1M63B

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
total genus 36
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m63B00
1QVIY 1LA3A 1BJFA 2Y5IA 1XFUO 1SL8A 2LM5A 3EKJA 1RWYA 3WNXB 2I94A 1MXLC 2WOSA 1KFXS 1TNPA 2ZRSA 4ORAB 1ODBA 1LA0A 4JQ0D 1SY9A 4YGDB 1Q80A 4MZKA 1ZUZA 1CDPA 2EGDA 1OMDA 2HQWA 3EVRA 3PN7C 3C1VA 2M9GA 1BLQA 2PASA 1DTLA 1JFKA 3JTDC 3O6BA 1PSBA 1WRKA 4WQ2A 4DCKA 3BXKA 2G9BA 1WRZA 5HYDA 3NSOA 1RROA 1SL9A 4DRWA 2GGZA 4FQOA 4MN0A 1MUXA 2H2KA 2LLTA 5DKQA 2HPSA 4YGEB 4U8DA 2NCPA 2AUCA 3OB1B 2LVVA 1IH0A 1G8IA 2HETA 2BE4A 1F4OA 1KSOA 3PALA 4CLNA 1BU3A 1DF0A 3I5HC 3PSRA 1CFFA 3SIAA 3EVUA 2M49B 3O2PA 4MBEA 4OV2A 1R6PA 3PFVA 2MLFC 3OX5A 1EG4A 1RJVA 4ZCVA 1FI6A 2LHIA 1BODA 3BQ3A 5CSJA 1YVHA 3TDIA 1A4PA 2K7BA 1A75B 1NWDA 1OSAA 3RM1A 2JNXA 3KHEA 1X02A 3DVKA 1KQMB 3PLFB 2LCPA 5HKZA 1JSAA 4QJ5B 4DIRA 2JXLA 3AAJA 5F6TA 4M2PA 1B7TY 1VRKA 1QVIZ 1NUBA 1TNQA 4ORBB 5I8NA 1EL4A 3BOWA 5KTYA 1V1GA 2LHLA 3EK7A 2KOTA 4MVFA 3TDUA 3IQOA 1NIWA 1YX8A 2R2IA 2LP2A 4ZCUA 1F55A 1K90D 2BL0C 4YGCB 1QIWA 2K7DA 1NCZA 2K7CA 1FPWA 4YI9A 3MSEB 4YRUA 1C7WA 1DJHA 1UURA 4CFRA 2L51A 4GNKB 1YVLA 2KFFA 5CSIA 4M2OA 1SR6B 2CT9A 1QLSA 1SCMB 2BKHB 1B7TZ 2RGIA 1JFJA 1CM4A 1XK4A 2ZN9A 2F33A 2K2FA 1IQ5A 4MZJA 1QJTA 4A4CA 3ICBA 1CNPA 2BBMA 4WRIA 1QV1A 1A75A 2KBMA 1OQPA 4ETOA 1B8CA 4OVNF 1CLLA 3TZ1A 1G33A 2JULA 3SG5A 1F70A 1UWOA 1XA5A 2KAYA 1IG5A 3BUOB 3DVJA 2WC8A 4L9MA 2FCDA 2KHNA 1WLMA 2Q4UA 4JWQA 2KI6D 1CDLA 1BF5A 5AFPA 1NPQA 1DGVA 1HT9A 3PN7B 1J7QA 1B8LA 2KGRA 2OTGB 3LLEA 4PCWA 1CB1A 4R1EA 2JT8A 1CMFA 4OCIA 1FW4A 1BR4B 2KDHA 4ORCB 2KGBC 5CSNA 5BPJA 1KFUL 4HREE 2PMYA 4PHNA 1S6IA 1UHIA 2Y1NA 1J1DA 2BCXA 2L2EA 1Y1UA 1ALWA 5CSFA 1NCXA 2JWWA 4GPLB 2NXQA 2WCFA 2DOQA 1E8AA 1B9AA 3AKAA 1F54A 3EK4A 2O60A 1QLKA 2PALA 3BOWB 4I5LB 1MHOA 1S6JA 1RFJA 2D8NA 3CS1A 2L4IA 5G08A 3TS5C 4AOMA 1YRUB 1UHNA 4N1GA 1NP8A 4GBAA 1F71A 2WORA 1XK4C 1OZSA 1TOPA 1B1GA 1KK7Z 1XFXO 3D0YA 1AP4A 4NDBA 4NQGA 3DF0A 3NSLA 1L2OB 2PSRA 5D69A 2SASA 2LVJA 2OPOA 2JQ6A 3EKHA 1PVAA 1L7ZA 4MZLA 1KCYA 2FJUB 4GAOA 1JF0A 2BKIB 3IQQA 2LNKA 2M1UA 4CFQA 2K7OA 1K96A 1OMRA 2LLSA 1NX3A 3KO0A 3NXAA 4MRXA 4Q04A 2LE9B 1CFPA 4C0JA 1IRJA 1W7JB 1TCOB 1CMGA 2FCEA 3VRRA 3GOFA 2MA2A 2NCOA 5D7FA 3I5IB 1K94A 2LMUA 1MR8A 2EC6B 5ER4X 1SR6C 1AJ4A 3WHUB 1B47A 1OZOA 1PSRA 2CXJA 3LK0A 1JC2A 2KI6C 2SCPA 3LL8B 3CR4X 3SG6A 4XYNA 4TNCA 1GJYA 3VGOA 3VRQA 4PE7A 1RECA 3QRXA 1A03A 1XVJA 2L0PA 3GK1A 3I5GB 2COLB 3KPXA 3NSIA 1WDCC 1V1FA 5HLOA 1K2HA 1BMOA 2MRDA 2V53A 1MWNA 1KWOB 1XFWO 1TNXA 4GGNA 2F2OA 3SIBA 1B4CA 1S3PA 2KNEA 4I5NB 3PM8A 2JT3A 4I5JA 1F4QA 3VRNA 1RK9A 3ZWHA 1LVCD 1K9UA 3TUYC 2LVIA 2M97A 2KQ6A 2JNFA 4MEWA 1YRTB 1NX0A 3WXAA 1CDMA 1K9KA 1S5GY 4D1EA 5AANA 5ER5A 1PALA 4BY4A 1XFZO 3SJSA 4QJ4B 4YGAA 2KAXA 2O5GA 2F3ZA 1FF1A 1SYMA 1AJ5A 3SG7A 1QV0A 1ZOTB 3H4SE 4HRGA 2K61A 2MAZA 1PK0D 1SW8A 3GK4X 5HLVA 4GFTA 5HKWA 5I2LA 1PVBA 3AKBA 3JVTC 1N0YA 1WRLA 1H4BA 1J7RA 1M63B 3K21A 2KFHA 3TDZA 1YTZC 5AEQA 3DVEA 1UHKA 1BR1B 4PE4A 4C0KA 2LMTA 1A2XA 1UHJA 5I2OA 1FBVA 2F8PA 4DUQA 1CM1A 2LV7A 1N2DA 2LC5A 2JRFA 2LVKA 1WY9A 4JPZB 5KSZA 3DD4A 3O78A 1J7OA 1J7PA 1UUSA 2KYCA 3FIAA 1FI5A 1OOJA 2L4HA 2I18A 5AERA 5TNCA 1DJZA 4PALA 3BYAA 3JTDB 1EJ3A 3OX6A 2HQ8A 4CPVA 1BOCA 3CGAA 2OS8B 1YUUA 5DKRA 3CR5X 1SK6D 1RTP1 5K89A 5I2QA 5JJGA 1GGWA 3I5FB 3AAKA 2NZ0A 3FWCA 1QX2A 1C07A 1IJ6A 3KF9A 1DJGA 1A29A 1KQMC 2H61C 2B1UA 5CPVA 2GGMA 4PHKA 1QS7A 1N65A 3EK8A 1NX2A 4P5OE 1SMGA 2Y1MA 1J55A 3IF7A 1K93D 3BUNB 1QATA 1TCFA 1UHHA 3I5IC 2L5XB 1SKTA 1SL7A 2K0JA 2L50A 2IS9A 5GQQC 2AMIA 3RLZA 1MF8B 2ZNDA 2CTNA 2F3YA 1DT7B 1YR5A 1MQ1A 3FS7A 2JPTA 3OP0A 4BY5A 1S6CA 1IQ3A 4USLA 1QIVA 3D0YB 4MLWA 1DJYA 1Y6WA 2MBXA 1IJ5A 1WDCB 1SPYA 2LMVA 1QX7A 2QPTA 3CZTX 3GK2A 4PE1A 2QACA 2BBNA 2M3WA 3OB2B 3VROA 1SNLA 2NLNA 3A8RA 2Y4QA 2KFGA 1OMVA 5KU1A 5AXIA 1AUIB 2M7NA 2LP3A 1K9PA 3TUYB 3ZNIA 3SG2A 2PVBA 2BL0B 3E3RA 1GQMA 2MJWB 2JC2A 1S1EA 1B8RA 4XJKB 1KK8C 2BCAA 1WLZA 2Q91A 1MXEA 2I2RE 1SCMC 1U5IB 1OE9B 2CNPA 4PE0A 2JT0A 4UPGA 2KAVA 1Y1XA 4E68A 2BE6A 2KYFA 3PATA 2M29A 2JTZA 1AVSA 4N5XA 3NSKA 4YGBB 3JVTB 1EH2A 1D1OA 2K2AA 1DVIA 1DJXA 1TIZA 1KFXL 1NYAA 4PHJA 1IKUA 1YUSA 2GV5A 4NDCA 2K8MB 1YURA 1CLBA 3SG4A 1YUTA 1QASA 2M7LA 2MHHA 1U5IA 2LLUA 1SCVA 2JTTA 3LCPC 4PHMA 1CDNA 1NSHA 1LKJA 1ALVA 3KEVA 4XJKA 1K8UA 1ZACA 3DVMA 1JUOA 4AQIA 2KI4B 1Y1AA 1YX7A 1DGUA 3CR2A 1LINA 1PRWA 2BECA 3D10A 1EXRA 2H61A 2OTGC 2A4JA 2ZRTA 4CIDA 5HKYA 5IBWA 1GGZA 2CCMA 1K95A 2OS8C 5B8IB 1PULA 4GGFA 2G2BA 2I7AA 2ZN8A 1QTXA 1TRFA 2CBLA 3F45A 5J3XA 3I5FC 1AHRA 2L98A 4NDDA 4QJ3B 4ICBA 1M45A 1CTRA 1QXPA 4IL1A 1M39A 2F2PA 2LUCA 3LK1A 2VRGA 2WNDA 3CWGA 2AAOA 2JU0A 2M1KB 1KK7Y 2BCBA 3BUMB 4GGFC 1Y0VH 3FWBA 1J1EA 4P2YB 4DS7A 1HQVA 4MSPA 2HF5A 1KSMA 1KQVA 1CFDA 1IWQA 1CLMA 1XO5A 2WCEA 5FYXA 2E30A 3I5HB 3OHMB 1BG1A 1IGVA 3TS5B 3M0WA 1NX1A 4OKHA 1UP5A 5PALA 1ZFSA 1DF0B 2FOTA 2M8UA 2EC6C 2PRUA 1SRAA 3HCMA 4C0LA 2E6WA 1BT6A 3CTNA 2ZNEA 1L2OC 1CFCA 1M31A 3EVVA 4F0ZB 2TN4A 1JBAA 1DJIA 4MRYA 5DKNA 3BUXB 1R2UA 2P6BB 4YBHB 1AK8A 1H8BA 1KWOC 1JWDA 1XFYO 2LANA 2LUXA 4WQ3A 5JOLA 1TN4A 1KK8B 4YI8A 3BUWB 2KBIA 4I5KA 1TNWA 1XYDA 3HX4A 3O4YA 1G4YR 1NCYA 1JF2A 4GUKA 1XFVO 1DJWA 1C7VA 2JZIA 1CKKA 4FTGA 1LXFC 2ZKMX 1QX5B 2WCBA 2KQYA 2MLEC 2LAPA 3I5GC 4HSZA 2EHBA 2M0RA 1EG3A 2JOJA 3DF0B 1S5GZ 3CLNA 1DMOA 1M46A 1S36A 1F8HA 1SBJA 1TTXA 2ZFDA 3WHTB 4HRHA 2JXCA 1KFUS 4OR9B 2ISDA 4A4BA 4AQJA 4M2QA 1W7IB 3A4UB 4N1FA 1ZMZA 4PDZA 3VRPA 3SG3A 1S26D 2KSPA 2KI4C
