1M63B

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
b'SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
total genus 36
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m63B00
2Y1NA 4YGAA 1F70A 3NSLA 2KFFA 1C7VA 1TNQA 3SG7A 3ZWHA 5JOLA 3D10A 2HF5A 2L5XB 2GGZA 1ZOTB 1TRFA 1DVIA 1YTZC 1YX7A 1CMGA 1BOCA 2KBMA 2L0PA 2CXJA 2FJUB 3PATA 1XFZO 2WORA 2MBXA 1QS7A 2LMTA 2HQWA 3PLFB 2QACA 5ER5A 1S1EA 3FWBA 1F54A 1SRAA 3ICBA 3O6BA 5CSFA 1LKJA 3DVJA 1A03A 3IQQA 2LHLA 3BUWB 1H8BA 1S3PA 1WDCC 3H4SE 2GGMA 1G4YR 2LMUA 2Y4QA 2JT0A 2WOSA 3DF0A 3EVVA 3O78A 3LK1A 2RGIA 2ZFDA 1BR1B 1YUTA 1XFUO 1KWOC 3OB1B 4HRGA 1X02A 3EK8A 1IJ6A 4PHKA 5AXIA 3LL8B 1WY9A 2PRUA 4GBAA 2BECA 1FBVA 4YBHB 1TNPA 1K9KA 3DVMA 1XFVO 3TUYB 1IWQA 2ZKMX 1DJWA 1L7ZA 1AUIB 1AJ4A 1WRLA 1QX5B 2EC6B 2MAZA 1A75B 2PALA 1IQ5A 2EGDA 3F45A 1K95A 4QJ5B 2LANA 3BXKA 2Y5IA 2JXLA 2VRGA 3BUOB 5AFPA 4ETOA 5TNCA 3TUYC 3FIAA 4XYNA 2L2EA 1SL9A 4AQJA 5HKWA 2F8PA 4GNKB 1CLLA 2KI4C 1CMFA 1DJIA 2LMVA 3LCPC 1YVHA 1K96A 2M9GA 2LLUA 4USLA 2PSRA 3PSRA 1A4PA 1LVCD 4HSZA 2LHIA 2M49B 4M2PA 1WLMA 1DMOA 2LVVA 1OMVA 4BY4A 3NSOA 2I2RE 4L9MA 1MQ1A 2H61C 2ZNDA 4IL1A 5F6TA 5CPVA 1KFXL 4CIDA 5IBWA 1L2OB 3I5IC 2CNPA 4PDZA 1BR4B 1Y1XA 4N1GA 1IG5A 2AMIA 5KTYA 1XVJA 1JSAA 2ZN8A 4DUQA 1H4BA 1Y1UA 1RECA 3AKBA 1TN4A 1BU3A 1B8LA 1M63B 5I2LA 2KYCA 1DF0B 2KHNA 2P6BB 1OSAA 1WRKA 1NX2A 2F3YA 3A4UB 2BBNA 3CWGA 1M31A 4OV2A 1CFPA 1C7WA 1J55A 4DS7A 1CLMA 2K0JA 1F4OA 5DKQA 2KFGA 4MN0A 4ORCB 5HYDA 2ZRSA 1UHHA 1D1OA 1EL4A 1YRTB 1QTXA 1N65A 4Q04A 1AK8A 2SCPA 1WLZA 4HREE 4M2OA 3JTDC 2K7DA 4F0ZB 2HQ8A 1U5IB 1TTXA 2MHHA 3VRPA 1XA5A 2LP3A 1IJ5A 3GK4X 5D7FA 1TNWA 2JT3A 2LUXA 5DKRA 4GGFC 5AANA 1S6IA 2LCPA 1YX8A 2COLB 2HETA 2JPTA 1UP5A 1DGVA 2L98A 1FI5A 1XFXO 3AAKA 2V53A 1RTP1 1E8AA 1DJHA 2E6WA 3O4YA 1XK4C 5J3XA 1QXPA 1B4CA 5GQQC 1EG3A 2NCOA 1JBAA 3D0YA 1SW8A 2JNFA 2MRDA 1MXEA 1JWDA 1QIVA 2M1UA 1J1EA 1WDCB 1JC2A 1UUSA 2OS8B 4OR9B 2A4JA 2FCEA 2GV5A 3BYAA 4D1EA 1JF0A 4GGNA 1BMOA 4FTGA 1QX7A 3C1VA 2OTGC 3PN7B 4A4BA 1CFDA 3SG3A 4ZCVA 1C07A 1MHOA 1FF1A 2LV7A 4R1EA 1R2UA 1A2XA 1PK0D 1KK8C 1OE9B 2KGBC 4PE7A 1F4QA 1SR6C 2JZIA 4ICBA 1KWOB 2KI6C 2L50A 2QPTA 5HKYA 1B8RA 1KQVA 1PULA 3LK0A 1RWYA 2HPSA 1B47A 2OS8C 2BKIB 3VRNA 1RFJA 1IKUA 4P2YB 1UHIA 3FS7A 4PALA 3PN7C 5K89A 1PALA 2FOTA 4GFTA 1M39A 2BCBA 4XJKB 1LA0A 2M8UA 1KK7Y 1HT9A 1IGVA 1S26D 1NSHA 2JWWA 3GK1A 3EKJA 4JWQA 1OMRA 1KSOA 1TCFA 2KQ6A 3GOFA 1J1DA 3OX5A 2WC8A 1KK7Z 4I5JA 3I5GC 1YVLA 3BQ3A 2KAYA 3TDUA 1B7TY 3GK2A 1Q80A 1F55A 3SG5A 1J7PA 3K21A 3SIBA 2KI4B 2Q4UA 3M0WA 3IQOA 2JTZA 5HLVA 3E3RA 2ISDA 1OOJA 1B7TZ 4MEWA 1WRZA 2CCMA 3ZNIA 2LAPA 2FCDA 4CLNA 1CM1A 4XJKA 1BODA 1PVBA 4PCWA 1RJVA 1NUBA 1PSRA 1QLKA 1NCXA 1RROA 2BBMA 2KI6D 1DJYA 3VRRA 3TS5C 4PE4A 1CTRA 2LVKA 3CGAA 1M46A 3CLNA 3I5IB 4JQ0D 4NDBA 1TNXA 2L4HA 1S6CA 1TOPA 1CNPA 5KSZA 3I5FC 3AKAA 1GQMA 3CR5X 4MBEA 3BUMB 1A75A 1TCOB 1PVAA 3NSIA 5PALA 2BCAA 1CDNA 1UHNA 1MWNA 3JVTC 1YRUB 2DOQA 4OCIA 5B8IB 1JF2A 5CSNA 1DGUA 2M7NA 2LE9B 2LVIA 2MLFC 3BOWB 2CTNA 4OVNF 2K7CA 2KDHA 3KF9A 3TDIA 1AHRA 2F33A 2KNEA 1NX1A 5KU1A 1K8UA 1S5GY 3QRXA 3CZTX 1B1GA 1SNLA 3BUNB 4MZKA 2NXQA 1CDLA 3OP0A 1S5GZ 1UHJA 3NXAA 1CDMA 1CDPA 3JTDB 4PE1A 1S6JA 1QATA 4MSPA 4NDDA 1KQMC 1NCZA 2JXCA 1SL7A 1ALWA 4NQGA 1W7JB 2MJWB 1M45A 4WRIA 2O5GA 1KFUS 2K7OA 4MLWA 1ZUZA 3LLEA 3OX6A 2LLSA 1V1FA 1DJGA 1G33A 1Y0VH 1CM4A 1YUSA 3I5HC 1DJZA 1AP4A 1DT7B 2CBLA 1R6PA 1CLBA 3EVUA 1K2HA 4ZCUA 4WQ3A 4A4CA 2Y1MA 1DF0A 1J7RA 2L51A 2PVBA 1NPQA 1EG4A 1JFJA 3WXAA 2B1UA 1QV1A 1YURA 1ZMZA 5CSJA 1UWOA 4YRUA 1J7OA 1EJ3A 2OTGB 2M0RA 1F8HA 1YUUA 4WQ2A 5FYXA 2K8MB 4OKHA 1F71A 1KK8B 2BE4A 4MZLA 1SR6B 1QASA 2L4IA 4DRWA 3SIAA 1K90D 1ZFSA 1LXFC 2KOTA 1XK4A 5CSIA 1U5IA 2KSPA 1HQVA 2WCFA 3WNXB 2AUCA 1BLQA 1NX0A 3TDZA 3EKHA 3OB2B 1NYAA 2F3ZA 2JTTA 4JPZB 3VGOA 3VROA 2WCBA 3NSKA 5I8NA 1K9UA 3EVRA 4C0JA 1IH0A 2JT8A 1SCMC 1XFYO 3HX4A 2K2FA 1OZOA 1SYMA 2BL0C 5JJGA 2SASA 2NLNA 4UPGA 5I2OA 3DF0B 1QLSA 3I5GB 1NWDA 2JRFA 4NDCA 2JULA 1MUXA 5HKZA 3SG6A 1MXLC 1PSBA 3CTNA 1SKTA 1NX3A 2JQ6A 4PE0A 2KBIA 2I18A 2ZNEA 3SJSA 1K9PA 1QV0A 2IS9A 2K61A 4DCKA 2KYFA 3DD4A 1EH2A 1G8IA 2M1KB 5DKNA 4AOMA 4C0KA 2F2OA 2WCEA 2JNXA 1SK6D 1FW4A 1DJXA 3KHEA 3KPXA 1A29A 3IF7A 1OMDA 1UHKA 4GUKA 3DVEA 3TS5B 4AQIA 4GAOA 5D69A 5HLOA 1UURA 4U8DA 1S36A 2LVJA 4YGDB 2K7BA 3I5FB 4TNCA 1MF8B 1V1GA 3PALA 4MZJA 3EK4A 1QVIY 4P5OE 1XFWO 1MR8A 4E68A 3BUXB 3DVKA 2LM5A 5G08A 2R2IA 4HRHA 1SPYA 3JVTB 1IRJA 4GPLB 3A8RA 4N5XA 5ER4X 2CT9A 1QVIZ 1FPWA 4C0LA 1K94A 2LLTA 2KAVA 4I5KA 2M97A 1BT6A 2NCPA 3CS1A 2PMYA 2M29A 2WNDA 1YR5A 1KFUL 2M3WA 1BJFA 2KQYA 3OHMB 1NCYA 3PFVA 3RLZA 3KO0A 3RM1A 1RK9A 1OZSA 2LNKA 3FWCA 2I94A 4FQOA 3CR4X 1TIZA 4QJ3B 4CPVA 2KAXA 1SCVA 4PHMA 2PASA 1IQ3A 4YGBB 1JFKA 2LC5A 2EC6C 1B8CA 4I5LB 2JOJA 3SG4A 1XYDA 3AAJA 1KQMB 2H61A 4MRXA 5BPJA 1QIWA 1ZACA 1Y1AA 1LINA 2E30A 4N1FA 1DTLA 4ORBB 1CFCA 1JUOA 4YGCB 1BF5A 2Q91A 1SY9A 2I7AA 2MA2A 2MLEC 2K2AA 4CFRA 3I5HB 4CFQA 1NP8A 5AEQA 1EXRA 2ZRTA 2BCXA 1NIWA 4YI8A 1FI6A 4I5NB 1N2DA 1KSMA 1OQPA 1VRKA 3VRQA 1W7IB 3WHTB 3PM8A 2NZ0A 2O60A 1K93D 3BOWA 2D8NA 4BY5A 3CR2A 2G2BA 1Y6WA 2ZN9A 4YI9A 1GJYA 1CFFA 1CB1A 1PRWA 2JC2A 1AVSA 4M2QA 4MRYA 4YGEB 1ALVA 1B9AA 1L2OC 2KGRA 4QJ4B 2BKHB 2KFHA 1LA3A 1QJTA 2JU0A 3O2PA 4DIRA 1QX2A 1GGWA 2M7LA 1GGZA 4PHJA 1SMGA 1SL8A 2OPOA 3MSEB 3SG2A 1J7QA 4PHNA 1KCYA 4ORAB 1SBJA 3D0YB 2TN4A 2BE6A 1AJ5A 2LUCA 2H2KA 4GGFA 3HCMA 3KEVA 3WHUB 1N0YA 1SCMB 2LP2A 1XO5A 1ODBA 2G9BA 2BL0B 5AERA 5I2QA 3EK7A 1KFXS 1BG1A 2F2PA 4MVFA 2AAOA 1CKKA 2EHBA 3TZ1A
