1M63B

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
b'SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
molecule tags Hydrolase/isomerase/immunosuppressant
source organism Homo sapiens
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
total genus 36
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m63B00
3TUYB 1PALA 1BJFA 2LLSA 1WRKA 2JTTA 2EGDA 2LAPA 1GGZA 1NX3A 3OP0A 4DUQA 1IH0A 1XFYO 4GNKB 1DJGA 2ZFDA 2VRGA 1J55A 5D69A 3LL8B 3AAKA 4GPLB 5F6TA 1KK7Z 4AQIA 3OB2B 1B8CA 4L9MA 5DKNA 4ETOA 4NDCA 1CDNA 1SR6C 2JZIA 1ZFSA 3I5FC 5AXIA 1MQ1A 2BECA 5AFPA 2H61C 1B7TY 1NX1A 1NPQA 5AERA 4MLWA 1SPYA 1TTXA 4MRYA 1K96A 5HLVA 4MBEA 1Y1XA 1RECA 2I94A 3ZNIA 2BE4A 1RTP1 1KCYA 2OTGB 1QTXA 4PE0A 1V1FA 4ICBA 4XJKB 1BG1A 1BT6A 1JWDA 3KO0A 2KQ6A 1K95A 3VRNA 1CDPA 1KK8B 5B8IB 1S26D 2JPTA 4MVFA 4ORBB 1EXRA 1YTZC 4UPGA 3TDIA 3JVTB 1DJYA 4N1GA 2LHIA 1R6PA 1ZOTB 2LANA 1SMGA 1EG4A 1SY9A 2P6BB 2CT9A 4XJKA 1SL9A 3EK4A 3SJSA 3CGAA 1F71A 1DF0A 1G8IA 2JT8A 1WRLA 2G2BA 3GK1A 2JU0A 1K9PA 2M0RA 1NUBA 1XYDA 3EVUA 3OX5A 4JQ0D 3CTNA 5DKQA 1AJ4A 1NX2A 1SCMB 2KDHA 2L50A 1QV0A 2LE9B 4M2OA 4PE4A 5CSNA 2LVKA 5J3XA 1A29A 2JULA 1K94A 5CSJA 3AKAA 4JPZB 1N65A 1ZUZA 2QPTA 3K21A 4PHJA 1K2HA 2EC6C 4QJ4B 1K8UA 1ALVA 1H4BA 3DVJA 2Y5IA 4HRHA 2KYFA 2WOSA 3I5FB 2NLNA 1UWOA 2NCOA 1MF8B 4IL1A 2A4JA 3CS1A 1UHJA 2F2OA 2L4HA 1SL7A 5JOLA 1YR5A 4MEWA 1M31A 1YUTA 3TZ1A 2OS8B 1M63B 1CM1A 4BY4A 1CDLA 4WQ2A 4I5JA 3CR5X 1CFPA 1KFUL 1OOJA 3IQOA 1J7RA 1TN4A 1KK8C 1B7TZ 2L2EA 2K61A 1KQVA 4GUKA 1LKJA 1WDCC 1YRUB 2LLTA 3FS7A 1JF0A 1C7VA 1SCMC 1XFWO 5AANA 2KBMA 4OR9B 3SG3A 3SIAA 2H61A 1K9KA 1A03A 3TDUA 2L4IA 2LVVA 2GGMA 1FF1A 4YRUA 3PLFB 4I5LB 3BOWB 4NDBA 4ORAB 2KAYA 4WQ3A 1DJXA 1AP4A 2MBXA 1FI5A 2K7CA 1WY9A 1QXPA 2F8PA 1A75B 1LINA 1QVIY 1TNXA 2BKIB 4A4CA 1PVBA 2K7BA 3FWCA 1RJVA 4PDZA 2HPSA 2LM5A 2FCEA 2KGBC 3D0YA 1XVJA 2AMIA 3PM8A 2KHNA 3KHEA 5G08A 1LVCD 2Q4UA 4YGBB 2LLUA 3BQ3A 2COLB 4GFTA 1A4PA 2H2KA 3VRRA 1TIZA 1CM4A 2BCAA 1KSMA 3I5IB 1WDCB 5I2OA 2M1KB 2CCMA 2QACA 3F45A 3LK1A 2ZKMX 1S6JA 1EL4A 3O2PA 1K9UA 1PVAA 2BL0C 1ZMZA 4FTGA 5HKZA 1AJ5A 5PALA 2L5XB 1SW8A 1DVIA 2WC8A 3PN7C 3I5GC 4TNCA 2O5GA 1SR6B 1W7JB 1C07A 4OKHA 1C7WA 1KWOB 5IBWA 2HETA 3LLEA 2K8MB 1SBJA 1YUUA 5ER4X 4F0ZB 2NXQA 1KK7Y 5KU1A 1F70A 2KAVA 3SG6A 2LUXA 1DJWA 1OQPA 3I5GB 2FJUB 1TRFA 1A75A 4ZCVA 2BL0B 2JC2A 4MZJA 2E30A 4CFQA 1LA3A 1S1EA 4PE7A 3BOWA 1TNPA 1CMFA 3I5IC 2FOTA 1S3PA 1YVHA 2LMVA 3DF0B 1XO5A 2HQWA 1LXFC 1XFUO 2M1UA 3ZWHA 3HCMA 3O6BA 1TCFA 2K0JA 1QJTA 1IWQA 1RROA 2JT0A 2PASA 5ER5A 2LP2A 3SG5A 1U5IA 1B4CA 4P5OE 2JNFA 3H4SE 2FCDA 1OZOA 1LA0A 1OE9B 3EKJA 2PALA 3D10A 2D8NA 1XFXO 5TNCA 3GK4X 1L7ZA 4D1EA 3PSRA 1J1EA 1QX2A 3O78A 1CNPA 3NSKA 1J7QA 1UUSA 1CLLA 2PMYA 1KFXS 3NSIA 1OMRA 2KFFA 2MRDA 4HSZA 2CXJA 1MXEA 3SG4A 1QVIZ 1JSAA 2L51A 2SCPA 1B1GA 1OMDA 1PK0D 3C1VA 3QRXA 4R1EA 5HLOA 5HYDA 2BBNA 3CWGA 1PULA 1YX7A 2Y1NA 2ZN9A 3BUOB 1NIWA 1H8BA 4YI8A 3A4UB 4PHMA 4N1FA 2ZN8A 1Q80A 2LP3A 1QX5B 2KGRA 4JWQA 1QS7A 2JQ6A 1DMOA 1DT7B 1SKTA 3HX4A 4YGAA 3A8RA 2OS8C 1QLKA 1J7PA 1DJZA 1UP5A 2WCFA 2NZ0A 2E6WA 3DF0A 4I5KA 2K7DA 1B9AA 1EG3A 4MZLA 1NCYA 2Q91A 1TOPA 1KFXL 1ZACA 5AEQA 4HREE 4U8DA 3CR2A 1G33A 3JTDC 2F3YA 4YGCB 5CPVA 5DKRA 2IS9A 1SL8A 3WHUB 2KSPA 1BR1B 1YUSA 3IQQA 1OZSA 3EK8A 4DIRA 1L2OC 1MWNA 1RWYA 1OMVA 2JXCA 2LHLA 1J1DA 1CFFA 1SRAA 2KI4C 1R2UA 1PSRA 3DVMA 1Y1UA 4M2QA 2L0PA 1N0YA 4BY5A 2GGZA 3BUMB 1AHRA 2AUCA 1Y1AA 2M29A 2ZNDA 3VGOA 1YURA 2GV5A 2F33A 3PN7B 3PALA 3ICBA 4P2YB 4PHKA 5GQQC 5KTYA 1GQMA 1CMGA 3NSOA 1GJYA 1QATA 2KI4B 3VRPA 1F4QA 1TCOB 1S6IA 3TUYC 2I2RE 2ISDA 2F3ZA 2JTZA 1UHIA 1TNQA 4PE1A 4CPVA 2I7AA 3KF9A 1HT9A 3I5HB 2Y4QA 1IRJA 2JRFA 2AAOA 2KI6C 3IF7A 4PCWA 1UHNA 1HQVA 1D1OA 2PSRA 1F54A 1CTRA 2PVBA 1NSHA 1NWDA 4YBHB 1CDMA 1NX0A 2MLFC 3NSLA 4NQGA 2MJWB 1M39A 3BUWB 1WRZA 5FYXA 3BXKA 1BMOA 1NCZA 1M45A 1M46A 1CLBA 1CFDA 1BOCA 3TS5B 3FIAA 3CZTX 1ALWA 3OHMB 4GGNA 3CLNA 4N5XA 1IG5A 5CSFA 3D0YB 1KFUS 1BR4B 4WRIA 1RFJA 4YGDB 2KQYA 1QX7A 4C0JA 4CFRA 1PRWA 3MSEB 1UURA 1FW4A 2M3WA 2K7OA 1B8LA 2PRUA 3VRQA 5JJGA 4DCKA 1B47A 3RLZA 2JNXA 2ZRSA 5HKYA 2KOTA 1XK4C 1EJ3A 1NP8A 3E3RA 1NCXA 4QJ5B 1XFZO 1CB1A 1WLMA 3PFVA 1SCVA 3GOFA 1XA5A 1FBVA 1DGVA 4I5NB 2LVJA 4OVNF 2RGIA 5I8NA 5HKWA 4OV2A 1SK6D 1TNWA 1DJIA 1V1GA 1S5GY 2M49B 2ZRTA 3WXAA 2M97A 4GBAA 1OSAA 3I5HC 2JT3A 2BCXA 1RK9A 1EH2A 3KEVA 3LCPC 2V53A 3FWBA 4C0KA 1B8RA 1KSOA 1YX8A 2OPOA 2R2IA 3LK0A 1XFVO 1CFCA 1DF0B 3GK2A 2M9GA 4AQJA 3BUNB 2LVIA 3SIBA 2KBIA 2MLEC 2LUCA 1SYMA 2K2AA 3JTDB 3VROA 2KNEA 2L98A 2NCPA 4MN0A 1BU3A 1JFJA 2I18A 4GGFA 1U5IB 3TS5C 2WCBA 2ZNEA 1K90D 1NYAA 1UHHA 4ORCB 2HQ8A 4YI9A 4ZCUA 1WLZA 3KPXA 4M2PA 1KWOC 4MSPA 1MR8A 2WCEA 3CR4X 4PHNA 1K93D 2BCBA 1F55A 1JFKA 1X02A 3DVKA 4XYNA 1GGWA 1E8AA 5D7FA 2M7NA 2BBMA 2KYCA 1ODBA 3NXAA 1JC2A 3OB1B 2Y1MA 1J7OA 1IKUA 2M7LA 1IQ3A 1UHKA 1KQMB 2LC5A 2OTGC 1F4OA 4GGFC 1QV1A 2BKHB 2G9BA 3BYAA 4NDDA 1MXLC 5BPJA 1G4YR 2KAXA 3AAJA 2TN4A 3EVRA 1PSBA 3EVVA 3SG7A 3PATA 3WHTB 3BUXB 5KSZA 1SNLA 2CBLA 1MUXA 4YGEB 1JUOA 5K89A 2WNDA 1AVSA 1A2XA 2CNPA 1IGVA 1FPWA 4MZKA 1YVLA 1QLSA 4C0LA 1DJHA 2LMTA 4DRWA 2M8UA 1IQ5A 2LCPA 1F8HA 3AKBA 5I2QA 1QIVA 4USLA 3DVEA 3JVTC 2SASA 4CIDA 5CSIA 2EC6B 3TDZA 1CKKA 2KFHA 2JXLA 2KI6D 2MHHA 3OX6A 1S6CA 1MHOA 3RM1A 4AOMA 2LNKA 2F2PA 2JWWA 1AUIB 2HF5A 2CTNA 1DGUA 4FQOA 4DS7A 2LMUA 3DD4A 2BE6A 1FI6A 4OCIA 1IJ5A 1YRTB 1BF5A 4A4BA 2WORA 4E68A 3WNXB 1Y6WA 1QIWA 1S36A 1DTLA 2MAZA 1IJ6A 2LV7A 2B1UA 5I2LA 1VRKA 4GAOA 1JBAA 3M0WA 1S5GZ 3SG2A 2K2FA 4MRXA 3O4YA 1AK8A 1Y0VH 4PALA 2JOJA 4Q04A 1XK4A 1W7IB 2KFGA 1BODA 2DOQA 1KQMC 1QASA 3EKHA 1BLQA 2O60A 1L2OB 1CLMA 2MA2A 4HRGA 4CLNA 1N2DA 2EHBA 1JF2A 3EK7A 4QJ3B
