1M63B

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m63B00
2PRUA 1L2OC 4M2QA 4YGBB 1J55A 4N5XA 1B7TZ 2OTGC 1QV0A 1TNQA 1XYDA 2JQ6A 4GFTA 1IQ5A 1UP5A 4WQ2A 2KYFA 2JTZA 1ALVA 2LHIA 1JBAA 1S26D 5AFPA 1ZFSA 5HLVA 3DVMA 4ORBB 2QACA 1F70A 3I5GB 5D7FA 3KEVA 1J7QA 2E30A 3GK4X 4FQOA 3RLZA 1SR6B 1SW8A 5JOLA 1NSHA 1IJ5A 3PN7B 3VRRA 5HKZA 1UUSA 1K94A 1SK6D 1PK0D 2OS8C 4M2OA 1IJ6A 5CSIA 3ZWHA 2LHLA 3TUYB 2G2BA 1CTRA 2HQ8A 1TOPA 4Q04A 1NX0A 2BCXA 3NSIA 1WRZA 2MA2A 4P2YB 4PE7A 2K7OA 1B8RA 1XO5A 4YBHB 4BY5A 1UWOA 2MLFC 1J7OA 2ZNEA 1OZSA 3SG6A 3DD4A 2WCBA 4L9MA 1SL8A 2BE6A 3GOFA 1LINA 3SG4A 4YGAA 1SYMA 3TS5C 2LLUA 3PFVA 2JT3A 2K2AA 3EVUA 3ICBA 1QX2A 2LANA 4MZLA 1PULA 1CNPA 3A8RA 1Q80A 3SG7A 4F0ZB 3JVTC 1LXFC 2K8MB 2KI4C 3LK1A 1IG5A 4AQIA 1IWQA 1PVBA 2LNKA 3JTDC 4M2PA 2JU0A 2MRDA 1YUTA 5HLOA 2F2PA 1DGVA 1OOJA 4A4BA 3DVJA 3GK2A 3OB1B 3OX6A 2FJUB 4GAOA 1OMRA 1J1DA 1RJVA 2LCPA 5HYDA 1C7WA 2O5GA 2L0PA 1B47A 1MWNA 1NUBA 5HKYA 3KO0A 1JF2A 1B4CA 1S36A 1UHIA 3EKHA 4I5LB 3PSRA 1B8LA 3CS1A 1M46A 1ZMZA 2VRGA 1A29A 2KFGA 1N0YA 1AVSA 1XA5A 2L98A 2O60A 1ZUZA 1MXLC 2EC6B 3BUOB 1XFVO 1AUIB 1OZOA 4WQ3A 2DOQA 1DT7B 4I5JA 3OP0A 1NWDA 2JNFA 1FF1A 2ZN9A 1MF8B 2R2IA 4DIRA 4ZCUA 1UHNA 1WLMA 5I2QA 1A03A 2K2FA 1SNLA 1KWOB 3CGAA 2RGIA 2KOTA 5ER4X 1M39A 3VGOA 1FPWA 2KGRA 5D69A 3AKBA 2V53A 3I5IB 2M7LA 2LMVA 1S5GY 1N65A 1SR6C 1A4PA 3IQOA 4PALA 1DMOA 1YX8A 2CNPA 3PN7C 2FOTA 3IF7A 3RM1A 2LMUA 2BCAA 4ORAB 3D0YA 5I2OA 1IGVA 2KHNA 5KU1A 1CDLA 3I5FB 1DJGA 1YRUB 2NLNA 4PCWA 2E6WA 1JSAA 1BR4B 2KYCA 3OX5A 1H4BA 1KQVA 4DRWA 4OV2A 2KBIA 4MSPA 5AEQA 1CFCA 3TDZA 2LLTA 2M1KB 1CB1A 1DF0A 3CR4X 1A2XA 2CTNA 1AJ5A 1B9AA 1J7PA 1R2UA 2F33A 5G08A 1TIZA 1J7RA 1ZACA 3AAJA 3FIAA 2HETA 1SCMB 2LP3A 2BBNA 3VROA 1DJWA 4PHMA 4CPVA 2KAXA 5CSFA 2M0RA 2FCDA 3AAKA 1M63B 5DKNA 1YR5A 2PALA 1B1GA 1FI6A 3SG3A 1TCOB 1R6PA 4DCKA 1XK4C 3FWCA 1CMFA 1JF0A 4QJ4B 2GGMA 1OMVA 1MHOA 3TDIA 2EHBA 3WHTB 1KFUS 1GGZA 3BOWB 2EGDA 4PE4A 2Y4QA 3KPXA 4MBEA 4MVFA 1QV1A 1BU3A 4HRHA 5F6TA 3NSKA 2LUCA 2LE9B 4PHNA 4NQGA 1BODA 4JQ0D 4QJ5B 1KK8B 1N2DA 2L51A 1IH0A 1G33A 2NCOA 5KTYA 1SRAA 4PDZA 1Y6WA 1QLSA 4OVNF 1U5IB 1FBVA 1QVIY 3WHUB 2I18A 2MBXA 1E8AA 1DJZA 2KNEA 3CWGA 4JPZB 1KWOC 2CCMA 4GUKA 3DF0B 2JXCA 4XJKB 5IBWA 1XFZO 1EH2A 1A75A 3QRXA 3WXAA 4ZCVA 2I7AA 1QS7A 4QJ3B 1KFXS 1K9KA 3BUXB 2I94A 3BQ3A 2Q91A 1QX7A 1S5GZ 2CBLA 2NCPA 3O2PA 4PHKA 3C1VA 1ALWA 4FTGA 5AANA 1AP4A 2COLB 4A4CA 1JWDA 4IL1A 1BF5A 4NDCA 1B8CA 1G4YR 1QIVA 1YVHA 2WNDA 3D0YB 3I5FC 1PRWA 2CT9A 4MLWA 2JRFA 1L7ZA 4HRGA 1DGUA 1QJTA 1SL7A 2NXQA 1RFJA 1K2HA 1QIWA 1EXRA 2OTGB 3D10A 2Q4UA 2K7BA 2BKHB 1YX7A 1CDPA 1CFPA 1DF0B 2AUCA 2NZ0A 3SJSA 1XVJA 4GGFC 4PHJA 1JUOA 1TRFA 2LLSA 2KAVA 2ZFDA 1SPYA 1F71A 1K9UA 1DVIA 3CTNA 1BLQA 4MZJA 4DS7A 1H8BA 2MJWB 1YTZC 1YRTB 2FCEA 4C0JA 2LVJA 4YGDB 2M9GA 2OS8B 3H4SE 2M29A 3O6BA 2PVBA 4C0KA 3BUMB 5CSNA 3CZTX 2WCFA 3IQQA 3EK8A 1OQPA 1UHHA 3I5GC 2JZIA 4NDDA 1UURA 4R1EA 1BJFA 2K7DA 4D1EA 3M0WA 1TNWA 5AXIA 3I5HB 2AAOA 2I2RE 2WCEA 1IKUA 5HKWA 5B8IB 3PALA 1LKJA 2HQWA 1WY9A 4GPLB 4XYNA 1GGWA 2SASA 5K89A 2JC2A 4OKHA 3TUYC 1J1EA 1SBJA 2JWWA 5JJGA 1S6IA 1Y0VH 1WDCB 1GJYA 1S6CA 2MHHA 4MRXA 2PSRA 2GV5A 1XFWO 3NSOA 2ZNDA 1S6JA 3TS5B 3VRNA 1NPQA 1PVAA 1LA0A 1QVIZ 2KBMA 1KQMB 1PALA 1WRKA 3BUNB 2KI4B 3PLFB 1KK7Y 1EG3A 2L4IA 3JTDB 1XK4A 1EL4A 3FS7A 5DKQA 1SY9A 2TN4A 1M45A 1A75B 1S3PA 3TZ1A 5I2LA 4BY4A 4UPGA 3VRPA 2MLEC 1KFUL 1S1EA 1SMGA 2L4HA 2JNXA 4I5NB 1OMDA 3DVKA 2H2KA 2M8UA 5CSJA 5KSZA 1SKTA 2GGZA 1FW4A 1XFUO 3HX4A 3SG5A 2BL0B 1TCFA 1XFYO 4P5OE 1CFDA 4YI9A 2ZRTA 5GQQC 2F8PA 4CFRA 1FI5A 4YGCB 2KFHA 4GBAA 4MN0A 1NX3A 5TNCA 1W7IB 1V1GA 4OCIA 1BG1A 2M49B 4E68A 3O78A 1CM4A 1JFKA 1MUXA 2ZKMX 1K93D 2AMIA 2JT8A 1F54A 3EVRA 3NSLA 1BOCA 2H61C 5AERA 1HT9A 1F55A 3MSEB 4AOMA 1NIWA 1KSMA 2EC6C 3K21A 1JC2A 1K96A 1KFXL 2Y1MA 1RROA 4N1GA 1NCZA 2KI6D 1IRJA 1LVCD 2JULA 1CMGA 3PATA 1CLLA 1W7JB 2L50A 3O4YA 1C7VA 1DTLA 2A4JA 2KSPA 1PSRA 2L2EA 3E3RA 4MRYA 3EKJA 4GNKB 2L5XB 2LVIA 3LCPC 2IS9A 3SIAA 3SG2A 1C07A 3I5IC 2LM5A 1Y1UA 2JTTA 3OHMB 1TN4A 2K61A 1NX2A 3A4UB 1Y1AA 3BXKA 2LVVA 3I5HC 3LLEA 1QLKA 2PASA 4MEWA 1TTXA 1XFXO 3CLNA 4JWQA 1UHJA 1K9PA 1F4OA 3AKAA 2P6BB 2HPSA 4PE0A 2LC5A 1SCVA 2D8NA 2KI6C 3KHEA 1SL9A 1DJXA 2CXJA 1WDCC 2F2OA 4GGFA 4ICBA 2LMTA 3VRQA 4HSZA 1YUSA 4TNCA 4MZKA 1CLMA 4HREE 4U8DA 2LAPA 1L2OB 3SIBA 1DJIA 1ODBA 4YRUA 1B7TY 1BT6A 2M3WA 2WC8A 3BUWB 4ORCB 2KQ6A 3ZNIA 2K7CA 1KQMC 3BYAA 3LL8B 4USLA 1F4QA 2F3YA 3KF9A 3GK1A 2ZN8A 1VRKA 4YI8A 1YUUA 3EK7A 1KK7Z 2KAYA 4N1FA 1CLBA 1EG4A 1M31A 1NYAA 1AJ4A 1CDMA 1HQVA 4C0LA 1SCMC 4DUQA 2LP2A 3PM8A 1AK8A 1CDNA 1KCYA 2WOSA 1UHKA 3BOWA 4ETOA 1PSBA 2M1UA 1Y1XA 1QX5B 2M97A 2BE4A 1NP8A 1EJ3A 1AHRA 4CIDA 2SCPA 1CFFA 1LA3A 2BL0C 2OPOA 1K90D 1QXPA 1WLZA 3EK4A 1QATA 5DKRA 5I8NA 1WRLA 2Y5IA 2ISDA 4YGEB 1U5IA 1RK9A 1K8UA 2PMYA 2K0JA 1BR1B 2LUXA 3CR5X 1RWYA 2KDHA 5PALA 2BKIB 3DF0A 4XJKA 1QASA 1V1FA 1KK8C 3F45A 2KQYA 4WRIA 3WNXB 2BBMA 1CKKA 3HCMA 1X02A 5BPJA 1BMOA 2Y1NA 2JPTA 1TNXA 4I5KA 1ZOTB 2BCBA 1MR8A 1KSOA 3DVEA 3LK0A 5J3XA 1QTXA 2KFFA 1MQ1A 2JOJA 1D1OA 3JVTB 3FWBA 1OSAA 2F3ZA 1NX1A 2LVKA 2MAZA 1IQ3A 1YVLA 2BECA 1JFJA 1CM1A 2JXLA 1YURA 1F8HA 2WORA 1MXEA 1G8IA 3CR2A 3TDUA 4CFQA 2M7NA 1GQMA 5CPVA 1TNPA 4PE1A 1OE9B 3EVVA 1DJYA 1K95A 1RTP1 4CLNA 4NDBA 4AQJA 2HF5A 2B1UA 1NCXA 1RECA 1NCYA 2H61A 4GGNA 3OB2B 2LV7A 2QPTA 2G9BA 2KGBC 5FYXA 4OR9B 3NXAA 1DJHA 5ER5A 2JT0A 2ZRSA