chains in the Genus database with same CATH superfamily
2Y1NA 4YGAA 1F70A 3NSLA 2KFFA 1C7VA 5FI2A 1TNQA 3SG7A 3ZWHA 5JOLA 3D10A 3L4AA 3SS3A 2HF5A 2L5XB 2GGZA 1ZOTB 1TRFA 1DVIA 1YTZC 1YX7A 1CMGA 1BOCA 2KBMA 2L0PA 2CXJA 2FJUB 2WCJA 3PATA 1XFZO 2WCHA 2WORA 2MBXA 1QS7A 2LMTA 2HQWA 3PLFB 2QACA 5ER5A 1S1EA 2KPHA 3FWBA 1F54A 2KLDA 1SRAA 3ICBA 3O6BA 5CSFA 1LKJA 3DVJA 1A03A 3IQQA 2LHLA 4F7FA 3BUWB 2K60A 1H8BA 1S3PA 1WDCC 3H4SE 2GGMA 1G4YR 2LMUA 2Y4QA 2JT0A 2WOSA 3DF0A 3EVVA 5HL1A 3O78A 3LK1A 2RGIA 2ZFDA 3S0AA 1BR1B 1Z2CB 1YUTA 1XFUO 1KWOC 3OB1B 4HRGA 1X02A 3S0DA 3EK8A 1IJ6A 4PHKA 5AXIA 3LL8B 1WY9A 2PRUA 4GBAA 2BECA 1FBVA 4YBHB 1TNPA 1K9KA 3DVMA 1XFVO 3TUYB 1IWQA 2ZKMX 1DJWA 1L7ZA 1AUIB 3BFAA 1AJ4A 3S0FA 1WRLA 1QX5B 2EC6B 2MAZA 3D74A 1A75B 2PALA 1IQ5A 3B6XA 2EGDA 3F45A 3Q8IA 1K95A 4QJ5B 2LANA 4INXA 3BXKA 2Y5IA 2JXLA 2VRGA 3BUOB 5AFPA 4ETOA 5TNCA 3TUYC 3FIAA 3O4XA 4XYNA 2L2EA 1SL9A 4AQJA 5HKWA 2F8PA 4GNKB 1CLLA 2KI4C 3QMEA 1CMFA 1DJIA 2LMVA 3LCPC 1YVHA 1K96A 2M9GA 2LLUA 4USLA 2PQLA 2PSRA 3PSRA 1A4PA 1LVCD 4HSZA 2LHIA 2M49B 4M2PA 1WLMA 1DMOA 2LVVA 1OMVA 4BY4A 3NSOA 2I2RE 4L9MA 1MQ1A 1C3YA 2H61C 2ZNDA 4IL1A 5F6TA 5CPVA 1KFXL 4CIDA 1DEKA 1L2OB 5IBWA 2KLEA 3I5IC 2CNPA 4PDZA 1BR4B 1Y1XA 4N1GA 1IG5A 2AMIA 5KTYA 1XVJA 3OBVA 2ZN8A 4DUQA 1H4BA 1JSAA 1Y1UA 1RECA 3AKBA 1TN4A 1BU3A 1B8LA 3UO9A 1M63B 5I2LA 2KYCA 1DF0B 2KHNA 2P6BB 1OSAA 1WRKA 1NX2A 2F3YA 3A4UB 2BBNA 3CWGA 1M31A 4OV2A 1CFPA 1C7WA 1J55A 4DS7A 2WCLA 1CLMA 2K0JA 3OGNA 1F4OA 5FI7A 5DKQA 2KFGA 4MN0A 1DQEA 2JPOA 2ZRSA 4ORCB 5HYDA 1UHHA 1D1OA 1EL4A 1YRTB 1QTXA 1N65A 4Q04A 1AK8A 2SCPA 1WLZA 4HREE 4M2OA 2YGUA 3R1VA 3JTDC 2K7DA 4F0ZB 1Z4HA 2HQ8A 1U5IB 1TTXA 2MHHA 3VRPA 1XA5A 2LP3A 1IJ5A 2QEVA 3GK4X 5D7FA 3SS5A 1GM0A 1TNWA 2JT3A 2LUXA 5DKRA 4GGFC 5AANA 1S6IA 2LCPA 1YX8A 2COLB 2HETA 2JPTA 1UP5A 1DGVA 2L98A 1FI5A 1XFXO 3AAKA 2V53A 1RTP1 3S0BA 1E8AA 1DJHA 2E6WA 3K1EA 1XK4C 3O4YA 5J3XA 1QXPA 1B4CA 5GQQC 1EG3A 2NCOA 1JBAA 3D0YA 1SW8A 2JNFA 2MRDA 1MXEA 3PM2A 1JWDA 1QIVA 2GTEA 2M1UA 1J1EA 1WDCB 3BJHA 3S0EA 1JC2A 1UUSA 2OS8B 3B88A 2A4JA 2FCEA 2GV5A 3BYAA 3IVTA 3NGVA 1JF0A 4GGNA 4D1EA 1BMOA 4FTGA 1QX7A 3C1VA 2OTGC 3PN7B 4A4BA 1CFDA 3SG3A 4ZCVA 1C07A 1MHOA 1FF1A 2LV7A 4R1EA 1PK0D 1R2UA 1A2XA 1KK8C 1OE9B 2KGBC 4PE7A 1F4QA 1SR6C 1T14A 2JZIA 3UNWA 4ICBA 1KWOB 2KI6C 2L50A 4INWA 2QPTA 5HKYA 1B8RA 1KQVA 1PULA 3LK0A 1RWYA 2HPSA 1B47A 2OS8C 3B87A 2BKIB 3CDNA 3VRNA 1RFJA 1IKUA 2QEHA 1UHIA 3FS7A 4P2YB 3PN7C 4PALA 5K89A 1PALA 2FOTA 4GFTA 1M39A 2BCBA 4PT1A 4XJKB 1LA0A 2M8UA 1KK7Y 1HT9A 1IGVA 1S26D 1NSHA 2JWWA 2ERBA 3EKJA 3GK1A 4JWQA 1OMRA 1KSOA 1TCFA 2KQ6A 3B86A 3GOFA 1J1DA 3OX5A 5FI6A 2WC8A 1KK7Z 4I5JA 3I5GC 1YVLA 3BQ3A 2KAYA 3TDUA 1B7TY 3GK2A 1Q80A 2P71A 1F55A 3SG5A 1J7PA 3K21A 3SIBA 3DXLA 2KI4B 2Q4UA 3M0WA 3IQOA 2JTZA 5HLVA 3E3RA 2ISDA 1OOJA 1B7TZ 4MEWA 1WRZA 2CCMA 3ZNIA 2LAPA 3L4LA 2FCDA 4CLNA 1CM1A 4XJKA 1BODA 1PVBA 4PCWA 1RJVA 1NUBA 1PSRA 1QLKA 2P70A 2L5YA 1NCXA 1RROA 2BBMA 2KI6D 1DJYA 2WCKA 3VRRA 3TS5C 4PE4A 1CTRA 2LVKA 3CGAA 1M46A 3CLNA 3I5IB 4JQ0D 3NHTA 1TNXA 4NDBA 2L4HA 1S6CA 1TOPA 1CNPA 5KSZA 3I5FC 3AKAA 1GQMA 3CR5X 4MBEA 3BUMB 1A75A 1TCOB 1PVAA 3NSIA 5PALA 2BCAA 1CDNA 1UHNA 1MWNA 3JVTC 1YRUB 2DOQA 4OCIA 5B8IB 1JF2A 4OR9B 1DGUA 2M7NA 2LE9B 1TUJA 2LVIA 2MLFC 3BOWB 5CSNA 2CTNA 4OVNF 3CABA 2K7CA 2KDHA 3KF9A 3TDIA 1AHRA 2F33A 2KNEA 1NX1A 5KU1A 1K8UA 1S5GY 3QRXA 3CZTX 1B1GA 1SNLA 3BUNB 4MZKA 2NXQA 1CDLA 3OP0A 3NHIA 1S5GZ 1UHJA 3NXAA 1CDMA 1CDPA 3JTDB 4PE1A 1S6JA 1QATA 4MSPA 4NDDA 1KQMC 1NCZA 2JXCA 1SL7A 1ALWA 4NQGA 1DELA 1W7JB 2MJWB 3CZ1A 1M45A 4WRIA 2O5GA 1KFUS 2K7OA 4MLWA 3DZTA 1ZUZA 3LLEA 3OX6A 1IIOA 2LLSA 1V1FA 1DJGA 1G33A 1Y0VH 3DY9A 1CM4A 1YUSA 3I5HC 1OOFA 1LS8A 1DJZA 2H8VA 1AP4A 3V2LA 1DT7B 2CBLA 1R6PA 1CLBA 3EVUA 1K2HA 4ZCUA 4WQ3A 4A4CA 2Y1MA 1DF0A 1J7RA 1OOHA 2L51A 2PVBA 1NPQA 3R1PA 1EG4A 1JFJA 4KYNA 1W9ZA 3WXAA 1XFRA 2B1UA 1QV1A 1YURA 1ZMZA 5CSJA 1UWOA 5DICA 4YRUA 1J7OA 1EJ3A 2OTGB 2FJYA 2M0RA 1F8HA 1YUUA 4WQ2A 3BFBA 5FYXA 2K8MB 4OKHA 1F71A 1KK8B 2BE4A 4MZLA 1SR6B 1QASA 3RZSA 2L4IA 4DRWA 3SIAA 1K90D 3DYEA 1ZFSA 1LXFC 2KOTA 1XK4A 3D75A 5CSIA 1U5IA 2KSPA 5I94A 1HQVA 2WCFA 3WNXB 2AUCA 1BLQA 1NX0A 3TDZA 3EKHA 3OB2B 1NYAA 2F3ZA 2JTTA 4JPZB 3VGOA 3VROA 1OOGA 2WCBA 2WCMA 1K9UA 3EVRA 3NSKA 4C0JA 1IH0A 3B7AA 2JT8A 1SCMC 2BNXA 1XFYO 3HX4A 2K2FA 1OZOA 1SYMA 2BL0C 2QEBA 5JJGA 2SASA 2NLNA 4UPGA 5I2OA 3DF0B 1QLSA 3I5GB 1NWDA 2JRFA 4NDCA 2JULA 5EL2A 1MUXA 5HKZA 3SG6A 1MXLC 1PSBA 3CTNA 1SKTA 4OZDA 1NX3A 2JQ6A 4PE0A 2KBIA 2I18A 2ZNEA 3SJSA 1K9PA 1QV0A 2IS9A 2K61A 4DCKA 2KYFA 3DD4A 1EH2A 1OW4A 1G8IA 2M1KB 5DKNA 4AOMA 2WC6A 4C0KA 3R1OA 2F2OA 2WCEA 2JNXA 1SK6D 1FW4A 1DJXA 3KHEA 3KPXA 1OOIX 1A29A 3IF7A 1OMDA 1UHKA 4GUKA 3DVEA 3TS5B 4AQIA 4GAOA 4JD9A 5D69A 5HLOA 1UURA 4U8DA 1S36A 2LVJA 3D73A 4YGDB 2K7BA 3S0GA 3I5FB 3CZ2A 1MF8B 1V1GA 3PALA 4TNCA 4MZJA 3EK4A 1QVIY 4P5OE 3VB1A 1XFWO 4FQTA 1MR8A 4E68A 3BUXB 3DVKA 2LM5A 5G08A 2R2IA 4HRHA 1SPYA 3JVTB 1IRJA 4GPLB 3A8RA 4N5XA 5ER4X 2CT9A 1QVIZ 1FPWA 4C0LA 1K94A 2LLTA 1P28A 2KAVA 4I5KA 2M97A 1BT6A 2NCPA 3CS1A 2PMYA 2M29A 2WNDA 1YR5A 1KFUL 2M3WA 1BJFA 2KQYA 3OHMB 