chains in the Genus database with same CATH superfamily
1QVIY 1LA3A 1BJFA 2Y5IA 1XFUO 1SL8A 2LM5A 3EKJA 1RWYA 3WNXB 3CABA 2I94A 1MXLC 2WOSA 1KFXS 3R72A 1TNPA 2ZRSA 4ORAB 1ODBA 1LA0A 1TUJA 4JQ0D 1SY9A 2WCLA 4YGDB 3IVTA 3L4LA 1Q80A 4MZKA 1ZUZA 1CDPA 1DEKA 2EGDA 1OMDA 2HQWA 3EVRA 3PN7C 3C1VA 2M9GA 1BLQA 2PASA 1DTLA 1JFKA 3JTDC 3O6BA 1PSBA 1WRKA 4WQ2A 4DCKA 3BXKA 2G9BA 2YGUA 1WRZA 5HYDA 3NSOA 1RROA 1SL9A 4DRWA 2GGZA 4FQOA 4MN0A 1MUXA 2H2KA 2LLTA 5DKQA 2HPSA 4YGEB 4U8DA 3D77A 2NCPA 2AUCA 3OB1B 2LVVA 1IH0A 1G8IA 2HETA 2BE4A 1F4OA 1KSOA 3PALA 4CLNA 1BU3A 1DF0A 3DXLA 3I5HC 3PSRA 1CFFA 3SIAA 3EVUA 4INWA 2M49B 3O2PA 4MBEA 4OV2A 4PT1A 1R6PA 3PFVA 2MLFC 3OX5A 1EG4A 1RJVA 4ZCVA 1FI6A 2LHIA 1BODA 3BQ3A 5CSJA 1YVHA 3TDIA 1A4PA 2K7BA 1A75B 1NWDA 1OSAA 5D3OA 3RM1A 1T14A 2JNXA 3CDNA 3KHEA 1X02A 3DVKA 1KQMB 3PLFB 2LCPA 3BJHA 5HKZA 1JSAA 4QJ5B 4DIRA 2JXLA 3AAJA 5F6TA 3N7HA 4M2PA 1B7TY 1VRKA 1QVIZ 1NUBA 1TNQA 1CFPA 3CZ0A 4ORBB 5I8NA 1EL4A 3BOWA 5KTYA 1V1GA 2LHLA 3EK7A 2KOTA 4MVFA 3TDUA 3IQOA 1NIWA 1YX8A 2R2IA 2LP2A 4ZCUA 1F55A 1K90D 2BL0C 2WCKA 4YGCB 1QIWA 2K7DA 1NCZA 2K7CA 1FPWA 4YI9A 3MSEB 4YRUA 1C7WA 1DJHA 1UURA 1OOHA 2L51A 2WCJA 4CFRA 4GNKB 1YVLA 2KFFA 5CSIA 4M2OA 1QWVA 1SR6B 1QLSA 1SCMB 2BKHB 2CT9A 1B7TZ 2RGIA 1JFJA 1CM4A 1XK4A 2ZN9A 2F33A 2K2FA 1IQ5A 2P70A 4MZJA 3FE8A 1QJTA 4A4CA 3ICBA 1CNPA 2BBMA 4WRIA 1QV1A 1A75A 3S0EA 3SS4A 4JKTA 2KBMA 3D75A 1OQPA 4ETOA 1B8CA 4OVNF 1CLLA 3TZ1A 1G33A 2JULA 3SG5A 1F70A 1UWOA 1XA5A 2KAYA 1IG5A 2PYQA 3BUOB 3DVJA 2WC8A 2WCMA 2FCDA 4L9MA 2KHNA 1WLMA 2Q4UA 4JWQA 2KI6D 1CDLA 1BF5A 5AFPA 1NPQA 1DGVA 1HT9A 3PN7B 1J7QA 1B8LA 2KGRA 2OTGB 3LLEA 4PCWA 1CB1A 4R1EA 2JT8A 1CMFA 2QEOA 4OCIA 1FW4A 1BR4B 2KDHA 4ORCB 2KGBC 5CSNA 5BPJA 1KFUL 4HREE 2PMYA 4PHNA 1S6IA 1UHIA 2Y1NA 1J1DA 1Z2CB 3FE6A 2BCXA 2L2EA 1Y1UA 1ALWA 5FI2A 5CSFA 1NCXA 2JWWA 4GPLB 2NXQA 2WCFA 2DOQA 1E8AA 1B9AA 3AKAA 1F54A 3EK4A 2O60A 1QLKA 2PALA 3S0BA 3BOWB 4I5LB 1MHOA 3L47A 1S6JA 1RFJA 2D8NA 3CS1A 2L4IA 5G08A 3TS5C 4AOMA 1YRUB 1UHNA 4N1GA 1XFRA 2ERBA 1NP8A 4GBAA 1F71A 2WORA 1XK4C 1OZSA 1TOPA 1B1GA 5EL2A 3QMEA 1KK7Z 1XFXO 3D0YA 3D74A 1AP4A 4NDBA 4NQGA 3DF0A 3NSLA 1L2OB 2PSRA 5D69A 1DQEA 2SASA 2LVJA 2K60A 2OPOA 2JQ6A 3B7AA 3EKHA 1PVAA 1L7ZA 2PQLA 4MZLA 1KCYA 2QEHA 2FJUB 4GAOA 1JF0A 2BKIB 3IQQA 2LNKA 2M1UA 4CFQA 2K7OA 1K96A 1OMRA 2LLSA 1NX3A 3KO0A 3NXAA 4MRXA 4Q04A 2LE9B 4F7FA 4C0JA 1IRJA 1W7JB 1TCOB 2JPOA 2FCEA 3VRRA 3GOFA 3NGVA 2MA2A 2NCOA 5D7FA 3I5IB 1K94A 2LMUA 1MR8A 2EC6B 5ER4X 1SR6C 3S0GA 1AJ4A 3WHUB 1B47A 1OZOA 1PSRA 2CXJA 3LK0A 1JC2A 2KI6C 2SCPA 3LL8B 3CR4X 3SG6A 4IJ7A 4XYNA 4TNCA 1GJYA 2KLEA 3VGOA 3VRQA 4PE7A 1RECA 3QRXA 1A03A 1XVJA 2L0PA 3GK1A 3I5GB 2COLB 3KPXA 3NSIA 1P28A 1WDCC 3NHIA 1V1FA 2H8VA 5HLOA 1K2HA 1BMOA 2MRDA 2BAPA 1MWNA 2V53A 1KWOB 1XFWO 1TNXA 4GGNA 2F2OA 3SIBA 1B4CA 1S3PA 4INXA 2KNEA 4I5NB 3PM8A 2JT3A 4I5JA 1F4QA 3VRNA 1LS8A 1RK9A 3ZWHA 1LVCD 1K9UA 3TUYC 2LVIA 3RZSA 2M97A 2KQ6A 2JNFA 3L4AA 3VB1A 4MEWA 3UNWA 1YRTB 1NX0A 3WXAA 1CDMA 3OBVA 4KYNA 1K9KA 1S5GY 4D1EA 5AANA 5ER5A 3D78A 1PALA 4BY4A 1XFZO 3SJSA 4QJ4B 3B87A 4YGAA 2KAXA 2O5GA 2F3ZA 1FF1A 1SYMA 1AJ5A 3FE9A 3SG7A 1QV0A 1ZOTB 3H4SE 4HRGA 2K61A 2MAZA 1PK0D 1SW8A 3GK4X 5HLVA 4GFTA 5HKWA 5I2LA 1PVBA 3AKBA 3JVTC 1N0YA 1WRLA 3S0FA 1H4BA 1J7RA 1TUZA 1M63B 3K21A 2KFHA 3TDZA 1YTZC 3R1PA 3DVEA 5AEQA 4OZDA 1UHKA 1BR1B 4PE4A 4C0KA 2LMTA 1A2XA 1UHJA 2QEVA 5I2OA 3BFHA 1FBVA 2F8PA 3UO9A 4DUQA 1CM1A 2LV7A 1N2DA 2LC5A 2JRFA 2FJYA 1WY9A 2LVKA 4JPZB 5KSZA 1W9ZA 3DD4A 3O78A 1J7OA 1J7PA 1UUSA 2KYCA 3FIAA 3K1EA 1FI5A 1OOJA 2L4HA 2I18A 5AERA 5TNCA 1DJZA 4PALA 3BYAA 3JTDB 1EJ3A 3OX6A 2HQ8A 4CPVA 1BOCA 3CGAA 2OS8B 1YUUA 5DKRA 3CR5X 1SK6D 1RTP1 5K89A 5I2QA 5JJGA 1GGWA 3I5FB 3AAKA 2NZ0A 3FWCA 1QX2A 1C07A 1IJ6A 3KF9A 1DJGA 1A29A 1KQMC 2H61C 2B1UA 2L2CA 2GGMA 5CPVA 4PHKA 1QS7A 1N65A 3SS5A 3EK8A 1NX2A 1SSEB 4P5OE 1C3YA 1SMGA 2Y1MA 1J55A 1OOIX 3IF7A 3B86A 1K93D 3BUNB 1QATA 1TCFA 1UHHA 3I5IC 1C3ZA 1SKTA 1SL7A 2K0JA 2L5XB 3CZ2A 2L50A 2IS9A 5GQQC 2AMIA 3RLZA 1MF8B 1DC1A 2ZNDA 2CTNA 2F3YA 1DT7B 1YR5A 1DELA 1MQ1A 3FS7A 2JPTA 3OP0A 3V2LA 4BY5A 5HL1A 1S6CA 1IQ3A 4USLA 1QIVA 3D0YB 3BFAA 4MLWA 1DJYA 1Y6WA 2MBXA 1IJ5A 1WDCB 1SPYA 5I94A 2LMVA 1QX7A 2QPTA 3CZTX 3GK2A 4PE1A 5FI7A 2QACA 2BBNA 2M3WA 3OB2B 3VROA 1SNLA 2NLNA 3A8RA 2Y4QA 2KFGA 1OMVA 5KU1A 5AXIA 1AUIB 2M7NA 2LP3A 1K9PA 3TUYB 1OOFA 3ZNIA 3SG2A 2PVBA 1Z4HA 2BL0B 3E3RA 1GQMA 2MJWB 3R1VA 2JC2A 1S1EA 1B8RA 4XJKB 1KK8C 2BCAA 1WLZA 2Q91A 1MXEA 2WC6A 3CZ1A 2I2RE 1SCMC 3EG5B 1U5IB 3BFBA 1OE9B 2CNPA 3CYZA 4PE0A 2JT0A 4UPGA 2KAVA 1Y1XA 4E68A 1ORGA 2BE6A 2KYFA 3PATA 2M29A 3O4XA 2JTZA 1AVSA 2KLDA 4N5XA 3B6XA 3NSKA 4YGBB 3JVTB 1EH2A 2WC5A 1D1OA 2K2AA 1DVIA 1DJXA 1TIZA 1KFXL 1NYAA 4FQTA 4PHJA 1IKUA 1YUSA 2GV5A 4NDCA 4JD9A 2K8MB 1YURA 1CLBA 3SG4A 1YUTA 1QASA 2M7LA 2MHHA 1U5IA 2LLUA 1SCVA 2JTTA 3LCPC 4PHMA 1CDNA 2BNXA 1NSHA 1LKJA 1ALVA 3KEVA 5FI6A 4XJKA 1K8UA 1ZACA 3DVMA 1JUOA 4AQIA 2KI4B 1Y1AA 1YX7A 1DGUA 3CR2A 1LINA 1PRWA 2BECA 3PM2A 3D10A 1EXRA 2H61A 2OTGC 2A4JA 2ZRTA 4CIDA 5HKYA 5IBWA 1GGZA 2CCMA 1K95A 2OS8C 5B8IB 1PULA 4GGFA 2G2BA 2I7AA 2ZN8A 1QTXA 1TRFA 2CBLA 3F45A 5J3XA 1CMGA 3I5FC 1AHRA 2L98A 4NDDA 3DYEA 