G Z;  1D1O A;  1A2X A;  3EKJ A;  5AXI A;  3LK1 A;  2PSR A;  3BOW A;  1G8I A;  1MHO A;  5D3O A;  1WRZ A;  1AVS A;  2Y1N A;  2OTG B;  1B47 A;  3FWC A;  1S6J A;  2M9G A;  4CLN A;  2NCP A;  2WCH A;  3RLZ A;  1UUS A;  3CZ1 A;  3GK4 X;  3LL8 B;  5F6T A;  1YTZ C;  5I8N A;  1IRJ A;  2FOT A;  4JWQ A;  4PHN A;  1Y1U A;  3VRR A;  5I94 A;  1DGV A;  2KDH A;  2F2O A;  2YGU A;  2HPS A;  3CTN A;  3N7H A;  4GNK B;  4HRE E;  1Y0V H;  3B7A A;  4PE0 A;  3SG5 A;  1K95 A;  2KBM A;  1SCV A;  2O60 A;  4MBE A;  2COL B;  1LIN A;  2NZ0 A;  2L4I A;  2CBL A;  2ERB A;  1NSH A;  1E8A A;  2BAP A;  1Y1A A;  3TS5 B;  3FS7 A;  2LLT A;  2AAO A;  5ER4 X;  1QIV A;  1Q80 A;  1DGU A;  1J55 A;  2L2E A;  1Y6W A;  3BYA A;  3PM8 A;  3TDU A;  3EVR A;  3VB1 A;  1CMF A;  1J7P A;  1NX1 A;  2PAL A;  3BQ3 A;  4CFQ A;  5EL2 A;  1EH2 A;  5HYD A;  2G9B A;  2OS8 B;  1C7W A;  4HRH A;  2ISD A;  5AFP A;  3SJS A;  3S0G A;  3SIA A;  4YBH B;  1IGV A;  3I5I C;  1TOP A;  1K8U A;  1SR6 C;  5DIC A;  1RRO A;  4UPG A;  4M2Q A;  5I2Q A;  2BCA A;  1QVI Z;  2M97 A;  4P2Y B;  1J7O A;  2JC2 A;  3QME A;  1KK7 Y;  2KFG A;  1UHI A;  1YRU B;  3EK4 A;  4ZCV A;  3TUY B;  2KYC A;  2WCB A;  3A8R A;  1PVB A;  4FQT A;  2JWW A;  4DUQ A;  2JZI A;  3DF0 A;  3CWG A;  3MSE B;  2WCE A;  1IJ6 A;  3CR4 X;  1AUI B;  1L2O C;  1R6P A;  2OPO A;  3H4S E;  1TUJ A;  1JC2 A;  3DYE A;  1MUX A;  1U5I B;  1MXL C;  3TS5 C;  1CKK A;  2A4J A;  2CNP A;  2FJU B;  2KPH A;  1IQ5 A;  2MRD A;  4YGA A;  4IL1 A;  3V2L A;  1KCY A;  2MJW B;  2P71 A;  1QJT A;  4DCK A;  5BPJ A;  3O4Y A;  2O5G A;  1AK8 A;  2RGI A;  2M49 B;  1TTX A;  1AP4 A;  1EJ3 A;  2EGD A;  3BUO B;  1YUT A;  4HRG A;  1K94 A;  1NPQ A;  1KWO B;  1Z4H A;  3CR2 A;  4KYN A;  2WOR A;  5K89 A;  3PSR A;  1H4B A;  3OBV A;  1B7T Y;  2H61 C;  3CLN A;  2MLF C;  1PAL A;  3AKB A;  3O78 A;  5D69 A;  1DTL A;  3PM2 A;  1IQ3 A;  4A4C A;  4GBA A;  2BNX A;  1NCX A;  3R1V A;  3PN7 B;  1CFF A;  4D1E A;  2KLD A;  2V53 A;  3CS1 A;  3TUY C;  2LAP A;  4JQ0 D;  1NCY A;  1S6C A;  1H8B A;  1TRF A;  3OX5 A;  