chains in the Genus database with same CATH superfamily
2QEBA 2PRUA 1L2OC 4M2QA 4YGBB 1J55A 4N5XA 1B7TZ 2OTGC 1QV0A 1TNQA 1W9ZA 1XYDA 2JQ6A 4GFTA 1IQ5A 1UP5A 3S0GA 4WQ2A 2KYFA 1Z4HA 2JTZA 1ALVA 2LHIA 1JBAA 3NHTA 3S0BA 1S26D 5AFPA 1ZFSA 1TUZA 3DY9A 5HLVA 3DVMA 4ORBB 2BAPA 2QACA 3I5GB 1F70A 5D7FA 3KEVA 1J7QA 2E30A 3GK4X 4FQOA 3RLZA 1SR6B 1SW8A 5JOLA 1NSHA 1TUJA 1IJ5A 3PN7B 3VRRA 5HKZA 1UUSA 1K94A 1SK6D 1PK0D 2OS8C 4M2OA 1IJ6A 3CYZA 5CSIA 3ZWHA 2LHLA 3TUYB 2G2BA 1CTRA 1P28A 2HQ8A 2YGUA 1TOPA 4Q04A 1T14A 1NX0A 2BCXA 3NSIA 3L47A 1WRZA 2MA2A 4P2YB 4PE7A 2K7OA 1B8RA 1XO5A 4YBHB 3SS4A 4BY5A 1UWOA 2MLFC 1J7OA 2ZNEA 3B88A 1OZSA 3SG6A 3DD4A 2WCBA 2BNXA 4L9MA 1SL8A 2BE6A 3GOFA 1LINA 1DELA 3SG4A 4YGAA 1SYMA 3D78A 3TS5C 2LLUA 3PFVA 2JT3A 2K2AA 3EVUA 3ICBA 1QX2A 2LANA 4MZLA 1PULA 2WCHA 1CNPA 3A8RA 1Q80A 3SG7A 3V2LA 3JVTC 1LXFC 2K8MB 2KI4C 3LK1A 3CDNA 1IG5A 4AQIA 1IWQA 1PVBA 2LNKA 3JTDC 4M2PA 2JU0A 4F7FA 2MRDA 1YUTA 5HLOA 2F2PA 1DGVA 1OOJA 1C3ZA 4A4BA 2QEOA 3DVJA 3GK2A 3OB1B 3OX6A 2FJUB 4GAOA 1OMRA 2ERBA 1J1DA 1RJVA 2LCPA 5HYDA 1C7WA 2O5GA 2L0PA 1B47A 1MWNA 1NUBA 3OBVA 3KO0A 1JF2A 5HKYA 1B4CA 1S36A 1UHIA 3EKHA 4I5LB 3CABA 3PSRA 1B8LA 2PYQA 3CS1A 1M46A 1ZMZA 2VRGA 1A29A 2KFGA 1N0YA 1AVSA 1XA5A 2L98A 3R1PA 2O60A 1ZUZA 1MXLC 2EC6B 3BUOB 1XFVO 1AUIB 1OZOA 4WQ3A 2DOQA 1DT7B 4I5JA 2QDIA 3OP0A 1NWDA 2JNFA 1FF1A 2ZN9A 1MF8B 2R2IA 4DIRA 4ZCUA 1UHNA 1WLMA 3UO9A 5I2QA 1A03A 2K2FA 1SNLA 1KWOB 3CGAA 2RGIA 2KOTA 5I94A 5ER4X 1M39A 3VGOA 1FPWA 2KGRA 5D69A 3AKBA 2GTEA 2V53A 3I5IB 2M7LA 2LMVA 1S5GY 1N65A 4PT1A 1SR6C 1A4PA 3IQOA 2P71A 4PALA 1DMOA 1YX8A 2CNPA 3PN7C 2FOTA 3IF7A 3RM1A 3CZ1A 2LMUA 2BCAA 2QEHA 4ORAB 3D0YA 5I2OA 1IGVA 2KHNA 5KU1A 1CDLA 3I5FB 1DJGA 4JD9A 1YRUB 3S0EA 2NLNA 3QMEA 2E6WA 4PCWA 2WCJA 3UNWA 1JSAA 1BR4B 2KYCA 3OX5A 1H4BA 1KQVA 4DRWA 4INXA 4OV2A 2KBIA 4MSPA 3N7HA 5AEQA 1CFCA 3TDZA 2LLTA 2M1KB 3BFBA 1CB1A 1OW4A 1OOHA 1DF0A 3CR4X 1A2XA 2CTNA 1AJ5A 1B9AA 1J7PA 1R2UA 2F33A 5G08A 1TIZA 1J7RA 1ZACA 3AAJA 3FIAA 2HETA 1SCMB 2LP3A 2BBNA 3VROA 1DJWA 4PHMA 4CPVA 2KAXA 5CSFA 2M0RA 2FCDA 3AAKA 1M63B 5DKNA 1YR5A 3S0DA 2PALA 1B1GA 1FI6A 3SG3A 1TCOB 1R6PA 1GM0A 4DCKA 1XK4C 3FWCA 1DC1A 1CMFA 1JF0A 4QJ4B 2GGMA 3R1OA 1OMVA 1MHOA 3TDIA 2EHBA 2KLDA 3WHTB 1KFUS 1GGZA 3BOWB 2EGDA 5FI7A 4PE4A 2Y4QA 3KPXA 4MBEA 4MVFA 1QV1A 1BU3A 4HRHA 5F6TA 3RZSA 3NSKA 2LUCA 2LE9B 4PHNA 4NQGA 1BODA 4JQ0D 4QJ5B 1KK8B 1N2DA 2L51A 1IH0A 1G33A 2NCOA 5KTYA 1SRAA 3DZTA 1Y6WA 1QLSA 4PDZA 4OVNF 1U5IB 1FBVA 3D77A 1QVIY 3WHUB 2I18A 1DEKA 2MBXA 1E8AA 1DJZA 3BJHA 2KNEA 3CWGA 4JPZB 1KWOC 2CCMA 3VB1A 4GUKA 3DF0B 2JXCA 4XJKB 5IBWA 1XFZO 1EH2A 1A75A 3QRXA 3WXAA 4ZCVA 2I7AA 1QS7A 4QJ3B 1KFXS 3B6XA 2KLEA 1K9KA 3BUXB 2I94A 3BQ3A 5FI6A 2Q91A 1QX7A 1S5GZ 2CBLA 2NCPA 3O2PA 4PHKA 3C1VA 1QWVA 1ALWA 4FTGA 5AANA 1AP4A 2COLB 4A4CA 1JWDA 4IL1A 1BF5A 4NDCA 1B8CA 1G4YR 1QIVA 1YVHA 2WNDA 3D0YB 3I5FC 1PRWA 2CT9A 4MLWA 2JRFA 1L7ZA 4HRGA 1DGUA 1QJTA 5DICA 1SL7A 2NXQA 1RFJA 1K2HA 1QIWA 1EXRA 1IIOA 2OTGB 3D10A 2Q4UA 2K7BA 1YX7A 2BKHB 1CDPA 1CFPA 4KYNA 1DF0B 2AUCA 2NZ0A 3SJSA 1XVJA 4GGFC 4PHJA 1JUOA 4JKTA 1TRFA 2LLSA 2KAVA 2ZFDA 1SPYA 3OGNA 3DXLA 3BFAA 1F71A 1K9UA 1DVIA 3CTNA 3NHIA 1BLQA 4MZJA 4DS7A 1H8BA 2MJWB 3NGVA 1YTZC 1YRTB 2FCEA 4C0JA 2LVJA 4YGDB 2M9GA 1C3YA 4INWA 2OS8B 3H4SE 2M29A 3O6BA 2PVBA 4C0KA 3BUMB 5CSNA 3CZTX 2WCFA 3IQQA 3D74A 3EK8A 1OOFA 1OQPA 1UHHA 2JZIA 3I5GC 4NDDA 3FE8A 1UURA 4R1EA 1BJFA 2K7DA 2L5YA 3M0WA 4D1EA 1TNWA 5AXIA 3I5HB 2AAOA 2I2RE 2WCEA 1IKUA 5HKWA 5B8IB 3PALA 1LKJA 2HQWA 1WY9A 4GPLB 4XYNA 1GGWA 2SASA 5K89A 2JC2A 2WC6A 4OKHA 3TUYC 1J1EA 1SBJA 2JWWA 5JJGA 1DQEA 1S6IA 3D76A 1Y0VH 1WDCB 1GJYA 1S6CA 2MHHA 4MRXA 2PSRA 2GV5A 1XFWO 3NSOA 2ZNDA 1S6JA 3TS5B 3VRNA 1NPQA 1PVAA 1LA0A 3EG5B 1LS8A 1XFRA 1QVIZ 2KBMA 1KQMB 1PALA 1WRKA 3BUNB 2KI4B 3PLFB 1KK7Y 1EG3A 2L4IA 3JTDB 1XK4A 1EL4A 3FS7A 2KPHA 5DKQA 4IJ7A 1SY9A 2TN4A 1M45A 1A75B 1S3PA 3TZ1A 5I2LA 4BY4A 4UPGA 3VRPA 2MLEC 1KFUL 1S1EA 1Z2CB 1SMGA 2L4HA 2JNXA 4I5NB 1OMDA 3DVKA 2H2KA 2M8UA 5CSJA 5KSZA 1SKTA 2GGZA 1FW4A 3DYEA 3FE9A 1XFUO 3HX4A 3K1EA 3SG5A 2BL0B 3R1VA 1TCFA 1XFYO 4P5OE 1CFDA 4YI9A 2ZRTA 3IVTA 2F8PA 5GQQC 4CFRA 1FI5A 4YGCB 2KFHA 4GBAA 4MN0A 1NX3A 5TNCA 1W7IB 1V1GA 4OCIA 1BG1A 2M49B 4E68A 3O78A 1CM4A 1JFKA 1MUXA 2ZKMX 1K93D 2AMIA 2JT8A 1F54A 3EVRA 3NSLA 5D3OA 1BOCA 2H61C 5AERA 1HT9A 1F55A 3MSEB 1ORGA 5EL2A 1NIWA 4AOMA 1KSMA 2EC6C 1SSEB 2WCLA 3K21A 1JC2A 1K96A 1KFXL 2Y1MA 1RROA 4N1GA 1NCZA 2KI6D 1IRJA 1LVCD 2JULA 1CMGA 3PATA 1CLLA 1W7JB 2L50A 3O4YA 1C7VA 1DTLA 2A4JA 2KSPA 1PSRA 3FE6A 2L2EA 3E3RA 4MRYA 3EKJA 4GNKB 2L5XB 2LVIA 3D75A 3LCPC 2IS9A 3SIAA 3SG2A 1C07A 3I5IC 2LM5A 1Y1UA 2JTTA 3OHMB 1TN4A 2K61A 1NX2A 3A4UB 1Y1AA 3BXKA 2LVVA 3I5HC 3LLEA 1QLKA 2PASA 4MEWA 1TTXA 1XFXO 3CLNA 4JWQA 1UHJA 1K9PA 2FJYA 1F4OA 3SS5A 3AKAA 2P6BB 2HPSA 4PE0A 2LC5A 1SCVA 2D8NA 2KI6C 3KHEA 1SL9A 1DJXA 2CXJA 1WDCC 2F2OA 4GGFA 4ICBA 2LMTA 3VRQA 4HSZA 1YUSA 4TNCA 4F0ZB 4MZKA 1CLMA 4HREE 4U8DA 2LAPA 1L2OB 3SIBA 1DJIA 1ODBA 4YRUA 1B7TY 1BT6A 2M3WA 2WC8A 3BUWB 4ORCB 2KQ6A 3ZNIA 2K7CA 1KQMC 3BYAA 3LL8B 4USLA 1F4QA 2F3YA 3KF9A 3GK1A 2ZN8A 1VRKA 4YI8A 1YUUA 3EK7A 1KK7Z 2KAYA 4N1FA 1CLBA 1EG4A 2H8VA 1M31A 1NYAA 1AJ4A 1CDMA 1HQVA 4C0LA 1SCMC 4DUQA 1OOIX 2LP2A 