4QJ3B 1OOGA 4ICBA 1M45A 1CTRA 1QXPA 4IL1A 1M39A 2F2PA 2LUCA 3LK1A 2VRGA 2WNDA 3CWGA 2AAOA 2JU0A 2M1KB 1KK7Y 2BCBA 3BUMB 3OGNA 4GGFC 1Y0VH 3D76A 3FWBA 1J1EA 4P2YB 4DS7A 1HQVA 4MSPA 2HF5A 1KSMA 3B88A 1KQVA 1CFDA 1IWQA 1CLMA 1XO5A 3PJIA 2WCEA 5FYXA 2GTEA 2E30A 3I5HB 3OHMB 1BG1A 1IGVA 3TS5B 3M0WA 1NX1A 4OKHA 1UP5A 5PALA 1ZFSA 1DF0B 2QDIA 2FOTA 2M8UA 2EC6C 2PRUA 1OW4A 1SRAA 3HCMA 4C0LA 2E6WA 1BT6A 3CTNA 2ZNEA 1L2OC 1CFCA 1M31A 3EVVA 4F0ZB 3NHTA 2TN4A 1JBAA 1DJIA 4MRYA 3S0AA 5DKNA 3BUXB 2P71A 3S0DA 3DY9A 1GM0A 1R2UA 2P6BB 4YBHB 1AK8A 1H8BA 3D73A 1KWOC 1JWDA 1XFYO 2LANA 2LUXA 4WQ3A 5JOLA 1TN4A 1KK8B 4YI8A 3BUWB 2KBIA 4I5KA 1TNWA 1XYDA 3HX4A 3O4YA 1G4YR 1NCYA 1JF2A 4GUKA 1XFVO 1DJWA 2KPHA 2JZIA 2QEBA 1C7VA 3SS3A 4FTGA 2L5YA 1CKKA 1LXFC 2ZKMX 1QX5B 2WCBA 5DICA 2KQYA 2MLEC 2LAPA 3I5GC 4HSZA 2EHBA 2M0RA 1EG3A 2JOJA 3DF0B 1S5GZ 3CLNA 1DMOA 1M46A 1S36A 3DZTA 1SBJA 1F8HA 1TTXA 2ZFDA 2WCHA 4HRHA 3WHTB 2JXCA 1IIOA 3R1OA 1KFUS 4OR9B 2ISDA 4A4BA 1TWOA 4AQJA 4M2QA 1W7IB 3A4UB 4N1FA 1ZMZA 4PDZA 3VRPA 3SG3A 1S26D 2KSPA 2KI4C 3Q8IA
chains in the Genus database with same CATH topology
1QVIY 1LA3A 1BJFA 2Y5IA 1XFUO 1SL8A 2LM5A 3EKJA 1RWYA 3WNXB 2I94A 1MXLC 2WOSA 1KFXS 1TNPA 2ZRSA 4ORAB 1ODBA 1LA0A 4JQ0D 1SY9A 4YGDB 1Q80A 4MZKA 1ZUZA 1CDPA 2EGDA 1OMDA 2HQWA 3EVRA 3PN7C 3C1VA 2M9GA 1BLQA 2PASA 1DTLA 1JFKA 3JTDC 3O6BA 1PSBA 1WRKA 4WQ2A 4DCKA 3BXKA 2G9BA 1WRZA 5HYDA 3NSOA 1RROA 1SL9A 4DRWA 2GGZA 4FQOA 4MN0A 1MUXA 2H2KA 2LLTA 5DKQA 2HPSA 4YGEB 4U8DA 2NCPA 2AUCA 3OB1B 2LVVA 1IH0A 1G8IA 2HETA 2BE4A 1F4OA 1KSOA 3PALA 4CLNA 1BU3A 1DF0A 3I5HC 3PSRA 1CFFA 3SIAA 3EVUA 2M49B 3O2PA 4MBEA 4OV2A 1R6PA 3PFVA 2MLFC 3OX5A 1EG4A 1RJVA 4ZCVA 1FI6A 2LHIA 1BODA 3BQ3A 5CSJA 1YVHA 3TDIA 1A4PA 2K7BA 1A75B 1NWDA 1OSAA 3RM1A 2JNXA 3KHEA 1X02A 3DVKA 1KQMB 3PLFB 2LCPA 5HKZA 1JSAA 4QJ5B 4DIRA 2JXLA 3AAJA 5F6TA 4M2PA 1B7TY 1VRKA 1QVIZ 1NUBA 1TNQA 4ORBB 5I8NA 1EL4A 3BOWA 5KTYA 1V1GA 2LHLA 3EK7A 2KOTA 4MVFA 3TDUA 3IQOA 1NIWA 1YX8A 2R2IA 2LP2A 4ZCUA 1F55A 1K90D 2BL0C 4YGCB 1QIWA 2K7DA 1NCZA 2K7CA 1FPWA 4YI9A 3MSEB 4YRUA 1C7WA 1DJHA 1UURA 4CFRA 2L51A 4GNKB 1YVLA 2KFFA 5CSIA 4M2OA 1SR6B 2CT9A 1QLSA 1SCMB 2BKHB 1B7TZ 2RGIA 1JFJA 1CM4A 1XK4A 2ZN9A 2F33A 2K2FA 1IQ5A 4MZJA 1QJTA 4A4CA 3ICBA 1CNPA 2BBMA 4WRIA 1QV1A 1A75A 2KBMA 1OQPA 4ETOA 1B8CA 4OVNF 1CLLA 3TZ1A 1G33A 2JULA 3SG5A 1F70A 1UWOA 1XA5A 2KAYA 1IG5A 3BUOB 3DVJA 2WC8A 4L9MA 2FCDA 2KHNA 1WLMA 2Q4UA 4JWQA 2KI6D 1CDLA 1BF5A 5AFPA 1NPQA 1DGVA 1HT9A 3PN7B 1J7QA 1B8LA 2KGRA 2OTGB 3LLEA 4PCWA 1CB1A 4R1EA 2JT8A 1CMFA 4OCIA 1FW4A 1BR4B 2KDHA 4ORCB 2KGBC 5CSNA 5BPJA 1KFUL 4HREE 2PMYA 4PHNA 1S6IA 1UHIA 2Y1NA 1J1DA 2BCXA 2L2EA 1Y1UA 1ALWA 5CSFA 1NCXA 2JWWA 4GPLB 2NXQA 2WCFA 2DOQA 1E8AA 1B9AA 3AKAA 1F54A 3EK4A 2O60A 1QLKA 2PALA 3BOWB 4I5LB 1MHOA 1S6JA 1RFJA 2D8NA 3CS1A 2L4IA 5G08A 3TS5C 4AOMA 1YRUB 1UHNA 4N1GA 1NP8A 4GBAA 1F71A 2WORA 1XK4C 1OZSA 1TOPA 1B1GA 1KK7Z 1XFXO 3D0YA 1AP4A 4NDBA 4NQGA 3DF0A 3NSLA 1L2OB 2PSRA 5D69A 2SASA 2LVJA 2OPOA 2JQ6A 3EKHA 1PVAA 1L7ZA 4MZLA 1KCYA 2FJUB 4GAOA 1JF0A 2BKIB 3IQQA 2LNKA 2M1UA 4CFQA 2K7OA 1K96A 1OMRA 2LLSA 1NX3A 3KO0A 3NXAA 4MRXA 4Q04A 2LE9B 1CFPA 4C0JA 1IRJA 1W7JB 1TCOB 1CMGA 2FCEA 3VRRA 3GOFA 2MA2A 2NCOA 5D7FA 3I5IB 1K94A 2LMUA 1MR8A 2EC6B 5ER4X 1SR6C 1AJ4A 3WHUB 1B47A 1OZOA 1PSRA 2CXJA 3LK0A 1JC2A 2KI6C 2SCPA 3LL8B 3CR4X 3SG6A 4XYNA 4TNCA 1GJYA 3VGOA 3VRQA 4PE7A 1RECA 3QRXA 1A03A 1XVJA 2L0PA 3GK1A 3I5GB 2COLB 3KPXA 3NSIA 1WDCC 1V1FA 5HLOA 1K2HA 1BMOA 2MRDA 2V53A 1MWNA 1KWOB 1XFWO 1TNXA 4GGNA 2F2OA 3SIBA 1B4CA 1S3PA 2KNEA 4I5NB 3PM8A 2JT3A 4I5JA 1F4QA 3VRNA 1RK9A 3ZWHA 1LVCD 1K9UA 3TUYC 2LVIA 2M97A 2KQ6A 2JNFA 4MEWA 1YRTB 1NX0A 3WXAA 1CDMA 1K9KA 1S5GY 4D1EA 5AANA 5ER5A 1PALA 4BY4A 1XFZO 3SJSA 4QJ4B 4YGAA 2KAXA 2O5GA 2F3ZA 1FF1A 1SYMA 1AJ5A 3SG7A 1QV0A 1ZOTB 3H4SE 4HRGA 2K61A 2MAZA 1PK0D 1SW8A 3GK4X 5HLVA 4GFTA 5HKWA 5I2LA 1PVBA 3AKBA 3JVTC 1N0YA 1WRLA 1H4BA 1J7RA 1M63B 3K21A 2KFHA 3TDZA 1YTZC 5AEQA 3DVEA 1UHKA 1BR1B 4PE4A 4C0KA 2LMTA 1A2XA 1UHJA 5I2OA 1FBVA 2F8PA 4DUQA 1CM1A 2LV7A 1N2DA 2LC5A 2JRFA 2LVKA 1WY9A 4JPZB 5KSZA 3DD4A 3O78A 1J7OA 1J7PA 1UUSA 2KYCA 3FIAA 1FI5A 1OOJA 2L4HA 2I18A 5AERA 5TNCA 1DJZA 4PALA 3BYAA 3JTDB 1EJ3A 3OX6A 2HQ8A 4CPVA 1BOCA 3CGAA 2OS8B 1YUUA 5DKRA 3CR5X 1SK6D 1RTP1 5K89A 5I2QA 5JJGA 1GGWA 3I5FB 3AAKA 2NZ0A 3FWCA 1QX2A 1C07A 1IJ6A 3KF9A 1DJGA 1A29A 1KQMC 2H61C 2B1UA 5CPVA 2GGMA 4PHKA 1QS7A 1N65A 3EK8A 1NX2A 4P5OE 1SMGA 2Y1MA 1J55A 3IF7A 1K93D 3BUNB 1QATA 1TCFA 1UHHA 3I5IC 2L5XB 1SKTA 1SL7A 2K0JA 2L50A 2IS9A 5GQQC 2AMIA 3RLZA 1MF8B 2ZNDA 2CTNA 2F3YA 1DT7B 1YR5A 1MQ1A 3FS7A 2JPTA 3OP0A 4BY5A 1S6CA 1IQ3A 4USLA 1QIVA 3D0YB 4MLWA 1DJYA 1Y6WA 2MBXA 1IJ5A 1WDCB 1SPYA 2LMVA 1QX7A 2QPTA 3CZTX 3GK2A 4PE1A 2QACA 2BBNA 2M3WA 3OB2B 3VROA 1SNLA 2NLNA 3A8RA 2Y4QA 2KFGA 1OMVA 5KU1A 5AXIA 1AUIB 2M7NA 2LP3A 1K9PA 3TUYB 3ZNIA 3SG2A 2PVBA 2BL0B 3E3RA 1GQMA 2MJWB 2JC2A 1S1EA 1B8RA 4XJKB 1KK8C 2BCAA 1WLZA 2Q91A 1MXEA 2I2RE 1SCMC 1U5IB 1OE9B 2CNPA 4PE0A 2JT0A 4UPGA 2KAVA 1Y1XA 4E68A 2BE6A 2KYFA 3PATA 2M29A 2JTZA 1AVSA 4N5XA 3NSKA 4YGBB 3JVTB 1EH2A 1D1OA 2K2AA 1DVIA 1DJXA 1TIZA 1KFXL 1NYAA 4PHJA 1IKUA 1YUSA 2GV5A 4NDCA 2K8MB 1YURA 1CLBA 3SG4A 1YUTA 1QASA 2M7LA 2MHHA 1U5IA 2LLUA 1SCVA 2JTTA 3LCPC 4PHMA 1CDNA 1NSHA 1LKJA 1ALVA 3KEVA 4XJKA 1K8UA 1ZACA 3DVMA 1JUOA 4AQIA 2KI4B 