1M63B

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
158
Chain Sequence
SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
total genus 36
structure length 158
sequence length 158
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m63B00
3VRNA 2L4IA 3OHMB 1J7RA 1NUBA 2BBMA 1QVIY 2F2PA 2FJUB 2KQYA 3RM1A 4CFQA 3DVEA 2MLFC 2BECA 2HQWA 2V53A 3M0WA 3GOFA 1D1OA 1BR4B 1CM4A 2QACA 1BF5A 1N65A 3ICBA 2JXCA 3HX4A 1CFCA 1S26D 1B7TZ 1EJ3A 1YTZC 2K7DA 1HT9A 2KBIA 3WHUB 1U5IA 1MXLC 1DF0B 2Q91A 5TNCA 5HLOA 5HLVA 3BQ3A 2OTGC 2FOTA 2COLB 1IJ5A 1IGVA 2LNKA 1MXEA 3I5FC 1L7ZA 2LP3A 2H61A 1KSOA 1C07A 2CBLA 1QXPA 2MLEC 4WQ2A 2BCBA 2LAPA 4N5XA 4TNCA 3ZWHA 4UPGA 2E30A 5KTYA 1G8IA 3O6BA 1ZFSA 3TDZA 2K7BA 1Q80A 1UHHA 4WQ3A 2BL0B 4L9MA 2KBMA 4PDZA 2LV7A 3CWGA 1CTRA 3LK1A 1NIWA 2LMTA 4QJ4B 3GK2A 5AEQA 1BMOA 5HKWA 3WHTB 1LINA 1IQ5A 4A4CA 1TNWA 3WNXB 1F70A 2LUCA 3EVVA 4YGCB 1CDPA 2AMIA 3D10A 2LVKA 4GGFA 2KNEA 1F54A 1EXRA 1A75B 3PALA 2PALA 1M31A 3AKBA 1W7JB 3BUWB 3D0YA 5K89A 5I2OA 1Y1AA 1S6JA 4PE0A 1DJHA 5CPVA 2MBXA 4YI8A 4ZCUA 2F3YA 2LLTA 1G33A 1DJYA 4GBAA 3KF9A 2BKHB 1YX8A 3FS7A 4DS7A 1C7WA 1EH2A 4FTGA 5AXIA 1CMFA 3TS5C 4MRXA 4MZKA 1S1EA 1SL8A 5D69A 1KFXS 1FF1A 1SR6B 4N1GA 1TOPA 1B47A 1OSAA 3TZ1A 1YUUA 2Y4QA 1V1GA 3SG6A 1NWDA 3BUOB 3PLFB 2PMYA 3DD4A 4MEWA 1A29A 3DF0A 4I5LB 1NX3A 3EVRA 4MRYA 1UP5A 2K61A 2JTZA 4PE1A 2M7LA 3VGOA 2TN4A 3O2PA 1CLLA 3GK4X 1RTP1 1CDMA 1WLZA 3HCMA 4C0JA 3IQQA 4PHKA 1QV1A 4A4BA 2ZN8A 4AOMA 1F4QA 4BY5A 2D8NA 1SCMC 3OP0A 4GGNA 4YRUA 1XFVO 2H2KA 2JZIA 2Y1MA 1J7PA 1R2UA 2JT0A 1S6IA 1DJXA 2LVVA 1RK9A 3E3RA 1HQVA 4YI9A 5DKRA 1OMVA 2M0RA 3C1VA 1DF0A 1ZUZA 2M1KB 3BUMB 2PSRA 2ZNEA 1TCOB 2KAYA 1FPWA 1YUTA 2K2AA 1L2OC 1PSRA 1UHIA 2ZKMX 3OB2B 3FIAA 1WRLA 3EK7A 4JQ0D 1X02A 1XFZO 2G9BA 1QX5B 1KK8C 2JXLA 1G4YR 1NSHA 2WNDA 1KK7Z 1N2DA 2M3WA 4XYNA 2I18A 3CR2A 3JTDC 1SK6D 3AAKA 1UHNA 1J55A 2AAOA 2R2IA 4CIDA 2K8MB 1JWDA 1CFFA 2PASA 4PE4A 2JTTA 2M49B 4QJ5B 1K93D 1YURA 3EKJA 2CCMA 1YVLA 2OS8C 5ER5A 3NXAA 1A75A 5DKNA 2ZRTA 4PHJA 1IRJA 1CB1A 1FW4A 1EL4A 2I7AA 1RJVA 2MAZA 2PVBA 4I5KA 2OTGB 1IWQA 3KPXA 4MN0A 3I5FB 3AAJA 3TUYC 1OZOA 4ETOA 3BUNB 1UWOA 2BE6A 4DRWA 3O4YA 2LMUA 3VRRA 1IJ6A 1S36A 1XA5A 1XK4A 4JWQA 2M97A 1MQ1A 3VRPA 1ALWA 4XJKB 2LCPA 1A03A 5I8NA 2F2OA 5B8IB 4M2OA 2VRGA 1QTXA 2PRUA 2JQ6A 4GFTA 4GNKB 3H4SE 1XFUO 3PM8A 2Y1NA 2KGBC 1JSAA 2K2FA 2ZFDA 2WC8A 1Y1UA 