1NCYA 3D76A 3PFVA 3KO0A 3RLZA 3RM1A 1RK9A 1OZSA 2LNKA 3FWCA 2I94A 4FQOA 3CR4X 1TIZA 4QJ3B 4CPVA 2KAXA 1SCVA 3R72A 2PASA 4PHMA 1IQ3A 4YGBB 1JFKA 2LC5A 2L2CA 2EC6C 1B8CA 4I5LB 2JOJA 3L47A 3SG4A 1XYDA 3AAJA 2PYQA 1KQMB 5D3OA 2H61A 4MRXA 5BPJA 1QIWA 1ZACA 1Y1AA 1LINA 2E30A 4N1FA 1DTLA 4ORBB 1C3ZA 1CFCA 1JUOA 4YGCB 1BF5A 3D77A 2Q91A 3FE6A 1SY9A 2I7AA 2MA2A 1TUZA 2MLEC 3FE8A 2K2AA 4CFRA 3I5HB 3D78A 4CFQA 1TWOA 1NP8A 2QEOA 5AEQA 1EXRA 2ZRTA 2BCXA 1NIWA 4YI8A 1FI6A 4I5NB 1N2DA 1KSMA 1OQPA 1VRKA 3VRQA 1W7IB 3WHTB 3PM8A 2NZ0A 2O60A 1K93D 3BOWA 4IJ7A 2D8NA 3N7HA 4BY5A 2WC5A 3CR2A 2G2BA 1Y6WA 2ZN9A 1ORGA 4YI9A 1GJYA 1CFFA 1CB1A 1SSEB 2QDIA 1PRWA 2JC2A 1AVSA 4M2QA 4MRYA 4YGEB 3EG5B 1ALVA 1B9AA 1L2OC 2KGRA 1DC1A 4QJ4B 2BKHB 2KFHA 1LA3A 3FE9A 1QJTA 2JU0A 3O2PA 4DIRA 1QX2A 1GGWA 1QWVA 2M7LA 4JKTA 1GGZA 4PHJA 1SMGA 1SL8A 2OPOA 3CYZA 3MSEB 3SG2A 4PHNA 5I8NA 1J7QA 1KCYA 3CZ0A 4ORAB 1SBJA 3D0YB 3BFHA 2BAPA 2TN4A 2BE6A 1AJ5A 2LUCA 2H2KA 4GGFA 3HCMA 3KEVA 3WHUB 1N0YA 1SCMB 2LP2A 1XO5A 1ODBA 2G9BA 2BL0B 5AERA 5I2QA 3EK7A 1KFXS 1BG1A 2F2PA 4MVFA 3PJIA 2AAOA 1CKKA 2EHBA 3TZ1A 3SS4A
chains in the Genus database with same CATH topology
2Y1NA 4YGAA 1F70A 3NSLA 2KFFA 1C7VA 1TNQA 3SG7A 3ZWHA 5JOLA 3D10A 2HF5A 2L5XB 2GGZA 1ZOTB 1TRFA 1DVIA 1YTZC 1YX7A 1CMGA 1BOCA 2KBMA 2L0PA 2CXJA 2FJUB 3PATA 1XFZO 2WORA 2MBXA 1QS7A 2LMTA 2HQWA 3PLFB 2QACA 5ER5A 1S1EA 3FWBA 1F54A 1SRAA 3ICBA 3O6BA 5CSFA 1LKJA 3DVJA 1A03A 3IQQA 2LHLA 3BUWB 1H8BA 1S3PA 1WDCC 3H4SE 2GGMA 1G4YR 2LMUA 2Y4QA 2JT0A 2WOSA 3DF0A 3EVVA 3O78A 3LK1A 2RGIA 2ZFDA 1BR1B 1YUTA 1XFUO 1KWOC 3OB1B 4HRGA 1X02A 3EK8A 1IJ6A 4PHKA 5AXIA 3LL8B 1WY9A 2PRUA 4GBAA 2BECA 1FBVA 4YBHB 1TNPA 1K9KA 3DVMA 1XFVO 3TUYB 1IWQA 2ZKMX 1DJWA 1L7ZA 1AUIB 1AJ4A 1WRLA 1QX5B 2EC6B 2MAZA 1A75B 2PALA 1IQ5A 2EGDA 3F45A 1K95A 4QJ5B 2LANA 3BXKA 2Y5IA 2JXLA 2VRGA 3BUOB 5AFPA 4ETOA 5TNCA 3TUYC 3FIAA 4XYNA 2L2EA 1SL9A 4AQJA 5HKWA 2F8PA 4GNKB 1CLLA 2KI4C 1CMFA 1DJIA 2LMVA 3LCPC 1YVHA 1K96A 2M9GA 2LLUA 4USLA 2PSRA 3PSRA 1A4PA 1LVCD 4HSZA 2LHIA 2M49B 4M2PA 1WLMA 1DMOA 2LVVA 1OMVA 4BY4A 3NSOA 2I2RE 4L9MA 1MQ1A 2H61C 2ZNDA 4IL1A 5F6TA 5CPVA 1KFXL 4CIDA 5IBWA 1L2OB 3I5IC 2CNPA 4PDZA 1BR4B 1Y1XA 4N1GA 1IG5A 2AMIA 5KTYA 1XVJA 1JSAA 2ZN8A 4DUQA 1H4BA 1Y1UA 1RECA 3AKBA 1TN4A 1BU3A 1B8LA 1M63B 5I2LA 2KYCA 1DF0B 2KHNA 2P6BB 1OSAA 1WRKA 1NX2A 2F3YA 3A4UB 2BBNA 3CWGA 1M31A 4OV2A 1CFPA 1C7WA 1J55A 4DS7A 1CLMA 2K0JA 1F4OA 5DKQA 2KFGA 4MN0A 4ORCB 5HYDA 2ZRSA 1UHHA 1D1OA 1EL4A 1YRTB 1QTXA 1N65A 4Q04A 1AK8A 2SCPA 1WLZA 4HREE 4M2OA 3JTDC 2K7DA 4F0ZB 2HQ8A 1U5IB 1TTXA 2MHHA 3VRPA 1XA5A 2LP3A 1IJ5A 3GK4X 5D7FA 1TNWA 2JT3A 2LUXA 5DKRA 4GGFC 5AANA 1S6IA 2LCPA 1YX8A 2COLB 2HETA 2JPTA 1UP5A 1DGVA 2L98A 1FI5A 1XFXO 3AAKA 2V53A 1RTP1 1E8AA 1DJHA 2E6WA 3O4YA 1XK4C 5J3XA 1QXPA 1B4CA 5GQQC 1EG3A 2NCOA 1JBAA 3D0YA 1SW8A 2JNFA 2MRDA 1MXEA 1JWDA 1QIVA 2M1UA 1J1EA 1WDCB 1JC2A 1UUSA 2OS8B 4OR9B 2A4JA 2FCEA 2GV5A 3BYAA 4D1EA 1JF0A 4GGNA 1BMOA 4FTGA 1QX7A 3C1VA 2OTGC 3PN7B 4A4BA 1CFDA 3SG3A 4ZCVA 1C07A 1MHOA 1FF1A 2LV7A 4R1EA 1R2UA 1A2XA 1PK0D 1KK8C 1OE9B 2KGBC 4PE7A 1F4QA 1SR6C 2JZIA 4ICBA 1KWOB 2KI6C 2L50A 2QPTA 5HKYA 1B8RA 1KQVA 1PULA 3LK0A 1RWYA 2HPSA 1B47A 2OS8C 2BKIB 3VRNA 1RFJA 1IKUA 4P2YB 1UHIA 3FS7A 4PALA 3PN7C 5K89A 1PALA 2FOTA 4GFTA 1M39A 2BCBA 4XJKB 1LA0A 2M8UA 1KK7Y 1HT9A 1IGVA 1S26D 1NSHA 2JWWA 3GK1A 3EKJA 4JWQA 1OMRA 1KSOA 1TCFA 2KQ6A 3GOFA 1J1DA 3OX5A 2WC8A 1KK7Z 4I5JA 3I5GC 1YVLA 3BQ3A 2KAYA 3TDUA 1B7TY 3GK2A 1Q80A 1F55A 3SG5A 1J7PA 3K21A 3SIBA 2KI4B 2Q4UA 3M0WA 3IQOA 2JTZA 5HLVA 3E3RA 2ISDA 1OOJA 1B7TZ 4MEWA 1WRZA 2CCMA 3ZNIA 2LAPA 2FCDA 4CLNA 1CM1A 4XJKA 1BODA 1PVBA 4PCWA 1RJVA 1NUBA 1PSRA 1QLKA 1NCXA 1RROA 2BBMA 2KI6D 1DJYA 3VRRA 3TS5C 4PE4A 1CTRA 2LVKA 3CGAA 1M46A 3CLNA 3I5IB 4JQ0D 4NDBA 1TNXA 2L4HA 1S6CA 1TOPA 1CNPA 5KSZA 3I5FC 3AKAA 1GQMA 3CR5X 4MBEA 3BUMB 1A75A 1TCOB 1PVAA 3NSIA 5PALA 2BCAA 1CDNA 1UHNA 1MWNA 3JVTC 1YRUB 2DOQA 4OCIA 5B8IB 1JF2A 5CSNA 1DGUA 2M7NA 2LE9B 2LVIA 2MLFC 3BOWB 2CTNA 4OVNF 2K7CA 2KDHA 3KF9A 3TDIA 1AHRA 2F33A 2KNEA 1NX1A 5KU1A 1K8UA 1S5GY 3QRXA 3CZTX 1B1GA 1SNLA 3BUNB 4MZKA 2NXQA 1CDLA 3OP0A 1S5GZ 1UHJA 3NXAA 1CDMA 1CDPA 3JTDB 4PE1A 1S6JA 1QATA 4MSPA 4NDDA 1KQMC 1NCZA 2JXCA 1SL7A 1ALWA 4NQGA 1W7JB 2MJWB 1M45A 4WRIA 2O5GA 1KFUS 2K7OA 4MLWA 1ZUZA 3LLEA 3OX6A 2LLSA 1V1FA 1DJGA 1G33A 1Y0VH 1CM4A 1YUSA 3I5HC 1DJZA 1AP4A 1DT7B 2CBLA 1R6PA 1CLBA 3EVUA 1K2HA 4ZCUA 4WQ3A 4A4CA 2Y1MA 1DF0A 1J7RA 2L51A 2PVBA 1NPQA 1EG4A 1JFJA 3WXAA 2B1UA 1QV1A 1YURA 1ZMZA 5CSJA 1UWOA 4YRUA 1J7OA 1EJ3A 2OTGB 2M0RA 1F8HA 1YUUA 4WQ2A 5FYXA 2K8MB 4OKHA 1F71A 1KK8B 2BE4A 4MZLA 1SR6B 1QASA 2L4IA 4DRWA 3SIAA 1K90D 1ZFSA 1LXFC 2KOTA 1XK4A 5CSIA 1U5IA 2KSPA 1HQVA 2WCFA 3WNXB 2AUCA 1BLQA 1NX0A 3TDZA 3EKHA 3OB2B 1NYAA 2F3ZA 2JTTA 4JPZB 3VGOA 3VROA 2WCBA 3NSKA 5I8NA 1K9UA 3EVRA 4C0JA 1IH0A 2JT8A 1SCMC 1XFYO 3HX4A 2K2FA 1OZOA 1SYMA 2BL0C 5JJGA 2SASA 2NLNA 4UPGA 5I2OA 3DF0B 1QLSA 3I5GB 1NWDA 2JRFA 4NDCA 2JULA 1MUXA 5HKZA 3SG6A 1MXLC 1PSBA 3CTNA 1SKTA 1NX3A 2JQ6A 4PE0A 2KBIA 2I18A 2ZNEA 3SJSA 1K9PA 1QV0A 2IS9A 2K61A 4DCKA 2KYFA 3DD4A 1EH2A 1G8IA 2M1KB 5DKNA 4AOMA 4C0KA 2F2OA 2WCEA 2JNXA 1SK6D 1FW4A 1DJXA 3KHEA 3KPXA 1A29A 3IF7A 1OMDA 1UHKA 4GUKA 3DVEA 3TS5B 4AQIA 4GAOA 5D69A 5HLOA 1UURA 4U8DA 1S36A 2LVJA 4YGDB 2K7BA 3I5FB 4TNCA 1MF8B 1V1GA 3PALA 