1Y1AA 1YX7A 1DGUA 3CR2A 1LINA 1PRWA 2BECA 3D10A 1EXRA 2H61A 2OTGC 2A4JA 2ZRTA 4CIDA 5HKYA 5IBWA 1GGZA 2CCMA 1K95A 2OS8C 5B8IB 1PULA 4GGFA 2G2BA 2I7AA 2ZN8A 1QTXA 1TRFA 2CBLA 3F45A 5J3XA 3I5FC 1AHRA 2L98A 4NDDA 4QJ3B 4ICBA 1M45A 1CTRA 1QXPA 4IL1A 1M39A 2F2PA 2LUCA 3LK1A 2VRGA 2WNDA 3CWGA 2AAOA 2JU0A 2M1KB 1KK7Y 2BCBA 3BUMB 4GGFC 1Y0VH 3FWBA 1J1EA 4P2YB 4DS7A 1HQVA 4MSPA 2HF5A 1KSMA 1KQVA 1CFDA 1IWQA 1CLMA 1XO5A 2WCEA 5FYXA 2E30A 3I5HB 3OHMB 1BG1A 1IGVA 3TS5B 3M0WA 1NX1A 4OKHA 1UP5A 5PALA 1ZFSA 1DF0B 2FOTA 2M8UA 2EC6C 2PRUA 1SRAA 3HCMA 4C0LA 2E6WA 1BT6A 3CTNA 2ZNEA 1L2OC 1CFCA 1M31A 3EVVA 4F0ZB 2TN4A 1JBAA 1DJIA 4MRYA 5DKNA 3BUXB 1R2UA 2P6BB 4YBHB 1AK8A 1H8BA 1KWOC 1JWDA 1XFYO 2LANA 2LUXA 4WQ3A 5JOLA 1TN4A 1KK8B 4YI8A 3BUWB 2KBIA 4I5KA 1TNWA 1XYDA 3HX4A 3O4YA 1G4YR 1NCYA 1JF2A 4GUKA 1XFVO 1DJWA 1C7VA 2JZIA 1CKKA 4FTGA 1LXFC 2ZKMX 1QX5B 2WCBA 2KQYA 2MLEC 2LAPA 3I5GC 4HSZA 2EHBA 2M0RA 1EG3A 2JOJA 3DF0B 1S5GZ 3CLNA 1DMOA 1M46A 1S36A 1F8HA 1SBJA 1TTXA 2ZFDA 3WHTB 4HRHA 2JXCA 1KFUS 4OR9B 2ISDA 4A4BA 4AQJA 4M2QA 1W7IB 3A4UB 4N1FA 1ZMZA 4PDZA 3VRPA 3SG3A 1S26D 2KSPA 2KI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVI Y;  1LA3 A;  1BJF A;  2Y5I A;  1XFU O;  1SL8 A;  2LM5 A;  3EKJ A;  1RWY A;  3WNX B;  2I94 A;  1MXL C;  2WOS A;  1KFX S;  1TNP A;  2ZRS A;  4ORA B;  1ODB A;  1LA0 A;  4JQ0 D;  1SY9 A;  4YGD B;  1Q80 A;  4MZK A;  1ZUZ A;  1CDP A;  2EGD A;  1OMD A;  2HQW A;  3EVR A;  3PN7 C;  3C1V A;  2M9G A;  1BLQ A;  2PAS A;  1DTL A;  1JFK A;  3JTD C;  3O6B A;  1PSB A;  1WRK A;  4WQ2 A;  4DCK A;  3BXK A;  2G9B A;  1WRZ A;  5HYD A;  3NSO A;  1RRO A;  1SL9 A;  4DRW A;  2GGZ A;  4FQO A;  4MN0 A;  1MUX A;  2H2K A;  2LLT A;  5DKQ A;  2HPS A;  4YGE B;  4U8D A;  2NCP A;  2AUC A;  3OB1 B;  2LVV A;  1IH0 A;  1G8I A;  2HET A;  2BE4 A;  1F4O A;  1KSO A;  3PAL A;  4CLN A;  1BU3 A;  1DF0 A;  3I5H C;  3PSR A;  1CFF A;  3SIA A;  3EVU A;  2M49 B;  3O2P A;  4MBE A;  4OV2 A;  1R6P A;  3PFV A;  2MLF C;  3OX5 A;  1EG4 A;  1RJV A;  4ZCV A;  1FI6 A;  2LHI A;  1BOD A;  3BQ3 A;  5CSJ A;  1YVH A;  3TDI A;  1A4P A;  2K7B A;  1A75 B;  1NWD A;  1OSA A;  3RM1 A;  2JNX A;  3KHE A;  1X02 A;  3DVK A;  1KQM B;  3PLF B;  2LCP A;  5HKZ A;  1JSA A;  4QJ5 B;  4DIR A;  2JXL A;  3AAJ A;  5F6T A;  4M2P A;  1B7T Y;  1VRK A;  1QVI Z;  1NUB A;  1TNQ A;  4ORB B;  5I8N A;  1EL4 A;  3BOW A;  5KTY A;  1V1G A;  2LHL A;  3EK7 A;  2KOT A;  4MVF A;  3TDU A;  3IQO A;  1NIW A;  1YX8 A;  2R2I A;  2LP2 A;  4ZCU A;  1F55 A;  1K90 D;  2BL0 C;  4YGC B;  1QIW A;  2K7D A;  1NCZ A;  2K7C A;  1FPW A;  4YI9 A;  3MSE B;  4YRU A;  1C7W A;  1DJH A;  1UUR A;  4CFR A;  2L51 A;  4GNK B;  1YVL A;  2KFF A;  5CSI A;  4M2O A;  1SR6 B;  2CT9 A;  1QLS A;  1SCM B;  2BKH B;  1B7T Z;  2RGI A;  1JFJ A;  1CM4 A;  1XK4 A;  2ZN9 A;  2F33 A;  2K2F A;  1IQ5 A;  4MZJ A;  1QJT A;  4A4C A;  3ICB A;  1CNP A;  2BBM A;  4WRI A;  1QV1 A;  1A75 A;  2KBM A;  1OQP A;  4ETO A;  1B8C A;  4OVN F;  1CLL A;  3TZ1 A;  1G33 A;  2JUL A;  3SG5 A;  1F70 A;  1UWO A;  1XA5 A;  2KAY A;  1IG5 A;  3BUO B;  3DVJ A;  2WC8 A;  4L9M A;  2FCD A;  2KHN A;  1WLM A;  2Q4U A;  4JWQ A;  2KI6 D;  1CDL A;  1BF5 A;  5AFP A;  1NPQ A;  1DGV A;  1HT9 A;  3PN7 B;  1J7Q A;  1B8L A;  2KGR A;  2OTG B;  3LLE A;  4PCW A;  1CB1 A;  4R1E A;  2JT8 A;  1CMF A;  4OCI A;  1FW4 A;  1BR4 B;  2KDH A;  4ORC B;  2KGB C;  5CSN A;  5BPJ A;  1KFU L;  4HRE E;  2PMY A;  4PHN A;  1S6I A;  1UHI A;  2Y1N A;  1J1D A;  2BCX A;  2L2E A;  1Y1U A;  1ALW A;  5CSF A;  1NCX A;  2JWW A;  4GPL B;  2NXQ A;  2WCF A;  2DOQ A;  1E8A A;  1B9A A;  3AKA A;  1F54 A;  3EK4 A;  2O60 A;  1QLK A;  2PAL A;  3BOW B;  4I5L B;  1MHO A;  1S6J A;  1RFJ A;  2D8N A;  3CS1 A;  2L4I A;  5G08 A;  3TS5 C;  4AOM A;  1YRU B;  1UHN A;  4N1G A;  1NP8 A;  4GBA A;  1F71 A;  2WOR A;  1XK4 C;  1OZS A;  1TOP A;  1B1G A;  1KK7 Z;  1XFX O;  3D0Y A;  1AP4 A;  4NDB A;  4NQG A;  3DF0 A;  3NSL A;  1L2O B;  2PSR A;  5D69 A;  2SAS A;  2LVJ A;  2OPO A;  2JQ6 A;  3EKH A;  1PVA A;  1L7Z A;  4MZL A;  1KCY A;  2FJU B;  4GAO A;  1JF0 A;  2BKI B;  3IQQ A;  2LNK A;  2M1U A;  4CFQ A;  2K7O A;  1K96 A;  1OMR A;  2LLS A;  1NX3 A;  3KO0 A;  3NXA A;  4MRX A;  4Q04 A;  2LE9 B;  1CFP A;  4C0J A;  1IRJ A;  1W7J B;  1TCO B;  1CMG A;  2FCE A;  3VRR A;  3GOF A;  2MA2 A;  2NCO A;  5D7F A;  3I5I B;  1K94 A;  2LMU A;  1MR8 A;  2EC6 B;  5ER4 X;  1SR6 C;  1AJ4 A;  3WHU B;  1B47 A;  1OZO A;  1PSR A;  2CXJ A;  3LK0 A;  1JC2 A;  2KI6 C;  2SCP A;  3LL8 B;  3CR4 X;  3SG6 A;  4XYN A;  4TNC A;  1GJY A;  3VGO A;  3VRQ A;  4PE7 A;  1REC A;  3QRX A;  1A03 A;  1XVJ A;  2L0P A;  3GK1 A;  3I5G B;  2COL B;  3KPX A;  3NSI A;  1WDC C;  1V1F A;  5HLO A;  1K2H A;  1BMO A;  2MRD A;  2V53 A;  1MWN A;  1KWO B;  1XFW O;  1TNX A;  4GGN A;  2F2O A;  3SIB A;  1B4C A;  1S3P A;  2KNE A;  4I5N B;  3PM8 A;  2JT3 A;  4I5J A;  1F4Q A;  3VRN A;  1RK9 A;  3ZWH A;  1LVC D;  1K9U A;  3TUY C;  2LVI A;  2M97 A;  2KQ6 A;  2JNF A;  4MEW A;  1YRT B;  1NX0 A;  3WXA A;  1CDM A;  1K9K A;  1S5G Y;  4D1E A;  5AAN A;  5ER5 A;  1PAL A;  4BY4 A;  1XFZ O;  3SJS A;  4QJ4 B;  4YGA A;  2KAX A;  2O5G A;  2F3Z A;  1FF1 A;  1SYM A;  1AJ5 A;  3SG7 A;  1QV0 A;  1ZOT B;  3H4S E;  4HRG A;  2K61 A;  2MAZ A;  1PK0 D;  1SW8 A;  3GK4 X;  5HLV A;  4GFT A;  5HKW A;  5I2L A;  1PVB A;  