1CB1 A;  2LC5 A;  5DKQ A;  2M1U A;  3AKA A;  1M46 A;  1R2U A;  3NHT A;  5CSN A;  1UHJ A;  2KFF A;  4M2P A;  1NX2 A;  1OOG A;  1QS7 A;  2CT9 A;  4PCW A;  1N0Y A;  4XYN A;  3SS5 A;  1IIO A;  4CFR A;  2BL0 B;  1KSO A;  1QLK A;  4CPV A;  1JUO A;  1KQV A;  5KU1 A;  1BR1 B;  3BJH A;  1FBV A;  3QRX A;  1RFJ A;  3D73 A;  5D7F A;  1M39 A;  2H2K A;  1PSR A;  4PHJ A;  3D77 A;  1LS8 A;  1A29 A;  4GPL B;  1SPY A;  3EK7 A;  4MSP A;  5FI7 A;  1G4Y R;  3SG4 A;  1YX8 A;  2M3W A;  1YRT B;  2CCM A;  2LVV A;  3EKH A;  3OB1 B;  1DJZ A;  2AUC A;  5B8I B;  1HT9 A;  1DC1 A;  1J7R A;  1B1G A;  1HQV A;  2LNK A;  3CDN A;  2MAZ A;  3SIB A;  1XA5 A;  3VGO A;  1A75 A;  4USL A;  3S0A A;  3GOF A;  2BCX A;  5G08 A;  2BKI B;  1LVC D;  1AJ4 A;  4PDZ A;  4A4B A;  1CNP A;  1M45 A;  1ZAC A;  2D8N A;  4MEW A;  1QAS A;  1CDL A;  1TNQ A;  3EVV A;  1XFW O;  2JQ6 A;  4JD9 A;  4ETO A;  2PMY A;  2JNF A;  4OVN F;  1CDM A;  2M8U A;  1OMD A;  1SK6 D;  1F4O A;  3DF0 B;  2JU0 A;  1OZS A;  1S26 D;  1K96 A;  2KGB C;  2L4H A;  1T14 A;  4WQ3 A;  2SCP A;  2JTZ A;  4INW A;  3FIA A;  4YI8 A;  4C0K A;  3BFH A;  4GGF A;  2LE9 B;  1NWD A;  2M29 A;  2LVJ A;  1B8R A;  3IVT A;  3O4X A;  1DJW A;  4BY5 A;  2KAX A;  1G33 A;  3I5I B;  1GQM A;  1XFV O;  4TNC A;  3DY9 A;  3HX4 A;  4GGN A;  2CTN A;  1RJV A;  1SR6 B;  4I5K A;  4DIR A;  3NXA A;  4YGE B;  2K60 A;  3K1E A;  1SYM A;  1RWY A;  2GGM A;  3SG6 A;  2K2F A;  2DOQ A;  2LUX A;  4PHM A;  5HKW A;  4JKT A;  3L4L A;  2NXQ A;  1DEL A;  3I5H B;  5GQQ C;  3D76 A;  3M0W A;  1DJX A;  1ZMZ A;  1IH0 A;  1L2O B;  4OCI A;  5AER A;  1K2H A;  3KPX A;  3BUM B;  2PRU A;  1DF0 A;  3NHI A;  1DMO A;  1C3Z A;  1QVI Y;  1WRK A;  1OOI X;  1LXF C;  1NX3 A;  1S3P A;  3S0D A;  2MLE C;  4MZJ A;  3I5F C;  2ZNE A;  1M31 A;  2JRF A;  5TNC A;  1IWQ A;  2WCF A;  2F3Z A;  1BF5 A;  2WND A;  1L7Z A;  3CAB A;  5HLV A;  4AOM A;  2G2B A;  1KQM C;  2KFH A;  4MVF A;  2LHL A;  3D75 A;  4NDC A;  1BG1 A;  3GK2 A;  2KBI A;  1SW8 A;  4GFT A;  3D74 A;  2HET A;  3NSL A;  2JNX A;  2JT3 A;  3JTD B;  1VRK A;  2FJY A;  3D10 A;  4GUK A;  3DZT A;  4XJK A;  2QAC A;  2R2I A;  3CZT X;  3I5H C;  1S36 A;  1SBJ A;  2K61 A;  4FQO A;  4YGD B; 