4MZJA 3EK4A 1QVIY 4P5OE 1XFWO 1MR8A 4E68A 3BUXB 3DVKA 2LM5A 5G08A 2R2IA 4HRHA 1SPYA 3JVTB 1IRJA 4GPLB 3A8RA 4N5XA 5ER4X 2CT9A 1QVIZ 1FPWA 4C0LA 1K94A 2LLTA 2KAVA 4I5KA 2M97A 1BT6A 2NCPA 3CS1A 2PMYA 2M29A 2WNDA 1YR5A 1KFUL 2M3WA 1BJFA 2KQYA 3OHMB 1NCYA 3PFVA 3RLZA 3KO0A 3RM1A 1RK9A 1OZSA 2LNKA 3FWCA 2I94A 4FQOA 3CR4X 1TIZA 4QJ3B 4CPVA 2KAXA 1SCVA 4PHMA 2PASA 1IQ3A 4YGBB 1JFKA 2LC5A 2EC6C 1B8CA 4I5LB 2JOJA 3SG4A 1XYDA 3AAJA 1KQMB 2H61A 4MRXA 5BPJA 1QIWA 1ZACA 1Y1AA 1LINA 2E30A 4N1FA 1DTLA 4ORBB 1CFCA 1JUOA 4YGCB 1BF5A 2Q91A 1SY9A 2I7AA 2MA2A 2MLEC 2K2AA 4CFRA 3I5HB 4CFQA 1NP8A 5AEQA 1EXRA 2ZRTA 2BCXA 1NIWA 4YI8A 1FI6A 4I5NB 1N2DA 1KSMA 1OQPA 1VRKA 3VRQA 1W7IB 3WHTB 3PM8A 2NZ0A 2O60A 1K93D 3BOWA 2D8NA 4BY5A 3CR2A 2G2BA 1Y6WA 2ZN9A 4YI9A 1GJYA 1CFFA 1CB1A 1PRWA 2JC2A 1AVSA 4M2QA 4MRYA 4YGEB 1ALVA 1B9AA 1L2OC 2KGRA 4QJ4B 2BKHB 2KFHA 1LA3A 1QJTA 2JU0A 3O2PA 4DIRA 1QX2A 1GGWA 2M7LA 1GGZA 4PHJA 1SMGA 1SL8A 2OPOA 3MSEB 3SG2A 1J7QA 4PHNA 1KCYA 4ORAB 1SBJA 3D0YB 2TN4A 2BE6A 1AJ5A 2LUCA 2H2KA 4GGFA 3HCMA 3KEVA 3WHUB 1N0YA 1SCMB 2LP2A 1XO5A 1ODBA 2G9BA 2BL0B 5AERA 5I2QA 3EK7A 1KFXS 1BG1A 2F2PA 4MVFA 2AAOA 1CKKA 2EHBA 3TZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  4YGA A;  1F70 A;  3NSL A;  2KFF A;  1C7V A;  1TNQ A;  3SG7 A;  3ZWH A;  5JOL A;  3D10 A;  2HF5 A;  2L5X B;  2GGZ A;  1ZOT B;  1TRF A;  1DVI A;  1YTZ C;  1YX7 A;  1CMG A;  1BOC A;  2KBM A;  2L0P A;  2CXJ A;  2FJU B;  3PAT A;  1XFZ O;  2WOR A;  2MBX A;  1QS7 A;  2LMT A;  2HQW A;  3PLF B;  2QAC A;  5ER5 A;  1S1E A;  3FWB A;  1F54 A;  1SRA A;  3ICB A;  3O6B A;  5CSF A;  1LKJ A;  3DVJ A;  1A03 A;  3IQQ A;  2LHL A;  3BUW B;  1H8B A;  1S3P A;  1WDC C;  3H4S E;  2GGM A;  1G4Y R;  2LMU A;  2Y4Q A;  2JT0 A;  2WOS A;  3DF0 A;  3EVV A;  3O78 A;  3LK1 A;  2RGI A;  2ZFD A;  1BR1 B;  1YUT A;  1XFU O;  1KWO C;  3OB1 B;  4HRG A;  1X02 A;  3EK8 A;  1IJ6 A;  4PHK A;  5AXI A;  3LL8 B;  1WY9 A;  2PRU A;  4GBA A;  2BEC A;  1FBV A;  4YBH B;  1TNP A;  1K9K A;  3DVM A;  1XFV O;  3TUY B;  1IWQ A;  2ZKM X;  1DJW A;  1L7Z A;  1AUI B;  1AJ4 A;  1WRL A;  1QX5 B;  2EC6 B;  2MAZ A;  1A75 B;  2PAL A;  1IQ5 A;  2EGD A;  3F45 A;  1K95 A;  4QJ5 B;  2LAN A;  3BXK A;  2Y5I A;  2JXL A;  2VRG A;  3BUO B;  5AFP A;  4ETO A;  5TNC A;  3TUY C;  3FIA A;  4XYN A;  2L2E A;  1SL9 A;  4AQJ A;  5HKW A;  2F8P A;  4GNK B;  1CLL A;  2KI4 C;  1CMF A;  1DJI A;  2LMV A;  3LCP C;  1YVH A;  1K96 A;  2M9G A;  2LLU A;  4USL A;  2PSR A;  3PSR A;  1A4P A;  1LVC D;  4HSZ A;  2LHI A;  2M49 B;  4M2P A;  1WLM A;  1DMO A;  2LVV A;  1OMV A;  4BY4 A;  3NSO A;  2I2R E;  4L9M A;  1MQ1 A;  2H61 C;  2ZND A;  4IL1 A;  5F6T A;  5CPV A;  1KFX L;  4CID A;  5IBW A;  1L2O B;  3I5I C;  2CNP A;  4PDZ A;  1BR4 B;  1Y1X A;  4N1G A;  1IG5 A;  2AMI A;  5KTY A;  1XVJ A;  1JSA A;  2ZN8 A;  4DUQ A;  1H4B A;  1Y1U A;  1REC A;  3AKB A;  1TN4 A;  1BU3 A;  1B8L A;  1M63 B;  5I2L A;  2KYC A;  1DF0 B;  2KHN A;  2P6B B;  1OSA A;  1WRK A;  1NX2 A;  2F3Y A;  3A4U B;  2BBN A;  3CWG A;  1M31 A;  4OV2 A;  1CFP A;  1C7W A;  1J55 A;  4DS7 A;  1CLM A;  2K0J A;  1F4O A;  5DKQ A;  2KFG A;  4MN0 A;  4ORC B;  5HYD A;  2ZRS A;  1UHH A;  1D1O A;  1EL4 A;  1YRT B;  1QTX A;  1N65 A;  4Q04 A;  1AK8 A;  2SCP A;  1WLZ A;  4HRE E;  4M2O A;  3JTD C;  2K7D A;  4F0Z B;  2HQ8 A;  1U5I B;  1TTX A;  2MHH A;  3VRP A;  1XA5 A;  2LP3 A;  1IJ5 A;  3GK4 X;  5D7F A;  1TNW A;  2JT3 A;  2LUX A;  5DKR A;  4GGF C;  5AAN A;  1S6I A;  2LCP A;  1YX8 A;  2COL B;  2HET A;  2JPT A;  1UP5 A;  1DGV A;  2L98 A;  1FI5 A;  1XFX O;  3AAK A;  2V53 A;  1RTP 1;  1E8A A;  1DJH A;  2E6W A;  3O4Y A;  1XK4 C;  5J3X A;  1QXP A;  1B4C A;  5GQQ C;  1EG3 A;  2NCO A;  1JBA A;  3D0Y A;  1SW8 A;  2JNF A;  2MRD A;  1MXE A;  1JWD A;  1QIV A;  2M1U A;  1J1E A;  1WDC B;  1JC2 A;  1UUS A;  2OS8 B;  4OR9 B;  2A4J A;  2FCE A;  2GV5 A;  3BYA A;  4D1E A;  1JF0 A;  4GGN A;  1BMO A;  4FTG A;  1QX7 A;  3C1V A;  2OTG C;  3PN7 B;  4A4B A;  1CFD A;  3SG3 A;  4ZCV A;  1C07 A;  1MHO A;  1FF1 A;  2LV7 A;  4R1E A;  1R2U A;  1A2X A;  1PK0 D;  1KK8 C;  1OE9 B;  2KGB C;  4PE7 A;  1F4Q A;  1SR6 C;  2JZI A;  4ICB A;  1KWO B;  2KI6 C;  2L50 A;  2QPT A;  5HKY A;  1B8R A;  1KQV A;  1PUL A;  3LK0 A;  1RWY A;  2HPS A;  1B47 A;  2OS8 C;  2BKI B;  3VRN A;  1RFJ A;  1IKU A;  4P2Y B;  1UHI A;  3FS7 A;  4PAL A;  3PN7 C;  5K89 A;  1PAL A;  2FOT A;  4GFT A;  1M39 A;  2BCB A;  4XJK B;  1LA0 A;  2M8U A;  1KK7 Y;  1HT9 A;  1IGV A;  1S26 D;  1NSH A;  2JWW A;  3GK1 A;  3EKJ A;  4JWQ A;  1OMR A;  1KSO A;  1TCF A;  2KQ6 A;  3GOF A;  1J1D A;  3OX5 A;  2WC8 A;  1KK7 Z;  4I5J A;  3I5G C;  1YVL A;  3BQ3 A;  2KAY A;  3TDU A;  1B7T Y;  3GK2 A;  1Q80 A;  1F55 A;  3SG5 A;  1J7P A;  3K21 A;  3SIB A;  2KI4 B;  2Q4U A;  3M0W A;  3IQO A;  2JTZ A;  5HLV A;  3E3R A;  2ISD A;  1OOJ A;  1B7T Z;  4MEW A;  1WRZ A;  2CCM A;  3ZNI A;  2LAP A;  2FCD A;  4CLN A;  1CM1 A;  4XJK A;  1BOD A;  1PVB A;  4PCW A;  1RJV A;  1NUB A;  1PSR A;  1QLK A;  1NCX A;  1RRO A;  2BBM A;  2KI6 D;  1DJY A;  3VRR A;  3TS5 C;  4PE4 A;  1CTR A;  2LVK A;  3CGA A;  1M46 A;  3CLN A;  3I5I B;  4JQ0 D;  4NDB A;  1TNX A;  2L4H A;  1S6C A;  1TOP A;  1CNP A;  5KSZ A;  3I5F C;  3AKA A;  1GQM A;  3CR5 X;  4MBE A;  3BUM B;  1A75 A;  1TCO B;  1PVA A;  3NSI A;  5PAL A;  2BCA A;  1CDN A;  1UHN