3SG5A 1RFJA 2JRFA 5I2QA 1AP4A 2NXQA 3EVUA 1OMRA 1KWOC 3RLZA 3NSIA 1K95A 5KSZA 2EHBA 1FI5A 3LLEA 2JNXA 3NSOA 4I5JA 1LXFC 4ICBA 1S5GZ 2JOJA 2O60A 4YGDB 4ZCVA 2G2BA 1NPQA 2KYCA 3SG4A 2L50A 4D1EA 3AKAA 3EK8A 1UUSA 2JC2A 1WY9A 1PK0D 2JNFA 3TS5B 1KQMC 3NSLA 3SIAA 3CR5X 1B8LA 1BG1A 2E6WA 2FCDA 5DKQA 3LCPC 4M2QA 4DIRA 3MSEB 1YRTB 4YGBB 2CXJA 3I5HC 1IQ3A 1OE9B 2EC6C 1J7OA 1B7TY 2KI4C 3CR4X 2KAVA 2M1UA 1KFUL 1QX7A 1NCZA 1B9AA 2L0PA 4OV2A 3DVMA 1JFKA 1JUOA 1TNQA 1AJ4A 2LHLA 4YGAA 3F45A 2LHIA 1NP8A 3BOWB 3VRQA 5J3XA 3QRXA 4QJ3B 4HREE 1BR1B 1NYAA 1MHOA 2LE9B 4HSZA 3BYAA 2KI6C 4ORBB 2F8PA 2LMVA 2JULA 3WXAA 2M8UA 1SCMB 3LK0A 4CPVA 1GGWA 1B8RA 1SMGA 4IL1A 1M63B 1ODBA 3I5IC 4CFRA 4DCKA 2KYFA 1YUSA 1TRFA 1AK8A 5HKYA 2Y5IA 1WRKA 1OMDA 2KSPA 4PHNA 2K7OA 1GJYA 4C0KA 4I5NB 4YGEB 1K9UA 3ZNIA 3IQOA 2CNPA 1L2OB 1GQMA 1XO5A 1JF2A 4P2YB 1DGVA 1SW8A 4FQOA 3FWBA 1KQVA 2WOSA 2GGMA 1KK8B 4XJKA 2LVJA 2H61C 1JFJA 4NDDA 1QVIZ 5G08A 1DTLA 4U8DA 3TDUA 2QPTA 1YR5A 3JTDB 1QLKA 2KFFA 5CSFA 5HKZA 1B1GA 1BJFA 3A8RA 1CLMA 2LM5A 2NCOA 1WDCC 1CFDA 5KU1A 3CZTX 2EGDA 1XFXO 1XFYO 3IF7A 2OS8B 2O5GA 1VRKA 1SL9A 4AQJA 1PVAA 2LLSA 3CTNA 3K21A 1IG5A 1J1EA 4M2PA 3DVKA 4GUKA 1QX2A 4N1FA 4GGFC 1AHRA 1V1FA 4P5OE 3KO0A 4Q04A 4OVNF 3TUYB 1A2XA 3JVTC 4C0LA 4HRHA 1QS7A 3SG3A 3CGAA 1AVSA 1RWYA 1K9PA 1TCFA 1SKTA 1MUXA 3EK4A 1S3PA 1MWNA 1F71A 1YVHA 2BKIB 2F3ZA 2P6BB 2BE4A 1F4OA 1QV0A 2KFHA 2ZNDA 2A4JA 4F0ZB 1LVCD 1KFUS 4MZJA 5FYXA 1J7QA 1Y0VH 1JF0A 4ORAB 4JPZB 3OB1B 1IKUA 2KAXA 1KFXL 2K0JA 4CLNA 4ORCB 4USLA 2BBNA 2OPOA 3I5GC 4E68A 1MR8A 2L5XB 1C7VA 2I94A 2JWWA 1K96A 1DMOA 4OCIA 1YRUB 2IS9A 4PCWA 1CM1A 1OQPA 1PRWA 4PE7A 5JOLA 2NCPA 1NCYA 3BOWA 1WRZA 2LVIA 3DVJA 4MVFA 2WCEA 1KWOB 2LANA 3PN7C 3LL8B 4PHMA 1B8CA 1H4BA 1Y6WA 3KEVA 3CLNA 3EKHA 1KK7Y 1UHKA 2GV5A 1PULA 1PVBA 1KQMB 3NSKA 2WCFA 3SG7A 5CSJA 1BU3A 1ALVA 2DOQA 5AFPA 5HYDA 4OR9B 4AQIA 3PSRA 1UHJA 5GQQC 2MRDA 1FBVA 3I5HB 3PFVA 1JBAA 1SL7A 2EC6B 2KI4B 1PSBA 1SNLA 1SYMA 2MA2A 1XVJA 4R1EA 3SG2A 1B4CA 2ZN9A 5JJGA 4MLWA 5AANA 1NX1A 1AJ5A 2JT3A 1QASA 2JT8A 1XFWO 1GGZA 2B1UA 1F55A 2KI6D 1SPYA 5BPJA 1Y1XA 1TNPA 2BL0C 2WORA 2LC5A 1QJTA 1TTXA 2L4HA 2L51A 3BXKA 5PALA 3FWCA 1OOJA 3I5IB 1BODA 1PALA 2AUCA 4MSPA 1BOCA 4GAOA 4DUQA 3VROA 2F33A 1QLSA 2JU0A 1WLMA 2FCEA 1RROA 1DJZA 1LA0A 2LUXA 3BUXB 4YBHB 1ZACA 4OKHA 2I2RE 2L2EA 1MF8B 1CDNA 4GPLB 4MBEA 1DGUA 2SASA 1M39A 1U5IB 2M7NA 