3PM8A 1AK8A 1CDNA 2K60A 1KCYA 2WOSA 1UHKA 3BOWA 4ETOA 1PSBA 2M1UA 1Y1XA 1QX5B 2M97A 2BE4A 1NP8A 1EJ3A 1AHRA 4CIDA 2QEVA 2SCPA 1CFFA 3O4XA 1LA3A 2BL0C 2OPOA 1K90D 1QXPA 1WLZA 3EK4A 1QATA 5DKRA 5HL1A 5I8NA 2P70A 1WRLA 2Y5IA 3S0FA 1TWOA 3L4AA 2ISDA 4YGEB 1U5IA 1RK9A 1K8UA 2PMYA 2K0JA 3B7AA 1BR1B 3R72A 2LUXA 3CR5X 1RWYA 2KDHA 5PALA 5FI2A 2BKIB 3DF0A 4XJKA 1QASA 1V1FA 1KK8C 3F45A 2KQYA 4WRIA 3D73A 2BBMA 3WNXB 3HCMA 4OZDA 1CKKA 1X02A 5BPJA 2WC5A 1BMOA 2Y1NA 2JPTA 1TNXA 2JPOA 4I5KA 2WCKA 1ZOTB 3S0AA 2BCBA 1MR8A 1KSOA 3PM2A 3Q8IA 3DVEA 3LK0A 5J3XA 1QTXA 2KFFA 1MQ1A 2JOJA 1D1OA 3JVTB 3CZ0A 3L4LA 3FWBA 1OSAA 2F3ZA 1NX1A 2LVKA 2MAZA 4FQTA 1IQ3A 3B86A 3PJIA 1YVLA 2BECA 1JFJA 1OOGA 1CM1A 2JXLA 2WCMA 3CZ2A 1YURA 3BFHA 1F8HA 2WORA 1MXEA 1G8IA 3CR2A 3TDUA 4CFQA 2M7NA 1GQMA 5CPVA 1TNPA 4PE1A 3SS3A 1OE9B 3B87A 3EVVA 1DJYA 1K95A 1RTP1 2PQLA 4CLNA 4NDBA 4AQJA 2HF5A 2B1UA 1NCXA 1RECA 1NCYA 2H61A 4GGNA 3OB2B 2LV7A 2QPTA 2G9BA 2KGBC 5FYXA 4OR9B 3NXAA 1DJHA 5ER5A 2JT0A 2ZRSA 2L2CA
chains in the Genus database with same CATH topology
2PRUA 1L2OC 4M2QA 4YGBB 1J55A 4N5XA 1B7TZ 2OTGC 1QV0A 1TNQA 1XYDA 2JQ6A 4GFTA 1IQ5A 1UP5A 4WQ2A 2KYFA 2JTZA 1ALVA 2LHIA 1JBAA 1S26D 5AFPA 1ZFSA 5HLVA 3DVMA 4ORBB 2QACA 1F70A 3I5GB 5D7FA 3KEVA 1J7QA 2E30A 3GK4X 4FQOA 3RLZA 1SR6B 1SW8A 5JOLA 1NSHA 1IJ5A 3PN7B 3VRRA 5HKZA 1UUSA 1K94A 1SK6D 1PK0D 2OS8C 4M2OA 1IJ6A 5CSIA 3ZWHA 2LHLA 3TUYB 2G2BA 1CTRA 2HQ8A 1TOPA 4Q04A 1NX0A 2BCXA 3NSIA 1WRZA 2MA2A 4P2YB 4PE7A 2K7OA 1B8RA 1XO5A 4YBHB 4BY5A 1UWOA 2MLFC 1J7OA 2ZNEA 1OZSA 3SG6A 3DD4A 2WCBA 4L9MA 1SL8A 2BE6A 3GOFA 1LINA 3SG4A 4YGAA 1SYMA 3TS5C 2LLUA 3PFVA 2JT3A 2K2AA 3EVUA 3ICBA 1QX2A 2LANA 4MZLA 1PULA 1CNPA 3A8RA 1Q80A 3SG7A 4F0ZB 3JVTC 1LXFC 2K8MB 2KI4C 3LK1A 1IG5A 4AQIA 1IWQA 1PVBA 2LNKA 3JTDC 4M2PA 2JU0A 2MRDA 1YUTA 5HLOA 2F2PA 1DGVA 1OOJA 4A4BA 3DVJA 3GK2A 3OB1B 3OX6A 2FJUB 4GAOA 1OMRA 1J1DA 1RJVA 2LCPA 5HYDA 1C7WA 2O5GA 2L0PA 1B47A 1MWNA 1NUBA 5HKYA 3KO0A 1JF2A 1B4CA 1S36A 1UHIA 3EKHA 4I5LB 3PSRA 1B8LA 3CS1A 1M46A 1ZMZA 2VRGA 1A29A 2KFGA 1N0YA 1AVSA 1XA5A 2L98A 2O60A 1ZUZA 1MXLC 2EC6B 3BUOB 1XFVO 1AUIB 1OZOA 4WQ3A 2DOQA 1DT7B 4I5JA 3OP0A 1NWDA 2JNFA 1FF1A 2ZN9A 1MF8B 2R2IA 4DIRA 4ZCUA 1UHNA 1WLMA 5I2QA 1A03A 2K2FA 1SNLA 1KWOB 3CGAA 2RGIA 2KOTA 5ER4X 1M39A 3VGOA 1FPWA 2KGRA 5D69A 3AKBA 2V53A 3I5IB 2M7LA 2LMVA 1S5GY 1N65A 1SR6C 1A4PA 3IQOA 4PALA 1DMOA 1YX8A 2CNPA 3PN7C 2FOTA 3IF7A 3RM1A 2LMUA 2BCAA 4ORAB 3D0YA 5I2OA 1IGVA 2KHNA 5KU1A 1CDLA 3I5FB 1DJGA 1YRUB 2NLNA 4PCWA 2E6WA 1JSAA 1BR4B 2KYCA 3OX5A 1H4BA 1KQVA 4DRWA 4OV2A 2KBIA 4MSPA 5AEQA 1CFCA 3TDZA 2LLTA 2M1KB 1CB1A 1DF0A 3CR4X 1A2XA 2CTNA 1AJ5A 1B9AA 1J7PA 1R2UA 2F33A 5G08A 1TIZA 1J7RA 1ZACA 3AAJA 3FIAA 2HETA 1SCMB 2LP3A 2BBNA 3VROA 1DJWA 4PHMA 4CPVA 2KAXA 5CSFA 2M0RA 2FCDA 3AAKA 1M63B 5DKNA 1YR5A 2PALA 1B1GA 1FI6A 3SG3A 1TCOB 1R6PA 4DCKA 1XK4C 3FWCA 1CMFA 1JF0A 4QJ4B 2GGMA 1OMVA 1MHOA 3TDIA 2EHBA 3WHTB 1KFUS 1GGZA 3BOWB 2EGDA 4PE4A 2Y4QA 3KPXA 4MBEA 4MVFA 1QV1A 1BU3A 4HRHA 5F6TA 3NSKA 2LUCA 2LE9B 4PHNA 4NQGA 1BODA 4JQ0D 4QJ5B 1KK8B 1N2DA 2L51A 1IH0A 1G33A 2NCOA 5KTYA 1SRAA 4PDZA 1Y6WA 1QLSA 4OVNF 1U5IB 1FBVA 1QVIY 3WHUB 2I18A 2MBXA 1E8AA 1DJZA 2KNEA 3CWGA 4JPZB 1KWOC 2CCMA 4GUKA 3DF0B 2JXCA 4XJKB 5IBWA 1XFZO 1EH2A 1A75A 3QRXA 3WXAA 4ZCVA 2I7AA 1QS7A 4QJ3B 1KFXS 1K9KA 3BUXB 2I94A 3BQ3A 2Q91A 1QX7A 1S5GZ 2CBLA 2NCPA 3O2PA 4PHKA 3C1VA 1ALWA 4FTGA 5AANA 1AP4A 2COLB 4A4CA 1JWDA 4IL1A 1BF5A 4NDCA 1B8CA 1G4YR 1QIVA 1YVHA 2WNDA 3D0YB 3I5FC 1PRWA 2CT9A 4MLWA 2JRFA 1L7ZA 4HRGA 1DGUA 1QJTA 1SL7A 2NXQA 1RFJA 1K2HA 1QIWA 1EXRA 2OTGB 3D10A 2Q4UA 2K7BA 2BKHB 1YX7A 1CDPA 1CFPA 1DF0B 2AUCA 2NZ0A 3SJSA 1XVJA 4GGFC 4PHJA 1JUOA 1TRFA 2LLSA 2KAVA 2ZFDA 1SPYA 1F71A 1K9UA 1DVIA 3CTNA 1BLQA 4MZJA 4DS7A 1H8BA 2MJWB 1YTZC 1YRTB 2FCEA 4C0JA 2LVJA 4YGDB 2M9GA 2OS8B 3H4SE 2M29A 3O6BA 2PVBA 4C0KA 3BUMB 5CSNA 3CZTX 2WCFA 3IQQA 3EK8A 1OQPA 1UHHA 3I5GC 2JZIA 4NDDA 1UURA 4R1EA 1BJFA 2K7DA 4D1EA 3M0WA 1TNWA 5AXIA 3I5HB 2AAOA 2I2RE 2WCEA 1IKUA 5HKWA 5B8IB 3PALA 1LKJA 2HQWA 1WY9A 4GPLB 4XYNA 1GGWA 2SASA 5K89A 2JC2A 4OKHA 3TUYC 1J1EA 1SBJA 2JWWA 5JJGA 1S6IA 1Y0VH 1WDCB 1GJYA 1S6CA 2MHHA 4MRXA 2PSRA 2GV5A 1XFWO 3NSOA 2ZNDA 1S6JA 3TS5B 3VRNA 1NPQA 1PVAA 1LA0A 1QVIZ 2KBMA 1KQMB 1PALA 1WRKA 3BUNB 2KI4B 3PLFB 1KK7Y 1EG3A 2L4IA 3JTDB 1XK4A 1EL4A 3FS7A 5DKQA 1SY9A 2TN4A 1M45A 1A75B 1S3PA 3TZ1A 5I2LA 4BY4A 4UPGA 3VRPA 2MLEC 1KFUL 1S1EA 1SMGA 2L4HA 2JNXA 4I5NB 1OMDA 3DVKA 2H2KA 2M8UA 5CSJA 5KSZA 1SKTA 2GGZA 1FW4A 1XFUO 3HX4A 3SG5A 2BL0B 1TCFA 1XFYO 4P5OE 1CFDA 4YI9A 2ZRTA 5GQQC 2F8PA 4CFRA 1FI5A 4YGCB 2KFHA 4GBAA 4MN0A 1NX3A 5TNCA 1W7IB 1V1GA 4OCIA 1BG1A 2M49B 4E68A 3O78A 1CM4A 1JFKA 1MUXA 2ZKMX 1K93D 2AMIA 2JT8A 1F54A 3EVRA 3NSLA 1BOCA 2H61C 5AERA 1HT9A 1F55A 3MSEB 4AOMA 1NIWA 1KSMA 2EC6C 3K21A 1JC2A 1K96A 1KFXL 2Y1MA 1RROA 4N1GA 1NCZA 2KI6D 1IRJA 1LVCD 2JULA 1CMGA 3PATA 1CLLA 1W7JB 2L50A 3O4YA 1C7VA 1DTLA 2A4JA 2KSPA 1PSRA 2L2EA 3E3RA 4MRYA 3EKJA 4GNKB 2L5XB 2LVIA 3LCPC 2IS9A 3SIAA 3SG2A 1C07A 3I5IC 2LM5A 1Y1UA 2JTTA 3OHMB 1TN4A 2K61A 1NX2A 3A4UB 1Y1AA 3BXKA 2LVVA 3I5HC 3LLEA 1QLKA 2PASA 4MEWA 1TTXA 1XFXO 3CLNA 4JWQA 1UHJA 1K9PA 1F4OA 3AKAA 2P6BB 2HPSA 4PE0A 2LC5A 1SCVA 2D8NA 2KI6C 3KHEA 1SL9A 1DJXA 2CXJA 1WDCC 2F2OA 4GGFA 4ICBA 2LMTA 3VRQA 4HSZA 1YUSA 4TNCA 4MZKA 1CLMA 4HREE 