#chains in the Genus database with same CATH homology
 3WHT B;  1AJ5 A;  1K9U A;  1KFX S;  1S1E A;  1SRA A;  3LLE A;  1QIW A;  1W7J B;  1NUB A;  3FWB A;  1IJ5 A;  5HKY A;  2PVB A;  1GGW A;  3DVM A;  4N1G A;  1ALW A;  1A75 B;  1XFU O;  2KI6 C;  2SAS A;  4PE4 A;  4YRU A;  1BOC A;  3OX6 A;  2JUL A;  2K0J A;  4L9M A;  1YUR A;  1YR5 A;  2K7D A;  1KFU S;  1DT7 B;  2KAV A;  1JF2 A;  2I94 A;  3OB2 B;  4ORA B;  2FCE A;  1ZOT B;  1OE9 B;  1KFX L;  1PRW A;  2BCB A;  1LKJ A;  1QXP A;  1CFC A;  3JTD C;  1TCO B;  2Y1M A;  3IQQ A;  3IQO A;  3O6B A;  3TDI A;  3BUN B;  3C1V A;  4JPZ B;  3BOW B;  1J1E A;  1QLS A;  1KFU L;  1KK7 Z;  2L50 A;  1OZO A;  5PAL A;  1MQ1 A;  1FPW A;  2JT0 A;  1SY9 A;  2I2R E;  1LA3 A;  1JBA A;  1CM4 A;  1JF0 A;  3D0Y A;  2F3Y A;  1B4C A;  5I2L A;  3DD4 A;  2KHN A;  1QX2 A;  1SL8 A;  2BBN A;  2LM5 A;  2EC6 C;  4OKH A;  1RTP 1;  1IKU A;  4F0Z B;  3HCM A;  1F4Q A;  3KO0 A;  2Q91 A;  2LCP A;  2TN4 A;  1LA0 A;  1CM1 A;  4PE7 A;  2F8P A;  4I5L B;  1KSM A;  3LK0 A;  4OV2 A;  4AQI A;  1GGZ A;  1B7T Z;  4WRI A;  1CMG A;  3E3R A;  2K7B A;  1Y1X A;  1BMO A;  3PAL A;  1BLQ A;  1S5G Y;  2BBM A;  1MF8 B;  1BU3 A;  1WDC C;  1OMV A;  2KYF A;  2KI4 C;  3AAJ A;  1QX7 A;  2HQW A;  2F2P A;  2JOJ A;  1UHK A;  5KTY A;  2LMT A;  4BY4 A;  3PAT A;  1KK8 C;  5DKN A;  2HF5 A;  4M2O A;  2NCO A;  4AQJ A;  1MR8 A;  1BJF A;  2LLU A;  3VRQ A;  1BOD A;  2AMI A;  1U5I A;  3I5F B;  2F33 A;  4YGC B;  5J3X A;  2I18 A;  4N1F A;  3NSI A;  4WQ2 A;  1K93 D;  1S6I A;  3WXA A;  2ZFD A;  2PAS A;  2GV5 A;  4MZL A;  1KQM B;  2BE4 A;  1TNX A;  2LAN A;  1JFJ A;  4MZK A;  3I5G C;  1XK4 A;  1DVI A;  1QTX A;  2VRG A;  1ODB A;  3ICB A;  1UP5 A;  1XVJ A;  4HSZ A;  1NYA A;  4NDB A;  1F71 A;  1QAT A;  1J1D A;  1QX5 B;  2KI6 D;  1IG5 A;  2QPT A;  3OP0 A;  3PLF B;  1QV0 A;  2KOT A;  4QJ5 B;  1GJY A;  2K8M B;  4OR9 B;  4ORB B;  2JXC A;  4GAO A;  1C7V A;  