chains in the Genus database with same CATH superfamily
3TUYB 1PALA 1BJFA 2LLSA 1WRKA 2JTTA 2EGDA 2LAPA 1GGZA 1NX3A 3OP0A 4DUQA 1IH0A 1XFYO 4GNKB 1DJGA 2ZFDA 2VRGA 1J55A 5D69A 3LL8B 3AAKA 4GPLB 5F6TA 1KK7Z 4AQIA 3OB2B 1B8CA 2WCMA 4L9MA 5DKNA 4ETOA 4NDCA 1CDNA 1SR6C 2JZIA 1ZFSA 3I5FC 5AXIA 1MQ1A 2WCLA 3FE8A 2BECA 5AFPA 2H61C 1B7TY 1NX1A 1NPQA 5AERA 4MLWA 1SPYA 1TTXA 4MRYA 1K96A 5HLVA 3R1PA 1Y1XA 4MBEA 1RECA 2I94A 3ZNIA 2BE4A 1RTP1 3DZTA 3UO9A 1KCYA 2OTGB 1QTXA 4PE0A 1V1FA 4ICBA 4XJKB 1BG1A 1BT6A 1JWDA 3B86A 3KO0A 2KQ6A 3VB1A 1K95A 3VRNA 1CDPA 1KK8B 3S0GA 1S26D 2JPTA 3UNWA 5B8IB 4MVFA 4ORBB 1EXRA 1YTZC 1DEKA 4UPGA 3TDIA 3JVTB 1DJYA 4N1GA 1Z4HA 1DELA 2LHIA 1R6PA 1ZOTB 2LANA 3OGNA 1SMGA 1EG4A 2WCHA 1SY9A 2P6BB 2CT9A 4XJKA 1SL9A 3S0FA 3EK4A 3SJSA 3CGAA 1F71A 1DF0A 1G8IA 2JT8A 1WRLA 2G2BA 4PT1A 3GK1A 2JU0A 1K9PA 2M0RA 1NUBA 1XYDA 3EVUA 1LS8A 3OX5A 4JQ0D 3CTNA 4OZDA 5DKQA 1AJ4A 1NX2A 1SCMB 2KDHA 2L50A 1QV0A 2LE9B 3QMEA 2KLDA 4M2OA 2LVKA 4PE4A 1A29A 5CSNA 2JULA 5J3XA 1K94A 5CSJA 5FI2A 3AKAA 4JPZB 3S0AA 1N65A 1ZUZA 2QPTA 1DC1A 3K21A 4PHJA 1K2HA 2EC6C 4QJ4B 1K8UA 1OOGA 1ALVA 1H4BA 3DVJA 2Y5IA 3FE9A 4HRHA 2WC5A 2KYFA 2WOSA 3I5FB 2NLNA 1UWOA 2NCOA 1MF8B 4IL1A 2A4JA 3CS1A 1UHJA 2F2OA 2L4HA 1SL7A 5JOLA 1YR5A 4MEWA 1M31A 1YUTA 3TZ1A 2OS8B 1M63B 5FI6A 1CM1A 4BY4A 1CDLA 2QEHA 4WQ2A 4I5JA 3CR5X 1CFPA 1KFUL 1OOJA 3IQOA 1J7RA 1TN4A 1KK8C 1B7TZ 2L2EA 2K61A 5I94A 1KQVA 4GUKA 1LKJA 1WDCC 1YRUB 2LLTA 3FS7A 1JF0A 1C7VA 1SCMC 1XFWO 5AANA 2KBMA 4OR9B 1ORGA 3SG3A 3SIAA 2H61A 1K9KA 1A03A 3OBVA 3TDUA 2BAPA 2L4IA 3Q8IA 2LVVA 2GGMA 1FF1A 5DICA 4YRUA 3PLFB 1OOIX 3BOWB 4I5LB 4NDBA 2KAYA 4ORAB 1DJXA 4WQ3A 2MBXA 3SS3A 1FI5A 4IJ7A 2K7CA 1WY9A 1QXPA 2F8PA 1A75B 1LINA 1QVIY 1TNXA 2BKIB 4A4CA 1PVBA 2K7BA 3FWCA 1RJVA 4PDZA 2HPSA 2LM5A 2FCEA 2KGBC 1OOHA 3CZ1A 3D0YA 1XVJA 2AMIA 3PM8A 2KHNA 3KHEA 5G08A 1LVCD 2Q4UA 4YGBB 2LLUA 3BQ3A 2COLB 4GFTA 1A4PA 2H2KA 3VRRA 1TIZA 1CM4A 2BCAA 1KSMA 3I5IB 1WDCB 5I2OA 2M1KB 3R1VA 2CCMA 2QACA 3F45A 3LK1A 2ZKMX 1S6JA 3BFBA 1EL4A 3O2PA 1K9UA 1PVAA 2BL0C 1ZMZA 4FTGA 5HKZA 1AJ5A 5PALA 2L5XB 1SW8A 1DVIA 2WC8A 3PN7C 3I5GC 4TNCA 1SSEB 2O5GA 1SR6B 3D76A 1W7JB 1C07A 4OKHA 4FQTA 1C7WA 1KWOB 5IBWA 2HETA 3B6XA 2K60A 3LLEA 2K8MB 1SBJA 1YUUA 3CZ0A 5ER4X 2P70A 2ERBA 4F0ZB 2NXQA 1KK7Y 5KU1A 1F70A 2KAVA 3SG6A 2LUXA 3B88A 1DJWA 1OQPA 3I5GB 2FJUB 1TRFA 1A75A 4ZCVA 2BL0B 2JC2A 4MZJA 2E30A 3O4XA 4CFQA 1LA3A 1S1EA 1P28A 4PE7A 3S0BA 3BOWA 1TNPA 1C3ZA 3NHIA 1CMFA 3I5IC 2FOTA 1S3PA 1YVHA 2LMVA 3DF0B 1XO5A 2HQWA 1LXFC 1XFUO 2M1UA 3ZWHA 2GTEA 3HCMA 3L4LA 3O6BA 1TCFA 2K0JA 1QJTA 1IWQA 1RROA 2JT0A 2PASA 5ER5A 2LP2A 3SG5A 1U5IA 1B4CA 3D75A 4P5OE 2JNFA 3H4SE 2FCDA 1OZOA 1LA0A 1OE9B 1OOFA 3EKJA 3S0DA 2PALA 3D10A 2D8NA 1XFXO 5TNCA 5FI7A 3GK4X 1L7ZA 4D1EA 3CYZA 1J1EA 1QX2A 3D74A 3O78A 3PSRA 1CNPA 3NSKA 2WCJA 1J7QA 1UUSA 1CLLA 2PMYA 1KFXS 3NSIA 1OMRA 2KFFA 2MRDA 3CZ2A 2CXJA 1MXEA 4HSZA 1QVIZ 3SG4A 1JSAA 2L51A 2SCPA 1B1GA 1OMDA 1PK0D 3C1VA 3QRXA 4R1EA 5HLOA 4F7FA 5HYDA 1TWOA 2BBNA 3CWGA 1PULA 1YX7A 3CDNA 4JKTA 2Y1NA 2ZN9A 3BUOB 1NIWA 1H8BA 4YI8A 2QDIA 3A4UB 4PHMA 4N1FA 2ZN8A 1Q80A 2LP3A 1QX5B 2KGRA 4JWQA 1QS7A 2JQ6A 1DMOA 1DT7B 1SKTA 3HX4A 4YGAA 3A8RA 2OS8C 1QLKA 2KLEA 1DJZA 2QEBA 1UP5A 1J7PA 2WCFA 2PYQA 2NZ0A 2E6WA 3DF0A 4I5KA 1GM0A 2K7DA 1B9AA 1EG3A 4MZLA 1NCYA 1QWVA 2Q91A 1Z2CB 1TOPA 1KFXL 1ZACA 5AEQA 4HREE 4U8DA 1W9ZA 3CR2A 1G33A 3JTDC 2F3YA 4YGCB 5CPVA 5DKRA 2IS9A 1SL8A 3WHUB 2KSPA 1BR1B 1YUSA 2JPOA 3IQQA 1OZSA 3EK8A 4DIRA 1L2OC 1MWNA 1RWYA 1OMVA 2JXCA 2LHLA 3BFAA 1J1DA 2L5YA 1CFFA 1SRAA 2H8VA 2KI4C 1R2UA 1PSRA 3DVMA 1Y1UA 4M2QA 2L0PA 1N0YA 4BY5A 1TUJA 2GGZA 3BUMB 1AHRA 2AUCA 1Y1AA 2M29A 2ZNDA 4KYNA 1YURA 3S0EA 3VGOA 2GV5A 3SS4A 2F33A 3PN7B 3PALA 3ICBA 4P2YB 4PHKA 5GQQC 5KTYA 1GQMA 1CMGA 3NSOA 1GJYA 1QATA 3NGVA 2KI4B 3VRPA 1F4QA 1TCOB 3V2LA 1S6IA 3TUYC 2QEVA 2I2RE 2ISDA 2F3ZA 2JTZA 1UHIA 1TNQA 4PE1A 4CPVA 2I7AA 3KF9A 1HT9A 3DXLA 3I5HB 4INWA 2Y4QA 1IRJA 2JRFA 2AAOA 2KI6C 3IF7A 4PCWA 1UHNA 1HQVA 1D1OA 2PSRA 1F54A 1CTRA 1OW4A 1XFRA 2PVBA 1NSHA 1NWDA 4YBHB 1CDMA 1NX0A 2MLFC 3NSLA 4NQGA 2MJWB 1M39A 3BUWB 1IIOA 1WRZA 5FYXA 3BXKA 1BMOA 1NCZA 1M45A 1M46A 1CLBA 1CFDA 1BOCA 3TS5B 3FIAA 2BNXA 3CZTX 1ALWA 3OHMB 4GGNA 3CLNA 4N5XA 1IG5A 5CSFA 3D0YB 3DYEA 1KFUS 1BR4B 4WRIA 1RFJA 4YGDB 2KQYA 1QX7A 4C0JA 4CFRA 1PRWA 3MSEB 1UURA 3K1EA 1FW4A 2M3WA 2K7OA 1B8LA 2PRUA 3VRQA 5JJGA 4DCKA 1B47A 3RLZA 2JNXA 2ZRSA 5HKYA 2KOTA 1XK4C 1EJ3A 1NP8A 3E3RA 2PQLA 1NCXA 3B7AA 4QJ5B 1XFZO 1CB1A 1WLMA 3PFVA 1SCVA 3GOFA 1XA5A 1FBVA 1DGVA 4I5NB 2LVJA 4OVNF 3R1OA 2RGIA 3BJHA 5HKWA 2WC6A 5I8NA 4OV2A 1SK6D 1TNWA 1DJIA 1V1GA 1S5GY 2M49B 2ZRTA 3WXAA 2M97A 4GBAA 2WCKA 3L4AA 1OSAA 3I5HC 2JT3A 2BCXA 1RK9A 3PJIA 3KEVA 3LCPC 1EH2A 2V53A 3FWBA 4C0KA 1B8RA 1KSOA 1YX8A 2OPOA 2R2IA 3LK0A 1XFVO 1T14A 1DF0B 3GK2A 1AP4A 1CFCA 2M9GA 4AQJA 3BUNB 2LVIA 3SIBA 1TUZA 2KBIA 2LUCA 1SYMA 2K2AA 2MLEC 3JTDB 3VROA 2KNEA 2L98A 2NCPA 3L47A 4MN0A 1BU3A 2YGUA 1JFJA 2I18A 4GGFA 1U5IB 3TS5C 2WCBA 2ZNEA 1K90D 1NYAA 1UHHA 4ORCB 