4U8DA 2LAPA 1L2OB 3SIBA 1DJIA 1ODBA 4YRUA 1B7TY 1BT6A 2M3WA 2WC8A 3BUWB 4ORCB 2KQ6A 3ZNIA 2K7CA 1KQMC 3BYAA 3LL8B 4USLA 1F4QA 2F3YA 3KF9A 3GK1A 2ZN8A 1VRKA 4YI8A 1YUUA 3EK7A 1KK7Z 2KAYA 4N1FA 1CLBA 1EG4A 1M31A 1NYAA 1AJ4A 1CDMA 1HQVA 4C0LA 1SCMC 4DUQA 2LP2A 3PM8A 1AK8A 1CDNA 1KCYA 2WOSA 1UHKA 3BOWA 4ETOA 1PSBA 2M1UA 1Y1XA 1QX5B 2M97A 2BE4A 1NP8A 1EJ3A 1AHRA 4CIDA 2SCPA 1CFFA 1LA3A 2BL0C 2OPOA 1K90D 1QXPA 1WLZA 3EK4A 1QATA 5DKRA 5I8NA 1WRLA 2Y5IA 2ISDA 4YGEB 1U5IA 1RK9A 1K8UA 2PMYA 2K0JA 1BR1B 2LUXA 3CR5X 1RWYA 2KDHA 5PALA 2BKIB 3DF0A 4XJKA 1QASA 1V1FA 1KK8C 3F45A 2KQYA 4WRIA 3WNXB 2BBMA 1CKKA 3HCMA 1X02A 5BPJA 1BMOA 2Y1NA 2JPTA 1TNXA 4I5KA 1ZOTB 2BCBA 1MR8A 1KSOA 3DVEA 3LK0A 5J3XA 1QTXA 2KFFA 1MQ1A 2JOJA 1D1OA 3JVTB 3FWBA 1OSAA 2F3ZA 1NX1A 2LVKA 2MAZA 1IQ3A 1YVLA 2BECA 1JFJA 1CM1A 2JXLA 1YURA 1F8HA 2WORA 1MXEA 1G8IA 3CR2A 3TDUA 4CFQA 2M7NA 1GQMA 5CPVA 1TNPA 4PE1A 1OE9B 3EVVA 1DJYA 1K95A 1RTP1 4CLNA 4NDBA 4AQJA 2HF5A 2B1UA 1NCXA 1RECA 1NCYA 2H61A 4GGNA 3OB2B 2LV7A 2QPTA 2G9BA 2KGBC 5FYXA 4OR9B 3NXAA 1DJHA 5ER5A 2JT0A 2ZRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRU A;  1L2O C;  4M2Q A;  4YGB B;  1J55 A;  4N5X A;  1B7T Z;  2OTG C;  1QV0 A;  1TNQ A;  1XYD A;  2JQ6 A;  4GFT A;  1IQ5 A;  1UP5 A;  4WQ2 A;  2KYF A;  2JTZ A;  1ALV A;  2LHI A;  1JBA A;  1S26 D;  5AFP A;  1ZFS A;  5HLV A;  3DVM A;  4ORB B;  2QAC A;  1F70 A;  3I5G B;  5D7F A;  3KEV A;  1J7Q A;  2E30 A;  3GK4 X;  4FQO A;  3RLZ A;  1SR6 B;  1SW8 A;  5JOL A;  1NSH A;  1IJ5 A;  3PN7 B;  3VRR A;  5HKZ A;  1UUS A;  1K94 A;  1SK6 D;  1PK0 D;  2OS8 C;  4M2O A;  1IJ6 A;  5CSI A;  3ZWH A;  2LHL A;  3TUY B;  2G2B A;  1CTR A;  2HQ8 A;  1TOP A;  4Q04 A;  1NX0 A;  2BCX A;  3NSI A;  1WRZ A;  2MA2 A;  4P2Y B;  4PE7 A;  2K7O A;  1B8R A;  1XO5 A;  4YBH B;  4BY5 A;  1UWO A;  2MLF C;  1J7O A;  2ZNE A;  1OZS A;  3SG6 A;  3DD4 A;  2WCB A;  4L9M A;  1SL8 A;  2BE6 A;  3GOF A;  1LIN A;  3SG4 A;  4YGA A;  1SYM A;  3TS5 C;  2LLU A;  3PFV A;  2JT3 A;  2K2A A;  3EVU A;  3ICB A;  1QX2 A;  2LAN A;  4MZL A;  1PUL A;  1CNP A;  3A8R A;  1Q80 A;  3SG7 A;  4F0Z B;  3JVT C;  1LXF C;  2K8M B;  2KI4 C;  3LK1 A;  1IG5 A;  4AQI A;  1IWQ A;  1PVB A;  2LNK A;  3JTD C;  4M2P A;  2JU0 A;  2MRD A;  1YUT A;  5HLO A;  2F2P A;  1DGV A;  1OOJ A;  4A4B A;  3DVJ A;  3GK2 A;  3OB1 B;  3OX6 A;  2FJU B;  4GAO A;  1OMR A;  1J1D A;  1RJV A;  2LCP A;  5HYD A;  1C7W A;  2O5G A;  2L0P A;  1B47 A;  1MWN A;  1NUB A;  5HKY A;  3KO0 A;  1JF2 A;  1B4C A;  1S36 A;  1UHI A;  3EKH A;  4I5L B;  3PSR A;  1B8L A;  3CS1 A;  1M46 A;  1ZMZ A;  2VRG A;  1A29 A;  2KFG A;  1N0Y A;  1AVS A;  1XA5 A;  2L98 A;  2O60 A;  1ZUZ A;  1MXL C;  2EC6 B;  3BUO B;  1XFV O;  1AUI B;  1OZO A;  4WQ3 A;  2DOQ A;  1DT7 B;  4I5J A;  3OP0 A;  1NWD A;  2JNF A;  1FF1 A;  2ZN9 A;  1MF8 B;  2R2I A;  4DIR A;  4ZCU A;  1UHN A;  1WLM A;  5I2Q A;  1A03 A;  2K2F A;  1SNL A;  1KWO B;  3CGA A;  2RGI A;  2KOT A;  5ER4 X;  1M39 A;  3VGO A;  1FPW A;  2KGR A;  5D69 A;  3AKB A;  2V53 A;  3I5I B;  2M7L A;  2LMV A;  1S5G Y;  1N65 A;  1SR6 C;  1A4P A;  3IQO A;  4PAL A;  1DMO A;  1YX8 A;  2CNP A;  3PN7 C;  2FOT A;  3IF7 A;  3RM1 A;  2LMU A;  2BCA A;  4ORA B;  3D0Y A;  5I2O A;  1IGV A;  2KHN A;  5KU1 A;  1CDL A;  3I5F B;  1DJG A;  1YRU B;  2NLN A;  4PCW A;  2E6W A;  1JSA A;  1BR4 B;  2KYC A;  3OX5 A;  1H4B A;  1KQV A;  4DRW A;  4OV2 A;  2KBI A;  4MSP A;  5AEQ A;  1CFC A;  3TDZ A;  2LLT A;  2M1K B;  1CB1 A;  1DF0 A;  3CR4 X;  1A2X A;  2CTN A;  1AJ5 A;  1B9A A;  1J7P A;  1R2U A;  2F33 A;  5G08 A;  1TIZ A;  1J7R A;  1ZAC A;  3AAJ A;  3FIA A;  2HET A;  1SCM B;  2LP3 A;  2BBN A;  3VRO A;  1DJW A;  4PHM A;  4CPV A;  2KAX A;  5CSF A;  2M0R A;  2FCD A;  3AAK A;  1M63 B;  5DKN A;  1YR5 A;  2PAL A;  1B1G A;  1FI6 A;  3SG3 A;  1TCO B;  1R6P A;  4DCK A;  1XK4 C;  3FWC A;  1CMF A;  1JF0 A;  4QJ4 B;  2GGM A;  1OMV A;  1MHO A;  3TDI A;  2EHB A;  3WHT B;  1KFU S;  1GGZ A;  3BOW B;  2EGD A;  4PE4 A;  2Y4Q A;  3KPX A;  4MBE A;  4MVF A;  1QV1 A;  1BU3 A;  4HRH A;  5F6T A;  3NSK A;  2LUC A;  2LE9 B;  4PHN A;  4NQG A;  1BOD A;  4JQ0 D;  4QJ5 B;  1KK8 B;  1N2D A;  2L51 A;  1IH0 A;  1G33 A;  2NCO A;  5KTY A;  1SRA A;  4PDZ A;  1Y6W A;  1QLS A;  4OVN F;  1U5I B;  1FBV A;  1QVI Y;  3WHU B;  2I18 A;  2MBX A;  1E8A A;  1DJZ A;  2KNE A;  3CWG A;  4JPZ B;  1KWO C;  2CCM A;  4GUK A;  3DF0 B;  2JXC A;  4XJK B;  5IBW A;  1XFZ O;  1EH2 A;  1A75 A;  3QRX A;  3WXA A;  4ZCV A;  2I7A A;  1QS7 A;  4QJ3 B;  1KFX S;  1K9K A;  3BUX B;  2I94 A;  3BQ3 A;  2Q91 A;  1QX7 A;  1S5G Z;  2CBL A;  2NCP A;  3O2P A;  4PHK A;  3C1V A;  1ALW A;  4FTG A;  5AAN A;  1AP4 A;  2COL B;  4A4C A;  1JWD A;  4IL1 A;  1BF5 A;  4NDC A;  1B8C A;  1G4Y R;  1QIV A;  1YVH A;  2WND A;  3D0Y B;  3I5F C;  1PRW A;  2CT9 A;  4MLW A;  2JRF A;  1L7Z A;  4HRG A;  1DGU A;  1QJT A;  1SL7 A;  2NXQ A;  1RFJ A;  1K2H A;  1QIW A;  1EXR A;  2OTG B;  3D10 A;  2Q4U A;  2K7B A;  2BKH B;  1YX7 A;  1CDP A;  1CFP A;  1DF0 B;  2AUC A;  2NZ0 A;  3SJS A;  1XVJ A;  4GGF C;  4PHJ A;  1JUO A;  1TRF A;  2LLS A;  2KAV A;  2ZFD A;  1SPY A;  1F71 A;  1K9U A;  1DVI A;  3CTN A;  1BLQ A;  4MZJ A;  4DS7 A;  1H8B A;  2MJW B;  1YTZ C;  1YRT B;  2FCE A;  4C0J A;  2LVJ A;  4YGD B;  2M9G A;  2OS8 B;  3H4S E;  2M29 A;  3O6B A;  2PVB A;  4C0K