3AKB A;  3JVT C;  1N0Y A;  1WRL A;  1H4B A;  1J7R A;  1M63 B;  3K21 A;  2KFH A;  3TDZ A;  1YTZ C;  5AEQ A;  3DVE A;  1UHK A;  1BR1 B;  4PE4 A;  4C0K A;  2LMT A;  1A2X A;  1UHJ A;  5I2O A;  1FBV A;  2F8P A;  4DUQ A;  1CM1 A;  2LV7 A;  1N2D A;  2LC5 A;  2JRF A;  2LVK A;  1WY9 A;  4JPZ B;  5KSZ A;  3DD4 A;  3O78 A;  1J7O A;  1J7P A;  1UUS A;  2KYC A;  3FIA A;  1FI5 A;  1OOJ A;  2L4H A;  2I18 A;  5AER A;  5TNC A;  1DJZ A;  4PAL A;  3BYA A;  3JTD B;  1EJ3 A;  3OX6 A;  2HQ8 A;  4CPV A;  1BOC A;  3CGA A;  2OS8 B;  1YUU A;  5DKR A;  3CR5 X;  1SK6 D;  1RTP 1;  5K89 A;  5I2Q A;  5JJG A;  1GGW A;  3I5F B;  3AAK A;  2NZ0 A;  3FWC A;  1QX2 A;  1C07 A;  1IJ6 A;  3KF9 A;  1DJG A;  1A29 A;  1KQM C;  2H61 C;  2B1U A;  5CPV A;  2GGM A;  4PHK A;  1QS7 A;  1N65 A;  3EK8 A;  1NX2 A;  4P5O E;  1SMG A;  2Y1M A;  1J55 A;  3IF7 A;  1K93 D;  3BUN B;  1QAT A;  1TCF A;  1UHH A;  3I5I C;  2L5X B;  1SKT A;  1SL7 A;  2K0J A;  2L50 A;  2IS9 A;  5GQQ C;  2AMI A;  3RLZ A;  1MF8 B;  2ZND A;  2CTN A;  2F3Y A;  1DT7 B;  1YR5 A;  1MQ1 A;  3FS7 A;  2JPT A;  3OP0 A;  4BY5 A;  1S6C A;  1IQ3 A;  4USL A;  1QIV A;  3D0Y B;  4MLW A;  1DJY A;  1Y6W A;  2MBX A;  1IJ5 A;  1WDC B;  1SPY A;  2LMV A;  1QX7 A;  2QPT A;  3CZT X;  3GK2 A;  4PE1 A;  2QAC A;  2BBN A;  2M3W A;  3OB2 B;  3VRO A;  1SNL A;  2NLN A;  3A8R A;  2Y4Q A;  2KFG A;  1OMV A;  5KU1 A;  5AXI A;  1AUI B;  2M7N A;  2LP3 A;  1K9P A;  3TUY B;  3ZNI A;  3SG2 A;  2PVB A;  2BL0 B;  3E3R A;  1GQM A;  2MJW B;  2JC2 A;  1S1E A;  1B8R A;  4XJK B;  1KK8 C;  2BCA A;  1WLZ A;  2Q91 A;  1MXE A;  2I2R E;  1SCM C;  1U5I B;  1OE9 B;  2CNP A;  4PE0 A;  2JT0 A;  4UPG A;  2KAV A;  1Y1X A;  4E68 A;  2BE6 A;  2KYF A;  3PAT A;  2M29 A;  2JTZ A;  1AVS A;  4N5X A;  3NSK A;  4YGB B;  3JVT B;  1EH2 A;  1D1O A;  2K2A A;  1DVI A;  1DJX A;  1TIZ A;  1KFX L;  1NYA A;  4PHJ A;  1IKU A;  1YUS A;  2GV5 A;  4NDC A;  2K8M B;  1YUR A;  1CLB A;  3SG4 A;  1YUT A;  1QAS A;  2M7L A;  2MHH A;  1U5I A;  2LLU A;  1SCV A;  2JTT A;  3LCP C;  4PHM A;  1CDN A;  1NSH A;  1LKJ A;  1ALV A;  3KEV A;  4XJK A;  1K8U A;  1ZAC A;  3DVM A;  1JUO A;  4AQI A;  2KI4 B;  1Y1A A;  1YX7 A;  1DGU A;  3CR2 A;  1LIN A;  1PRW A;  2BEC A;  3D10 A;  1EXR A;  2H61 A;  2OTG C;  2A4J A;  2ZRT A;  4CID A;  5HKY A;  5IBW A;  1GGZ A;  2CCM A;  1K95 A;  2OS8 C;  5B8I B;  1PUL A;  4GGF A;  2G2B A;  2I7A A;  2ZN8 A;  1QTX A;  1TRF A;  2CBL A;  3F45 A;  5J3X A;  3I5F C;  1AHR A;  2L98 A;  4NDD A;  4QJ3 B;  4ICB A;  1M45 A;  1CTR A;  1QXP A;  4IL1 A;  1M39 A;  2F2P A;  2LUC A;  3LK1 A;  2VRG A;  2WND A;  3CWG A;  2AAO A;  2JU0 A;  2M1K B;  1KK7 Y;  2BCB A;  3BUM B;  4GGF C;  1Y0V H;  3FWB A;  1J1E A;  4P2Y B;  4DS7 A;  1HQV A;  4MSP A;  2HF5 A;  1KSM A;  1KQV A;  1CFD A;  1IWQ A;  1CLM A;  1XO5 A;  2WCE A;  5FYX A;  2E30 A;  3I5H B;  3OHM B;  1BG1 A;  1IGV A;  3TS5 B;  3M0W A;  1NX1 A;  4OKH A;  1UP5 A;  5PAL A;  1ZFS A;  1DF0 B;  2FOT A;  2M8U A;  2EC6 C;  2PRU A;  1SRA A;  3HCM A;  4C0L A;  2E6W A;  1BT6 A;  3CTN A;  2ZNE A;  1L2O C;  1CFC A;  1M31 A;  3EVV A;  4F0Z B;  2TN4 A;  1JBA A;  1DJI A;  4MRY A;  5DKN A;  3BUX B;  1R2U A;  2P6B B;  4YBH B;  1AK8 A;  1H8B A;  1KWO C;  1JWD A;  1XFY O;  2LAN A;  2LUX A;  4WQ3 A;  5JOL A;  1TN4 A;  1KK8 B;  4YI8 A;  3BUW B;  2KBI A;  4I5K A;  1TNW A;  1XYD A;  3HX4 A;  3O4Y A;  1G4Y R;  1NCY A;  1JF2 A;  4GUK A;  1XFV O;  1DJW A;  1C7V A;  2JZI A;  1CKK A;  4FTG A;  1LXF C;  2ZKM X;  1QX5 B;  2WCB A;  2KQY A;  2MLE C;  2LAP A;  3I5G C;  4HSZ A;  2EHB A;  2M0R A;  1EG3 A;  2JOJ A;  3DF0 B;  1S5G Z;  3CLN A;  1DMO A;  1M46 A;  1S36 A;  1F8H A;  1SBJ A;  1TTX A;  2ZFD A;  3WHT B;  4HRH A;  2JXC A;  1KFU S;  4OR9 B;  2ISD A;  4A4B A;  4AQJ A;  4M2Q A;  1W7I B;  3A4U B;  4N1F A;  1ZMZ A;  4PDZ A;  3VRP A;  3SG3 A;  1S26 D;  2KSP A;  2KI4 C; 
#chains in the Genus database with same CATH topology
 1QVI Y;  1LA3 A;  1BJF A;  2Y5I A;  1XFU O;  1SL8 A;  2LM5 A;  3EKJ A;  1RWY A;  3WNX B;  3CAB A;  2I94 A;  1MXL C;  2WOS A;  1KFX S;  3R72 A;  1TNP A;  2ZRS A;  4ORA B;  1ODB A;  1LA0 A;  1TUJ A;  4JQ0 D;  1SY9 A;  2WCL A;  4YGD B;  3IVT A;  3L4L A;  1Q80 A;  4MZK A;  1ZUZ A;  1CDP A;  1DEK A;  2EGD A;  1OMD A;  2HQW A;  3EVR A;  3PN7 C;  3C1V A;  2M9G A;  1BLQ A;  2PAS A;  1DTL A;  1JFK A;  3JTD C;  3O6B A;  1PSB A;  1WRK A;  4WQ2 A;  4DCK A;  3BXK A;  2G9B A;  2YGU A;  1WRZ A;  5HYD A;  3NSO A;  1RRO A;  1SL9 A;  4DRW A;  2GGZ A;  4FQO A;  4MN0 A;  1MUX A;  2H2K A;  2LLT A;  5DKQ A;  2HPS A;  4YGE B;  4U8D A;  3D77 A;  2NCP A;  2AUC A;  3OB1 B;  2LVV A;  1IH0 A;  1G8I A;  2HET A;  2BE4 A;  1F4O A;  1KSO A;  3PAL A;  4CLN A;  1BU3 A;  1DF0 A;  3DXL A;  3I5H C;  3PSR A;  1CFF A;  3SIA A;  3EVU A;  4INW A;  2M49 B;  3O2P A;  4MBE A;  4OV2 A;  4PT1 A;  1R6P A;  3PFV A;  2MLF C;  3OX5 A;  1EG4 A;  1RJV A;  4ZCV A;  1FI6 A;  2LHI A;  1BOD A;  3BQ3 A;  5CSJ A;  1YVH A;  3TDI A;  1A4P A;  2K7B A;  1A75 B;  1NWD A;  1OSA A;  5D3O A;  3RM1 A;  1T14 A;  2JNX A;  3CDN A;  3KHE A;  1X02 A;  3DVK A;  1KQM B;  3PLF B;  2LCP A;  3BJH A;  5HKZ A;  1JSA A;  4QJ5 B;  4DIR A;  2JXL A;  3AAJ A;  5F6T A;  3N7H A;  4M2P A;  1B7T Y;  1VRK A;  1QVI Z;  1NUB A;  1TNQ A;  1CFP A;  3CZ0 A;  4ORB B;  5I8N A;  1EL4 A;  3BOW A;  5KTY A;  1V1G A;  2LHL A;  3EK7 