1CFPA 1UURA 1IH0A 1QIVA 2BCXA 4BY4A 3O78A 1TIZA 3CS1A 2K7CA 1SBJA 2ZRSA 1CDLA 1N0YA 1DJWA 1XYDA 2GGZA 1S5GY 2KOTA 5ER4X 2NLNA 2KDHA 2RGIA 3OX6A 1XK4C 1EG4A 1K9KA 1CNPA 2BCAA 1SR6C 2MJWB 5CSIA 1BLQA 1NCXA 3A4UB 1WDCB 1QIWA 2JPTA 4WRIA 2Q4UA 1FI6A 1K8UA 2CTNA 1LA3A 2L98A 1NX2A 5AERA 1ZMZA 2LP2A 2SCPA 2CT9A 1RECA 1K94A 1DJIA 1EG3A 1M46A 4HRGA 5D7FA 1M45A 1DT7B 3SIBA 1J1DA 2HETA 1DVIA 2M9GA 2ISDA 1SCVA 2KFGA 1KCYA 4PALA 1CKKA 3D0YB 1OZSA 3JVTB 3SJSA 1AUIB 2KGRA 1BT6A 5I2LA 3PATA 2MHHA 1SRAA 1JC2A 5CSNA 5F6TA 2KQ6A 2M29A 3OX5A 1ZOTB 2HQ8A 3KHEA 2LLUA 2HPSA 1E8AA 1S6CA 4NDBA 1H8BA 1K2HA 1TNXA 1A4PA 3I5GB 2NZ0A 3GK1A 1NX0A 1YX7A 1LKJA 2KHNA 1CLBA 1QATA 1K90D 1KSMA 1W7IB 3DF0B 1TN4A 2HF5A 1F8HA 1R6PA 1SY9A 3PN7B 4MZLA 1CMGA 5IBWA 1DJGA 3TDIA 4NDCA 2WCBA 4NQGA
chains in the Genus database with same CATH superfamily
3VRNA 2L4IA 3OHMB 1J7RA 1NUBA 2BBMA 1QVIY 2F2PA 2FJUB 2KQYA 3L4AA 3RM1A 4CFQA 3DVEA 2MLFC 2BECA 2HQWA 2V53A 3DZTA 3M0WA 3GOFA 1D1OA 1BR4B 1CM4A 2QACA 1BF5A 1N65A 3ICBA 3D73A 2JXCA 3HX4A 1CFCA 1S26D 1B7TZ 1EJ3A 1YTZC 2K7DA 1HT9A 2KBIA 3WHUB 1U5IA 1MXLC 2JPOA 3CZ0A 1DF0B 2Q91A 5TNCA 5HLOA 1T14A 3BQ3A 2OTGC 2FOTA 5HLVA 3RZSA 2COLB 1IJ5A 1IGVA 2LNKA 1MXEA 3I5FC 1L7ZA 3DY9A 2LP3A 2H61A 1KSOA 2H8VA 1C07A 2CBLA 1QXPA 2MLEC 4WQ2A 2BCBA 2K60A 2LAPA 3OBVA 4N5XA 4TNCA 3ZWHA 4UPGA 2E30A 5KTYA 1G8IA 3O6BA 1ZFSA 3TDZA 2K7BA 1Q80A 1UHHA 4WQ3A 2BL0B 4L9MA 2KBMA 4PDZA 2LV7A 3CWGA 1CTRA 3R72A 3LK1A 3CYZA 5FI2A 1NIWA 2LMTA 4QJ4B 2WCMA 3BFBA 3GK2A 1BMOA 5AEQA 5HKWA 3WHTB 1LINA 1IQ5A 1Z2CB 4A4CA 1TNWA 3S0EA 3WNXB 1F70A 2LUCA 3EVVA 4YGCB 1CDPA 2AMIA 3D10A 2LVKA 4GGFA 2KNEA 1F54A 1EXRA 1A75B 3PALA 2PALA 1M31A 2KPHA 3AKBA 1W7JB 3BUWB 3D0YA 5K89A 5I2OA 1Y1AA 1S6JA 4PE0A 1DJHA 5CPVA 2MBXA 4YI8A 1C3ZA 4ZCUA 2F3YA 2LLTA 3S0FA 1G33A 1DJYA 4GBAA 3KF9A 2BKHB 1OOHA 1YX8A 3FS7A 4DS7A 1C7WA 1EH2A 4FTGA 5AXIA 1CMFA 3TS5C 4MRXA 4MZKA 1S1EA 5HL1A 1SL8A 5D69A 1KFXS 1FF1A 1SR6B 4N1GA 1TOPA 1B47A 1OSAA 3TZ1A 1YUUA 2Y4QA 1V1GA 3SG6A 1LS8A 1NWDA 3BUOB 3PLFB 2PMYA 3DD4A 5D3OA 4F7FA 4MEWA 1A29A 2KLDA 3DF0A 4I5LB 1NX3A 3EVRA 4MRYA 1UP5A 2K61A 2JTZA 4PE1A 3S0BA 2M7LA 3VGOA 2TN4A 3O2PA 1CLLA 3GK4X 1RTP1 1CDMA 1WLZA 3HCMA 4C0JA 3IQQA 4PHKA 1QV1A 4A4BA 2ZN8A 4AOMA 1F4QA 4BY5A 2D8NA 1SCMC 3OP0A 4GGNA 4YRUA 1XFVO 2H2KA 2JZIA 2Y1MA 1J7PA 1R2UA 2JT0A 1S6IA 1DJXA 2LVVA 1RK9A 3E3RA 1HQVA 4YI9A 5DKRA 