1ZFS A;  1ZUZ A;  2KNE A;  3O2P A;  4NDD A;  3JVT B;  4MLW A;  1X02 A;  1DJH A;  2ZN8 A;  1EL4 A;  1PVA A;  3AAK A;  4N5X A;  3SG2 A;  4PHK A;  1UWO A;  2E30 A;  2MA2 A;  3D0Y B;  1FI6 A;  2M7L A;  4Q04 A;  3DVK A;  1NX0 A;  4MRY A;  2LVI A;  1WLM A;  1YVH A;  1SCM B;  2GGZ A;  2KAY A;  3EK8 A;  4I5J A;  5HLO A;  3CR5 X;  2P6B B;  3K21 A;  3GK1 A;  1MWN A;  2JPT A;  1YUU A;  2I7A A;  1CLB A;  2KQ6 A;  1B9A A;  4QJ3 B;  2M0R A;  1SKT A;  2WC8 A;  1CFD A;  2L5X B;  3RM1 A;  1WRL A;  4MRX A;  2JXL A;  1W7I B;  1BT6 A;  1XFY O;  3OHM B;  4DRW A;  1WLZ A;  2OTG C;  2M1K B;  3JVT C;  2BE6 A;  3WNX B;  5CSJ A;  1SMG A;  1K9K A;  1NP8 A;  1XFX O;  2EC6 B;  1UHN A;  1SL7 A;  1DJG A;  1N65 A;  5FYX A;  2LMV A;  1F70 A;  3F45 A;  2ZND A;  4YGB B;  1XFZ O;  2Y5I A;  3VRN A;  5KSZ A;  1JWD A;  1A4P A;  1BR4 B;  1SCM C;  1DJI A;  1SL9 A;  3KHE A;  1JFK A;  2ZRT A;  5IBW A;  4ICB A;  4E68 A;  3SG3 A;  2NLN A;  2ZKM X;  4NQG A;  2LLS A;  2LHI A;  2JTT A;  1WDC B;  5CPV A;  5AAN A;  2LMU A;  4ZCU A;  2KI4 B;  1V1G A;  1TN4 A;  1PUL A;  1EG4 A;  1CDP A;  1TNW A;  2OS8 C;  5JJG A;  3ZWH A;  1NIW A;  1CLL A;  1TNP A;  1J7Q A;  3LCP C;  2Q4U A;  3VRO A;  1KK8 B;  1SNL A;  1JSA A;  1MXE A;  1CFP A;  1K90 D;  1EG3 A;  1V1F A;  3BXK A;  1PK0 D;  2K7C A;  2Y4Q A;  4YI9 A;  3EVU A;  2LUC A;  1YX7 A;  2K2A A;  1DF0 B;  1EXR A;  1ALV A;  3IF7 A;  4ORC B;  2MHH A;  1OOJ A;  3NSK A;  1CDN A;  3DVJ A;  1FF1 A;  1B8C A;  1F8H A;  3VRP A;  3I5G B;  2EHB A;  1YUS A;  2LVK A;  4GGF C;  4MN0 A;  1FW4 A;  1M63 B;  1K9P A;  1CTR A;  1TIZ A;  2H61 A;  2KSP A;  1UHH A;  2K7O A;  4P5O E;  2LP3 A;  2ZN9 A;  1KWO C;  1F55 A;  1XK4 C;  1B8L A;  3BUW B;  1UUR A;  2BEC A;  2BKH B;  3SG7 A;  3WHU B;  1OQP A;  1NCZ A;  4FTG A;  4XJK B;  2B1U A;  2LP2 A;  3TZ1 A;  1CLM A;  1DJY A;  1TCF A;  3BUX B;  5CSF A;  4C0L A;  1YVL A;  5ER5 A;  2L0P A;  1A03 A;  3PFV A;  4R1E A;  1PSB A;  1WY9 A;  3PN7 C;  2KQY A;  3KF9 A;  3TDZ A;  1QV1 A;  5HKZ A;  5I2O A;  1REC A;  2ZRS A;  4C0J A;  3DVE