A;  1MWN A;  3JVT C;  1YRU B;  2DOQ A;  4OCI A;  5B8I B;  1JF2 A;  5CSN A;  1DGU A;  2M7N A;  2LE9 B;  2LVI A;  2MLF C;  3BOW B;  2CTN A;  4OVN F;  2K7C A;  2KDH A;  3KF9 A;  3TDI A;  1AHR A;  2F33 A;  2KNE A;  1NX1 A;  5KU1 A;  1K8U A;  1S5G Y;  3QRX A;  3CZT X;  1B1G A;  1SNL A;  3BUN B;  4MZK A;  2NXQ A;  1CDL A;  3OP0 A;  1S5G Z;  1UHJ A;  3NXA A;  1CDM A;  1CDP A;  3JTD B;  4PE1 A;  1S6J A;  1QAT A;  4MSP A;  4NDD A;  1KQM C;  1NCZ A;  2JXC A;  1SL7 A;  1ALW A;  4NQG A;  1W7J B;  2MJW B;  1M45 A;  4WRI A;  2O5G A;  1KFU S;  2K7O A;  4MLW A;  1ZUZ A;  3LLE A;  3OX6 A;  2LLS A;  1V1F A;  1DJG A;  1G33 A;  1Y0V H;  1CM4 A;  1YUS A;  3I5H C;  1DJZ A;  1AP4 A;  1DT7 B;  2CBL A;  1R6P A;  1CLB A;  3EVU A;  1K2H A;  4ZCU A;  4WQ3 A;  4A4C A;  2Y1M A;  1DF0 A;  1J7R A;  2L51 A;  2PVB A;  1NPQ A;  1EG4 A;  1JFJ A;  3WXA A;  2B1U A;  1QV1 A;  1YUR A;  1ZMZ A;  5CSJ A;  1UWO A;  4YRU A;  1J7O A;  1EJ3 A;  2OTG B;  2M0R A;  1F8H A;  1YUU A;  4WQ2 A;  5FYX A;  2K8M B;  4OKH A;  1F71 A;  1KK8 B;  2BE4 A;  4MZL A;  1SR6 B;  1QAS A;  2L4I A;  4DRW A;  3SIA A;  1K90 D;  1ZFS A;  1LXF C;  2KOT A;  1XK4 A;  5CSI A;  1U5I A;  2KSP A;  1HQV A;  2WCF A;  3WNX B;  2AUC A;  1BLQ A;  1NX0 A;  3TDZ A;  3EKH A;  3OB2 B;  1NYA A;  2F3Z A;  2JTT A;  4JPZ B;  3VGO A;  3VRO A;  2WCB A;  3NSK A;  5I8N A;  1K9U A;  3EVR A;  4C0J A;  1IH0 A;  2JT8 A;  1SCM C;  1XFY O;  3HX4 A;  2K2F A;  1OZO A;  1SYM A;  2BL0 C;  5JJG A;  2SAS A;  2NLN A;  4UPG A;  5I2O A;  3DF0 B;  1QLS A;  3I5G B;  1NWD A;  2JRF A;  4NDC A;  2JUL A;  1MUX A;  5HKZ A;  3SG6 A;  1MXL C;  1PSB A;  3CTN A;  1SKT A;  1NX3 A;  2JQ6 A;  4PE0 A;  2KBI A;  2I18 A;  2ZNE A;  3SJS A;  1K9P A;  1QV0 A;  2IS9 A;  2K61 A;  4DCK A;  2KYF A;  3DD4 A;  1EH2 A;  1G8I A;  2M1K B;  5DKN A;  4AOM A;  4C0K A;  2F2O A;  2WCE A;  2JNX A;  1SK6 D;  1FW4 A;  1DJX A;  3KHE A;  3KPX A;  1A29 A;  3IF7 A;  1OMD A;  1UHK A;  4GUK A;  3DVE A;  3TS5 B;  4AQI A;  4GAO A;  5D69 A;  5HLO A;  1UUR A;  4U8D A;  1S36 A;  2LVJ A;  4YGD B;  2K7B A;  3I5F B;  4TNC A;  1MF8 B;  1V1G A;  3PAL A;  4MZJ A;  3EK4 A;  1QVI Y;  4P5O E;  1XFW O;  1MR8 A;  4E68 A;  3BUX B;  3DVK A;  2LM5 A;  5G08 A;  2R2I A;  4HRH A;  1SPY A;  3JVT B;  1IRJ A;  4GPL B;  3A8R A;  4N5X A;  5ER4 X;  2CT9 A;  1QVI Z;  1FPW A;  4C0L A;  1K94 A;  2LLT A;  2KAV A;  4I5K A;  2M97 A;  1BT6 A;  2NCP A;  3CS1 A;  2PMY A;  2M29 A;  2WND A;  1YR5 A;  1KFU L;  2M3W A;  1BJF A;  2KQY A;  3OHM B;  1NCY A;  3PFV A;  3RLZ A;  3KO0 A;  3RM1 A;  1RK9 A;  1OZS A;  2LNK A;  3FWC A;  2I94 A;  4FQO A;  3CR4 X;  1TIZ A;  4QJ3 B;  4CPV A;  2KAX A;  1SCV A;  4PHM A;  2PAS A;  1IQ3 A;  4YGB B;  1JFK A;  2LC5 A;  2EC6 C;  1B8C A;  4I5L B;  2JOJ A;  3SG4 A;  1XYD A;  3AAJ A;  1KQM B;  2H61 A;  4MRX A;  5BPJ A;  1QIW A;  1ZAC A;  1Y1A A;  1LIN A;  2E30 A;  4N1F A;  1DTL A;  4ORB B;  1CFC A;  1JUO A;  4YGC B;  1BF5 A;  2Q91 A;  1SY9 A;  2I7A A;  2MA2 A;  2MLE C;  2K2A A;  4CFR A;  3I5H B;  4CFQ A;  1NP8 A;  5AEQ A;  1EXR A;  2ZRT A;  2BCX A;  1NIW A;  4YI8 A;  1FI6 A;  4I5N B;  1N2D A;  1KSM A;  1OQP A;  1VRK A;  3VRQ A;  1W7I B;  3WHT B;  3PM8 A;  2NZ0 A;  2O60 A;  1K93 D;  3BOW A;  2D8N A;  4BY5 A;  3CR2 A;  2G2B A;  1Y6W A;  2ZN9 A;  4YI9 A;  1GJY A;  1CFF A;  1CB1 A;  1PRW A;  2JC2 A;  1AVS A;  4M2Q A;  4MRY A;  4YGE B;  1ALV A;  1B9A A;  1L2O C;  2KGR A;  4QJ4 B;  2BKH B;  2KFH A;  1LA3 A;  1QJT A;  2JU0 A;  3O2P A;  4DIR A;  1QX2 A;  1GGW A;  2M7L A;  1GGZ A;  4PHJ A;  1SMG A;  1SL8 A;  2OPO A;  3MSE B;  3SG2 A;  1J7Q A;  4PHN A;  1KCY A;  4ORA B;  1SBJ A;  3D0Y B;  2TN4 A;  2BE6 A;  1AJ5 A;  2LUC A;  2H2K A;  4GGF A;  3HCM A;  3KEV A;  3WHU B;  1N0Y A;  1SCM B;  2LP2 A;  1XO5 A;  1ODB A;  2G9B A;  2BL0 B;  5AER A;  5I2Q A;  3EK7 A;  1KFX S;  1BG1 A;  2F2P A;  4MVF A;  2AAO A;  1CKK A;  2EHB A;  3TZ1 A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  4YGA A;  1F70 A;  3NSL A;  2KFF A;  1C7V A;  5FI2 A;  1TNQ A;  3SG7 A;  3ZWH A;  5JOL A;  3D10 A;  3L4A A;  3SS3 A;  2HF5 A;  2L5X B;  2GGZ A;  1ZOT B;  1TRF A;  1DVI A;  1YTZ C;  1YX7 A;  1CMG A;  1BOC A;  2KBM A;  2L0P A;  2CXJ A;  2FJU B;  2WCJ A;  3PAT A;  1XFZ O;  2WCH A;  2WOR A;  2MBX A;  1QS7 A;  2LMT A;  2HQW A;  3PLF B;  2QAC A;  5ER5 A;  1S1E A;  2KPH A;  3FWB A;  1F54 A;  2KLD A;  1SRA A;  3ICB A;  3O6B A;  5CSF A;  1LKJ A;  3DVJ A;  1A03 A;  3IQQ A;  2LHL A;  4F7F A;  3BUW B;  2K60 A;  1H8B A;  1S3P A;  1WDC C;  3H4S E;  2GGM A;  1G4Y R;  2LMU A;  2Y4Q A;  2JT0 A;  2WOS A;  3DF0 A;  3EVV A;  5HL1 A;  3O78 A;  3LK1 A;  2RGI A;  2ZFD A;  3S0A A;  1BR1 B;  1Z2C B;  1YUT A;  1XFU O;  1KWO C;  3OB1 B;  4HRG A;  1X02 A;  3S0D A;  3EK8 A;  1IJ6 A;  4PHK A;  5AXI A;  3LL8 B;  1WY9 A;  2PRU A;  4GBA A;  2BEC A;  1FBV A;  4YBH B;  1TNP A;  1K9K A;  3DVM A;  1XFV O;  3TUY B;  1IWQ A;  2ZKM X;  1DJW A;  1L7Z A;  1AUI B;  3BFA A;  1AJ4 A;  3S0F A;  1WRL A;  1QX5 B;  2EC6 B;  2MAZ A;  3D74 A;  1A75 B;  2PAL A;  1IQ5 A;  3B6X A;  2EGD A;  3F45 A;  3Q8I A;  1K95 A;  4QJ5 B;  2LAN A;  4INX A;  3BXK A;  2Y5I A;  2JXL A;  2VRG A;  3BUO B;  5AFP A;  4ETO A;  5TNC A;  3TUY C;  3FIA A;  3O4X A;  4XYN A;  2L2E A;  1SL9 A;  4AQJ A;  5HKW A;  2F8P A;  4GNK B;  1CLL A;  2KI4 C;  3QME A;  1CMF A;  1DJI A;  2LMV A;  