2HQ8A 4YI9A 4JD9A 4ZCUA 1WLZA 3KPXA 4M2PA 3RZSA 1KWOC 4MSPA 1MR8A 2WCEA 3CR4X 3D77A 4PHNA 1K93D 2BCBA 1F55A 1JFKA 1X02A 3DVKA 2KPHA 4XYNA 1GGWA 1E8AA 5D7FA 2M7NA 2BBMA 2KYCA 1ODBA 3NXAA 1JC2A 5D3OA 3OB1B 2Y1MA 1J7OA 1IKUA 2M7LA 1IQ3A 1UHKA 1KQMB 2LC5A 2OTGC 1F4OA 3B87A 4GGFC 5EL2A 3D78A 1QV1A 2BKHB 2G9BA 2P71A 3BYAA 4NDDA 1MXLC 5BPJA 1G4YR 2KAXA 3AAJA 2TN4A 3EVRA 3N7HA 1PSBA 3DY9A 3EVVA 3SG7A 3PATA 3WHTB 3BUXB 5KSZA 1SNLA 2CBLA 1MUXA 2FJYA 1JUOA 4YGEB 5K89A 2WNDA 2L2CA 1AVSA 1A2XA 2CNPA 1IGVA 3SS5A 1FPWA 4MZKA 1YVLA 3BFHA 1QLSA 4C0LA 1DJHA 2LMTA 4DRWA 2M8UA 1IQ5A 2LCPA 1F8HA 3AKBA 5I2QA 1QIVA 4USLA 3DVEA 3JVTC 2SASA 4CIDA 5CSIA 2EC6B 3TDZA 3EG5B 1CKKA 2KFHA 2JXLA 2KI6D 2MHHA 3NHTA 3OX6A 1S6CA 1MHOA 3RM1A 1DQEA 4AOMA 2LNKA 2QEOA 2F2PA 3FE6A 2JWWA 1AUIB 2HF5A 2CTNA 1DGUA 4FQOA 4DS7A 5HL1A 2LMUA 3DD4A 2BE6A 1FI6A 4OCIA 1IJ5A 1YRTB 1BF5A 4INXA 2WORA 4A4BA 4E68A 3PM2A 3WNXB 1Y6WA 1QIWA 1S36A 1DTLA 2MAZA 3CABA 1IJ6A 2LV7A 2B1UA 5I2LA 1VRKA 4GAOA 1JBAA 3M0WA 1S5GZ 3SG2A 2K2FA 4MRXA 3O4YA 1AK8A 1C3YA 1Y0VH 4PALA 3R72A 2JOJA 3IVTA 1XK4A 1W7IB 2KFGA 4Q04A 1BODA 2DOQA 1KQMC 1QASA 3EKHA 1BLQA 3D73A 2O60A 1L2OB 1CLMA 2MA2A 4HRGA 4CLNA 1N2DA 2EHBA 1JF2A 3EK7A 4QJ3B
chains in the Genus database with same CATH topology
3TUYB 1PALA 1BJFA 2LLSA 1WRKA 2JTTA 2EGDA 2LAPA 1GGZA 1NX3A 3OP0A 4DUQA 1IH0A 1XFYO 4GNKB 1DJGA 2ZFDA 2VRGA 1J55A 5D69A 3LL8B 3AAKA 4GPLB 5F6TA 1KK7Z 4AQIA 3OB2B 1B8CA 4L9MA 5DKNA 4ETOA 4NDCA 1CDNA 1SR6C 2JZIA 1ZFSA 3I5FC 5AXIA 1MQ1A 2BECA 5AFPA 2H61C 1B7TY 1NX1A 1NPQA 5AERA 4MLWA 1SPYA 1TTXA 4MRYA 1K96A 5HLVA 4MBEA 1Y1XA 1RECA 2I94A 3ZNIA 2BE4A 1RTP1 1KCYA 2OTGB 1QTXA 4PE0A 1V1FA 4ICBA 4XJKB 1BG1A 1BT6A 1JWDA 3KO0A 2KQ6A 1K95A 3VRNA 1CDPA 1KK8B 5B8IB 1S26D 2JPTA 4MVFA 4ORBB 1EXRA 1YTZC 4UPGA 3TDIA 3JVTB 1DJYA 4N1GA 2LHIA 1R6PA 1ZOTB 2LANA 1SMGA 1EG4A 1SY9A 2P6BB 2CT9A 4XJKA 1SL9A 3EK4A 3SJSA 3CGAA 1F71A 1DF0A 1G8IA 2JT8A 1WRLA 2G2BA 3GK1A 2JU0A 1K9PA 2M0RA 1NUBA 1XYDA 3EVUA 3OX5A 4JQ0D 3CTNA 5DKQA 1AJ4A 1NX2A 1SCMB 2KDHA 2L50A 1QV0A 2LE9B 4M2OA 4PE4A 5CSNA 2LVKA 5J3XA 1A29A 2JULA 1K94A 5CSJA 3AKAA 4JPZB 1N65A 1ZUZA 2QPTA 3K21A 4PHJA 1K2HA 2EC6C 4QJ4B 1K8UA 1ALVA 1H4BA 3DVJA 2Y5IA 4HRHA 2KYFA 2WOSA 3I5FB 2NLNA 1UWOA 2NCOA 1MF8B 4IL1A 2A4JA 3CS1A 1UHJA 2F2OA 2L4HA 1SL7A 5JOLA 1YR5A 4MEWA 1M31A 1YUTA 3TZ1A 2OS8B 1M63B 1CM1A 4BY4A 1CDLA 4WQ2A 4I5JA 3CR5X 1CFPA 1KFUL 1OOJA 3IQOA 1J7RA 1TN4A 1KK8C 1B7TZ 2L2EA 2K61A 1KQVA 4GUKA 1LKJA 1WDCC 1YRUB 2LLTA 3FS7A 1JF0A 1C7VA 1SCMC 1XFWO 5AANA 2KBMA 4OR9B 3SG3A 3SIAA 2H61A 1K9KA 1A03A 3TDUA 2L4IA 2LVVA 2GGMA 1FF1A 4YRUA 3PLFB 4I5LB 3BOWB 4NDBA 4ORAB 2KAYA 4WQ3A 1DJXA 1AP4A 2MBXA 1FI5A 2K7CA 1WY9A 1QXPA 2F8PA 1A75B 1LINA 1QVIY 1TNXA 2BKIB 4A4CA 1PVBA 2K7BA 3FWCA 1RJVA 4PDZA 2HPSA 2LM5A 2FCEA 2KGBC 3D0YA 1XVJA 2AMIA 3PM8A 2KHNA 3KHEA 5G08A 1LVCD 2Q4UA 4YGBB 2LLUA 3BQ3A 2COLB 4GFTA 1A4PA 2H2KA 3VRRA 1TIZA 1CM4A 2BCAA 1KSMA 3I5IB 1WDCB 5I2OA 2M1KB 2CCMA 2QACA 3F45A 3LK1A 2ZKMX 1S6JA 1EL4A 3O2PA 1K9UA 1PVAA 2BL0C 1ZMZA 4FTGA 5HKZA 1AJ5A 5PALA 2L5XB 1SW8A 1DVIA 2WC8A 3PN7C 3I5GC 4TNCA 2O5GA 1SR6B 1W7JB 1C07A 4OKHA 1C7WA 1KWOB 5IBWA 2HETA 3LLEA 2K8MB 1SBJA 1YUUA 5ER4X 4F0ZB 2NXQA 1KK7Y 5KU1A 1F70A 2KAVA 3SG6A 2LUXA 1DJWA 1OQPA 3I5GB 2FJUB 1TRFA 1A75A 4ZCVA 2BL0B 2JC2A 4MZJA 2E30A 4CFQA 1LA3A 1S1EA 4PE7A 3BOWA 1TNPA 1CMFA 3I5IC 2FOTA 1S3PA 1YVHA 2LMVA 3DF0B 1XO5A 2HQWA 1LXFC 1XFUO 2M1UA 3ZWHA 3HCMA 3O6BA 1TCFA 2K0JA 1QJTA 1IWQA 1RROA 2JT0A 2PASA 5ER5A 2LP2A 3SG5A 1U5IA 1B4CA 4P5OE 2JNFA 3H4SE 2FCDA 1OZOA 1LA0A 1OE9B 3EKJA 2PALA 3D10A 2D8NA 1XFXO 5TNCA 3GK4X 1L7ZA 4D1EA 3PSRA 1J1EA 1QX2A 3O78A 1CNPA 3NSKA 1J7QA 1UUSA 1CLLA 2PMYA 1KFXS 3NSIA 1OMRA 2KFFA 2MRDA 4HSZA 2CXJA 1MXEA 3SG4A 1QVIZ 1JSAA 2L51A 2SCPA 1B1GA 1OMDA 1PK0D 3C1VA 3QRXA 4R1EA 5HLOA 5HYDA 2BBNA 3CWGA 1PULA 1YX7A 2Y1NA 2ZN9A 3BUOB 1NIWA 1H8BA 4YI8A 3A4UB 4PHMA 4N1FA 2ZN8A 1Q80A 2LP3A 1QX5B 2KGRA 4JWQA 1QS7A 2JQ6A 1DMOA 1DT7B 1SKTA 3HX4A 4YGAA 3A8RA 2OS8C 1QLKA 1J7PA 1DJZA 1UP5A 2WCFA 2NZ0A 2E6WA 3DF0A 4I5KA 2K7DA 1B9AA 1EG3A 4MZLA 1NCYA 2Q91A 1TOPA 1KFXL 1ZACA 5AEQA 4HREE 4U8DA 3CR2A 1G33A 3JTDC 2F3YA 4YGCB 5CPVA 5DKRA 2IS9A 1SL8A 3WHUB 2KSPA 1BR1B 1YUSA 3IQQA 1OZSA 3EK8A 4DIRA 1L2OC 1MWNA 1RWYA 1OMVA 2JXCA 2LHLA 1J1DA 1CFFA 1SRAA 2KI4C 1R2UA 1PSRA 3DVMA 1Y1UA 4M2QA 2L0PA 1N0YA 4BY5A 2GGZA 3BUMB 1AHRA 2AUCA 1Y1AA 2M29A 2ZNDA 3VGOA 1YURA 2GV5A 2F33A 3PN7B 3PALA 3ICBA 4P2YB 4PHKA 5GQQC 5KTYA 1GQMA 1CMGA 3NSOA 1GJYA 1QATA 2KI4B 3VRPA 1F4QA 1TCOB 1S6IA 3TUYC 2I2RE 2ISDA 2F3ZA 2JTZA 1UHIA 1TNQA 4PE1A 4CPVA 2I7AA 3KF9A 1HT9A 3I5HB 2Y4QA 1IRJA 2JRFA 2AAOA 2KI6C 3IF7A 4PCWA 1UHNA 1HQVA 1D1OA 2PSRA 1F54A 1CTRA 2PVBA 1NSHA 1NWDA 4YBHB 1CDMA 1NX0A 2MLFC 3NSLA 4NQGA 2MJWB 1M39A 3BUWB 1WRZA 5FYXA 3BXKA 1BMOA 1NCZA 1M45A 1M46A 1CLBA 1CFDA 1BOCA 3TS5B 3FIAA 3CZTX 1ALWA 3OHMB 4GGNA 3CLNA 4N5XA 1IG5A 5CSFA 3D0YB 1KFUS 1BR4B 4WRIA 1RFJA 4YGDB 2KQYA 1QX7A 4C0JA 4CFRA 1PRWA 3MSEB 1UURA 1FW4A 2M3WA 2K7OA 1B8LA 2PRUA 3VRQA 5JJGA 4DCKA 1B47A 3RLZA 2JNXA 2ZRSA 5HKYA 2KOTA 1XK4C 1EJ3A 1NP8A 3E3RA 1NCXA 4QJ5B 1XFZO 1CB1A 1WLMA 3PFVA 1SCVA 3GOFA 1XA5A 1FBVA 1DGVA 4I5NB 2LVJA 4OVNF 2RGIA 5I8NA 5HKWA 4OV2A 1SK6D 1TNWA 1DJIA 1V1GA 1S5GY 2M49B 2ZRTA 3WXAA 2M97A 4GBAA 1OSAA 3I5HC 2JT3A 2BCXA 1RK9A 1EH2A 3KEVA 3LCPC 2V53A 3FWBA 4C0KA 1B8RA 1KSOA 1YX8A 2OPOA 2R2IA 