A;  2KOT A;  4MVF A;  3TDU A;  3IQO A;  1NIW A;  1YX8 A;  2R2I A;  2LP2 A;  4ZCU A;  1F55 A;  1K90 D;  2BL0 C;  2WCK A;  4YGC B;  1QIW A;  2K7D A;  1NCZ A;  2K7C A;  1FPW A;  4YI9 A;  3MSE B;  4YRU A;  1C7W A;  1DJH A;  1UUR A;  1OOH A;  2L51 A;  2WCJ A;  4CFR A;  4GNK B;  1YVL A;  2KFF A;  5CSI A;  4M2O A;  1QWV A;  1SR6 B;  1QLS A;  1SCM B;  2BKH B;  2CT9 A;  1B7T Z;  2RGI A;  1JFJ A;  1CM4 A;  1XK4 A;  2ZN9 A;  2F33 A;  2K2F A;  1IQ5 A;  2P70 A;  4MZJ A;  3FE8 A;  1QJT A;  4A4C A;  3ICB A;  1CNP A;  2BBM A;  4WRI A;  1QV1 A;  1A75 A;  3S0E A;  3SS4 A;  4JKT A;  2KBM A;  3D75 A;  1OQP A;  4ETO A;  1B8C A;  4OVN F;  1CLL A;  3TZ1 A;  1G33 A;  2JUL A;  3SG5 A;  1F70 A;  1UWO A;  1XA5 A;  2KAY A;  1IG5 A;  2PYQ A;  3BUO B;  3DVJ A;  2WC8 A;  2WCM A;  2FCD A;  4L9M A;  2KHN A;  1WLM A;  2Q4U A;  4JWQ A;  2KI6 D;  1CDL A;  1BF5 A;  5AFP A;  1NPQ A;  1DGV A;  1HT9 A;  3PN7 B;  1J7Q A;  1B8L A;  2KGR A;  2OTG B;  3LLE A;  4PCW A;  1CB1 A;  4R1E A;  2JT8 A;  1CMF A;  2QEO A;  4OCI A;  1FW4 A;  1BR4 B;  2KDH A;  4ORC B;  2KGB C;  5CSN A;  5BPJ A;  1KFU L;  4HRE E;  2PMY A;  4PHN A;  1S6I A;  1UHI A;  2Y1N A;  1J1D A;  1Z2C B;  3FE6 A;  2BCX A;  2L2E A;  1Y1U A;  1ALW A;  5FI2 A;  5CSF A;  1NCX A;  2JWW A;  4GPL B;  2NXQ A;  2WCF A;  2DOQ A;  1E8A A;  1B9A A;  3AKA A;  1F54 A;  3EK4 A;  2O60 A;  1QLK A;  2PAL A;  3S0B A;  3BOW B;  4I5L B;  1MHO A;  3L47 A;  1S6J A;  1RFJ A;  2D8N A;  3CS1 A;  2L4I A;  5G08 A;  3TS5 C;  4AOM A;  1YRU B;  1UHN A;  4N1G A;  1XFR A;  2ERB A;  1NP8 A;  4GBA A;  1F71 A;  2WOR A;  1XK4 C;  1OZS A;  1TOP A;  1B1G A;  5EL2 A;  3QME A;  1KK7 Z;  1XFX O;  3D0Y A;  3D74 A;  1AP4 A;  4NDB A;  4NQG A;  3DF0 A;  3NSL A;  1L2O B;  2PSR A;  5D69 A;  1DQE A;  2SAS A;  2LVJ A;  2K60 A;  2OPO A;  2JQ6 A;  3B7A A;  3EKH A;  1PVA A;  1L7Z A;  2PQL A;  4MZL A;  1KCY A;  2QEH A;  2FJU B;  4GAO A;  1JF0 A;  2BKI B;  3IQQ A;  2LNK A;  2M1U A;  4CFQ A;  2K7O A;  1K96 A;  1OMR A;  2LLS A;  1NX3 A;  3KO0 A;  3NXA A;  4MRX A;  4Q04 A;  2LE9 B;  4F7F A;  4C0J A;  1IRJ A;  1W7J B;  1TCO B;  2JPO A;  2FCE A;  3VRR A;  3GOF A;  3NGV A;  2MA2 A;  2NCO A;  5D7F A;  3I5I B;  1K94 A;  2LMU A;  1MR8 A;  2EC6 B;  5ER4 X;  1SR6 C;  3S0G A;  1AJ4 A;  3WHU B;  1B47 A;  1OZO A;  1PSR A;  2CXJ A;  3LK0 A;  1JC2 A;  2KI6 C;  2SCP A;  3LL8 B;  3CR4 X;  3SG6 A;  4IJ7 A;  4XYN A;  4TNC A;  1GJY A;  2KLE A;  3VGO A;  3VRQ A;  4PE7 A;  1REC A;  3QRX A;  1A03 A;  1XVJ A;  2L0P A;  3GK1 A;  3I5G B;  2COL B;  3KPX A;  3NSI A;  1P28 A;  1WDC C;  3NHI A;  1V1F A;  2H8V A;  5HLO A;  1K2H A;  1BMO A;  2MRD A;  2BAP A;  1MWN A;  2V53 A;  1KWO B;  1XFW O;  1TNX A;  4GGN A;  2F2O A;  3SIB A;  1B4C A;  1S3P A;  4INX A;  2KNE A;  4I5N B;  3PM8 A;  2JT3 A;  4I5J A;  1F4Q A;  3VRN A;  1LS8 A;  1RK9 A;  3ZWH A;  1LVC D;  1K9U A;  3TUY C;  2LVI A;  3RZS A;  2M97 A;  2KQ6 A;  2JNF A;  3L4A A;  3VB1 A;  4MEW A;  3UNW A;  1YRT B;  1NX0 A;  3WXA A;  1CDM A;  3OBV A;  4KYN A;  1K9K A;  1S5G Y;  4D1E A;  5AAN A;  5ER5 A;  3D78 A;  1PAL A;  4BY4 A;  1XFZ O;  3SJS A;  4QJ4 B;  3B87 A;  4YGA A;  2KAX A;  2O5G A;  2F3Z A;  1FF1 A;  1SYM A;  1AJ5 A;  3FE9 A;  3SG7 A;  1QV0 A;  1ZOT B;  3H4S E;  4HRG A;  2K61 A;  2MAZ A;  1PK0 D;  1SW8 A;  3GK4 X;  5HLV A;  4GFT A;  5HKW A;  5I2L A;  1PVB A;  3AKB A;  3JVT C;  1N0Y A;  1WRL A;  3S0F A;  1H4B A;  1J7R A;  1TUZ A;  1M63 B;  3K21 A;  2KFH A;  3TDZ A;  1YTZ C;  3R1P A;  3DVE A;  5AEQ A;  4OZD A;  1UHK A;  1BR1 B;  4PE4 A;  4C0K A;  2LMT A;  1A2X A;  1UHJ A;  2QEV A;  5I2O A;  3BFH A;  1FBV A;  2F8P A;  3UO9 A;  4DUQ A;  1CM1 A;  2LV7 A;  1N2D A;  2LC5 A;  2JRF A;  2FJY A;  1WY9 A;  2LVK A;  4JPZ B;  5KSZ A;  1W9Z A;  3DD4 A;  3O78 A;  1J7O A;  1J7P A;  1UUS A;  2KYC A;  3FIA A;  3K1E A;  1FI5 A;  1OOJ A;  2L4H A;  2I18 A;  5AER A;  5TNC A;  1DJZ A;  4PAL A;  3BYA A;  3JTD B;  1EJ3 A;  3OX6 A;  2HQ8 A;  4CPV A;  1BOC A;  3CGA A;  2OS8 B;  1YUU A;  5DKR A;  3CR5 X;  1SK6 D;  1RTP 1;  5K89 A;  5I2Q A;  5JJG A;  1GGW A;  3I5F B;  3AAK A;  2NZ0 A;  3FWC A;  1QX2 A;  1C07 A;  1IJ6 A;  3KF9 A;  1DJG A;  1A29 A;  1KQM C;  2H61 C;  2B1U A;  2L2C A;  2GGM A;  5CPV A;  4PHK A;  1QS7 A;  1N65 A;  3SS5 A;  3EK8 A;  1NX2 A;  1SSE B;  4P5O E;  1C3Y A;  1SMG A;  2Y1M A;  1J55 A;  1OOI X;  3IF7 A;  3B86 A;  1K93 D;  3BUN B;  1QAT A;  1TCF A;  1UHH A;  3I5I C;  1C3Z A;  1SKT A;  1SL7 A;  2K0J A;  2L5X B;  3CZ2 A;  2L50 A;  2IS9 A;  5GQQ C;  2AMI A;  3RLZ A;  1MF8 B;  1DC1 A;  2ZND A;  2CTN A;  2F3Y A;  1DT7 B;  1YR5 A;  1DEL A;  1MQ1 A;  3FS7 A;  2JPT A;  3OP0 A;  3V2L A;  4BY5 A;  5HL1 A;  1S6C A;  1IQ3 A;  4USL A;  1QIV A;  3D0Y B;  3BFA A;  4MLW A;  1DJY A;  1Y6W A;  2MBX A;  1IJ5 A;  1WDC B;  1SPY A;  5I94 A;  2LMV A;  1QX7 A;  2QPT A;  3CZT X;  3GK2 A;  4PE1 A;  5FI7 A;  2QAC A;  2BBN A;  2M3W A;  3OB2 B;  3VRO A;  1SNL A;  2NLN A;  3A8R A;  2Y4Q A;  2KFG A;  1OMV A;  5KU1 A;  5AXI A;  1AUI B;  2M7N A;  2LP3 A;  1K9P A;  3TUY B;  1OOF A;  3ZNI A;  3SG2 A;  2PVB A;  1Z4H A;  2BL0 B;  3E3R A;  1GQM A;  2MJW B;  3R1V A;  2JC2 A;  1S1E A;  1B8R A;  4XJK B;  1KK8 C;  2BCA A;  1WLZ A;  2Q91 A;  1MXE A;  2WC6 A;  3CZ1 A;  2I2R E;  1SCM C;  3EG5 B;  1U5I B;  3BFB A;  1OE9 B;  2CNP A;  3CYZ A;  4PE0 A;  2JT0 A;  4UPG