3LCP C;  1YVH A;  1K96 A;  2M9G A;  2LLU A;  4USL A;  2PQL A;  2PSR A;  3PSR A;  1A4P A;  1LVC D;  4HSZ A;  2LHI A;  2M49 B;  4M2P A;  1WLM A;  1DMO A;  2LVV A;  1OMV A;  4BY4 A;  3NSO A;  2I2R E;  4L9M A;  1MQ1 A;  1C3Y A;  2H61 C;  2ZND A;  4IL1 A;  5F6T A;  5CPV A;  1KFX L;  4CID A;  1DEK A;  1L2O B;  5IBW A;  2KLE A;  3I5I C;  2CNP A;  4PDZ A;  1BR4 B;  1Y1X A;  4N1G A;  1IG5 A;  2AMI A;  5KTY A;  1XVJ A;  3OBV A;  2ZN8 A;  4DUQ A;  1H4B A;  1JSA A;  1Y1U A;  1REC A;  3AKB A;  1TN4 A;  1BU3 A;  1B8L A;  3UO9 A;  1M63 B;  5I2L A;  2KYC A;  1DF0 B;  2KHN A;  2P6B B;  1OSA A;  1WRK A;  1NX2 A;  2F3Y A;  3A4U B;  2BBN A;  3CWG A;  1M31 A;  4OV2 A;  1CFP A;  1C7W A;  1J55 A;  4DS7 A;  2WCL A;  1CLM A;  2K0J A;  3OGN A;  1F4O A;  5FI7 A;  5DKQ A;  2KFG A;  4MN0 A;  1DQE A;  2JPO A;  2ZRS A;  4ORC B;  5HYD A;  1UHH A;  1D1O A;  1EL4 A;  1YRT B;  1QTX A;  1N65 A;  4Q04 A;  1AK8 A;  2SCP A;  1WLZ A;  4HRE E;  4M2O A;  2YGU A;  3R1V A;  3JTD C;  2K7D A;  4F0Z B;  1Z4H A;  2HQ8 A;  1U5I B;  1TTX A;  2MHH A;  3VRP A;  1XA5 A;  2LP3 A;  1IJ5 A;  2QEV A;  3GK4 X;  5D7F A;  3SS5 A;  1GM0 A;  1TNW A;  2JT3 A;  2LUX A;  5DKR A;  4GGF C;  5AAN A;  1S6I A;  2LCP A;  1YX8 A;  2COL B;  2HET A;  2JPT A;  1UP5 A;  1DGV A;  2L98 A;  1FI5 A;  1XFX O;  3AAK A;  2V53 A;  1RTP 1;  3S0B A;  1E8A A;  1DJH A;  2E6W A;  3K1E A;  1XK4 C;  3O4Y A;  5J3X A;  1QXP A;  1B4C A;  5GQQ C;  1EG3 A;  2NCO A;  1JBA A;  3D0Y A;  1SW8 A;  2JNF A;  2MRD A;  1MXE A;  3PM2 A;  1JWD A;  1QIV A;  2GTE A;  2M1U A;  1J1E A;  1WDC B;  3BJH A;  3S0E A;  1JC2 A;  1UUS A;  2OS8 B;  3B88 A;  2A4J A;  2FCE A;  2GV5 A;  3BYA A;  3IVT A;  3NGV A;  1JF0 A;  4GGN A;  4D1E A;  1BMO A;  4FTG A;  1QX7 A;  3C1V A;  2OTG C;  3PN7 B;  4A4B A;  1CFD A;  3SG3 A;  4ZCV A;  1C07 A;  1MHO A;  1FF1 A;  2LV7 A;  4R1E A;  1PK0 D;  1R2U A;  1A2X A;  1KK8 C;  1OE9 B;  2KGB C;  4PE7 A;  1F4Q A;  1SR6 C;  1T14 A;  2JZI A;  3UNW A;  4ICB A;  1KWO B;  2KI6 C;  2L50 A;  4INW A;  2QPT A;  5HKY A;  1B8R A;  1KQV A;  1PUL A;  3LK0 A;  1RWY A;  2HPS A;  1B47 A;  2OS8 C;  3B87 A;  2BKI B;  3CDN A;  3VRN A;  1RFJ A;  1IKU A;  2QEH A;  1UHI A;  3FS7 A;  4P2Y B;  3PN7 C;  4PAL A;  5K89 A;  1PAL A;  2FOT A;  4GFT A;  1M39 A;  2BCB A;  4PT1 A;  4XJK B;  1LA0 A;  2M8U A;  1KK7 Y;  1HT9 A;  1IGV A;  1S26 D;  1NSH A;  2JWW A;  2ERB A;  3EKJ A;  3GK1 A;  4JWQ A;  1OMR A;  1KSO A;  1TCF A;  2KQ6 A;  3B86 A;  3GOF A;  1J1D A;  3OX5 A;  5FI6 A;  2WC8 A;  1KK7 Z;  4I5J A;  3I5G C;  1YVL A;  3BQ3 A;  2KAY A;  3TDU A;  1B7T Y;  3GK2 A;  1Q80 A;  2P71 A;  1F55 A;  3SG5 A;  1J7P A;  3K21 A;  3SIB A;  3DXL A;  2KI4 B;  2Q4U A;  3M0W A;  3IQO A;  2JTZ A;  5HLV A;  3E3R A;  2ISD A;  1OOJ A;  1B7T Z;  4MEW A;  1WRZ A;  2CCM A;  3ZNI A;  2LAP A;  3L4L A;  2FCD A;  4CLN A;  1CM1 A;  4XJK A;  1BOD A;  1PVB A;  4PCW A;  1RJV A;  1NUB A;  1PSR A;  1QLK A;  2P70 A;  2L5Y A;  1NCX A;  1RRO A;  2BBM A;  2KI6 D;  1DJY A;  2WCK A;  3VRR A;  3TS5 C;  4PE4 A;  1CTR A;  2LVK A;  3CGA A;  1M46 A;  3CLN A;  3I5I B;  4JQ0 D;  3NHT A;  1TNX A;  4NDB A;  2L4H A;  1S6C A;  1TOP A;  1CNP A;  5KSZ A;  3I5F C;  3AKA A;  1GQM A;  3CR5 X;  4MBE A;  3BUM B;  1A75 A;  1TCO B;  1PVA A;  3NSI A;  5PAL A;  2BCA A;  1CDN A;  1UHN A;  1MWN A;  3JVT C;  1YRU B;  2DOQ A;  4OCI A;  5B8I B;  1JF2 A;  4OR9 B;  1DGU A;  2M7N A;  2LE9 B;  1TUJ A;  2LVI A;  2MLF C;  3BOW B;  5CSN A;  2CTN A;  4OVN F;  3CAB A;  2K7C A;  2KDH A;  3KF9 A;  3TDI A;  1AHR A;  2F33 A;  2KNE A;  1NX1 A;  5KU1 A;  1K8U A;  1S5G Y;  3QRX A;  3CZT X;  1B1G A;  1SNL A;  3BUN B;  4MZK A;  2NXQ A;  1CDL A;  3OP0 A;  3NHI A;  1S5G Z;  1UHJ A;  3NXA A;  1CDM A;  1CDP A;  3JTD B;  4PE1 A;  1S6J A;  1QAT A;  4MSP A;  4NDD A;  1KQM C;  1NCZ A;  2JXC A;  1SL7 A;  1ALW A;  4NQG A;  1DEL A;  1W7J B;  2MJW B;  3CZ1 A;  1M45 A;  4WRI A;  2O5G A;  1KFU S;  2K7O A;  4MLW A;  3DZT A;  1ZUZ A;  3LLE A;  3OX6 A;  1IIO A;  2LLS A;  1V1F A;  1DJG A;  1G33 A;  1Y0V H;  3DY9 A;  1CM4 A;  1YUS A;  3I5H C;  1OOF A;  1LS8 A;  1DJZ A;  2H8V A;  1AP4 A;  3V2L A;  1DT7 B;  2CBL A;  1R6P A;  1CLB A;  3EVU A;  1K2H A;  4ZCU A;  4WQ3 A;  4A4C A;  2Y1M A;  1DF0 A;  1J7R A;  1OOH A;  2L51 A;  2PVB A;  1NPQ A;  3R1P A;  1EG4 A;  1JFJ A;  4KYN A;  1W9Z A;  3WXA A;  1XFR A;  2B1U A;  1QV1 A;  1YUR A;  1ZMZ A;  5CSJ A;  1UWO A;  5DIC A;  4YRU A;  1J7O A;  1EJ3 A;  2OTG B;  2FJY A;  2M0R A;  1F8H A;  1YUU A;  4WQ2 A;  3BFB A;  5FYX A;  2K8M B;  4OKH A;  1F71 A;  1KK8 B;  2BE4 A;  4MZL A;  1SR6 B;  1QAS A;  3RZS A;  2L4I A;  4DRW A;  3SIA A;  1K90 D;  3DYE A;  1ZFS A;  1LXF C;  2KOT A;  1XK4 A;  3D75 A;  5CSI A;  1U5I A;  2KSP A;  5I94 A;  1HQV A;  2WCF A;  3WNX B;  2AUC A;  1BLQ A;  1NX0 A;  3TDZ A;  3EKH A;  3OB2 B;  1NYA A;  2F3Z A;  2JTT A;  4JPZ B;  3VGO A;  3VRO A;  1OOG A;  2WCB A;  2WCM A;  1K9U A;  3EVR A;  3NSK A;  4C0J A;  1IH0 A;  3B7A A;  2JT8 A;  1SCM C;  2BNX A;  1XFY O;  3HX4 A;  2K2F A;  1OZO A;  1SYM A;  2BL0 C;  2QEB A;  5JJG A;  2SAS A;  2NLN A;  4UPG A;  5I2O A;  3DF0 B;  1QLS A;  3I5G B;  1NWD A;  2JRF A;  4NDC A;  2JUL A;  5EL2 A;  1MUX A;  5HKZ A;  3SG6 A;  1MXL C;  1PSB A;  3CTN A;  1SKT A;  4OZD A;  1NX3 A;  2JQ6 A;  4PE0 A;  2KBI A;  2I18 A;  2ZNE A;  3SJS A;  1K9P A;  1QV0 