3LK0A 1XFVO 1CFCA 1DF0B 3GK2A 2M9GA 4AQJA 3BUNB 2LVIA 3SIBA 2KBIA 2MLEC 2LUCA 1SYMA 2K2AA 3JTDB 3VROA 2KNEA 2L98A 2NCPA 4MN0A 1BU3A 1JFJA 2I18A 4GGFA 1U5IB 3TS5C 2WCBA 2ZNEA 1K90D 1NYAA 1UHHA 4ORCB 2HQ8A 4YI9A 4ZCUA 1WLZA 3KPXA 4M2PA 1KWOC 4MSPA 1MR8A 2WCEA 3CR4X 4PHNA 1K93D 2BCBA 1F55A 1JFKA 1X02A 3DVKA 4XYNA 1GGWA 1E8AA 5D7FA 2M7NA 2BBMA 2KYCA 1ODBA 3NXAA 1JC2A 3OB1B 2Y1MA 1J7OA 1IKUA 2M7LA 1IQ3A 1UHKA 1KQMB 2LC5A 2OTGC 1F4OA 4GGFC 1QV1A 2BKHB 2G9BA 3BYAA 4NDDA 1MXLC 5BPJA 1G4YR 2KAXA 3AAJA 2TN4A 3EVRA 1PSBA 3EVVA 3SG7A 3PATA 3WHTB 3BUXB 5KSZA 1SNLA 2CBLA 1MUXA 4YGEB 1JUOA 5K89A 2WNDA 1AVSA 1A2XA 2CNPA 1IGVA 1FPWA 4MZKA 1YVLA 1QLSA 4C0LA 1DJHA 2LMTA 4DRWA 2M8UA 1IQ5A 2LCPA 1F8HA 3AKBA 5I2QA 1QIVA 4USLA 3DVEA 3JVTC 2SASA 4CIDA 5CSIA 2EC6B 3TDZA 1CKKA 2KFHA 2JXLA 2KI6D 2MHHA 3OX6A 1S6CA 1MHOA 3RM1A 4AOMA 2LNKA 2F2PA 2JWWA 1AUIB 2HF5A 2CTNA 1DGUA 4FQOA 4DS7A 2LMUA 3DD4A 2BE6A 1FI6A 4OCIA 1IJ5A 1YRTB 1BF5A 4A4BA 2WORA 4E68A 3WNXB 1Y6WA 1QIWA 1S36A 1DTLA 2MAZA 1IJ6A 2LV7A 2B1UA 5I2LA 1VRKA 4GAOA 1JBAA 3M0WA 1S5GZ 3SG2A 2K2FA 4MRXA 3O4YA 1AK8A 1Y0VH 4PALA 2JOJA 4Q04A 1XK4A 1W7IB 2KFGA 1BODA 2DOQA 1KQMC 1QASA 3EKHA 1BLQA 2O60A 1L2OB 1CLMA 2MA2A 4HRGA 4CLNA 1N2DA 2EHBA 1JF2A 3EK7A 4QJ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUY B;  1PAL A;  1BJF A;  2LLS A;  1WRK A;  2JTT A;  2EGD A;  2LAP A;  1GGZ A;  1NX3 A;  3OP0 A;  4DUQ A;  1IH0 A;  1XFY O;  4GNK B;  1DJG A;  2ZFD A;  2VRG A;  1J55 A;  5D69 A;  3LL8 B;  3AAK A;  4GPL B;  5F6T A;  1KK7 Z;  4AQI A;  3OB2 B;  1B8C A;  4L9M A;  5DKN A;  4ETO A;  4NDC A;  1CDN A;  1SR6 C;  2JZI A;  1ZFS A;  3I5F C;  5AXI A;  1MQ1 A;  2BEC A;  5AFP A;  2H61 C;  1B7T Y;  1NX1 A;  1NPQ A;  5AER A;  4MLW A;  1SPY A;  1TTX A;  4MRY A;  1K96 A;  5HLV A;  4MBE A;  1Y1X A;  1REC A;  2I94 A;  3ZNI A;  2BE4 A;  1RTP 1;  1KCY A;  2OTG B;  1QTX A;  4PE0 A;  1V1F A;  4ICB A;  4XJK B;  1BG1 A;  1BT6 A;  1JWD A;  3KO0 A;  2KQ6 A;  1K95 A;  3VRN A;  1CDP A;  1KK8 B;  5B8I B;  1S26 D;  2JPT A;  4MVF A;  4ORB B;  1EXR A;  1YTZ C;  4UPG A;  3TDI A;  3JVT B;  1DJY A;  4N1G A;  2LHI A;  1R6P A;  1ZOT B;  2LAN A;  1SMG A;  1EG4 A;  1SY9 A;  2P6B B;  2CT9 A;  4XJK A;  1SL9 A;  3EK4 A;  3SJS A;  3CGA A;  1F71 A;  1DF0 A;  1G8I A;  2JT8 A;  1WRL A;  2G2B A;  3GK1 A;  2JU0 A;  1K9P A;  2M0R A;  1NUB A;  1XYD A;  3EVU A;  3OX5 A;  4JQ0 D;  3CTN A;  5DKQ A;  1AJ4 A;  1NX2 A;  1SCM B;  2KDH A;  2L50 A;  1QV0 A;  2LE9 B;  4M2O A;  4PE4 A;  5CSN A;  2LVK A;  5J3X A;  1A29 A;  2JUL A;  1K94 A;  5CSJ A;  3AKA A;  4JPZ B;  1N65 A;  1ZUZ A;  2QPT A;  3K21 A;  4PHJ A;  1K2H A;  2EC6 C;  4QJ4 B;  1K8U A;  1ALV A;  1H4B A;  3DVJ A;  2Y5I A;  4HRH A;  2KYF A;  2WOS A;  3I5F B;  2NLN A;  1UWO A;  2NCO A;  1MF8 B;  4IL1 A;  2A4J A;  3CS1 A;  1UHJ A;  2F2O A;  2L4H A;  1SL7 A;  5JOL A;  1YR5 A;  4MEW A;  1M31 A;  1YUT A;  3TZ1 A;  2OS8 B;  1M63 B;  1CM1 A;  4BY4 A;  1CDL A;  4WQ2 A;  4I5J A;  3CR5 X;  1CFP A;  1KFU L;  1OOJ A;  3IQO A;  1J7R A;  1TN4 A;  1KK8 C;  1B7T Z;  2L2E A;  2K61 A;  1KQV A;  4GUK A;  1LKJ A;  1WDC C;  1YRU B;  2LLT A;  3FS7 A;  1JF0 A;  1C7V A;  1SCM C;  1XFW O;  5AAN A;  2KBM A;  4OR9 B;  3SG3 A;  3SIA A;  2H61 A;  1K9K A;  1A03 A;  3TDU A;  2L4I A;  2LVV A;  2GGM A;  1FF1 A;  4YRU A;  3PLF B;  4I5L B;  3BOW B;  4NDB A;  4ORA B;  2KAY A;  4WQ3 A;  1DJX A;  1AP4 A;  2MBX A;  1FI5 A;  2K7C A;  1WY9 A;  1QXP A;  2F8P A;  1A75 B;  1LIN A;  1QVI Y;  1TNX A;  2BKI B;  4A4C A;  1PVB A;  2K7B A;  3FWC A;  1RJV A;  4PDZ A;  2HPS A;  2LM5 A;  2FCE A;  2KGB C;  3D0Y A;  1XVJ A;  2AMI A;  3PM8 A;  2KHN A;  3KHE A;  5G08 A;  1LVC D;  2Q4U A;  4YGB B;  2LLU A;  3BQ3 A;  2COL B;  4GFT A;  1A4P A;  2H2K A;  3VRR A;  1TIZ A;  1CM4 A;  2BCA A;  1KSM A;  3I5I B;  1WDC B;  5I2O A;  2M1K B;  2CCM A;  2QAC A;  3F45 A;  3LK1 A;  2ZKM X;  1S6J A;  1EL4 A;  3O2P A;  1K9U A;  1PVA A;  2BL0 C;  1ZMZ A;  4FTG A;  5HKZ A;  1AJ5 A;  5PAL A;  2L5X B;  1SW8 A;  1DVI A;  2WC8 A;  3PN7 C;  3I5G C;  4TNC A;  2O5G A;  1SR6 B;  1W7J B;  1C07 A;  4OKH A;  1C7W A;  1KWO B;  5IBW A;  2HET A;  3LLE A;  2K8M B;  1SBJ A;  1YUU A;  5ER4 X;  4F0Z B;  2NXQ A;  1KK7 Y;  5KU1 A;  1F70 A;  2KAV A;  3SG6 A;  2LUX A;  1DJW A;  1OQP A;  3I5G B;  2FJU B;  1TRF A;  1A75 A;  4ZCV A;  2BL0 B;  2JC2 A;  4MZJ A;  2E30 A;  4CFQ A;  1LA3 A;  1S1E A;  4PE7 A;  3BOW A;  1TNP A;  1CMF A;  3I5I C;  2FOT A;  1S3P A;  1YVH A;  2LMV A;  3DF0 B;  1XO5 A;  2HQW A;  1LXF C;  1XFU O;  2M1U A;  3ZWH A;  3HCM A;  3O6B A;  1TCF A;  2K0J A;  1QJT A;  1IWQ A;  1RRO A;  2JT0 A;  2PAS A;  5ER5 A;  2LP2 A;  3SG5 A;  1U5I A;  1B4C A;  4P5O E;  2JNF A;  3H4S E;  2FCD A;  1OZO A;  1LA0 A;  1OE9 B;  3EKJ A;  2PAL A;  3D10 A;  2D8N A;  1XFX O;  5TNC A;  3GK4 X;  1L7Z A;  4D1E A;  3PSR A;  1J1E A;  1QX2 A;  3O78 A;  1CNP A;  3NSK A;  1J7Q A;  1UUS A;  1CLL A;  2PMY A;  1KFX S;  3NSI A;  1OMR A;  2KFF A;  2MRD A;  4HSZ A;  2CXJ A;  1MXE A;  3SG4 A;  1QVI Z;  1JSA A;  2L51 A;  2SCP A;  1B1G A;  1OMD A;  1PK0 D;  3C1V A;  3QRX A;  4R1E A;  5HLO A;  5HYD A;  2BBN A;  3CWG A;  1PUL A;  1YX7 A;  2Y1N A;  2ZN9 A;  3BUO B;  1NIW A;  1H8B A;  4YI8 A;  3A4U B;  4PHM A;  4N1F A;  2ZN8 A;  1Q80 A;  2LP3 A;  1QX5 B;  2KGR A;  4JWQ A;  1QS7 A;  2JQ6 A;  1DMO A;  1DT7 B;  1SKT A;  3HX4 A;  