A;  3BUM B;  5CSN A;  3CZT X;  2WCF A;  3IQQ A;  3EK8 A;  1OQP A;  1UHH A;  3I5G C;  2JZI A;  4NDD A;  1UUR A;  4R1E A;  1BJF A;  2K7D A;  4D1E A;  3M0W A;  1TNW A;  5AXI A;  3I5H B;  2AAO A;  2I2R E;  2WCE A;  1IKU A;  5HKW A;  5B8I B;  3PAL A;  1LKJ A;  2HQW A;  1WY9 A;  4GPL B;  4XYN A;  1GGW A;  2SAS A;  5K89 A;  2JC2 A;  4OKH A;  3TUY C;  1J1E A;  1SBJ A;  2JWW A;  5JJG A;  1S6I A;  1Y0V H;  1WDC B;  1GJY A;  1S6C A;  2MHH A;  4MRX A;  2PSR A;  2GV5 A;  1XFW O;  3NSO A;  2ZND A;  1S6J A;  3TS5 B;  3VRN A;  1NPQ A;  1PVA A;  1LA0 A;  1QVI Z;  2KBM A;  1KQM B;  1PAL A;  1WRK A;  3BUN B;  2KI4 B;  3PLF B;  1KK7 Y;  1EG3 A;  2L4I A;  3JTD B;  1XK4 A;  1EL4 A;  3FS7 A;  5DKQ A;  1SY9 A;  2TN4 A;  1M45 A;  1A75 B;  1S3P A;  3TZ1 A;  5I2L A;  4BY4 A;  4UPG A;  3VRP A;  2MLE C;  1KFU L;  1S1E A;  1SMG A;  2L4H A;  2JNX A;  4I5N B;  1OMD A;  3DVK A;  2H2K A;  2M8U A;  5CSJ A;  5KSZ A;  1SKT A;  2GGZ A;  1FW4 A;  1XFU O;  3HX4 A;  3SG5 A;  2BL0 B;  1TCF A;  1XFY O;  4P5O E;  1CFD A;  4YI9 A;  2ZRT A;  5GQQ C;  2F8P A;  4CFR A;  1FI5 A;  4YGC B;  2KFH A;  4GBA A;  4MN0 A;  1NX3 A;  5TNC A;  1W7I B;  1V1G A;  4OCI A;  1BG1 A;  2M49 B;  4E68 A;  3O78 A;  1CM4 A;  1JFK A;  1MUX A;  2ZKM X;  1K93 D;  2AMI A;  2JT8 A;  1F54 A;  3EVR A;  3NSL A;  1BOC A;  2H61 C;  5AER A;  1HT9 A;  1F55 A;  3MSE B;  4AOM A;  1NIW A;  1KSM A;  2EC6 C;  3K21 A;  1JC2 A;  1K96 A;  1KFX L;  2Y1M A;  1RRO A;  4N1G A;  1NCZ A;  2KI6 D;  1IRJ A;  1LVC D;  2JUL A;  1CMG A;  3PAT A;  1CLL A;  1W7J B;  2L50 A;  3O4Y A;  1C7V A;  1DTL A;  2A4J A;  2KSP A;  1PSR A;  2L2E A;  3E3R A;  4MRY A;  3EKJ A;  4GNK B;  2L5X B;  2LVI A;  3LCP C;  2IS9 A;  3SIA A;  3SG2 A;  1C07 A;  3I5I C;  2LM5 A;  1Y1U A;  2JTT A;  3OHM B;  1TN4 A;  2K61 A;  1NX2 A;  3A4U B;  1Y1A A;  3BXK A;  2LVV A;  3I5H C;  3LLE A;  1QLK A;  2PAS A;  4MEW A;  1TTX A;  1XFX O;  3CLN A;  4JWQ A;  1UHJ A;  1K9P A;  1F4O A;  3AKA A;  2P6B B;  2HPS A;  4PE0 A;  2LC5 A;  1SCV A;  2D8N A;  2KI6 C;  3KHE A;  1SL9 A;  1DJX A;  2CXJ A;  1WDC C;  2F2O A;  4GGF A;  4ICB A;  2LMT A;  3VRQ A;  4HSZ A;  1YUS A;  4TNC A;  4MZK A;  1CLM A;  4HRE E;  4U8D A;  2LAP A;  1L2O B;  3SIB A;  1DJI A;  1ODB A;  4YRU A;  1B7T Y;  1BT6 A;  2M3W A;  2WC8 A;  3BUW B;  4ORC B;  2KQ6 A;  3ZNI A;  2K7C A;  1KQM C;  3BYA A;  3LL8 B;  4USL A;  1F4Q A;  2F3Y A;  3KF9 A;  3GK1 A;  2ZN8 A;  1VRK A;  4YI8 A;  1YUU A;  3EK7 A;  1KK7 Z;  2KAY A;  4N1F A;  1CLB A;  1EG4 A;  1M31 A;  1NYA A;  1AJ4 A;  1CDM A;  1HQV A;  4C0L A;  1SCM C;  4DUQ A;  2LP2 A;  3PM8 A;  1AK8 A;  1CDN A;  1KCY A;  2WOS A;  1UHK A;  3BOW A;  4ETO A;  1PSB A;  2M1U A;  1Y1X A;  1QX5 B;  2M97 A;  2BE4 A;  1NP8 A;  1EJ3 A;  1AHR A;  4CID A;  2SCP A;  1CFF A;  1LA3 A;  2BL0 C;  2OPO A;  1K90 D;  1QXP A;  1WLZ A;  3EK4 A;  1QAT A;  5DKR A;  5I8N A;  1WRL A;  2Y5I A;  2ISD A;  4YGE B;  1U5I A;  1RK9 A;  1K8U A;  2PMY A;  2K0J A;  1BR1 B;  2LUX A;  3CR5 X;  1RWY A;  2KDH A;  5PAL A;  2BKI B;  3DF0 A;  4XJK A;  1QAS A;  1V1F A;  1KK8 C;  3F45 A;  2KQY A;  4WRI A;  3WNX B;  2BBM A;  1CKK A;  3HCM A;  1X02 A;  5BPJ A;  1BMO A;  2Y1N A;  2JPT A;  1TNX A;  4I5K A;  1ZOT B;  2BCB A;  1MR8 A;  1KSO A;  3DVE A;  3LK0 A;  5J3X A;  1QTX A;  2KFF A;  1MQ1 A;  2JOJ A;  1D1O A;  3JVT B;  3FWB A;  1OSA A;  2F3Z A;  1NX1 A;  2LVK A;  2MAZ A;  1IQ3 A;  1YVL A;  2BEC A;  1JFJ A;  1CM1 A;  2JXL A;  1YUR A;  1F8H A;  2WOR A;  1MXE A;  1G8I A;  3CR2 A;  3TDU A;  4CFQ A;  2M7N A;  1GQM A;  5CPV A;  1TNP A;  4PE1 A;  1OE9 B;  3EVV A;  1DJY A;  1K95 A;  1RTP 1;  4CLN A;  4NDB A;  4AQJ A;  2HF5 A;  2B1U A;  1NCX A;  1REC A;  1NCY A;  2H61 A;  4GGN A;  3OB2 B;  2LV7 A;  2QPT A;  2G9B A;  2KGB C;  5FYX A;  4OR9 B;  3NXA A;  1DJH A;  5ER5 A;  2JT0 A;  2ZRS A; 
#chains in the Genus database with same CATH topology
 2QEB A;  2PRU A;  1L2O C;  4M2Q A;  4YGB B;  1J55 A;  4N5X A;  1B7T Z;  2OTG C;  1QV0 A;  1TNQ A;  1W9Z A;  1XYD A;  2JQ6 A;  4GFT A;  1IQ5 A;  1UP5 A;  3S0G A;  4WQ2 A;  2KYF A;  1Z4H A;  2JTZ A;  1ALV A;  2LHI A;  1JBA A;  3NHT A;  3S0B A;  1S26 D;  5AFP A;  1ZFS A;  1TUZ A;  3DY9 A;  5HLV A;  3DVM A;  4ORB B;  2BAP A;  2QAC A;  3I5G B;  1F70 A;  5D7F A;  3KEV A;  1J7Q A;  2E30 A;  3GK4 X;  4FQO A;  3RLZ A;  1SR6 B;  1SW8 A;  5JOL A;  1NSH A;  1TUJ A;  1IJ5 A;  3PN7 B;  3VRR A;  5HKZ A;  1UUS A;  1K94 A;  1SK6 D;  1PK0 D;  2OS8 C;  4M2O A;  1IJ6 A;  3CYZ A;  5CSI A;  3ZWH A;  2LHL A;  3TUY B;  2G2B A;  1CTR A;  1P28 A;  2HQ8 A;  2YGU A;  1TOP A;  4Q04 A;  1T14 A;  1NX0 A;  2BCX A;  3NSI A;  3L47 A;  1WRZ A;  2MA2 A;  4P2Y B;  4PE7 A;  2K7O A;  1B8R A;  1XO5 A;  4YBH B;  3SS4 A;  4BY5 A;  1UWO A;  2MLF C;  1J7O A;  2ZNE A;  3B88 A;  1OZS A;  3SG6 A;  3DD4 A;  2WCB A;  2BNX A;  4L9M A;  1SL8 A;  2BE6 A;  3GOF A;  1LIN A;  1DEL A;  3SG4 A;  4YGA A;  1SYM A;  3D78 A;  3TS5 C;  2LLU A;  3PFV A;  2JT3 A;  2K2A A;  3EVU A;  3ICB A;  1QX2 A;  2LAN A;  4MZL A;  1PUL A;  2WCH A;  1CNP A;  3A8R A;  1Q80 A;  3SG7 A;  3V2L A;  3JVT C;  1LXF C;  2K8M B;  2KI4 C;  3LK1 A;  3CDN A;  1IG5 A;  4AQI A;  1IWQ A;  1PVB A;  2LNK A;  3JTD C;  4M2P A;  2JU0 A;  4F7F A;  2MRD A;  1YUT A;  5HLO A;  2F2P A;  1DGV A;  1OOJ A;  1C3Z A;  4A4B A;  2QEO A;  3DVJ A;  3GK2 A;  3OB1 B;  