A;  2IS9 A;  2K61 A;  4DCK A;  2KYF A;  3DD4 A;  1EH2 A;  1OW4 A;  1G8I A;  2M1K B;  5DKN A;  4AOM A;  2WC6 A;  4C0K A;  3R1O A;  2F2O A;  2WCE A;  2JNX A;  1SK6 D;  1FW4 A;  1DJX A;  3KHE A;  3KPX A;  1OOI X;  1A29 A;  3IF7 A;  1OMD A;  1UHK A;  4GUK A;  3DVE A;  3TS5 B;  4AQI A;  4GAO A;  4JD9 A;  5D69 A;  5HLO A;  1UUR A;  4U8D A;  1S36 A;  2LVJ A;  3D73 A;  4YGD B;  2K7B A;  3S0G A;  3I5F B;  3CZ2 A;  1MF8 B;  1V1G A;  3PAL A;  4TNC A;  4MZJ A;  3EK4 A;  1QVI Y;  4P5O E;  3VB1 A;  1XFW O;  4FQT A;  1MR8 A;  4E68 A;  3BUX B;  3DVK A;  2LM5 A;  5G08 A;  2R2I A;  4HRH A;  1SPY A;  3JVT B;  1IRJ A;  4GPL B;  3A8R A;  4N5X A;  5ER4 X;  2CT9 A;  1QVI Z;  1FPW A;  4C0L A;  1K94 A;  2LLT A;  1P28 A;  2KAV A;  4I5K A;  2M97 A;  1BT6 A;  2NCP A;  3CS1 A;  2PMY A;  2M29 A;  2WND A;  1YR5 A;  1KFU L;  2M3W A;  1BJF A;  2KQY A;  3OHM B;  1NCY A;  3D76 A;  3PFV A;  3KO0 A;  3RLZ A;  3RM1 A;  1RK9 A;  1OZS A;  2LNK A;  3FWC A;  2I94 A;  4FQO A;  3CR4 X;  1TIZ A;  4QJ3 B;  4CPV A;  2KAX A;  1SCV A;  3R72 A;  2PAS A;  4PHM A;  1IQ3 A;  4YGB B;  1JFK A;  2LC5 A;  2L2C A;  2EC6 C;  1B8C A;  4I5L B;  2JOJ A;  3L47 A;  3SG4 A;  1XYD A;  3AAJ A;  2PYQ A;  1KQM B;  5D3O A;  2H61 A;  4MRX A;  5BPJ A;  1QIW A;  1ZAC A;  1Y1A A;  1LIN A;  2E30 A;  4N1F A;  1DTL A;  4ORB B;  1C3Z A;  1CFC A;  1JUO A;  4YGC B;  1BF5 A;  3D77 A;  2Q91 A;  3FE6 A;  1SY9 A;  2I7A A;  2MA2 A;  1TUZ A;  2MLE C;  3FE8 A;  2K2A A;  4CFR A;  3I5H B;  3D78 A;  4CFQ A;  1TWO A;  1NP8 A;  2QEO A;  5AEQ A;  1EXR A;  2ZRT A;  2BCX A;  1NIW A;  4YI8 A;  1FI6 A;  4I5N B;  1N2D A;  1KSM A;  1OQP A;  1VRK A;  3VRQ A;  1W7I B;  3WHT B;  3PM8 A;  2NZ0 A;  2O60 A;  1K93 D;  3BOW A;  4IJ7 A;  2D8N A;  3N7H A;  4BY5 A;  2WC5 A;  3CR2 A;  2G2B A;  1Y6W A;  2ZN9 A;  1ORG A;  4YI9 A;  1GJY A;  1CFF A;  1CB1 A;  1SSE B;  2QDI A;  1PRW A;  2JC2 A;  1AVS A;  4M2Q A;  4MRY A;  4YGE B;  3EG5 B;  1ALV A;  1B9A A;  1L2O C;  2KGR A;  1DC1 A;  4QJ4 B;  2BKH B;  2KFH A;  1LA3 A;  3FE9 A;  1QJT A;  2JU0 A;  3O2P A;  4DIR A;  1QX2 A;  1GGW A;  1QWV A;  2M7L A;  4JKT A;  1GGZ A;  4PHJ A;  1SMG A;  1SL8 A;  2OPO A;  3CYZ A;  3MSE B;  3SG2 A;  4PHN A;  5I8N A;  1J7Q A;  1KCY A;  3CZ0 A;  4ORA B;  1SBJ A;  3D0Y B;  3BFH A;  2BAP A;  2TN4 A;  2BE6 A;  1AJ5 A;  2LUC A;  2H2K A;  4GGF A;  3HCM A;  3KEV A;  3WHU B;  1N0Y A;  1SCM B;  2LP2 A;  1XO5 A;  1ODB A;  2G9B A;  2BL0 B;  5AER A;  5I2Q A;  3EK7 A;  1KFX S;  1BG1 A;  2F2P A;  4MVF A;  3PJI A;  2AAO A;  1CKK A;  2EHB A;  3TZ1 A;  3SS4 A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  4YGA A;  1F70 A;  3NSL A;  2KFF A;  1C7V A;  1TNQ A;  3SG7 A;  3ZWH A;  5JOL A;  3D10 A;  2HF5 A;  2L5X B;  2GGZ A;  1ZOT B;  1TRF A;  1DVI A;  1YTZ C;  1YX7 A;  1CMG A;  1BOC A;  2KBM A;  2L0P A;  2CXJ A;  2FJU B;  3PAT A;  1XFZ O;  2WOR A;  2MBX A;  1QS7 A;  2LMT A;  2HQW A;  3PLF B;  2QAC A;  5ER5 A;  1S1E A;  3FWB A;  1F54 A;  1SRA A;  3ICB A;  3O6B A;  5CSF A;  1LKJ A;  3DVJ A;  1A03 A;  3IQQ A;  2LHL A;  3BUW B;  1H8B A;  1S3P A;  1WDC C;  3H4S E;  2GGM A;  1G4Y R;  2LMU A;  2Y4Q A;  2JT0 A;  2WOS A;  3DF0 A;  3EVV A;  3O78 A;  3LK1 A;  2RGI A;  2ZFD A;  1BR1 B;  1YUT A;  1XFU O;  1KWO C;  3OB1 B;  4HRG A;  1X02 A;  3EK8 A;  1IJ6 A;  4PHK A;  5AXI A;  3LL8 B;  1WY9 A;  2PRU A;  4GBA A;  2BEC A;  1FBV A;  4YBH B;  1TNP A;  1K9K A;  3DVM A;  1XFV O;  3TUY B;  1IWQ A;  2ZKM X;  1DJW A;  1L7Z A;  1AUI B;  1AJ4 A;  1WRL A;  1QX5 B;  2EC6 B;  2MAZ A;  1A75 B;  2PAL A;  1IQ5 A;  2EGD A;  3F45 A;  1K95 A;  4QJ5 B;  2LAN A;  3BXK A;  2Y5I A;  2JXL A;  2VRG A;  3BUO B;  5AFP A;  4ETO A;  5TNC A;  3TUY C;  3FIA A;  4XYN A;  2L2E A;  1SL9 A;  4AQJ A;  5HKW A;  2F8P A;  4GNK B;  1CLL A;  2KI4 C;  1CMF A;  1DJI A;  2LMV A;  3LCP C;  1YVH A;  1K96 A;  2M9G A;  2LLU A;  4USL A;  2PSR A;  3PSR A;  1A4P A;  1LVC D;  4HSZ A;  2LHI A;  2M49 B;  4M2P A;  1WLM A;  1DMO A;  2LVV A;  1OMV A;  4BY4 A;  3NSO A;  2I2R E;  4L9M A;  1MQ1 A;  2H61 C;  2ZND A;  4IL1 A;  5F6T A;  5CPV A;  1KFX L;  4CID A;  5IBW A;  1L2O B;  3I5I C;  2CNP A;  4PDZ A;  1BR4 B;  1Y1X A;  4N1G A;  1IG5 A;  2AMI A;  5KTY A;  1XVJ A;  1JSA A;  2ZN8 A;  4DUQ A;  1H4B A;  1Y1U A;  1REC A;  3AKB A;  1TN4 A;  1BU3 A;  1B8L A;  1M63 B;  5I2L A;  2KYC A;  1DF0 B;  2KHN A;  2P6B B;  1OSA A;  1WRK A;  1NX2 A;  2F3Y A;  3A4U B;  2BBN A;  3CWG A;  1M31 A;  4OV2 A;  1CFP A;  1C7W A;  1J55 A;  4DS7 A;  1CLM A;  2K0J A;  1F4O A;  5DKQ A;  2KFG A;  4MN0 A;  4ORC B;  5HYD A;  2ZRS A;  1UHH A;  1D1O A;  1EL4 A;  1YRT B;  1QTX A;  1N65 A;  4Q04 A;  1AK8 A;  2SCP A;  1WLZ A;  4HRE E;  4M2O A;  3JTD C;  2K7D A;  4F0Z B;  2HQ8 A;  1U5I B;  1TTX A;  2MHH A;  3VRP A;  1XA5 A;  2LP3 A;  1IJ5 A;  3GK4 X;  5D7F A;  1TNW A;  2JT3 A;  2LUX A;  5DKR A;  4GGF C;  5AAN A;  1S6I A;  2LCP A;  1YX8 A;  2COL B;  2HET A;  2JPT A;  1UP5 A;  1DGV A;  2L98 A;  1FI5 A;  1XFX O;  3AAK A;  2V53 A;  1RTP 1;  1E8A A;  1DJH A;  2E6W A;  3O4Y A;  1XK4 C;  5J3X A;  1QXP A;  1B4C A;  5GQQ C;  1EG3 A;  2NCO A;  1JBA A;  3D0Y A;  1SW8 A;  2JNF A;  2MRD A;  1MXE A;  1JWD A;  1QIV A;  2M1U A;  1J1E A;  1WDC B;  1JC2 A;  1UUS A;  2OS8 B;  4OR9 B;  2A4J A;  2FCE A;  2GV5 A;  3BYA A;  4D1E A;  1JF0 A;  4GGN A;  1BMO A;  4FTG A;  1QX7 A;  3C1V