4YGA A;  3A8R A;  2OS8 C;  1QLK A;  1J7P A;  1DJZ A;  1UP5 A;  2WCF A;  2NZ0 A;  2E6W A;  3DF0 A;  4I5K A;  2K7D A;  1B9A A;  1EG3 A;  4MZL A;  1NCY A;  2Q91 A;  1TOP A;  1KFX L;  1ZAC A;  5AEQ A;  4HRE E;  4U8D A;  3CR2 A;  1G33 A;  3JTD C;  2F3Y A;  4YGC B;  5CPV A;  5DKR A;  2IS9 A;  1SL8 A;  3WHU B;  2KSP A;  1BR1 B;  1YUS A;  3IQQ A;  1OZS A;  3EK8 A;  4DIR A;  1L2O C;  1MWN A;  1RWY A;  1OMV A;  2JXC A;  2LHL A;  1J1D A;  1CFF A;  1SRA A;  2KI4 C;  1R2U A;  1PSR A;  3DVM A;  1Y1U A;  4M2Q A;  2L0P A;  1N0Y A;  4BY5 A;  2GGZ A;  3BUM B;  1AHR A;  2AUC A;  1Y1A A;  2M29 A;  2ZND A;  3VGO A;  1YUR A;  2GV5 A;  2F33 A;  3PN7 B;  3PAL A;  3ICB A;  4P2Y B;  4PHK A;  5GQQ C;  5KTY A;  1GQM A;  1CMG A;  3NSO A;  1GJY A;  1QAT A;  2KI4 B;  3VRP A;  1F4Q A;  1TCO B;  1S6I A;  3TUY C;  2I2R E;  2ISD A;  2F3Z A;  2JTZ A;  1UHI A;  1TNQ A;  4PE1 A;  4CPV A;  2I7A A;  3KF9 A;  1HT9 A;  3I5H B;  2Y4Q A;  1IRJ A;  2JRF A;  2AAO A;  2KI6 C;  3IF7 A;  4PCW A;  1UHN A;  1HQV A;  1D1O A;  2PSR A;  1F54 A;  1CTR A;  2PVB A;  1NSH A;  1NWD A;  4YBH B;  1CDM A;  1NX0 A;  2MLF C;  3NSL A;  4NQG A;  2MJW B;  1M39 A;  3BUW B;  1WRZ A;  5FYX A;  3BXK A;  1BMO A;  1NCZ A;  1M45 A;  1M46 A;  1CLB A;  1CFD A;  1BOC A;  3TS5 B;  3FIA A;  3CZT X;  1ALW A;  3OHM B;  4GGN A;  3CLN A;  4N5X A;  1IG5 A;  5CSF A;  3D0Y B;  1KFU S;  1BR4 B;  4WRI A;  1RFJ A;  4YGD B;  2KQY A;  1QX7 A;  4C0J A;  4CFR A;  1PRW A;  3MSE B;  1UUR A;  1FW4 A;  2M3W A;  2K7O A;  1B8L A;  2PRU A;  3VRQ A;  5JJG A;  4DCK A;  1B47 A;  3RLZ A;  2JNX A;  2ZRS A;  5HKY A;  2KOT A;  1XK4 C;  1EJ3 A;  1NP8 A;  3E3R A;  1NCX A;  4QJ5 B;  1XFZ O;  1CB1 A;  1WLM A;  3PFV A;  1SCV A;  3GOF A;  1XA5 A;  1FBV A;  1DGV A;  4I5N B;  2LVJ A;  4OVN F;  2RGI A;  5I8N A;  5HKW A;  4OV2 A;  1SK6 D;  1TNW A;  1DJI A;  1V1G A;  1S5G Y;  2M49 B;  2ZRT A;  3WXA A;  2M97 A;  4GBA A;  1OSA A;  3I5H C;  2JT3 A;  2BCX A;  1RK9 A;  1EH2 A;  3KEV A;  3LCP C;  2V53 A;  3FWB A;  4C0K A;  1B8R A;  1KSO A;  1YX8 A;  2OPO A;  2R2I A;  3LK0 A;  1XFV O;  1CFC A;  1DF0 B;  3GK2 A;  2M9G A;  4AQJ A;  3BUN B;  2LVI A;  3SIB A;  2KBI A;  2MLE C;  2LUC A;  1SYM A;  2K2A A;  3JTD B;  3VRO A;  2KNE A;  2L98 A;  2NCP A;  4MN0 A;  1BU3 A;  1JFJ A;  2I18 A;  4GGF A;  1U5I B;  3TS5 C;  2WCB A;  2ZNE A;  1K90 D;  1NYA A;  1UHH A;  4ORC B;  2HQ8 A;  4YI9 A;  4ZCU A;  1WLZ A;  3KPX A;  4M2P A;  1KWO C;  4MSP A;  1MR8 A;  2WCE A;  3CR4 X;  4PHN A;  1K93 D;  2BCB A;  1F55 A;  1JFK A;  1X02 A;  3DVK A;  4XYN A;  1GGW A;  1E8A A;  5D7F A;  2M7N A;  2BBM A;  2KYC A;  1ODB A;  3NXA A;  1JC2 A;  3OB1 B;  2Y1M A;  1J7O A;  1IKU A;  2M7L A;  1IQ3 A;  1UHK A;  1KQM B;  2LC5 A;  2OTG C;  1F4O A;  4GGF C;  1QV1 A;  2BKH B;  2G9B A;  3BYA A;  4NDD A;  1MXL C;  5BPJ A;  1G4Y R;  2KAX A;  3AAJ A;  2TN4 A;  3EVR A;  1PSB A;  3EVV A;  3SG7 A;  3PAT A;  3WHT B;  3BUX B;  5KSZ A;  1SNL A;  2CBL A;  1MUX A;  4YGE B;  1JUO A;  5K89 A;  2WND A;  1AVS A;  1A2X A;  2CNP A;  1IGV A;  1FPW A;  4MZK A;  1YVL A;  1QLS A;  4C0L A;  1DJH A;  2LMT A;  4DRW A;  2M8U A;  1IQ5 A;  2LCP A;  1F8H A;  3AKB A;  5I2Q A;  1QIV A;  4USL A;  3DVE A;  3JVT C;  2SAS A;  4CID A;  5CSI A;  2EC6 B;  3TDZ A;  1CKK A;  2KFH A;  2JXL A;  2KI6 D;  2MHH A;  3OX6 A;  1S6C A;  1MHO A;  3RM1 A;  4AOM A;  2LNK A;  2F2P A;  2JWW A;  1AUI B;  2HF5 A;  2CTN A;  1DGU A;  4FQO A;  4DS7 A;  2LMU A;  3DD4 A;  2BE6 A;  1FI6 A;  4OCI A;  1IJ5 A;  1YRT B;  1BF5 A;  4A4B A;  2WOR A;  4E68 A;  3WNX B;  1Y6W A;  1QIW A;  1S36 A;  1DTL A;  2MAZ A;  1IJ6 A;  2LV7 A;  2B1U A;  5I2L A;  1VRK A;  4GAO A;  1JBA A;  3M0W A;  1S5G Z;  3SG2 A;  2K2F A;  4MRX A;  3O4Y A;  1AK8 A;  1Y0V H;  4PAL A;  2JOJ A;  4Q04 A;  1XK4 A;  1W7I B;  2KFG A;  1BOD A;  2DOQ A;  1KQM C;  1QAS A;  3EKH A;  1BLQ A;  2O60 A;  1L2O B;  1CLM A;  2MA2 A;  4HRG A;  4CLN A;  1N2D A;  2EHB A;  1JF2 A;  3EK7 A;  4QJ3 B; 
#chains in the Genus database with same CATH topology
 3TUY B;  1PAL A;  1BJF A;  2LLS A;  1WRK A;  2JTT A;  2EGD A;  2LAP A;  1GGZ A;  1NX3 A;  3OP0 A;  4DUQ A;  1IH0 A;  1XFY O;  4GNK B;  1DJG A;  2ZFD A;  2VRG A;  1J55 A;  5D69 A;  3LL8 B;  3AAK A;  4GPL B;  5F6T A;  1KK7 Z;  4AQI A;  3OB2 B;  1B8C A;  2WCM A;  4L9M A;  5DKN A;  4ETO A;  4NDC A;  1CDN A;  1SR6 C;  2JZI A;  1ZFS A;  3I5F C;  5AXI A;  1MQ1 A;  2WCL A;  3FE8 A;  2BEC A;  5AFP A;  2H61 C;  1B7T Y;  1NX1 A;  1NPQ A;  5AER A;  4MLW A;  1SPY A;  1TTX A;  4MRY A;  1K96 A;  5HLV A;  3R1P A;  1Y1X A;  4MBE A;  1REC A;  2I94 A;  3ZNI A;  2BE4 A;  1RTP 1;  3DZT A;  3UO9 A;  1KCY A;  2OTG B;  1QTX A;  4PE0 A;  1V1F A;  4ICB A;  4XJK B;  1BG1 A;  1BT6 A;  1JWD A;  3B86 A;  3KO0 A;  2KQ6 A;  3VB1 A;  1K95 A;  3VRN A;  1CDP A;  1KK8 B;  3S0G A;  1S26 D;  2JPT A;  3UNW A;  5B8I B;  4MVF A;  4ORB B;  1EXR A;  1YTZ C;  1DEK A;  4UPG A;  3TDI A;  3JVT B;  1DJY A;  4N1G A;  1Z4H A;  1DEL A;  2LHI A;  1R6P A;  1ZOT B;  2LAN A;  3OGN A;  1SMG A;  1EG4 A;  2WCH A;  1SY9 A;  2P6B B;  2CT9 A;  4XJK A;  1SL9 A;  3S0F A;  3EK4 A;  3SJS A;  3CGA A;  1F71 A;  1DF0 A;  1G8I A;  2JT8 A;  1WRL A;  2G2B A;  4PT1 A;  3GK1 A;  2JU0 A;  1K9P A;  2M0R A;  1NUB A;  1XYD A;  3EVU A;  1LS8 A;  3OX5 A;  4JQ0 D;  3CTN A;  4OZD A;  5DKQ A;  1AJ4 A;  1NX2 A;  1SCM B;  2KDH A;  2L50 A;  1QV0 