3OX6 A;  2FJU B;  4GAO A;  1OMR A;  2ERB A;  1J1D A;  1RJV A;  2LCP A;  5HYD A;  1C7W A;  2O5G A;  2L0P A;  1B47 A;  1MWN A;  1NUB A;  3OBV A;  3KO0 A;  1JF2 A;  5HKY A;  1B4C A;  1S36 A;  1UHI A;  3EKH A;  4I5L B;  3CAB A;  3PSR A;  1B8L A;  2PYQ A;  3CS1 A;  1M46 A;  1ZMZ A;  2VRG A;  1A29 A;  2KFG A;  1N0Y A;  1AVS A;  1XA5 A;  2L98 A;  3R1P A;  2O60 A;  1ZUZ A;  1MXL C;  2EC6 B;  3BUO B;  1XFV O;  1AUI B;  1OZO A;  4WQ3 A;  2DOQ A;  1DT7 B;  4I5J A;  2QDI A;  3OP0 A;  1NWD A;  2JNF A;  1FF1 A;  2ZN9 A;  1MF8 B;  2R2I A;  4DIR A;  4ZCU A;  1UHN A;  1WLM A;  3UO9 A;  5I2Q A;  1A03 A;  2K2F A;  1SNL A;  1KWO B;  3CGA A;  2RGI A;  2KOT A;  5I94 A;  5ER4 X;  1M39 A;  3VGO A;  1FPW A;  2KGR A;  5D69 A;  3AKB A;  2GTE A;  2V53 A;  3I5I B;  2M7L A;  2LMV A;  1S5G Y;  1N65 A;  4PT1 A;  1SR6 C;  1A4P A;  3IQO A;  2P71 A;  4PAL A;  1DMO A;  1YX8 A;  2CNP A;  3PN7 C;  2FOT A;  3IF7 A;  3RM1 A;  3CZ1 A;  2LMU A;  2BCA A;  2QEH A;  4ORA B;  3D0Y A;  5I2O A;  1IGV A;  2KHN A;  5KU1 A;  1CDL A;  3I5F B;  1DJG A;  4JD9 A;  1YRU B;  3S0E A;  2NLN A;  3QME A;  2E6W A;  4PCW A;  2WCJ A;  3UNW A;  1JSA A;  1BR4 B;  2KYC A;  3OX5 A;  1H4B A;  1KQV A;  4DRW A;  4INX A;  4OV2 A;  2KBI A;  4MSP A;  3N7H A;  5AEQ A;  1CFC A;  3TDZ A;  2LLT A;  2M1K B;  3BFB A;  1CB1 A;  1OW4 A;  1OOH A;  1DF0 A;  3CR4 X;  1A2X A;  2CTN A;  1AJ5 A;  1B9A A;  1J7P A;  1R2U A;  2F33 A;  5G08 A;  1TIZ A;  1J7R A;  1ZAC A;  3AAJ A;  3FIA A;  2HET A;  1SCM B;  2LP3 A;  2BBN A;  3VRO A;  1DJW A;  4PHM A;  4CPV A;  2KAX A;  5CSF A;  2M0R A;  2FCD A;  3AAK A;  1M63 B;  5DKN A;  1YR5 A;  3S0D A;  2PAL A;  1B1G A;  1FI6 A;  3SG3 A;  1TCO B;  1R6P A;  1GM0 A;  4DCK A;  1XK4 C;  3FWC A;  1DC1 A;  1CMF A;  1JF0 A;  4QJ4 B;  2GGM A;  3R1O A;  1OMV A;  1MHO A;  3TDI A;  2EHB A;  2KLD A;  3WHT B;  1KFU S;  1GGZ A;  3BOW B;  2EGD A;  5FI7 A;  4PE4 A;  2Y4Q A;  3KPX A;  4MBE A;  4MVF A;  1QV1 A;  1BU3 A;  4HRH A;  5F6T A;  3RZS A;  3NSK A;  2LUC A;  2LE9 B;  4PHN A;  4NQG A;  1BOD A;  4JQ0 D;  4QJ5 B;  1KK8 B;  1N2D A;  2L51 A;  1IH0 A;  1G33 A;  2NCO A;  5KTY A;  1SRA A;  3DZT A;  1Y6W A;  1QLS A;  4PDZ A;  4OVN F;  1U5I B;  1FBV A;  3D77 A;  1QVI Y;  3WHU B;  2I18 A;  1DEK A;  2MBX A;  1E8A A;  1DJZ A;  3BJH A;  2KNE A;  3CWG A;  4JPZ B;  1KWO C;  2CCM A;  3VB1 A;  4GUK A;  3DF0 B;  2JXC A;  4XJK B;  5IBW A;  1XFZ O;  1EH2 A;  1A75 A;  3QRX A;  3WXA A;  4ZCV A;  2I7A A;  1QS7 A;  4QJ3 B;  1KFX S;  3B6X A;  2KLE A;  1K9K A;  3BUX B;  2I94 A;  3BQ3 A;  5FI6 A;  2Q91 A;  1QX7 A;  1S5G Z;  2CBL A;  2NCP A;  3O2P A;  4PHK A;  3C1V A;  1QWV A;  1ALW A;  4FTG A;  5AAN A;  1AP4 A;  2COL B;  4A4C A;  1JWD A;  4IL1 A;  1BF5 A;  4NDC A;  1B8C A;  1G4Y R;  1QIV A;  1YVH A;  2WND A;  3D0Y B;  3I5F C;  1PRW A;  2CT9 A;  4MLW A;  2JRF A;  1L7Z A;  4HRG A;  1DGU A;  1QJT A;  5DIC A;  1SL7 A;  2NXQ A;  1RFJ A;  1K2H A;  1QIW A;  1EXR A;  1IIO A;  2OTG B;  3D10 A;  2Q4U A;  2K7B A;  1YX7 A;  2BKH B;  1CDP A;  1CFP A;  4KYN A;  1DF0 B;  2AUC A;  2NZ0 A;  3SJS A;  1XVJ A;  4GGF C;  4PHJ A;  1JUO A;  4JKT A;  1TRF A;  2LLS A;  2KAV A;  2ZFD A;  1SPY A;  3OGN A;  3DXL A;  3BFA A;  1F71 A;  1K9U A;  1DVI A;  3CTN A;  3NHI A;  1BLQ A;  4MZJ A;  4DS7 A;  1H8B A;  2MJW B;  3NGV A;  1YTZ C;  1YRT B;  2FCE A;  4C0J A;  2LVJ A;  4YGD B;  2M9G A;  1C3Y A;  4INW A;  2OS8 B;  3H4S E;  2M29 A;  3O6B A;  2PVB A;  4C0K A;  3BUM B;  5CSN A;  3CZT X;  2WCF A;  3IQQ A;  3D74 A;  3EK8 A;  1OOF A;  1OQP A;  1UHH A;  2JZI A;  3I5G C;  4NDD A;  3FE8 A;  1UUR A;  4R1E A;  1BJF A;  2K7D A;  2L5Y A;  3M0W A;  4D1E A;  1TNW A;  5AXI A;  3I5H B;  2AAO A;  2I2R E;  2WCE A;  1IKU A;  5HKW A;  5B8I B;  3PAL A;  1LKJ A;  2HQW A;  1WY9 A;  4GPL B;  4XYN A;  1GGW A;  2SAS A;  5K89 A;  2JC2 A;  2WC6 A;  4OKH A;  3TUY C;  1J1E A;  1SBJ A;  2JWW A;  5JJG A;  1DQE A;  1S6I A;  3D76 A;  1Y0V H;  1WDC B;  1GJY A;  1S6C A;  2MHH A;  4MRX A;  2PSR A;  2GV5 A;  1XFW O;  3NSO A;  2ZND A;  1S6J A;  3TS5 B;  3VRN A;  1NPQ A;  1PVA A;  1LA0 A;  3EG5 B;  1LS8 A;  1XFR A;  1QVI Z;  2KBM A;  1KQM B;  1PAL A;  1WRK A;  3BUN B;  2KI4 B;  3PLF B;  1KK7 Y;  1EG3 A;  2L4I A;  3JTD B;  1XK4 A;  1EL4 A;  3FS7 A;  2KPH A;  5DKQ A;  4IJ7 A;  1SY9 A;  2TN4 A;  1M45 A;  1A75 B;  1S3P A;  3TZ1 A;  5I2L A;  4BY4 A;  4UPG A;  3VRP A;  2MLE C;  1KFU L;  1S1E A;  1Z2C B;  1SMG A;  2L4H A;  2JNX A;  4I5N B;  1OMD A;  3DVK A;  2H2K A;  2M8U A;  5CSJ A;  5KSZ A;  1SKT A;  2GGZ A;  1FW4 A;  3DYE A;  3FE9 A;  1XFU O;  3HX4 A;  3K1E A;  3SG5 A;  2BL0 B;  3R1V A;  1TCF A;  1XFY O;  4P5O E;  1CFD A;  4YI9 A;  2ZRT A;  3IVT A;  2F8P A;  5GQQ C;  4CFR A;  1FI5 A;  4YGC B;  2KFH A;  4GBA A;  4MN0 A;  1NX3 A;  5TNC A;  1W7I B;  1V1G A;  4OCI A;  1BG1 A;  2M49 B;  4E68 A;  3O78 A;  1CM4 A;  1JFK A;  1MUX A;  2ZKM X;  1K93 D;  2AMI A;  2JT8 A;  1F54 A;  3EVR A;  3NSL A;  5D3O A;  1BOC A;  2H61 C;  5AER A;  1HT9 A;  1F55 A;  3MSE B;  1ORG A;  5EL2 A;  1NIW A;  4AOM A;  1KSM A;  2EC6 C;  1SSE B;  2WCL A;  3K21 A;  1JC2 A;  1K96 A;  1KFX L;  2Y1M A;  1RRO A;  4N1G A;  1NCZ A;  2KI6 D;  1IRJ A;  1LVC D;  2JUL A;  1CMG A;  3PAT A;  1CLL A;  1W7J B;  2L50 A;  3O4Y A;  1C7V A;  1DTL A;  2A4J A;  2KSP A;  1PSR A;  3FE6 A;  2L2E A;  3E3R A;  4MRY