1OMVA 2M0RA 3C1VA 1DF0A 1ZUZA 2M1KB 3BUMB 2PSRA 2ZNEA 1TCOB 1OOGA 2KAYA 1YUTA 2K2AA 3FE8A 1FPWA 1L2OC 3B88A 1PSRA 1UHIA 2ZKMX 3OB2B 3FIAA 1WRLA 3NGVA 3EK7A 4JQ0D 3CZ1A 1X02A 1XFZO 2G9BA 1QX5B 2QEHA 1KK8C 2JXLA 2L2CA 3B86A 3R1OA 3SS5A 1G4YR 1NSHA 2WNDA 1TUZA 1KK7Z 1N2DA 2M3WA 4XYNA 2I18A 3CR2A 3JTDC 1SK6D 3AAKA 1UHNA 1J55A 2AAOA 2R2IA 4CIDA 2K8MB 1JWDA 1CFFA 2PASA 2BAPA 4PE4A 2JTTA 2M49B 4QJ5B 1K93D 1YURA 3EKJA 3S0DA 2CCMA 1YVLA 2OS8C 5ER5A 3NXAA 1A75A 5DKNA 2ZRTA 4PHJA 1IRJA 1CB1A 1FW4A 1EL4A 2I7AA 1RJVA 2MAZA 2PVBA 4I5KA 2OTGB 1IWQA 3DYEA 3KPXA 4MN0A 3I5FB 3AAJA 3TUYC 1OZOA 1GM0A 4ETOA 4PT1A 3OGNA 3BUNB 1UWOA 2BE6A 4DRWA 3O4YA 2LMUA 3VRRA 1IJ6A 1ORGA 1S36A 1XA5A 1XK4A 4JWQA 2M97A 1MQ1A 3VRPA 1ALWA 4XJKB 2LCPA 1A03A 3K1EA 5I8NA 2F2OA 5B8IB 3PJIA 4M2OA 2VRGA 1J7QA 4INWA 1QTXA 3L4LA 2PRUA 2JQ6A 3N7HA 4GFTA 4GNKB 3H4SE 3S0AA 1XFUO 3PM8A 4INXA 2Y1NA 2KGBC 1JSAA 2K2FA 2ZFDA 2WC8A 1Y1UA 3SG5A 3VB1A 1RFJA 2JRFA 5I2QA 1AP4A 2NXQA 3EVUA 1OMRA 1KWOC 3RLZA 3NSIA 4JKTA 3QMEA 1K95A 2QEOA 2EHBA 5KSZA 1FI5A 3LLEA 2JNXA 3NSOA 4I5JA 1LXFC 4ICBA 1S5GZ 2JOJA 2O60A 4YGDB 4ZCVA 2G2BA 3R1PA 1NPQA 2KYCA 3SG4A 2L50A 4D1EA 3AKAA 3EK8A 1UUSA 1XFRA 2JC2A 1WY9A 1PK0D 2JNFA 3TS5B 1KQMC 3NSLA 3SIAA 3CR5X 1B8LA 1BG1A 2E6WA 2FCDA 5DKQA 3LCPC 4M2QA 4DIRA 2WC5A 3EG5B 3MSEB 1YRTB 4YGBB 2CXJA 3I5HC 1IQ3A 1OE9B 2EC6C 1J7OA 1B7TY 2KI4C 3CR4X 1IIOA 2KAVA 2M1UA 1KFUL 1QX7A 3B87A 3D77A 1NCZA 1B9AA 2L0PA 4OV2A 3DVMA 1JFKA 1JUOA 1TNQA 1AJ4A 2LHLA 4YGAA 3F45A 2LHIA 1NP8A 3BOWB 4IJ7A 3VRQA 5J3XA 3QRXA 4QJ3B 4HREE 1BR1B 1NYAA 1MHOA 2YGUA 2LE9B 4HSZA 3BYAA 2KI6C 4ORBB 2F8PA 3CABA 2LMVA 2JULA 3WXAA 2M8UA 1SCMB 3LK0A 4CPVA 1GGWA 1B8RA 1SMGA 4IL1A 1M63B 1ODBA 3I5IC 4CFRA 4DCKA 2KYFA 1YUSA 1TRFA 3NHTA 1AK8A 5HKYA 2Y5IA 1WRKA 1OMDA 2WCHA 2KSPA 4PHNA 2K7OA 1GJYA 4C0KA 5I94A 4I5NB 4YGEB 1K9UA 3ZNIA 3CZ2A 3IQOA 2CNPA 1L2OB 1DEKA 1GQMA 1XO5A 1JF2A 4P2YB 1DGVA 1SW8A 4FQOA 3FWBA 1KQVA 2WOSA 2GGMA 1KK8B 4XJKA 2LVJA 3UO9A 3UNWA 2H61C 1JFJA 4NDDA 3FE6A 1QVIZ 5G08A 3D78A 1DTLA 4U8DA 5FI6A 3TDUA 2QPTA 1YR5A 3JTDB 1QLKA 2KFFA 2L5YA 5CSFA 5HKZA 1B1GA 2ERBA 1BJFA 3A8RA 1CLMA 2LM5A 2NCOA 1WDCC 1CFDA 1OOIX 5KU1A 3CZTX 2EGDA 1XFXO 1XFYO 3IF7A 2OS8B 5EL2A 2O5GA 1VRKA 1SL9A 3B6XA 4AQJA 5FI7A 3SS3A 1PVAA 2LLSA 1DELA 3CTNA 3K21A 1IG5A 1J1EA 4M2PA 3DVKA 4GUKA 1QX2A 4N1FA 4GGFC 1AHRA 1V1FA 3BJHA 3KO0A 4P5OE 4Q04A 4OVNF 1P28A 