A;  2IS9 A;  1RK9 A;  1AHR A;  2WOS A;  2L51 A;  1XYD A;  2HQ8 A;  3A4U B;  4CID A;  1F54 A;  3ZNI A;  5AEQ A;  2MBX A;  2CXJ A;  4PE1 A;  1XO5 A;  2LV7 A;  1N2D A;  4DS7 A;  1OMR A;  4QJ4 B;  5JOL A;  1FI5 A;  1C07 A;  2L98 A;  2BL0 C;  2FCD A;  2E6W A;  2KGR A;  5DKR A;  5CSI A;  4PAL A;  3NSO A;  2JT8 A;  4I5N B;  3KEV A;  4U8D A;  3CGA A;  2M7N A;  1OSA A;  1S5G Z;  1D1O A;  1A2X A;  3EKJ A;  5AXI A;  3LK1 A;  2PSR A;  3BOW A;  1G8I A;  1MHO A;  1WRZ A;  1AVS A;  2Y1N A;  2OTG B;  1B47 A;  3FWC A;  1S6J A;  2M9G A;  4CLN A;  2NCP A;  3RLZ A;  1UUS A;  3GK4 X;  3LL8 B;  5F6T A;  1YTZ C;  5I8N A;  1IRJ A;  2FOT A;  4JWQ A;  4PHN A;  1Y1U A;  3VRR A;  1DGV A;  2KDH A;  2F2O A;  3CTN A;  2HPS A;  4GNK B;  4HRE E;  4PE0 A;  3SG5 A;  1Y0V H;  1K95 A;  2KBM A;  1SCV A;  2O60 A;  4MBE A;  2COL B;  1LIN A;  2NZ0 A;  2L4I A;  2CBL A;  1NSH A;  1E8A A;  1Y1A A;  3TS5 B;  3FS7 A;  2LLT A;  2AAO A;  5ER4 X;  1QIV A;  1Q80 A;  1DGU A;  1J55 A;  2L2E A;  1Y6W A;  3BYA A;  3PM8 A;  3TDU A;  3EVR A;  1J7P A;  1CMF A;  1NX1 A;  2PAL A;  3BQ3 A;  4CFQ A;  1EH2 A;  5HYD A;  2G9B A;  2OS8 B;  1C7W A;  4HRH A;  2ISD A;  5AFP A;  3SJS A;  3SIA A;  4YBH B;  1IGV A;  3I5I C;  1TOP A;  1K8U A;  1SR6 C;  1RRO A;  4UPG A;  4M2Q A;  5I2Q A;  2BCA A;  1QVI Z;  2M97 A;  4P2Y B;  1J7O A;  2JC2 A;  4ZCV A;  1KK7 Y;  2KFG A;  1UHI A;  1YRU B;  3EK4 A;  3TUY B;  2KYC A;  2WCB A;  3A8R A;  1PVB A;  2JWW A;  4DUQ A;  2JZI A;  3DF0 A;  3CWG A;  3MSE B;  2WCE A;  1IJ6 A;  3CR4 X;  1AUI B;  1L2O C;  1R6P A;  2OPO A;  3H4S E;  1JC2 A;  1MUX A;  1U5I B;  1MXL C;  3TS5 C;  1CKK A;  2A4J A;  2CNP A;  2FJU B;  1IQ5 A;  2MRD A;  4YGA A;  4IL1 A;  1KCY A;  2MJW B;  4DCK A;  1QJT A;  5BPJ A;  3O4Y A;  2O5G A;  1AK8 A;  2RGI A;  2M49 B;  1TTX A;  1AP4 A;  1EJ3 A;  2EGD A;  3BUO B;  1YUT A;  4HRG A;  1K94 A;  1NPQ A;  1KWO B;  3CR2 A;  1H4B A;  2WOR A;  5K89 A;  3PSR A;  1B7T Y;  2H61 C;  3CLN A;  2MLF C;  1PAL A;  3AKB A;  3O78 A;  5D69 A;  1DTL A;  1IQ3 A;  4A4C A;  4GBA A;  1NCX