A;  3EKJ A;  4GNK B;  2L5X B;  2LVI A;  3D75 A;  3LCP C;  2IS9 A;  3SIA A;  3SG2 A;  1C07 A;  3I5I C;  2LM5 A;  1Y1U A;  2JTT A;  3OHM B;  1TN4 A;  2K61 A;  1NX2 A;  3A4U B;  1Y1A A;  3BXK A;  2LVV A;  3I5H C;  3LLE A;  1QLK A;  2PAS A;  4MEW A;  1TTX A;  1XFX O;  3CLN A;  4JWQ A;  1UHJ A;  1K9P A;  2FJY A;  1F4O A;  3SS5 A;  3AKA A;  2P6B B;  2HPS A;  4PE0 A;  2LC5 A;  1SCV A;  2D8N A;  2KI6 C;  3KHE A;  1SL9 A;  1DJX A;  2CXJ A;  1WDC C;  2F2O A;  4GGF A;  4ICB A;  2LMT A;  3VRQ A;  4HSZ A;  1YUS A;  4TNC A;  4F0Z B;  4MZK A;  1CLM A;  4HRE E;  4U8D A;  2LAP A;  1L2O B;  3SIB A;  1DJI A;  1ODB A;  4YRU A;  1B7T Y;  1BT6 A;  2M3W A;  2WC8 A;  3BUW B;  4ORC B;  2KQ6 A;  3ZNI A;  2K7C A;  1KQM C;  3BYA A;  3LL8 B;  4USL A;  1F4Q A;  2F3Y A;  3KF9 A;  3GK1 A;  2ZN8 A;  1VRK A;  4YI8 A;  1YUU A;  3EK7 A;  1KK7 Z;  2KAY A;  4N1F A;  1CLB A;  1EG4 A;  2H8V A;  1M31 A;  1NYA A;  1AJ4 A;  1CDM A;  1HQV A;  4C0L A;  1SCM C;  4DUQ A;  1OOI X;  2LP2 A;  3PM8 A;  1AK8 A;  1CDN A;  2K60 A;  1KCY A;  2WOS A;  1UHK A;  3BOW A;  4ETO A;  1PSB A;  2M1U A;  1Y1X A;  1QX5 B;  2M97 A;  2BE4 A;  1NP8 A;  1EJ3 A;  1AHR A;  4CID A;  2QEV A;  2SCP A;  1CFF A;  3O4X A;  1LA3 A;  2BL0 C;  2OPO A;  1K90 D;  1QXP A;  1WLZ A;  3EK4 A;  1QAT A;  5DKR A;  5HL1 A;  5I8N A;  2P70 A;  1WRL A;  2Y5I A;  3S0F A;  1TWO A;  3L4A A;  2ISD A;  4YGE B;  1U5I A;  1RK9 A;  1K8U A;  2PMY A;  2K0J A;  3B7A A;  1BR1 B;  3R72 A;  2LUX A;  3CR5 X;  1RWY A;  2KDH A;  5PAL A;  5FI2 A;  2BKI B;  3DF0 A;  4XJK A;  1QAS A;  1V1F A;  1KK8 C;  3F45 A;  2KQY A;  4WRI A;  3D73 A;  2BBM A;  3WNX B;  3HCM A;  4OZD A;  1CKK A;  1X02 A;  5BPJ A;  2WC5 A;  1BMO A;  2Y1N A;  2JPT A;  1TNX A;  2JPO A;  4I5K A;  2WCK A;  1ZOT B;  3S0A A;  2BCB A;  1MR8 A;  1KSO A;  3PM2 A;  3Q8I A;  3DVE A;  3LK0 A;  5J3X A;  1QTX A;  2KFF A;  1MQ1 A;  2JOJ A;  1D1O A;  3JVT B;  3CZ0 A;  3L4L A;  3FWB A;  1OSA A;  2F3Z A;  1NX1 A;  2LVK A;  2MAZ A;  4FQT A;  1IQ3 A;  3B86 A;  3PJI A;  1YVL A;  2BEC A;  1JFJ A;  1OOG A;  1CM1 A;  2JXL A;  2WCM A;  3CZ2 A;  1YUR A;  3BFH A;  1F8H A;  2WOR A;  1MXE A;  1G8I A;  3CR2 A;  3TDU A;  4CFQ A;  2M7N A;  1GQM A;  5CPV A;  1TNP A;  4PE1 A;  3SS3 A;  1OE9 B;  3B87 A;  3EVV A;  1DJY A;  1K95 A;  1RTP 1;  2PQL A;  4CLN A;  4NDB A;  4AQJ A;  2HF5 A;  2B1U A;  1NCX A;  1REC A;  1NCY A;  2H61 A;  4GGN A;  3OB2 B;  2LV7 A;  2QPT A;  2G9B A;  2KGB C;  5FYX A;  4OR9 B;  3NXA A;  1DJH A;  5ER5 A;  2JT0 A;  2ZRS A;  2L2C A; 
#chains in the Genus database with same CATH homology
 2PRU A;  1L2O C;  4M2Q A;  4YGB B;  1J55 A;  4N5X A;  1B7T Z;  2OTG C;  1QV0 A;  1TNQ A;  1XYD A;  2JQ6 A;  4GFT A;  1IQ5 A;  1UP5 A;  4WQ2 A;  2KYF A;  2JTZ A;  1ALV A;  2LHI A;  1JBA A;  1S26 D;  5AFP A;  1ZFS A;  5HLV A;  3DVM A;  4ORB B;  2QAC A;  1F70 A;  3I5G B;  5D7F A;  3KEV A;  1J7Q A;  2E30 A;  3GK4 X;  4FQO A;  3RLZ A;  1SR6 B;  1SW8 A;  5JOL A;  1NSH A;  1IJ5 A;  3PN7 B;  3VRR A;  5HKZ A;  1UUS A;  1K94 A;  1SK6 D;  1PK0 D;  2OS8 C;  4M2O A;  1IJ6 A;  5CSI A;  3ZWH A;  2LHL A;  3TUY B;  2G2B A;  1CTR A;  2HQ8 A;  1TOP A;  4Q04 A;  1NX0 A;  2BCX A;  3NSI A;  1WRZ A;  2MA2 A;  4P2Y B;  4PE7 A;  2K7O A;  1B8R A;  1XO5 A;  4YBH B;  4BY5 A;  1UWO A;  2MLF C;  1J7O A;  2ZNE A;  1OZS A;  3SG6 A;  3DD4 A;  2WCB A;  4L9M A;  1SL8 A;  2BE6 A;  3GOF A;  1LIN A;  3SG4 A;  4YGA A;  1SYM A;  3TS5 C;  2LLU A;  3PFV A;  2JT3 A;  2K2A A;  3EVU A;  3ICB A;  1QX2 A;  2LAN A;  4MZL A;  1PUL A;  1CNP A;  3A8R A;  1Q80 A;  3SG7 A;  4F0Z B;  3JVT C;  1LXF C;  2K8M B;  2KI4 C;  3LK1 A;  1IG5 A;  4AQI A;  1IWQ A;  1PVB A;  2LNK A;  3JTD C;  4M2P A;  2JU0 A;  2MRD A;  1YUT A;  5HLO A;  2F2P A;  1DGV A;  1OOJ A;  4A4B A;  3DVJ A;  3GK2 A;  3OB1 B;  3OX6 A;  2FJU B;  4GAO A;  1OMR A;  1J1D A;  1RJV A;  2LCP A;  5HYD A;  1C7W A;  2O5G A;  2L0P A;  1B47 A;  1MWN A;  1NUB A;  5HKY A;  3KO0 A;  1JF2 A;  1B4C A;  1S36 A;  1UHI A;  3EKH A;  4I5L B;  3PSR A;  1B8L A;  3CS1 A;  1M46 A;  1ZMZ A;  2VRG A;  1A29 A;  2KFG A;  1N0Y A;  1AVS A;  1XA5 A;  2L98 A;  2O60 A;  1ZUZ A;  1MXL C;  2EC6 B;  3BUO B;  1XFV O;  1AUI B;  1OZO A;  4WQ3 A;  2DOQ A;  1DT7 B;  4I5J A;  3OP0 A;  1NWD A;  2JNF A;  1FF1 A;  2ZN9 A;  1MF8 B;  2R2I A;  4DIR A;  4ZCU A;  1UHN A;  1WLM A;  5I2Q A;  1A03 A;  2K2F A;  1SNL A;  1KWO B;  3CGA A;  2RGI A;  2KOT A;  5ER4 X;  1M39 A;  3VGO A;  1FPW A;  2KGR A;  5D69 A;  3AKB A;  2V53 A;  3I5I B;  2M7L A;  2LMV A;  1S5G Y;  1N65 A;  1SR6 C;  1A4P A;  3IQO A;  4PAL A;  1DMO A;  1YX8 A;  2CNP A;  3PN7 C;  2FOT A;  3IF7 A;  3RM1 A;  2LMU A;  2BCA A;  4ORA B;  3D0Y A;  5I2O A;  1IGV A;  2KHN A;  5KU1 A;  1CDL A;  3I5F B;  1DJG A;  1YRU B;  2NLN A;  4PCW A;  2E6W A;  1JSA A;  1BR4 B;  2KYC A;  3OX5 A;  1H4B A;  1KQV A;  4DRW A;  4OV2 A;  2KBI A;  4MSP A;  5AEQ A;  1CFC A;  3TDZ A;  2LLT A;  2M1K B;  1CB1 A;  1DF0 A;  3CR4 X;  1A2X A;  2CTN A;  1AJ5 A;  1B9A A;  1J7P A;  1R2U A;  2F33 A;  5G08 A;  1TIZ A;  1J7R A;  1ZAC A;  3AAJ A;  3FIA A;  2HET A;  1SCM B;  2LP3 A;  2BBN A;  3VRO A;  1DJW A;  4PHM A;  4CPV A;  2KAX A;  5CSF A;  2M0R A;  2FCD A;  3AAK A;  1M63 B;  5DKN A;  1YR5 A;  2PAL A;  1B1G A;  1FI6 A;  3SG3 A;  1TCO B;  1R6P A;  4DCK A;  1XK4 C;  3FWC A;  1CMF A;  1JF0 A;  