3TUYB 1A2XA 3JVTC 4C0LA 4HRHA 1QS7A 2KLEA 3SG3A 3CGAA 2P70A 1AVSA 1RWYA 1K9PA 1TCFA 1SKTA 1MUXA 3EK4A 1S3PA 1MWNA 1F71A 1YVHA 2BKIB 2F3ZA 2P6BB 1F4OA 2BE4A 1QV0A 2KFHA 2ZNDA 2A4JA 3B7AA 1LVCD 1KFUS 3IVTA 4MZJA 5FYXA 4F0ZB 1Y0VH 1JF0A 4ORAB 4JPZB 3OB1B 1TWOA 1IKUA 2KAXA 1KFXL 2K0JA 3SS4A 4CLNA 4ORCB 4USLA 2BBNA 2OPOA 3I5GC 4E68A 1MR8A 3S0GA 2L5XB 1C7VA 2I94A 2JWWA 1K96A 1DMOA 4OCIA 1YRUB 2IS9A 4PCWA 1DQEA 1CM1A 1OQPA 1PRWA 2QEVA 2WCLA 2NCPA 4PE7A 5JOLA 1NCYA 3BOWA 1WRZA 5DICA 1SSEB 2LVIA 3D76A 3DVJA 3O4XA 2WCEA 4MVFA 1KWOB 2LANA 3PN7C 3LL8B 1DC1A 3D75A 2BNXA 4PHMA 1B8CA 4JD9A 2QDIA 1H4BA 1Y6WA 3KEVA 3CLNA 3EKHA 1KK7Y 1UHKA 2GV5A 1PULA 1PVBA 1KQMB 3NSKA 2WCFA 3SG7A 5CSJA 1BU3A 1ALVA 2DOQA 5AFPA 5HYDA 4OR9B 4AQIA 3PSRA 1UHJA 5GQQC 2MRDA 1C3YA 1FBVA 3I5HB 3PFVA 1JBAA 1SL7A 2EC6B 2KI4B 1PSBA 1SNLA 1SYMA 2MA2A 1XVJA 4R1EA 3SG2A 1B4CA 2ZN9A 3R1VA 5JJGA 4MLWA 5AANA 1NX1A 1AJ5A 2JT3A 1QASA 2JT8A 1XFWO 1GGZA 2B1UA 2WCJA 1F55A 2KI6D 3NHIA 1SPYA 5BPJA 1Y1XA 1TNPA 2BL0C 2WORA 2LC5A 1QJTA 1TTXA 2L4HA 2L51A 3BXKA 5PALA 3FWCA 1OOJA 3I5IB 1BODA 1PALA 2AUCA 4MSPA 1BOCA 4GAOA 4DUQA 3VROA 2F33A 1QLSA 2JU0A 1WLMA 2FCEA 1RROA 1DJZA 1LA0A 2LUXA 3BUXB 3CDNA 4YBHB 1ZACA 4OKHA 3V2LA 2I2RE 2L2EA 1MF8B 1CDNA 3L47A 4GPLB 4MBEA 1DGUA 2SASA 2WC6A 1M39A 1U5IB 1Z4HA 2M7NA 1CFPA 1UURA 1IH0A 1QIVA 2BCXA 4BY4A 3O78A 1TIZA 3BFAA 3CS1A 2K7CA 1SBJA 4OZDA 1QWVA 2ZRSA 1CDLA 1N0YA 1DJWA 1XYDA 2GGZA 1S5GY 2KOTA 2PQLA 5ER4X 2NLNA 2KDHA 3BFHA 2RGIA 3OX6A 1XK4C 1EG4A 1K9KA 1CNPA 2BCAA 1SR6C 2MJWB 5CSIA 1BLQA 1NCXA 3A4UB 1WDCB 1QIWA 2JPTA 4WRIA 2Q4UA 1FI6A 1K8UA 2CTNA 1LA3A 2L98A 1NX2A 5AERA 1ZMZA 2LP2A 2GTEA 2SCPA 2CT9A 1RECA 1K94A 1DJIA 1EG3A 1M46A 4HRGA 5D7FA 1M45A 1DT7B 3SIBA 1J1DA 2HETA 1DVIA 2M9GA 1W9ZA 2ISDA 1SCVA 2KFGA 1KCYA 1TUJA 4PALA 1CKKA 3D0YB 1OZSA 3JVTB 3SJSA 1AUIB 2KGRA 2QEBA 3FE9A 1BT6A 5I2LA 2WCKA 3PATA 2MHHA 1SRAA 1JC2A 5CSNA 5F6TA 2KQ6A 2M29A 3OX5A 1ZOTB 2HQ8A 3KHEA 2LLUA 3Q8IA 2HPSA 1E8AA 1S6CA 4NDBA 1H8BA 1K2HA 1TNXA 3D74A 3DXLA 1A4PA 1OOFA 3I5GB 2NZ0A 3PM2A 3GK1A 4KYNA 1NX0A 1YX7A 1LKJA 2KHNA 1CLBA 1QATA 1K90D 1KSMA 1OW4A 4FQTA 1W7IB 3DF0B 1TN4A 2HF5A 1F8HA 1R6PA 1SY9A 3PN7B 4MZLA 1CMGA 2P71A 5IBWA 1DJGA 3TDIA 2FJYA 2PYQA 4NDCA 2WCBA 4NQGA
chains in the Genus database with same CATH topology