A;  2LE9 B;  3QME A;  2KLD A;  4M2O A;  2LVK A;  4PE4 A;  1A29 A;  5CSN A;  2JUL A;  5J3X A;  1K94 A;  5CSJ A;  5FI2 A;  3AKA A;  4JPZ B;  3S0A A;  1N65 A;  1ZUZ A;  2QPT A;  1DC1 A;  3K21 A;  4PHJ A;  1K2H A;  2EC6 C;  4QJ4 B;  1K8U A;  1OOG A;  1ALV A;  1H4B A;  3DVJ A;  2Y5I A;  3FE9 A;  4HRH A;  2WC5 A;  2KYF A;  2WOS A;  3I5F B;  2NLN A;  1UWO A;  2NCO A;  1MF8 B;  4IL1 A;  2A4J A;  3CS1 A;  1UHJ A;  2F2O A;  2L4H A;  1SL7 A;  5JOL A;  1YR5 A;  4MEW A;  1M31 A;  1YUT A;  3TZ1 A;  2OS8 B;  1M63 B;  5FI6 A;  1CM1 A;  4BY4 A;  1CDL A;  2QEH A;  4WQ2 A;  4I5J A;  3CR5 X;  1CFP A;  1KFU L;  1OOJ A;  3IQO A;  1J7R A;  1TN4 A;  1KK8 C;  1B7T Z;  2L2E A;  2K61 A;  5I94 A;  1KQV A;  4GUK A;  1LKJ A;  1WDC C;  1YRU B;  2LLT A;  3FS7 A;  1JF0 A;  1C7V A;  1SCM C;  1XFW O;  5AAN A;  2KBM A;  4OR9 B;  1ORG A;  3SG3 A;  3SIA A;  2H61 A;  1K9K A;  1A03 A;  3OBV A;  3TDU A;  2BAP A;  2L4I A;  3Q8I A;  2LVV A;  2GGM A;  1FF1 A;  5DIC A;  4YRU A;  3PLF B;  1OOI X;  3BOW B;  4I5L B;  4NDB A;  2KAY A;  4ORA B;  1DJX A;  4WQ3 A;  2MBX A;  3SS3 A;  1FI5 A;  4IJ7 A;  2K7C A;  1WY9 A;  1QXP A;  2F8P A;  1A75 B;  1LIN A;  1QVI Y;  1TNX A;  2BKI B;  4A4C A;  1PVB A;  2K7B A;  3FWC A;  1RJV A;  4PDZ A;  2HPS A;  2LM5 A;  2FCE A;  2KGB C;  1OOH A;  3CZ1 A;  3D0Y A;  1XVJ A;  2AMI A;  3PM8 A;  2KHN A;  3KHE A;  5G08 A;  1LVC D;  2Q4U A;  4YGB B;  2LLU A;  3BQ3 A;  2COL B;  4GFT A;  1A4P A;  2H2K A;  3VRR A;  1TIZ A;  1CM4 A;  2BCA A;  1KSM A;  3I5I B;  1WDC B;  5I2O A;  2M1K B;  3R1V A;  2CCM A;  2QAC A;  3F45 A;  3LK1 A;  2ZKM X;  1S6J A;  3BFB A;  1EL4 A;  3O2P A;  1K9U A;  1PVA A;  2BL0 C;  1ZMZ A;  4FTG A;  5HKZ A;  1AJ5 A;  5PAL A;  2L5X B;  1SW8 A;  1DVI A;  2WC8 A;  3PN7 C;  3I5G C;  4TNC A;  1SSE B;  2O5G A;  1SR6 B;  3D76 A;  1W7J B;  1C07 A;  4OKH A;  4FQT A;  1C7W A;  1KWO B;  5IBW A;  2HET A;  3B6X A;  2K60 A;  3LLE A;  2K8M B;  1SBJ A;  1YUU A;  3CZ0 A;  5ER4 X;  2P70 A;  2ERB A;  4F0Z B;  2NXQ A;  1KK7 Y;  5KU1 A;  1F70 A;  2KAV A;  3SG6 A;  2LUX A;  3B88 A;  1DJW A;  1OQP A;  3I5G B;  2FJU B;  1TRF A;  1A75 A;  4ZCV A;  2BL0 B;  2JC2 A;  4MZJ A;  2E30 A;  3O4X A;  4CFQ A;  1LA3 A;  1S1E A;  1P28 A;  4PE7 A;  3S0B A;  3BOW A;  1TNP A;  1C3Z A;  3NHI A;  1CMF A;  3I5I C;  2FOT A;  1S3P A;  1YVH A;  2LMV A;  3DF0 B;  1XO5 A;  2HQW A;  1LXF C;  1XFU O;  2M1U A;  3ZWH A;  2GTE A;  3HCM A;  3L4L A;  3O6B A;  1TCF A;  2K0J A;  1QJT A;  1IWQ A;  1RRO A;  2JT0 A;  2PAS A;  5ER5 A;  2LP2 A;  3SG5 A;  1U5I A;  1B4C A;  3D75 A;  4P5O E;  2JNF A;  3H4S E;  2FCD A;  1OZO A;  1LA0 A;  1OE9 B;  1OOF A;  3EKJ A;  3S0D A;  2PAL A;  3D10 A;  2D8N A;  1XFX O;  5TNC A;  5FI7 A;  3GK4 X;  1L7Z A;  4D1E A;  3CYZ A;  1J1E A;  1QX2 A;  3D74 A;  3O78 A;  3PSR A;  1CNP A;  3NSK A;  2WCJ A;  1J7Q A;  1UUS A;  1CLL A;  2PMY A;  1KFX S;  3NSI A;  1OMR A;  2KFF A;  2MRD A;  3CZ2 A;  2CXJ A;  1MXE A;  4HSZ A;  1QVI Z;  3SG4 A;  1JSA A;  2L51 A;  2SCP A;  1B1G A;  1OMD A;  1PK0 D;  3C1V A;  3QRX A;  4R1E A;  5HLO A;  4F7F A;  5HYD A;  1TWO A;  2BBN A;  3CWG A;  1PUL A;  1YX7 A;  3CDN A;  4JKT A;  2Y1N A;  2ZN9 A;  3BUO B;  1NIW A;  1H8B A;  4YI8 A;  2QDI A;  3A4U B;  4PHM A;  4N1F A;  2ZN8 A;  1Q80 A;  2LP3 A;  1QX5 B;  2KGR A;  4JWQ A;  1QS7 A;  2JQ6 A;  1DMO A;  1DT7 B;  1SKT A;  3HX4 A;  4YGA A;  3A8R A;  2OS8 C;  1QLK A;  2KLE A;  1DJZ A;  2QEB A;  1UP5 A;  1J7P A;  2WCF A;  2PYQ A;  2NZ0 A;  2E6W A;  3DF0 A;  4I5K A;  1GM0 A;  2K7D A;  1B9A A;  1EG3 A;  4MZL A;  1NCY A;  1QWV A;  2Q91 A;  1Z2C B;  1TOP A;  1KFX L;  1ZAC A;  5AEQ A;  4HRE E;  4U8D A;  1W9Z A;  3CR2 A;  1G33 A;  3JTD C;  2F3Y A;  4YGC B;  5CPV A;  5DKR A;  2IS9 A;  1SL8 A;  3WHU B;  2KSP A;  1BR1 B;  1YUS A;  2JPO A;  3IQQ A;  1OZS A;  3EK8 A;  4DIR A;  1L2O C;  1MWN A;  1RWY A;  1OMV A;  2JXC A;  2LHL A;  3BFA A;  1J1D A;  2L5Y A;  1CFF A;  1SRA A;  2H8V A;  2KI4 C;  1R2U A;  1PSR A;  3DVM A;  1Y1U A;  4M2Q A;  2L0P A;  1N0Y A;  4BY5 A;  1TUJ A;  2GGZ A;  3BUM B;  1AHR A;  2AUC A;  1Y1A A;  2M29 A;  2ZND A;  4KYN A;  1YUR A;  3S0E A;  3VGO A;  2GV5 A;  3SS4 A;  2F33 A;  3PN7 B;  3PAL A;  3ICB A;  4P2Y B;  4PHK A;  5GQQ C;  5KTY A;  1GQM A;  1CMG A;  3NSO A;  1GJY A;  1QAT A;  3NGV A;  2KI4 B;  3VRP A;  1F4Q A;  1TCO B;  3V2L A;  1S6I A;  3TUY C;  2QEV A;  2I2R E;  2ISD A;  2F3Z A;  2JTZ A;  1UHI A;  1TNQ A;  4PE1 A;  4CPV A;  2I7A A;  3KF9 A;  1HT9 A;  3DXL A;  3I5H B;  4INW A;  2Y4Q A;  1IRJ A;  2JRF A;  2AAO A;  2KI6 C;  3IF7 A;  4PCW A;  1UHN A;  1HQV A;  1D1O A;  2PSR A;  1F54 A;  1CTR A;  1OW4 A;  1XFR A;  2PVB A;  1NSH A;  1NWD A;  4YBH B;  1CDM A;  1NX0 A;  2MLF C;  3NSL A;  4NQG A;  2MJW B;  1M39 A;  3BUW B;  1IIO A;  1WRZ A;  5FYX A;  3BXK A;  1BMO A;  1NCZ A;  1M45 A;  1M46 A;  1CLB A;  1CFD A;  1BOC A;  3TS5 B;  3FIA A;  2BNX A;  3CZT X;  1ALW A;  3OHM B;  4GGN A;  3CLN A;  4N5X A;  1IG5 A;  5CSF A;  3D0Y B;  3DYE A;  1KFU S;  1BR4 B;  4WRI A;  1RFJ A;  4YGD B;  2KQY A;  1QX7 A;  4C0J A;  4CFR A;  1PRW A;  3MSE B;  1UUR A;  3K1E A;  1FW4 A;  2M3W A;  2K7O A;  1B8L A;  2PRU A;  3VRQ A;  5JJG A;  4DCK A;  1B47 A;  3RLZ A;  2JNX A;  2ZRS A;  5HKY A;  2KOT A;  1XK4 C;  1EJ3 A;  1NP8 A;  3E3R A;  2PQL A;  1NCX A;  3B7A A;  4QJ5 B;  1XFZ O;  1CB1 A;  1WLM A;  3PFV A;  1SCV A;  3GOF