A;  2KAV A;  1Y1X A;  4E68 A;  1ORG A;  2BE6 A;  2KYF A;  3PAT A;  2M29 A;  3O4X A;  2JTZ A;  1AVS A;  2KLD A;  4N5X A;  3B6X A;  3NSK A;  4YGB B;  3JVT B;  1EH2 A;  2WC5 A;  1D1O A;  2K2A A;  1DVI A;  1DJX A;  1TIZ A;  1KFX L;  1NYA A;  4FQT A;  4PHJ A;  1IKU A;  1YUS A;  2GV5 A;  4NDC A;  4JD9 A;  2K8M B;  1YUR A;  1CLB A;  3SG4 A;  1YUT A;  1QAS A;  2M7L A;  2MHH A;  1U5I A;  2LLU A;  1SCV A;  2JTT A;  3LCP C;  4PHM A;  1CDN A;  2BNX A;  1NSH A;  1LKJ A;  1ALV A;  3KEV A;  5FI6 A;  4XJK A;  1K8U A;  1ZAC A;  3DVM A;  1JUO A;  4AQI A;  2KI4 B;  1Y1A A;  1YX7 A;  1DGU A;  3CR2 A;  1LIN A;  1PRW A;  2BEC A;  3PM2 A;  3D10 A;  1EXR A;  2H61 A;  2OTG C;  2A4J A;  2ZRT A;  4CID A;  5HKY A;  5IBW A;  1GGZ A;  2CCM A;  1K95 A;  2OS8 C;  5B8I B;  1PUL A;  4GGF A;  2G2B A;  2I7A A;  2ZN8 A;  1QTX A;  1TRF A;  2CBL A;  3F45 A;  5J3X A;  1CMG A;  3I5F C;  1AHR A;  2L98 A;  4NDD A;  3DYE A;  4QJ3 B;  1OOG A;  4ICB A;  1M45 A;  1CTR A;  1QXP A;  4IL1 A;  1M39 A;  2F2P A;  2LUC A;  3LK1 A;  2VRG A;  2WND A;  3CWG A;  2AAO A;  2JU0 A;  2M1K B;  1KK7 Y;  2BCB A;  3BUM B;  3OGN A;  4GGF C;  1Y0V H;  3D76 A;  3FWB A;  1J1E A;  4P2Y B;  4DS7 A;  1HQV A;  4MSP A;  2HF5 A;  1KSM A;  3B88 A;  1KQV A;  1CFD A;  1IWQ A;  1CLM A;  1XO5 A;  3PJI A;  2WCE A;  5FYX A;  2GTE A;  2E30 A;  3I5H B;  3OHM B;  1BG1 A;  1IGV A;  3TS5 B;  3M0W A;  1NX1 A;  4OKH A;  1UP5 A;  5PAL A;  1ZFS A;  1DF0 B;  2QDI A;  2FOT A;  2M8U A;  2EC6 C;  2PRU A;  1OW4 A;  1SRA A;  3HCM A;  4C0L A;  2E6W A;  1BT6 A;  3CTN A;  2ZNE A;  1L2O C;  1CFC A;  1M31 A;  3EVV A;  4F0Z B;  3NHT A;  2TN4 A;  1JBA A;  1DJI A;  4MRY A;  3S0A A;  5DKN A;  3BUX B;  2P71 A;  3S0D A;  3DY9 A;  1GM0 A;  1R2U A;  2P6B B;  4YBH B;  1AK8 A;  1H8B A;  3D73 A;  1KWO C;  1JWD A;  1XFY O;  2LAN A;  2LUX A;  4WQ3 A;  5JOL A;  1TN4 A;  1KK8 B;  4YI8 A;  3BUW B;  2KBI A;  4I5K A;  1TNW A;  1XYD A;  3HX4 A;  3O4Y A;  1G4Y R;  1NCY A;  1JF2 A;  4GUK A;  1XFV O;  1DJW A;  2KPH A;  2JZI A;  2QEB A;  1C7V A;  3SS3 A;  4FTG A;  2L5Y A;  1CKK A;  1LXF C;  2ZKM X;  1QX5 B;  2WCB A;  5DIC A;  2KQY A;  2MLE C;  2LAP A;  3I5G C;  4HSZ A;  2EHB A;  2M0R A;  1EG3 A;  2JOJ A;  3DF0 B;  1S5G Z;  3CLN A;  1DMO A;  1M46 A;  1S36 A;  3DZT A;  1SBJ A;  1F8H A;  1TTX A;  2ZFD A;  2WCH A;  4HRH A;  3WHT B;  2JXC A;  1IIO A;  3R1O A;  1KFU S;  4OR9 B;  2ISD A;  4A4B A;  1TWO A;  4AQJ A;  4M2Q A;  1W7I B;  3A4U B;  4N1F A;  1ZMZ A;  4PDZ A;  3VRP A;  3SG3 A;  1S26 D;  2KSP A;  2KI4 C;  3Q8I A; 
#chains in the Genus database with same CATH homology
 1QVI Y;  1LA3 A;  1BJF A;  2Y5I A;  1XFU O;  1SL8 A;  2LM5 A;  3EKJ A;  1RWY A;  3WNX B;  2I94 A;  1MXL C;  2WOS A;  1KFX S;  1TNP A;  2ZRS A;  4ORA B;  1ODB A;  1LA0 A;  4JQ0 D;  1SY9 A;  4YGD B;  1Q80 A;  4MZK A;  1ZUZ A;  1CDP A;  2EGD A;  1OMD A;  2HQW A;  3EVR A;  3PN7 C;  3C1V A;  2M9G A;  1BLQ A;  2PAS A;  1DTL A;  1JFK A;  3JTD C;  3O6B A;  1PSB A;  1WRK A;  4WQ2 A;  4DCK A;  3BXK A;  2G9B A;  1WRZ A;  5HYD A;  3NSO A;  1RRO A;  1SL9 A;  4DRW A;  2GGZ A;  4FQO A;  4MN0 A;  1MUX A;  2H2K A;  2LLT A;  5DKQ A;  2HPS A;  4YGE B;  4U8D A;  2NCP A;  2AUC A;  3OB1 B;  2LVV A;  1IH0 A;  1G8I A;  2HET A;  2BE4 A;  1F4O A;  1KSO A;  3PAL A;  4CLN A;  1BU3 A;  1DF0 A;  3I5H C;  3PSR A;  1CFF A;  3SIA A;  3EVU A;  2M49 B;  3O2P A;  4MBE A;  4OV2 A;  1R6P A;  3PFV A;  2MLF C;  3OX5 A;  1EG4 A;  1RJV A;  4ZCV A;  1FI6 A;  2LHI A;  1BOD A;  3BQ3 A;  5CSJ A;  1YVH A;  3TDI A;  1A4P A;  2K7B A;  1A75 B;  1NWD A;  1OSA A;  3RM1 A;  2JNX A;  3KHE A;  1X02 A;  3DVK A;  1KQM B;  3PLF B;  2LCP A;  5HKZ A;  1JSA A;  4QJ5 B;  4DIR A;  2JXL A;  3AAJ A;  5F6T A;  4M2P A;  1B7T Y;  1VRK A;  1QVI Z;  1NUB A;  1TNQ A;  4ORB B;  5I8N A;  1EL4 A;  3BOW A;  5KTY A;  1V1G A;  2LHL A;  3EK7 A;  2KOT A;  4MVF A;  3TDU A;  3IQO A;  1NIW A;  1YX8 A;  2R2I A;  2LP2 A;  4ZCU A;  1F55 A;  1K90 D;  2BL0 C;  4YGC B;  1QIW A;  2K7D A;  1NCZ A;  2K7C A;  1FPW A;  4YI9 A;  3MSE B;  4YRU A;  1C7W A;  1DJH A;  1UUR A;  4CFR A;  2L51 A;  4GNK B;  1YVL A;  2KFF A;  5CSI A;  4M2O A;  1SR6 B;  2CT9 A;  1QLS A;  1SCM B;  2BKH B;  1B7T Z;  2RGI A;  1JFJ A;  1CM4 A;  1XK4 A;  2ZN9 A;  2F33 A;  2K2F A;  1IQ5 A;  4MZJ A;  1QJT A;  4A4C A;  3ICB A;  1CNP A;  2BBM A;  4WRI A;  1QV1 A;  1A75 A;  2KBM A;  1OQP A;  4ETO A;  1B8C A;  4OVN F;  1CLL A;  3TZ1 A;  1G33 A;  2JUL A;  3SG5 A;  1F70 A;  1UWO A;  1XA5 A;  2KAY A;  1IG5 A;  3BUO B;  3DVJ A;  2WC8 A;  4L9M A;  2FCD A;  2KHN A;  1WLM A;  2Q4U A;  4JWQ A;  2KI6 D;  1CDL A;  1BF5 A;  5AFP A;  1NPQ A;  1DGV A;  1HT9 A;  3PN7 B;  1J7Q A;  1B8L A;  2KGR A;  2OTG B;  3LLE A;  4PCW A;  1CB1 A;  4R1E A;  2JT8 A;  1CMF A;  4OCI A;  1FW4 A;  1BR4 B;  2KDH A;  4ORC B;  2KGB C;  5CSN A;  5BPJ A;  1KFU L;  4HRE E;  2PMY A;  4PHN A;  1S6I A;  1UHI A;  2Y1N A;  1J1D A;  2BCX A;  2L2E A;  1Y1U A;  1ALW A;  5CSF A;  1NCX A;  2JWW A;  4GPL B;  2NXQ A;  2WCF A;  2DOQ A;  1E8A A;  1B9A A;  3AKA A;  1F54 A;  3EK4 A;  2O60 A;  1QLK A;  2PAL A;  3BOW B;  4I5L B;  1MHO A;  1S6J A;  1RFJ A;  2D8N A;  3CS1 A;  2L4I A;  5G08 A;  3TS5 C;  4AOM A;  1YRU B;  1UHN A;  4N1G A;  1NP8 A;  4GBA A;  1F71 A;  2WOR A;  1XK4 C;  1OZS A;  1TOP A;  1B1G A;  1KK7 Z;  1XFX O;  3D0Y A;  1AP4 A;  