3VRNA 2L4IA 3OHMB 1J7RA 1NUBA 2BBMA 1QVIY 2F2PA 2FJUB 2KQYA 3RM1A 4CFQA 3DVEA 2MLFC 2BECA 2HQWA 2V53A 3M0WA 3GOFA 1D1OA 1BR4B 1CM4A 2QACA 1BF5A 1N65A 3ICBA 2JXCA 3HX4A 1CFCA 1S26D 1B7TZ 1EJ3A 1YTZC 2K7DA 1HT9A 2KBIA 3WHUB 1U5IA 1MXLC 1DF0B 2Q91A 5TNCA 5HLOA 5HLVA 3BQ3A 2OTGC 2FOTA 2COLB 1IJ5A 1IGVA 2LNKA 1MXEA 3I5FC 1L7ZA 2LP3A 2H61A 1KSOA 1C07A 2CBLA 1QXPA 2MLEC 4WQ2A 2BCBA 2LAPA 4N5XA 4TNCA 3ZWHA 4UPGA 2E30A 5KTYA 1G8IA 3O6BA 1ZFSA 3TDZA 2K7BA 1Q80A 1UHHA 4WQ3A 2BL0B 4L9MA 2KBMA 4PDZA 2LV7A 3CWGA 1CTRA 3LK1A 1NIWA 2LMTA 4QJ4B 3GK2A 5AEQA 1BMOA 5HKWA 3WHTB 1LINA 1IQ5A 4A4CA 1TNWA 3WNXB 1F70A 2LUCA 3EVVA 4YGCB 1CDPA 2AMIA 3D10A 2LVKA 4GGFA 2KNEA 1F54A 1EXRA 1A75B 3PALA 2PALA 1M31A 3AKBA 1W7JB 3BUWB 3D0YA 5K89A 5I2OA 1Y1AA 1S6JA 4PE0A 1DJHA 5CPVA 2MBXA 4YI8A 4ZCUA 2F3YA 2LLTA 1G33A 1DJYA 4GBAA 3KF9A 2BKHB 1YX8A 3FS7A 4DS7A 1C7WA 1EH2A 4FTGA 5AXIA 1CMFA 3TS5C 4MRXA 4MZKA 1S1EA 1SL8A 5D69A 1KFXS 1FF1A 1SR6B 4N1GA 1TOPA 1B47A 1OSAA 3TZ1A 1YUUA 2Y4QA 1V1GA 3SG6A 1NWDA 3BUOB 3PLFB 2PMYA 3DD4A 4MEWA 1A29A 3DF0A 4I5LB 1NX3A 3EVRA 4MRYA 1UP5A 2K61A 2JTZA 4PE1A 2M7LA 3VGOA 2TN4A 3O2PA 1CLLA 3GK4X 1RTP1 1CDMA 1WLZA 3HCMA 4C0JA 3IQQA 4PHKA 1QV1A 4A4BA 2ZN8A 4AOMA 1F4QA 4BY5A 2D8NA 1SCMC 3OP0A 4GGNA 4YRUA 1XFVO 2H2KA 2JZIA 2Y1MA 1J7PA 1R2UA 2JT0A 1S6IA 1DJXA 2LVVA 1RK9A 3E3RA 1HQVA 4YI9A 5DKRA 1OMVA 2M0RA 3C1VA 1DF0A 1ZUZA 2M1KB 3BUMB 2PSRA 2ZNEA 1TCOB 2KAYA 1FPWA 1YUTA 2K2AA 1L2OC 1PSRA 1UHIA 2ZKMX 3OB2B 3FIAA 1WRLA 3EK7A 4JQ0D 1X02A 1XFZO 2G9BA 1QX5B 1KK8C 2JXLA 1G4YR 1NSHA 2WNDA 1KK7Z 1N2DA 2M3WA 4XYNA 2I18A 3CR2A 3JTDC 1SK6D 3AAKA 1UHNA 1J55A 2AAOA 2R2IA 4CIDA 2K8MB 1JWDA 1CFFA 2PASA 4PE4A 2JTTA 2M49B 4QJ5B 1K93D 1YURA 3EKJA 2CCMA 1YVLA 2OS8C 5ER5A 3NXAA 1A75A 5DKNA 2ZRTA 4PHJA 1IRJA 1CB1A 1FW4A 1EL4A 2I7AA 1RJVA 2MAZA 2PVBA 4I5KA 2OTGB 1IWQA 3KPXA 4MN0A 3I5FB 3AAJA 3TUYC 1OZOA 4ETOA 3BUNB 1UWOA 2BE6A 4DRWA 3O4YA 2LMUA 3VRRA 1IJ6A 1S36A 1XA5A 1XK4A 4JWQA 2M97A 1MQ1A 3VRPA 1ALWA 4XJKB 2LCPA 1A03A 5I8NA 2F2OA 5B8IB 4M2OA 2VRGA 1QTXA 2PRUA 2JQ6A 4GFTA 4GNKB 3H4SE 1XFUO 3PM8A 2Y1NA 2KGBC 1JSAA 2K2FA 2ZFDA 2WC8A 1Y1UA 3SG5A 1RFJA 2JRFA 5I2QA 1AP4A 2NXQA 3EVUA 1OMRA 1KWOC 3RLZA 3NSIA 1K95A 5KSZA 2EHBA 1FI5A 3LLEA 2JNXA 3NSOA 4I5JA 1LXFC 4ICBA 1S5GZ 2JOJA 2O60A 4YGDB 4ZCVA 2G2BA 1NPQA 2KYCA 3SG4A 2L50A 4D1EA 3AKAA 3EK8A 1UUSA 2JC2A 1WY9A 1PK0D 2JNFA 3TS5B 1KQMC 3NSLA 3SIAA 3CR5X 1B8LA 1BG1A 2E6WA 2FCDA 5DKQA 3LCPC 4M2QA 4DIRA 3MSEB 1YRTB 4YGBB 