4QJ4 B;  2GGM A;  1OMV A;  1MHO A;  3TDI A;  2EHB A;  3WHT B;  1KFU S;  1GGZ A;  3BOW B;  2EGD A;  4PE4 A;  2Y4Q A;  3KPX A;  4MBE A;  4MVF A;  1QV1 A;  1BU3 A;  4HRH A;  5F6T A;  3NSK A;  2LUC A;  2LE9 B;  4PHN A;  4NQG A;  1BOD A;  4JQ0 D;  4QJ5 B;  1KK8 B;  1N2D A;  2L51 A;  1IH0 A;  1G33 A;  2NCO A;  5KTY A;  1SRA A;  4PDZ A;  1Y6W A;  1QLS A;  4OVN F;  1U5I B;  1FBV A;  1QVI Y;  3WHU B;  2I18 A;  2MBX A;  1E8A A;  1DJZ A;  2KNE A;  3CWG A;  4JPZ B;  1KWO C;  2CCM A;  4GUK A;  3DF0 B;  2JXC A;  4XJK B;  5IBW A;  1XFZ O;  1EH2 A;  1A75 A;  3QRX A;  3WXA A;  4ZCV A;  2I7A A;  1QS7 A;  4QJ3 B;  1KFX S;  1K9K A;  3BUX B;  2I94 A;  3BQ3 A;  2Q91 A;  1QX7 A;  1S5G Z;  2CBL A;  2NCP A;  3O2P A;  4PHK A;  3C1V A;  1ALW A;  4FTG A;  5AAN A;  1AP4 A;  2COL B;  4A4C A;  1JWD A;  4IL1 A;  1BF5 A;  4NDC A;  1B8C A;  1G4Y R;  1QIV A;  1YVH A;  2WND A;  3D0Y B;  3I5F C;  1PRW A;  2CT9 A;  4MLW A;  2JRF A;  1L7Z A;  4HRG A;  1DGU A;  1QJT A;  1SL7 A;  2NXQ A;  1RFJ A;  1K2H A;  1QIW A;  1EXR A;  2OTG B;  3D10 A;  2Q4U A;  2K7B A;  2BKH B;  1YX7 A;  1CDP A;  1CFP A;  1DF0 B;  2AUC A;  2NZ0 A;  3SJS A;  1XVJ A;  4GGF C;  4PHJ A;  1JUO A;  1TRF A;  2LLS A;  2KAV A;  2ZFD A;  1SPY A;  1F71 A;  1K9U A;  1DVI A;  3CTN A;  1BLQ A;  4MZJ A;  4DS7 A;  1H8B A;  2MJW B;  1YTZ C;  1YRT B;  2FCE A;  4C0J A;  2LVJ A;  4YGD B;  2M9G A;  2OS8 B;  3H4S E;  2M29 A;  3O6B A;  2PVB A;  4C0K A;  3BUM B;  5CSN A;  3CZT X;  2WCF A;  3IQQ A;  3EK8 A;  1OQP A;  1UHH A;  3I5G C;  2JZI A;  4NDD A;  1UUR A;  4R1E A;  1BJF A;  2K7D A;  4D1E A;  3M0W A;  1TNW A;  5AXI A;  3I5H B;  2AAO A;  2I2R E;  2WCE A;  1IKU A;  5HKW A;  5B8I B;  3PAL A;  1LKJ A;  2HQW A;  1WY9 A;  4GPL B;  4XYN A;  1GGW A;  2SAS A;  5K89 A;  2JC2 A;  4OKH A;  3TUY C;  1J1E A;  1SBJ A;  2JWW A;  5JJG A;  1S6I A;  1Y0V H;  1WDC B;  1GJY A;  1S6C A;  2MHH A;  4MRX A;  2PSR A;  2GV5 A;  1XFW O;  3NSO A;  2ZND A;  1S6J A;  3TS5 B;  3VRN A;  1NPQ A;  1PVA A;  1LA0 A;  1QVI Z;  2KBM A;  1KQM B;  1PAL A;  1WRK A;  3BUN B;  2KI4 B;  3PLF B;  1KK7 Y;  1EG3 A;  2L4I A;  3JTD B;  1XK4 A;  1EL4 A;  3FS7 A;  5DKQ A;  1SY9 A;  2TN4 A;  1M45 A;  1A75 B;  1S3P A;  3TZ1 A;  5I2L A;  4BY4 A;  4UPG A;  3VRP A;  2MLE C;  1KFU L;  1S1E A;  1SMG A;  2L4H A;  2JNX A;  4I5N B;  1OMD A;  3DVK A;  2H2K A;  2M8U A;  5CSJ A;  5KSZ A;  1SKT A;  2GGZ A;  1FW4 A;  1XFU O;  3HX4 A;  3SG5 A;  2BL0 B;  1TCF A;  1XFY O;  4P5O E;  1CFD A;  4YI9 A;  2ZRT A;  5GQQ C;  2F8P A;  4CFR A;  1FI5 A;  4YGC B;  2KFH A;  4GBA A;  4MN0 A;  1NX3 A;  5TNC A;  1W7I B;  1V1G A;  4OCI A;  1BG1 A;  2M49 B;  4E68 A;  3O78 A;  1CM4 A;  1JFK A;  1MUX A;  2ZKM X;  1K93 D;  2AMI A;  2JT8 A;  1F54 A;  3EVR A;  3NSL A;  1BOC A;  2H61 C;  5AER A;  1HT9 A;  1F55 A;  3MSE B;  4AOM A;  1NIW A;  1KSM A;  2EC6 C;  3K21 A;  1JC2 A;  1K96 A;  1KFX L;  2Y1M A;  1RRO A;  4N1G A;  1NCZ A;  2KI6 D;  1IRJ A;  1LVC D;  2JUL A;  1CMG A;  3PAT A;  1CLL A;  1W7J B;  2L50 A;  3O4Y A;  1C7V A;  1DTL A;  2A4J A;  2KSP A;  1PSR A;  2L2E A;  3E3R A;  4MRY A;  3EKJ A;  4GNK B;  2L5X B;  2LVI A;  3LCP C;  2IS9 A;  3SIA A;  3SG2 A;  1C07 A;  3I5I C;  2LM5 A;  1Y1U A;  2JTT A;  3OHM B;  1TN4 A;  2K61 A;  1NX2 A;  3A4U B;  1Y1A A;  3BXK A;  2LVV A;  3I5H C;  3LLE A;  1QLK A;  2PAS A;  4MEW A;  1TTX A;  1XFX O;  3CLN A;  4JWQ A;  1UHJ A;  1K9P A;  1F4O A;  3AKA A;  2P6B B;  2HPS A;  4PE0 A;  2LC5 A;  1SCV A;  2D8N A;  2KI6 C;  3KHE A;  1SL9 A;  1DJX A;  2CXJ A;  1WDC C;  2F2O A;  4GGF A;  4ICB A;  2LMT A;  3VRQ A;  4HSZ A;  1YUS A;  4TNC A;  4MZK A;  1CLM A;  4HRE E;  4U8D A;  2LAP A;  1L2O B;  3SIB A;  1DJI A;  1ODB A;  4YRU A;  1B7T Y;  1BT6 A;  2M3W A;  2WC8 A;  3BUW B;  4ORC B;  2KQ6 A;  3ZNI A;  2K7C A;  1KQM C;  3BYA A;  3LL8 B;  4USL A;  1F4Q A;  2F3Y A;  3KF9 A;  3GK1 A;  2ZN8 A;  1VRK A;  4YI8 A;  1YUU A;  3EK7 A;  1KK7 Z;  2KAY A;  4N1F A;  1CLB A;  1EG4 A;  1M31 A;  1NYA A;  1AJ4 A;  1CDM A;  1HQV A;  4C0L A;  1SCM C;  4DUQ A;  2LP2 A;  3PM8 A;  1AK8 A;  1CDN A;  1KCY A;  2WOS A;  1UHK A;  3BOW A;  4ETO A;  1PSB A;  2M1U A;  1Y1X A;  1QX5 B;  2M97 A;  2BE4 A;  1NP8 A;  1EJ3 A;  1AHR A;  4CID A;  2SCP A;  1CFF A;  1LA3 A;  2BL0 C;  2OPO A;  1K90 D;  1QXP A;  1WLZ A;  3EK4 A;  1QAT A;  5DKR A;  5I8N A;  1WRL A;  2Y5I A;  2ISD A;  4YGE B;  1U5I A;  1RK9 A;  1K8U A;  2PMY A;  2K0J A;  1BR1 B;  2LUX A;  3CR5 X;  1RWY A;  2KDH A;  5PAL A;  2BKI B;  3DF0 A;  4XJK A;  1QAS A;  1V1F A;  1KK8 C;  3F45 A;  2KQY A;  4WRI A;  3WNX B;  2BBM A;  1CKK A;  3HCM A;  1X02 A;  5BPJ A;  1BMO A;  2Y1N A;  2JPT A;  1TNX A;  4I5K A;  1ZOT B;  2BCB A;  1MR8 A;  1KSO A;  3DVE A;  3LK0 A;  5J3X A;  1QTX A;  2KFF A;  1MQ1 A;  2JOJ A;  1D1O A;  3JVT B;  3FWB A;  1OSA A;  2F3Z A;  1NX1 A;  2LVK A;  2MAZ A;  1IQ3 A;  1YVL A;  2BEC A;  1JFJ A;  1CM1 A;  2JXL A;  1YUR A;  1F8H A;  2WOR A;  1MXE A;  1G8I A;  3CR2 A;  3TDU A;  4CFQ A;  2M7N A;  1GQM A;  5CPV A;  1TNP A;  4PE1 A;  1OE9 B;  3EVV A;  1DJY A;  1K95 A;  1RTP 1;  4CLN A;  4NDB A;  4AQJ A;  2HF5 A;  2B1U A;  1NCX A;  1REC A;  1NCY A;  2H61 A;  4GGN A;  3OB2 B;  2LV7 A;  2QPT A;  2G9B A;  2KGB C;  5FYX A;  4OR9 B;  3NXA A;  1DJH A;  5ER5 A;  2JT0 A;  2ZRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...