A;  1XA5 A;  1FBV A;  1DGV A;  4I5N B;  2LVJ A;  4OVN F;  3R1O A;  2RGI A;  3BJH A;  5HKW A;  2WC6 A;  5I8N A;  4OV2 A;  1SK6 D;  1TNW A;  1DJI A;  1V1G A;  1S5G Y;  2M49 B;  2ZRT A;  3WXA A;  2M97 A;  4GBA A;  2WCK A;  3L4A A;  1OSA A;  3I5H C;  2JT3 A;  2BCX A;  1RK9 A;  3PJI A;  3KEV A;  3LCP C;  1EH2 A;  2V53 A;  3FWB A;  4C0K A;  1B8R A;  1KSO A;  1YX8 A;  2OPO A;  2R2I A;  3LK0 A;  1XFV O;  1T14 A;  1DF0 B;  3GK2 A;  1AP4 A;  1CFC A;  2M9G A;  4AQJ A;  3BUN B;  2LVI A;  3SIB A;  1TUZ A;  2KBI A;  2LUC A;  1SYM A;  2K2A A;  2MLE C;  3JTD B;  3VRO A;  2KNE A;  2L98 A;  2NCP A;  3L47 A;  4MN0 A;  1BU3 A;  2YGU A;  1JFJ A;  2I18 A;  4GGF A;  1U5I B;  3TS5 C;  2WCB A;  2ZNE A;  1K90 D;  1NYA A;  1UHH A;  4ORC B;  2HQ8 A;  4YI9 A;  4JD9 A;  4ZCU A;  1WLZ A;  3KPX A;  4M2P A;  3RZS A;  1KWO C;  4MSP A;  1MR8 A;  2WCE A;  3CR4 X;  3D77 A;  4PHN A;  1K93 D;  2BCB A;  1F55 A;  1JFK A;  1X02 A;  3DVK A;  2KPH A;  4XYN A;  1GGW A;  1E8A A;  5D7F A;  2M7N A;  2BBM A;  2KYC A;  1ODB A;  3NXA A;  1JC2 A;  5D3O A;  3OB1 B;  2Y1M A;  1J7O A;  1IKU A;  2M7L A;  1IQ3 A;  1UHK A;  1KQM B;  2LC5 A;  2OTG C;  1F4O A;  3B87 A;  4GGF C;  5EL2 A;  3D78 A;  1QV1 A;  2BKH B;  2G9B A;  2P71 A;  3BYA A;  4NDD A;  1MXL C;  5BPJ A;  1G4Y R;  2KAX A;  3AAJ A;  2TN4 A;  3EVR A;  3N7H A;  1PSB A;  3DY9 A;  3EVV A;  3SG7 A;  3PAT A;  3WHT B;  3BUX B;  5KSZ A;  1SNL A;  2CBL A;  1MUX A;  2FJY A;  1JUO A;  4YGE B;  5K89 A;  2WND A;  2L2C A;  1AVS A;  1A2X A;  2CNP A;  1IGV A;  3SS5 A;  1FPW A;  4MZK A;  1YVL A;  3BFH A;  1QLS A;  4C0L A;  1DJH A;  2LMT A;  4DRW A;  2M8U A;  1IQ5 A;  2LCP A;  1F8H A;  3AKB A;  5I2Q A;  1QIV A;  4USL A;  3DVE A;  3JVT C;  2SAS A;  4CID A;  5CSI A;  2EC6 B;  3TDZ A;  3EG5 B;  1CKK A;  2KFH A;  2JXL A;  2KI6 D;  2MHH A;  3NHT A;  3OX6 A;  1S6C A;  1MHO A;  3RM1 A;  1DQE A;  4AOM A;  2LNK A;  2QEO A;  2F2P A;  3FE6 A;  2JWW A;  1AUI B;  2HF5 A;  2CTN A;  1DGU A;  4FQO A;  4DS7 A;  5HL1 A;  2LMU A;  3DD4 A;  2BE6 A;  1FI6 A;  4OCI A;  1IJ5 A;  1YRT B;  1BF5 A;  4INX A;  2WOR A;  4A4B A;  4E68 A;  3PM2 A;  3WNX B;  1Y6W A;  1QIW A;  1S36 A;  1DTL A;  2MAZ A;  3CAB A;  1IJ6 A;  2LV7 A;  2B1U A;  5I2L A;  1VRK A;  4GAO A;  1JBA A;  3M0W A;  1S5G Z;  3SG2 A;  2K2F A;  4MRX A;  3O4Y A;  1AK8 A;  1C3Y A;  1Y0V H;  4PAL A;  3R72 A;  2JOJ A;  3IVT A;  1XK4 A;  1W7I B;  2KFG A;  4Q04 A;  1BOD A;  2DOQ A;  1KQM C;  1QAS A;  3EKH A;  1BLQ A;  3D73 A;  2O60 A;  1L2O B;  1CLM A;  2MA2 A;  4HRG A;  4CLN A;  1N2D A;  2EHB A;  1JF2 A;  3EK7 A;  4QJ3 B; 
#chains in the Genus database with same CATH homology
 3TUY B;  1PAL A;  1BJF A;  2LLS A;  1WRK A;  2JTT A;  2EGD A;  2LAP A;  1GGZ A;  1NX3 A;  3OP0 A;  4DUQ A;  1IH0 A;  1XFY O;  4GNK B;  1DJG A;  2ZFD A;  2VRG A;  1J55 A;  5D69 A;  3LL8 B;  3AAK A;  4GPL B;  5F6T A;  1KK7 Z;  4AQI A;  3OB2 B;  1B8C A;  4L9M A;  5DKN A;  4ETO A;  4NDC A;  1CDN A;  1SR6 C;  2JZI A;  1ZFS A;  3I5F C;  5AXI A;  1MQ1 A;  2BEC A;  5AFP A;  2H61 C;  1B7T Y;  1NX1 A;  1NPQ A;  5AER A;  4MLW A;  1SPY A;  1TTX A;  4MRY A;  1K96 A;  5HLV A;  4MBE A;  1Y1X A;  1REC A;  2I94 A;  3ZNI A;  2BE4 A;  1RTP 1;  1KCY A;  2OTG B;  1QTX A;  4PE0 A;  1V1F A;  4ICB A;  4XJK B;  1BG1 A;  1BT6 A;  1JWD A;  3KO0 A;  2KQ6 A;  1K95 A;  3VRN A;  1CDP A;  1KK8 B;  5B8I B;  1S26 D;  2JPT A;  4MVF A;  4ORB B;  1EXR A;  1YTZ C;  4UPG A;  3TDI A;  3JVT B;  1DJY A;  4N1G A;  2LHI A;  1R6P A;  1ZOT B;  2LAN A;  1SMG A;  1EG4 A;  1SY9 A;  2P6B B;  2CT9 A;  4XJK A;  1SL9 A;  3EK4 A;  3SJS A;  3CGA A;  1F71 A;  1DF0 A;  1G8I A;  2JT8 A;  1WRL A;  2G2B A;  3GK1 A;  2JU0 A;  1K9P A;  2M0R A;  1NUB A;  1XYD A;  3EVU A;  3OX5 A;  4JQ0 D;  3CTN A;  5DKQ A;  1AJ4 A;  1NX2 A;  1SCM B;  2KDH A;  2L50 A;  1QV0 A;  2LE9 B;  4M2O A;  4PE4 A;  5CSN A;  2LVK A;  5J3X A;  1A29 A;  2JUL A;  1K94 A;  5CSJ A;  3AKA A;  4JPZ B;  1N65 A;  1ZUZ A;  2QPT A;  3K21 A;  4PHJ A;  1K2H A;  2EC6 C;  4QJ4 B;  1K8U A;  1ALV A;  1H4B A;  3DVJ A;  2Y5I A;  4HRH A;  2KYF A;  2WOS A;  3I5F B;  2NLN A;  1UWO A;  2NCO A;  1MF8 B;  4IL1 A;  2A4J A;  3CS1 A;  1UHJ A;  2F2O A;  2L4H A;  1SL7 A;  5JOL A;  1YR5 A;  4MEW A;  1M31 A;  1YUT A;  3TZ1 A;  2OS8 B;  1M63 B;  1CM1 A;  4BY4 A;  1CDL A;  4WQ2 A;  4I5J A;  3CR5 X;  1CFP A;  1KFU L;  1OOJ A;  3IQO A;  1J7R A;  1TN4 A;  1KK8 C;  1B7T Z;  2L2E A;  2K61 A;  1KQV A;  4GUK A;  1LKJ A;  1WDC C;  1YRU B;  2LLT A;  3FS7 A;  1JF0 A;  1C7V A;  1SCM C;  1XFW O;  5AAN A;  2KBM A;  4OR9 B;  3SG3 A;  3SIA A;  2H61 A;  1K9K A;  1A03 A;  3TDU A;  2L4I A;  2LVV A;  2GGM A;  1FF1 A;  4YRU A;  3PLF B;  4I5L B;  3BOW B;  4NDB A;  4ORA B;  2KAY A;  4WQ3 A;  1DJX A;  1AP4 A;  2MBX A;  1FI5 A;  2K7C A;  1WY9 A;  1QXP A;  2F8P A;  1A75 B;  1LIN A;  1QVI Y;  1TNX A;  2BKI B;  4A4C A;  1PVB A;  2K7B A;  3FWC A;  1RJV A;  4PDZ A;  2HPS A;  2LM5 A;  2FCE A;  2KGB C;  3D0Y A;  1XVJ A;  2AMI A;  3PM8 A;  2KHN A;  3KHE A;  5G08 A;  1LVC D;  2Q4U A;  4YGB B;  2LLU A;  3BQ3 A;  2COL B;  4GFT A;  1A4P A;  2H2K A;  3VRR A;  1TIZ A;  1CM4 A;  2BCA A;  1KSM A;  3I5I B;  1WDC B;  5I2O A;  2M1K B;  2CCM A;  2QAC A;  3F45 A;  3LK1 A;  2ZKM X;  1S6J A;  1EL4 A;  3O2P A;  1K9U A;  1PVA A;  2BL0 C;  1ZMZ A;  4FTG A;  5HKZ A;  1AJ5 A;  5PAL A;  2L5X B;  1SW8 A;  1DVI