2CXJA 3I5HC 1IQ3A 1OE9B 2EC6C 1J7OA 1B7TY 2KI4C 3CR4X 2KAVA 2M1UA 1KFUL 1QX7A 1NCZA 1B9AA 2L0PA 4OV2A 3DVMA 1JFKA 1JUOA 1TNQA 1AJ4A 2LHLA 4YGAA 3F45A 2LHIA 1NP8A 3BOWB 3VRQA 5J3XA 3QRXA 4QJ3B 4HREE 1BR1B 1NYAA 1MHOA 2LE9B 4HSZA 3BYAA 2KI6C 4ORBB 2F8PA 2LMVA 2JULA 3WXAA 2M8UA 1SCMB 3LK0A 4CPVA 1GGWA 1B8RA 1SMGA 4IL1A 1M63B 1ODBA 3I5IC 4CFRA 4DCKA 2KYFA 1YUSA 1TRFA 1AK8A 5HKYA 2Y5IA 1WRKA 1OMDA 2KSPA 4PHNA 2K7OA 1GJYA 4C0KA 4I5NB 4YGEB 1K9UA 3ZNIA 3IQOA 2CNPA 1L2OB 1GQMA 1XO5A 1JF2A 4P2YB 1DGVA 1SW8A 4FQOA 3FWBA 1KQVA 2WOSA 2GGMA 1KK8B 4XJKA 2LVJA 2H61C 1JFJA 4NDDA 1QVIZ 5G08A 1DTLA 4U8DA 3TDUA 2QPTA 1YR5A 3JTDB 1QLKA 2KFFA 5CSFA 5HKZA 1B1GA 1BJFA 3A8RA 1CLMA 2LM5A 2NCOA 1WDCC 1CFDA 5KU1A 3CZTX 2EGDA 1XFXO 1XFYO 3IF7A 2OS8B 2O5GA 1VRKA 1SL9A 4AQJA 1PVAA 2LLSA 3CTNA 3K21A 1IG5A 1J1EA 4M2PA 3DVKA 4GUKA 1QX2A 4N1FA 4GGFC 1AHRA 1V1FA 4P5OE 3KO0A 4Q04A 4OVNF 3TUYB 1A2XA 3JVTC 4C0LA 4HRHA 1QS7A 3SG3A 3CGAA 1AVSA 1RWYA 1K9PA 1TCFA 1SKTA 1MUXA 3EK4A 1S3PA 1MWNA 1F71A 1YVHA 2BKIB 2F3ZA 2P6BB 2BE4A 1F4OA 1QV0A 2KFHA 2ZNDA 2A4JA 4F0ZB 1LVCD 1KFUS 4MZJA 5FYXA 1J7QA 1Y0VH 1JF0A 4ORAB 4JPZB 3OB1B 1IKUA 2KAXA 1KFXL 2K0JA 4CLNA 4ORCB 4USLA 2BBNA 2OPOA 3I5GC 4E68A 1MR8A 2L5XB 1C7VA 2I94A 2JWWA 1K96A 1DMOA 4OCIA 1YRUB 2IS9A 4PCWA 1CM1A 1OQPA 1PRWA 4PE7A 5JOLA 2NCPA 1NCYA 3BOWA 1WRZA 2LVIA 3DVJA 4MVFA 2WCEA 1KWOB 2LANA 3PN7C 3LL8B 4PHMA 1B8CA 1H4BA 1Y6WA 3KEVA 3CLNA 3EKHA 1KK7Y 1UHKA 2GV5A 1PULA 1PVBA 1KQMB 3NSKA 2WCFA 3SG7A 5CSJA 1BU3A 1ALVA 2DOQA 5AFPA 5HYDA 4OR9B 4AQIA 3PSRA 1UHJA 5GQQC 2MRDA 1FBVA 3I5HB 3PFVA 1JBAA 1SL7A 2EC6B 2KI4B 1PSBA 1SNLA 1SYMA 2MA2A 1XVJA 4R1EA 3SG2A 1B4CA 2ZN9A 5JJGA 4MLWA 5AANA 1NX1A 1AJ5A 2JT3A 1QASA 2JT8A 1XFWO 1GGZA 2B1UA 1F55A 2KI6D 1SPYA 5BPJA 1Y1XA 1TNPA 2BL0C 2WORA 2LC5A 1QJTA 1TTXA 2L4HA 2L51A 3BXKA 5PALA 3FWCA 1OOJA 3I5IB 1BODA 1PALA 2AUCA 4MSPA 1BOCA 4GAOA 4DUQA 3VROA 2F33A 1QLSA 2JU0A 1WLMA 2FCEA 1RROA 1DJZA 1LA0A 2LUXA 3BUXB 4YBHB 1ZACA 4OKHA 2I2RE 2L2EA 1MF8B 1CDNA 4GPLB 4MBEA 1DGUA 2SASA 1M39A 1U5IB 2M7NA 1CFPA 1UURA 1IH0A 1QIVA 2BCXA 4BY4A 3O78A 1TIZA 3CS1A 2K7CA 1SBJA 2ZRSA 1CDLA 1N0YA 1DJWA 1XYDA 2GGZA 1S5GY 2KOTA 5ER4X 2NLNA 2KDHA 2RGIA 3OX6A 1XK4C 1EG4A 1K9KA 1CNPA 2BCAA 1SR6C 2MJWB 5CSIA 1BLQA 1NCXA 3A4UB 1WDCB 1QIWA 2JPTA 4WRIA 2Q4UA 1FI6A 1K8UA 2CTNA 1LA3A 2L98A 1NX2A 5AERA 1ZMZA 2LP2A 2SCPA 2CT9A 1RECA 1K94A 1DJIA 1EG3A 