4NDB A;  4NQG A;  3DF0 A;  3NSL A;  1L2O B;  2PSR A;  5D69 A;  2SAS A;  2LVJ A;  2OPO A;  2JQ6 A;  3EKH A;  1PVA A;  1L7Z A;  4MZL A;  1KCY A;  2FJU B;  4GAO A;  1JF0 A;  2BKI B;  3IQQ A;  2LNK A;  2M1U A;  4CFQ A;  2K7O A;  1K96 A;  1OMR A;  2LLS A;  1NX3 A;  3KO0 A;  3NXA A;  4MRX A;  4Q04 A;  2LE9 B;  1CFP A;  4C0J A;  1IRJ A;  1W7J B;  1TCO B;  1CMG A;  2FCE A;  3VRR A;  3GOF A;  2MA2 A;  2NCO A;  5D7F A;  3I5I B;  1K94 A;  2LMU A;  1MR8 A;  2EC6 B;  5ER4 X;  1SR6 C;  1AJ4 A;  3WHU B;  1B47 A;  1OZO A;  1PSR A;  2CXJ A;  3LK0 A;  1JC2 A;  2KI6 C;  2SCP A;  3LL8 B;  3CR4 X;  3SG6 A;  4XYN A;  4TNC A;  1GJY A;  3VGO A;  3VRQ A;  4PE7 A;  1REC A;  3QRX A;  1A03 A;  1XVJ A;  2L0P A;  3GK1 A;  3I5G B;  2COL B;  3KPX A;  3NSI A;  1WDC C;  1V1F A;  5HLO A;  1K2H A;  1BMO A;  2MRD A;  2V53 A;  1MWN A;  1KWO B;  1XFW O;  1TNX A;  4GGN A;  2F2O A;  3SIB A;  1B4C A;  1S3P A;  2KNE A;  4I5N B;  3PM8 A;  2JT3 A;  4I5J A;  1F4Q A;  3VRN A;  1RK9 A;  3ZWH A;  1LVC D;  1K9U A;  3TUY C;  2LVI A;  2M97 A;  2KQ6 A;  2JNF A;  4MEW A;  1YRT B;  1NX0 A;  3WXA A;  1CDM A;  1K9K A;  1S5G Y;  4D1E A;  5AAN A;  5ER5 A;  1PAL A;  4BY4 A;  1XFZ O;  3SJS A;  4QJ4 B;  4YGA A;  2KAX A;  2O5G A;  2F3Z A;  1FF1 A;  1SYM A;  1AJ5 A;  3SG7 A;  1QV0 A;  1ZOT B;  3H4S E;  4HRG A;  2K61 A;  2MAZ A;  1PK0 D;  1SW8 A;  3GK4 X;  5HLV A;  4GFT A;  5HKW A;  5I2L A;  1PVB A;  3AKB A;  3JVT C;  1N0Y A;  1WRL A;  1H4B A;  1J7R A;  1M63 B;  3K21 A;  2KFH A;  3TDZ A;  1YTZ C;  5AEQ A;  3DVE A;  1UHK A;  1BR1 B;  4PE4 A;  4C0K A;  2LMT A;  1A2X A;  1UHJ A;  5I2O A;  1FBV A;  2F8P A;  4DUQ A;  1CM1 A;  2LV7 A;  1N2D A;  2LC5 A;  2JRF A;  2LVK A;  1WY9 A;  4JPZ B;  5KSZ A;  3DD4 A;  3O78 A;  1J7O A;  1J7P A;  1UUS A;  2KYC A;  3FIA A;  1FI5 A;  1OOJ A;  2L4H A;  2I18 A;  5AER A;  5TNC A;  1DJZ A;  4PAL A;  3BYA A;  3JTD B;  1EJ3 A;  3OX6 A;  2HQ8 A;  4CPV A;  1BOC A;  3CGA A;  2OS8 B;  1YUU A;  5DKR A;  3CR5 X;  1SK6 D;  1RTP 1;  5K89 A;  5I2Q A;  5JJG A;  1GGW A;  3I5F B;  3AAK A;  2NZ0 A;  3FWC A;  1QX2 A;  1C07 A;  1IJ6 A;  3KF9 A;  1DJG A;  1A29 A;  1KQM C;  2H61 C;  2B1U A;  5CPV A;  2GGM A;  4PHK A;  1QS7 A;  1N65 A;  3EK8 A;  1NX2 A;  4P5O E;  1SMG A;  2Y1M A;  1J55 A;  3IF7 A;  1K93 D;  3BUN B;  1QAT A;  1TCF A;  1UHH A;  3I5I C;  2L5X B;  1SKT A;  1SL7 A;  2K0J A;  2L50 A;  2IS9 A;  5GQQ C;  2AMI A;  3RLZ A;  1MF8 B;  2ZND A;  2CTN A;  2F3Y A;  1DT7 B;  1YR5 A;  1MQ1 A;  3FS7 A;  2JPT A;  3OP0 A;  4BY5 A;  1S6C A;  1IQ3 A;  4USL A;  1QIV A;  3D0Y B;  4MLW A;  1DJY A;  1Y6W A;  2MBX A;  1IJ5 A;  1WDC B;  1SPY A;  2LMV A;  1QX7 A;  2QPT A;  3CZT X;  3GK2 A;  4PE1 A;  2QAC A;  2BBN A;  2M3W A;  3OB2 B;  3VRO A;  1SNL A;  2NLN A;  3A8R A;  2Y4Q A;  2KFG A;  1OMV A;  5KU1 A;  5AXI A;  1AUI B;  2M7N A;  2LP3 A;  1K9P A;  3TUY B;  3ZNI A;  3SG2 A;  2PVB A;  2BL0 B;  3E3R A;  1GQM A;  2MJW B;  2JC2 A;  1S1E A;  1B8R A;  4XJK B;  1KK8 C;  2BCA A;  1WLZ A;  2Q91 A;  1MXE A;  2I2R E;  1SCM C;  1U5I B;  1OE9 B;  2CNP A;  4PE0 A;  2JT0 A;  4UPG A;  2KAV A;  1Y1X A;  4E68 A;  2BE6 A;  2KYF A;  3PAT A;  2M29 A;  2JTZ A;  1AVS A;  4N5X A;  3NSK A;  4YGB B;  3JVT B;  1EH2 A;  1D1O A;  2K2A A;  1DVI A;  1DJX A;  1TIZ A;  1KFX L;  1NYA A;  4PHJ A;  1IKU A;  1YUS A;  2GV5 A;  4NDC A;  2K8M B;  1YUR A;  1CLB A;  3SG4 A;  1YUT A;  1QAS A;  2M7L A;  2MHH A;  1U5I A;  2LLU A;  1SCV A;  2JTT A;  3LCP C;  4PHM A;  1CDN A;  1NSH A;  1LKJ A;  1ALV A;  3KEV A;  4XJK A;  1K8U A;  1ZAC A;  3DVM A;  1JUO A;  4AQI A;  2KI4 B;  1Y1A A;  1YX7 A;  1DGU A;  3CR2 A;  1LIN A;  1PRW A;  2BEC A;  3D10 A;  1EXR A;  2H61 A;  2OTG C;  2A4J A;  2ZRT A;  4CID A;  5HKY A;  5IBW A;  1GGZ A;  2CCM A;  1K95 A;  2OS8 C;  5B8I B;  1PUL A;  4GGF A;  2G2B A;  2I7A A;  2ZN8 A;  1QTX A;  1TRF A;  2CBL A;  3F45 A;  5J3X A;  3I5F C;  1AHR A;  2L98 A;  4NDD A;  4QJ3 B;  4ICB A;  1M45 A;  1CTR A;  1QXP A;  4IL1 A;  1M39 A;  2F2P A;  2LUC A;  3LK1 A;  2VRG A;  2WND A;  3CWG A;  2AAO A;  2JU0 A;  2M1K B;  1KK7 Y;  2BCB A;  3BUM B;  4GGF C;  1Y0V H;  3FWB A;  1J1E A;  4P2Y B;  4DS7 A;  1HQV A;  4MSP A;  2HF5 A;  1KSM A;  1KQV A;  1CFD A;  1IWQ A;  1CLM A;  1XO5 A;  2WCE A;  5FYX A;  2E30 A;  3I5H B;  3OHM B;  1BG1 A;  1IGV A;  3TS5 B;  3M0W A;  1NX1 A;  4OKH A;  1UP5 A;  5PAL A;  1ZFS A;  1DF0 B;  2FOT A;  2M8U A;  2EC6 C;  2PRU A;  1SRA A;  3HCM A;  4C0L A;  2E6W A;  1BT6 A;  3CTN A;  2ZNE A;  1L2O C;  1CFC A;  1M31 A;  3EVV A;  4F0Z B;  2TN4 A;  1JBA A;  1DJI A;  4MRY A;  5DKN A;  3BUX B;  1R2U A;  2P6B B;  4YBH B;  1AK8 A;  1H8B A;  1KWO C;  1JWD A;  1XFY O;  2LAN A;  2LUX A;  4WQ3 A;  5JOL A;  1TN4 A;  1KK8 B;  4YI8 A;  3BUW B;  2KBI A;  4I5K A;  1TNW A;  1XYD A;  3HX4 A;  3O4Y A;  1G4Y R;  1NCY A;  1JF2 A;  4GUK A;  1XFV O;  1DJW A;  1C7V A;  2JZI A;  1CKK A;  4FTG A;  1LXF C;  2ZKM X;  1QX5 B;  2WCB A;  2KQY A;  2MLE C;  2LAP A;  3I5G C;  4HSZ A;  2EHB A;  2M0R A;  1EG3 A;  2JOJ A;  3DF0 B;  1S5G Z;  3CLN A;  1DMO A;  1M46 A;  1S36 A;  1F8H A;  1SBJ A;  1TTX A;  2ZFD A;  3WHT B;  4HRH A;  2JXC A;  1KFU S;  4OR9 B;  2ISD A;  4A4B A;  4AQJ A;  4M2Q A;  1W7I B;  3A4U B;  4N1F A;  1ZMZ A;  4PDZ A;  3VRP A;  3SG3 A;  1S26 D;  2KSP A;  2KI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...