A;  2WC8 A;  3PN7 C;  3I5G C;  4TNC A;  2O5G A;  1SR6 B;  1W7J B;  1C07 A;  4OKH A;  1C7W A;  1KWO B;  5IBW A;  2HET A;  3LLE A;  2K8M B;  1SBJ A;  1YUU A;  5ER4 X;  4F0Z B;  2NXQ A;  1KK7 Y;  5KU1 A;  1F70 A;  2KAV A;  3SG6 A;  2LUX A;  1DJW A;  1OQP A;  3I5G B;  2FJU B;  1TRF A;  1A75 A;  4ZCV A;  2BL0 B;  2JC2 A;  4MZJ A;  2E30 A;  4CFQ A;  1LA3 A;  1S1E A;  4PE7 A;  3BOW A;  1TNP A;  1CMF A;  3I5I C;  2FOT A;  1S3P A;  1YVH A;  2LMV A;  3DF0 B;  1XO5 A;  2HQW A;  1LXF C;  1XFU O;  2M1U A;  3ZWH A;  3HCM A;  3O6B A;  1TCF A;  2K0J A;  1QJT A;  1IWQ A;  1RRO A;  2JT0 A;  2PAS A;  5ER5 A;  2LP2 A;  3SG5 A;  1U5I A;  1B4C A;  4P5O E;  2JNF A;  3H4S E;  2FCD A;  1OZO A;  1LA0 A;  1OE9 B;  3EKJ A;  2PAL A;  3D10 A;  2D8N A;  1XFX O;  5TNC A;  3GK4 X;  1L7Z A;  4D1E A;  3PSR A;  1J1E A;  1QX2 A;  3O78 A;  1CNP A;  3NSK A;  1J7Q A;  1UUS A;  1CLL A;  2PMY A;  1KFX S;  3NSI A;  1OMR A;  2KFF A;  2MRD A;  4HSZ A;  2CXJ A;  1MXE A;  3SG4 A;  1QVI Z;  1JSA A;  2L51 A;  2SCP A;  1B1G A;  1OMD A;  1PK0 D;  3C1V A;  3QRX A;  4R1E A;  5HLO A;  5HYD A;  2BBN A;  3CWG A;  1PUL A;  1YX7 A;  2Y1N A;  2ZN9 A;  3BUO B;  1NIW A;  1H8B A;  4YI8 A;  3A4U B;  4PHM A;  4N1F A;  2ZN8 A;  1Q80 A;  2LP3 A;  1QX5 B;  2KGR A;  4JWQ A;  1QS7 A;  2JQ6 A;  1DMO A;  1DT7 B;  1SKT A;  3HX4 A;  4YGA A;  3A8R A;  2OS8 C;  1QLK A;  1J7P A;  1DJZ A;  1UP5 A;  2WCF A;  2NZ0 A;  2E6W A;  3DF0 A;  4I5K A;  2K7D A;  1B9A A;  1EG3 A;  4MZL A;  1NCY A;  2Q91 A;  1TOP A;  1KFX L;  1ZAC A;  5AEQ A;  4HRE E;  4U8D A;  3CR2 A;  1G33 A;  3JTD C;  2F3Y A;  4YGC B;  5CPV A;  5DKR A;  2IS9 A;  1SL8 A;  3WHU B;  2KSP A;  1BR1 B;  1YUS A;  3IQQ A;  1OZS A;  3EK8 A;  4DIR A;  1L2O C;  1MWN A;  1RWY A;  1OMV A;  2JXC A;  2LHL A;  1J1D A;  1CFF A;  1SRA A;  2KI4 C;  1R2U A;  1PSR A;  3DVM A;  1Y1U A;  4M2Q A;  2L0P A;  1N0Y A;  4BY5 A;  2GGZ A;  3BUM B;  1AHR A;  2AUC A;  1Y1A A;  2M29 A;  2ZND A;  3VGO A;  1YUR A;  2GV5 A;  2F33 A;  3PN7 B;  3PAL A;  3ICB A;  4P2Y B;  4PHK A;  5GQQ C;  5KTY A;  1GQM A;  1CMG A;  3NSO A;  1GJY A;  1QAT A;  2KI4 B;  3VRP A;  1F4Q A;  1TCO B;  1S6I A;  3TUY C;  2I2R E;  2ISD A;  2F3Z A;  2JTZ A;  1UHI A;  1TNQ A;  4PE1 A;  4CPV A;  2I7A A;  3KF9 A;  1HT9 A;  3I5H B;  2Y4Q A;  1IRJ A;  2JRF A;  2AAO A;  2KI6 C;  3IF7 A;  4PCW A;  1UHN A;  1HQV A;  1D1O A;  2PSR A;  1F54 A;  1CTR A;  2PVB A;  1NSH A;  1NWD A;  4YBH B;  1CDM A;  1NX0 A;  2MLF C;  3NSL A;  4NQG A;  2MJW B;  1M39 A;  3BUW B;  1WRZ A;  5FYX A;  3BXK A;  1BMO A;  1NCZ A;  1M45 A;  1M46 A;  1CLB A;  1CFD A;  1BOC A;  3TS5 B;  3FIA A;  3CZT X;  1ALW A;  3OHM B;  4GGN A;  3CLN A;  4N5X A;  1IG5 A;  5CSF A;  3D0Y B;  1KFU S;  1BR4 B;  4WRI A;  1RFJ A;  4YGD B;  2KQY A;  1QX7 A;  4C0J A;  4CFR A;  1PRW A;  3MSE B;  1UUR A;  1FW4 A;  2M3W A;  2K7O A;  1B8L A;  2PRU A;  3VRQ A;  5JJG A;  4DCK A;  1B47 A;  3RLZ A;  2JNX A;  2ZRS A;  5HKY A;  2KOT A;  1XK4 C;  1EJ3 A;  1NP8 A;  3E3R A;  1NCX A;  4QJ5 B;  1XFZ O;  1CB1 A;  1WLM A;  3PFV A;  1SCV A;  3GOF A;  1XA5 A;  1FBV A;  1DGV A;  4I5N B;  2LVJ A;  4OVN F;  2RGI A;  5I8N A;  5HKW A;  4OV2 A;  1SK6 D;  1TNW A;  1DJI A;  1V1G A;  1S5G Y;  2M49 B;  2ZRT A;  3WXA A;  2M97 A;  4GBA A;  1OSA A;  3I5H C;  2JT3 A;  2BCX A;  1RK9 A;  1EH2 A;  3KEV A;  3LCP C;  2V53 A;  3FWB A;  4C0K A;  1B8R A;  1KSO A;  1YX8 A;  2OPO A;  2R2I A;  3LK0 A;  1XFV O;  1CFC A;  1DF0 B;  3GK2 A;  2M9G A;  4AQJ A;  3BUN B;  2LVI A;  3SIB A;  2KBI A;  2MLE C;  2LUC A;  1SYM A;  2K2A A;  3JTD B;  3VRO A;  2KNE A;  2L98 A;  2NCP A;  4MN0 A;  1BU3 A;  1JFJ A;  2I18 A;  4GGF A;  1U5I B;  3TS5 C;  2WCB A;  2ZNE A;  1K90 D;  1NYA A;  1UHH A;  4ORC B;  2HQ8 A;  4YI9 A;  4ZCU A;  1WLZ A;  3KPX A;  4M2P A;  1KWO C;  4MSP A;  1MR8 A;  2WCE A;  3CR4 X;  4PHN A;  1K93 D;  2BCB A;  1F55 A;  1JFK A;  1X02 A;  3DVK A;  4XYN A;  1GGW A;  1E8A A;  5D7F A;  2M7N A;  2BBM A;  2KYC A;  1ODB A;  3NXA A;  1JC2 A;  3OB1 B;  2Y1M A;  1J7O A;  1IKU A;  2M7L A;  1IQ3 A;  1UHK A;  1KQM B;  2LC5 A;  2OTG C;  1F4O A;  4GGF C;  1QV1 A;  2BKH B;  2G9B A;  3BYA A;  4NDD A;  1MXL C;  5BPJ A;  1G4Y R;  2KAX A;  3AAJ A;  2TN4 A;  3EVR A;  1PSB A;  3EVV A;  3SG7 A;  3PAT A;  3WHT B;  3BUX B;  5KSZ A;  1SNL A;  2CBL A;  1MUX A;  4YGE B;  1JUO A;  5K89 A;  2WND A;  1AVS A;  1A2X A;  2CNP A;  1IGV A;  1FPW A;  4MZK A;  1YVL A;  1QLS A;  4C0L A;  1DJH A;  2LMT A;  4DRW A;  2M8U A;  1IQ5 A;  2LCP A;  1F8H A;  3AKB A;  5I2Q A;  1QIV A;  4USL A;  3DVE A;  3JVT C;  2SAS A;  4CID A;  5CSI A;  2EC6 B;  3TDZ A;  1CKK A;  2KFH A;  2JXL A;  2KI6 D;  2MHH A;  3OX6 A;  1S6C A;  1MHO A;  3RM1 A;  4AOM A;  2LNK A;  2F2P A;  2JWW A;  1AUI B;  2HF5 A;  2CTN A;  1DGU A;  4FQO A;  4DS7 A;  2LMU A;  3DD4 A;  2BE6 A;  1FI6 A;  4OCI A;  1IJ5 A;  1YRT B;  1BF5 A;  4A4B A;  2WOR A;  4E68 A;  3WNX B;  1Y6W A;  1QIW A;  1S36 A;  1DTL A;  2MAZ A;  1IJ6 A;  2LV7 A;  2B1U A;  5I2L A;  1VRK A;  4GAO A;  1JBA A;  3M0W A;  1S5G Z;  3SG2 A;  2K2F A;  4MRX A;  3O4Y A;  1AK8 A;  1Y0V H;  4PAL A;  2JOJ A;  4Q04 A;  1XK4 A;  1W7I B;  2KFG A;  1BOD A;  2DOQ A;  1KQM C;  1QAS A;  3EKH A;  1BLQ A;  2O60 A;  1L2O B;  1CLM A;  2MA2 A;  4HRG A;  4CLN A;  1N2D A;  2EHB A;  1JF2 A;  3EK7 A;  4QJ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...