A;  2OTG C;  3PN7 B;  4A4B A;  1CFD A;  3SG3 A;  4ZCV A;  1C07 A;  1MHO A;  1FF1 A;  2LV7 A;  4R1E A;  1R2U A;  1A2X A;  1PK0 D;  1KK8 C;  1OE9 B;  2KGB C;  4PE7 A;  1F4Q A;  1SR6 C;  2JZI A;  4ICB A;  1KWO B;  2KI6 C;  2L50 A;  2QPT A;  5HKY A;  1B8R A;  1KQV A;  1PUL A;  3LK0 A;  1RWY A;  2HPS A;  1B47 A;  2OS8 C;  2BKI B;  3VRN A;  1RFJ A;  1IKU A;  4P2Y B;  1UHI A;  3FS7 A;  4PAL A;  3PN7 C;  5K89 A;  1PAL A;  2FOT A;  4GFT A;  1M39 A;  2BCB A;  4XJK B;  1LA0 A;  2M8U A;  1KK7 Y;  1HT9 A;  1IGV A;  1S26 D;  1NSH A;  2JWW A;  3GK1 A;  3EKJ A;  4JWQ A;  1OMR A;  1KSO A;  1TCF A;  2KQ6 A;  3GOF A;  1J1D A;  3OX5 A;  2WC8 A;  1KK7 Z;  4I5J A;  3I5G C;  1YVL A;  3BQ3 A;  2KAY A;  3TDU A;  1B7T Y;  3GK2 A;  1Q80 A;  1F55 A;  3SG5 A;  1J7P A;  3K21 A;  3SIB A;  2KI4 B;  2Q4U A;  3M0W A;  3IQO A;  2JTZ A;  5HLV A;  3E3R A;  2ISD A;  1OOJ A;  1B7T Z;  4MEW A;  1WRZ A;  2CCM A;  3ZNI A;  2LAP A;  2FCD A;  4CLN A;  1CM1 A;  4XJK A;  1BOD A;  1PVB A;  4PCW A;  1RJV A;  1NUB A;  1PSR A;  1QLK A;  1NCX A;  1RRO A;  2BBM A;  2KI6 D;  1DJY A;  3VRR A;  3TS5 C;  4PE4 A;  1CTR A;  2LVK A;  3CGA A;  1M46 A;  3CLN A;  3I5I B;  4JQ0 D;  4NDB A;  1TNX A;  2L4H A;  1S6C A;  1TOP A;  1CNP A;  5KSZ A;  3I5F C;  3AKA A;  1GQM A;  3CR5 X;  4MBE A;  3BUM B;  1A75 A;  1TCO B;  1PVA A;  3NSI A;  5PAL A;  2BCA A;  1CDN A;  1UHN A;  1MWN A;  3JVT C;  1YRU B;  2DOQ A;  4OCI A;  5B8I B;  1JF2 A;  5CSN A;  1DGU A;  2M7N A;  2LE9 B;  2LVI A;  2MLF C;  3BOW B;  2CTN A;  4OVN F;  2K7C A;  2KDH A;  3KF9 A;  3TDI A;  1AHR A;  2F33 A;  2KNE A;  1NX1 A;  5KU1 A;  1K8U A;  1S5G Y;  3QRX A;  3CZT X;  1B1G A;  1SNL A;  3BUN B;  4MZK A;  2NXQ A;  1CDL A;  3OP0 A;  1S5G Z;  1UHJ A;  3NXA A;  1CDM A;  1CDP A;  3JTD B;  4PE1 A;  1S6J A;  1QAT A;  4MSP A;  4NDD A;  1KQM C;  1NCZ A;  2JXC A;  1SL7 A;  1ALW A;  4NQG A;  1W7J B;  2MJW B;  1M45 A;  4WRI A;  2O5G A;  1KFU S;  2K7O A;  4MLW A;  1ZUZ A;  3LLE A;  3OX6 A;  2LLS A;  1V1F A;  1DJG A;  1G33 A;  1Y0V H;  1CM4 A;  1YUS A;  3I5H C;  1DJZ A;  1AP4 A;  1DT7 B;  2CBL A;  1R6P A;  1CLB A;  3EVU A;  1K2H A;  4ZCU A;  4WQ3 A;  4A4C A;  2Y1M A;  1DF0 A;  1J7R A;  2L51 A;  2PVB A;  1NPQ A;  1EG4 A;  1JFJ A;  3WXA A;  2B1U A;  1QV1 A;  1YUR A;  1ZMZ A;  5CSJ A;  1UWO A;  4YRU A;  1J7O A;  1EJ3 A;  2OTG B;  2M0R A;  1F8H A;  1YUU A;  4WQ2 A;  5FYX A;  2K8M B;  4OKH A;  1F71 A;  1KK8 B;  2BE4 A;  4MZL A;  1SR6 B;  1QAS A;  2L4I A;  4DRW A;  3SIA A;  1K90 D;  1ZFS A;  1LXF C;  2KOT A;  1XK4 A;  5CSI A;  1U5I A;  2KSP A;  1HQV A;  2WCF A;  3WNX B;  2AUC A;  1BLQ A;  1NX0 A;  3TDZ A;  3EKH A;  3OB2 B;  1NYA A;  2F3Z A;  2JTT A;  4JPZ B;  3VGO A;  3VRO A;  2WCB A;  3NSK A;  5I8N A;  1K9U A;  3EVR A;  4C0J A;  1IH0 A;  2JT8 A;  1SCM C;  1XFY O;  3HX4 A;  2K2F A;  1OZO A;  1SYM A;  2BL0 C;  5JJG A;  2SAS A;  2NLN A;  4UPG A;  5I2O A;  3DF0 B;  1QLS A;  3I5G B;  1NWD A;  2JRF A;  4NDC A;  2JUL A;  1MUX A;  5HKZ A;  3SG6 A;  1MXL C;  1PSB A;  3CTN A;  1SKT A;  1NX3 A;  2JQ6 A;  4PE0 A;  2KBI A;  2I18 A;  2ZNE A;  3SJS A;  1K9P A;  1QV0 A;  2IS9 A;  2K61 A;  4DCK A;  2KYF A;  3DD4 A;  1EH2 A;  1G8I A;  2M1K B;  5DKN A;  4AOM A;  4C0K A;  2F2O A;  2WCE A;  2JNX A;  1SK6 D;  1FW4 A;  1DJX A;  3KHE A;  3KPX A;  1A29 A;  3IF7 A;  1OMD A;  1UHK A;  4GUK A;  3DVE A;  3TS5 B;  4AQI A;  4GAO A;  5D69 A;  5HLO A;  1UUR A;  4U8D A;  1S36 A;  2LVJ A;  4YGD B;  2K7B A;  3I5F B;  4TNC A;  1MF8 B;  1V1G A;  3PAL A;  4MZJ A;  3EK4 A;  1QVI Y;  4P5O E;  1XFW O;  1MR8 A;  4E68 A;  3BUX B;  3DVK A;  2LM5 A;  5G08 A;  2R2I A;  4HRH A;  1SPY A;  3JVT B;  1IRJ A;  4GPL B;  3A8R A;  4N5X A;  5ER4 X;  2CT9 A;  1QVI Z;  1FPW A;  4C0L A;  1K94 A;  2LLT A;  2KAV A;  4I5K A;  2M97 A;  1BT6 A;  2NCP A;  3CS1 A;  2PMY A;  2M29 A;  2WND A;  1YR5 A;  1KFU L;  2M3W A;  1BJF A;  2KQY A;  3OHM B;  1NCY A;  3PFV A;  3RLZ A;  3KO0 A;  3RM1 A;  1RK9 A;  1OZS A;  2LNK A;  3FWC A;  2I94 A;  4FQO A;  3CR4 X;  1TIZ A;  4QJ3 B;  4CPV A;  2KAX A;  1SCV A;  4PHM A;  2PAS A;  1IQ3 A;  4YGB B;  1JFK A;  2LC5 A;  2EC6 C;  1B8C A;  4I5L B;  2JOJ A;  3SG4 A;  1XYD A;  3AAJ A;  1KQM B;  2H61 A;  4MRX A;  5BPJ A;  1QIW A;  1ZAC A;  1Y1A A;  1LIN A;  2E30 A;  4N1F A;  1DTL A;  4ORB B;  1CFC A;  1JUO A;  4YGC B;  1BF5 A;  2Q91 A;  1SY9 A;  2I7A A;  2MA2 A;  2MLE C;  2K2A A;  4CFR A;  3I5H B;  4CFQ A;  1NP8 A;  5AEQ A;  1EXR A;  2ZRT A;  2BCX A;  1NIW A;  4YI8 A;  1FI6 A;  4I5N B;  1N2D A;  1KSM A;  1OQP A;  1VRK A;  3VRQ A;  1W7I B;  3WHT B;  3PM8 A;  2NZ0 A;  2O60 A;  1K93 D;  3BOW A;  2D8N A;  4BY5 A;  3CR2 A;  2G2B A;  1Y6W A;  2ZN9 A;  4YI9 A;  1GJY A;  1CFF A;  1CB1 A;  1PRW A;  2JC2 A;  1AVS A;  4M2Q A;  4MRY A;  4YGE B;  1ALV A;  1B9A A;  1L2O C;  2KGR A;  4QJ4 B;  2BKH B;  2KFH A;  1LA3 A;  1QJT A;  2JU0 A;  3O2P A;  4DIR A;  1QX2 A;  1GGW A;  2M7L A;  1GGZ A;  4PHJ A;  1SMG A;  1SL8 A;  2OPO A;  3MSE B;  3SG2 A;  1J7Q A;  4PHN A;  1KCY A;  4ORA B;  1SBJ A;  3D0Y B;  2TN4 A;  2BE6 A;  1AJ5 A;  2LUC A;  2H2K A;  4GGF A;  3HCM A;  3KEV A;  3WHU B;  1N0Y A;  1SCM B;  2LP2 A;  1XO5 A;  1ODB A;  2G9B A;  2BL0 B;  5AER A;  5I2Q A;  3EK7 A;  1KFX S;  1BG1 A;  2F2P A;  4MVF A;  2AAO A;  1CKK A;  2EHB A;  3TZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...