A;  3PN7 B;  1CFF A;  4D1E A;  2V53 A;  3CS1 A;  3TUY C;  2LAP A;  4JQ0 D;  1NCY A;  1S6C A;  1H8B A;  1TRF A;  3OX5 A;  1CB1 A;  2LC5 A;  5DKQ A;  2M1U A;  3AKA A;  1M46 A;  1R2U A;  5CSN A;  1UHJ A;  2KFF A;  4M2P A;  1NX2 A;  1QS7 A;  2CT9 A;  4PCW A;  4XYN A;  1N0Y A;  4CFR A;  2BL0 B;  1KSO A;  1QLK A;  4CPV A;  1JUO A;  1KQV A;  5KU1 A;  1BR1 B;  1FBV A;  3QRX A;  1RFJ A;  5D7F A;  1M39 A;  2H2K A;  1PSR A;  4PHJ A;  1A29 A;  4GPL B;  1SPY A;  3EK7 A;  4MSP A;  1G4Y R;  3SG4 A;  1YX8 A;  2M3W A;  1YRT B;  2CCM A;  2LVV A;  3EKH A;  3OB1 B;  1DJZ A;  2AUC A;  5B8I B;  1HT9 A;  1J7R A;  1B1G A;  1HQV A;  2LNK A;  2MAZ A;  3SIB A;  1XA5 A;  3VGO A;  1A75 A;  4USL A;  3GOF A;  2BCX A;  5G08 A;  2BKI B;  1LVC D;  1AJ4 A;  4PDZ A;  4A4B A;  1CNP A;  1M45 A;  1ZAC A;  2D8N A;  4MEW A;  1QAS A;  1CDL A;  1TNQ A;  3EVV A;  1XFW O;  2JQ6 A;  4ETO A;  2PMY A;  2JNF A;  4OVN F;  1CDM A;  2M8U A;  1OMD A;  1SK6 D;  1F4O A;  3DF0 B;  2JU0 A;  1OZS A;  1S26 D;  1K96 A;  2KGB C;  2L4H A;  4WQ3 A;  2SCP A;  2JTZ A;  3FIA A;  4YI8 A;  4C0K A;  4GGF A;  2LE9 B;  1NWD A;  2M29 A;  2LVJ A;  1B8R A;  1DJW A;  4BY5 A;  2KAX A;  1G33 A;  3I5I B;  1GQM A;  1XFV O;  4TNC A;  4GGN A;  3HX4 A;  4I5K A;  2CTN A;  1RJV A;  1SR6 B;  4DIR A;  3NXA A;  4YGE B;  1SYM A;  1RWY A;  2GGM A;  3SG6 A;  2K2F A;  2DOQ A;  2LUX A;  4PHM A;  5HKW A;  2NXQ A;  3I5H B;  5GQQ C;  3M0W A;  1DJX A;  1ZMZ A;  1IH0 A;  1L2O B;  4OCI A;  5AER A;  1K2H A;  3KPX A;  3BUM B;  2PRU A;  1DF0 A;  1DMO A;  1QVI Y;  1WRK A;  1LXF C;  1NX3 A;  1S3P A;  2MLE C;  4MZJ A;  3I5F C;  2ZNE A;  1M31 A;  2JRF A;  5TNC A;  1IWQ A;  2WCF A;  2F3Z A;  1BF5 A;  2WND A;  1L7Z A;  5HLV A;  4AOM A;  2G2B A;  1KQM C;  2KFH A;  4MVF A;  2LHL A;  4NDC A;  1BG1 A;  3GK2 A;  2KBI A;  1SW8 A;  4GFT A;  2HET A;  3NSL A;  2JNX A;  2JT3 A;  3JTD B;  1VRK A;  3D10 A;  4GUK A;  4XJK A;  2QAC A;  2R2I A;  3CZT X;  3I5H C;  1S36 A;  1SBJ A;  2K61 A;  4FQO A;  4YGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...