1M46A 4HRGA 5D7FA 1M45A 1DT7B 3SIBA 1J1DA 2HETA 1DVIA 2M9GA 2ISDA 1SCVA 2KFGA 1KCYA 4PALA 1CKKA 3D0YB 1OZSA 3JVTB 3SJSA 1AUIB 2KGRA 1BT6A 5I2LA 3PATA 2MHHA 1SRAA 1JC2A 5CSNA 5F6TA 2KQ6A 2M29A 3OX5A 1ZOTB 2HQ8A 3KHEA 2LLUA 2HPSA 1E8AA 1S6CA 4NDBA 1H8BA 1K2HA 1TNXA 1A4PA 3I5GB 2NZ0A 3GK1A 1NX0A 1YX7A 1LKJA 2KHNA 1CLBA 1QATA 1K90D 1KSMA 1W7IB 3DF0B 1TN4A 2HF5A 1F8HA 1R6PA 1SY9A 3PN7B 4MZLA 1CMGA 5IBWA 1DJGA 3TDIA 4NDCA 2WCBA 4NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRN A;  2L4I A;  3OHM B;  1J7R A;  1NUB A;  2BBM A;  1QVI Y;  2F2P A;  2FJU B;  2KQY A;  3RM1 A;  4CFQ A;  3DVE A;  2MLF C;  2BEC A;  2HQW A;  2V53 A;  3M0W A;  3GOF A;  1D1O A;  1BR4 B;  1CM4 A;  2QAC A;  1BF5 A;  1N65 A;  3ICB A;  2JXC A;  3HX4 A;  1CFC A;  1S26 D;  1B7T Z;  1EJ3 A;  1YTZ C;  2K7D A;  1HT9 A;  2KBI A;  3WHU B;  1U5I A;  1MXL C;  1DF0 B;  2Q91 A;  5TNC A;  5HLO A;  5HLV A;  3BQ3 A;  2OTG C;  2FOT A;  2COL B;  1IJ5 A;  1IGV A;  2LNK A;  1MXE A;  3I5F C;  1L7Z A;  2LP3 A;  2H61 A;  1KSO A;  1C07 A;  2CBL A;  1QXP A;  2MLE C;  4WQ2 A;  2BCB A;  2LAP A;  4N5X A;  4TNC A;  3ZWH A;  4UPG A;  2E30 A;  5KTY A;  1G8I A;  3O6B A;  1ZFS A;  3TDZ A;  2K7B A;  1Q80 A;  1UHH A;  4WQ3 A;  2BL0 B;  4L9M A;  2KBM A;  4PDZ A;  2LV7 A;  3CWG A;  1CTR A;  3LK1 A;  1NIW A;  2LMT A;  4QJ4 B;  3GK2 A;  5AEQ A;  1BMO A;  5HKW A;  3WHT B;  1LIN A;  1IQ5 A;  4A4C A;  1TNW A;  3WNX B;  1F70 A;  2LUC A;  3EVV A;  4YGC B;  1CDP A;  2AMI A;  3D10 A;  2LVK A;  4GGF A;  2KNE A;  1F54 A;  1EXR A;  1A75 B;  3PAL A;  2PAL A;  1M31 A;  3AKB A;  1W7J B;  3BUW B;  3D0Y A;  5K89 A;  5I2O A;  1Y1A A;  1S6J A;  4PE0 A;  1DJH A;  5CPV A;  2MBX A;  4YI8 A;  4ZCU A;  2F3Y A;  2LLT A;  1G33 A;  1DJY A;  4GBA A;  3KF9 A;  2BKH B;  1YX8 A;  3FS7 A;  4DS7 A;  1C7W A;  1EH2 A;  4FTG A;  5AXI A;  1CMF A;  3TS5 C;  4MRX A;  4MZK A;  1S1E A;  1SL8 A;  5D69 A;  1KFX S;  1FF1 A;  1SR6 B;  4N1G A;  1TOP A;  1B47 A;  1OSA A;  3TZ1 A;  1YUU A;  2Y4Q A;  1V1G A;  3SG6 A;  1NWD A;  3BUO B;  3PLF B;  2PMY A;  3DD4 A;  4MEW A;  1A29 A;  3DF0 A;  4I5L B;  1NX3 A;  3EVR A;  4MRY A;  1UP5 A;  2K61 A;  2JTZ A;  4PE1 A;  2M7L A;  3VGO A;  2TN4 A;  3O2P A;  1CLL A;  3GK4 X;  1RTP 1;  1CDM A;  1WLZ A;  3HCM A;  4C0J A;  3IQQ A;  4PHK A;  1QV1 A;  4A4B A;  2ZN8 A;  4AOM A;  1F4Q A;  4BY5 A;  2D8N A;  1SCM C;  3OP0 A;  4GGN A;  4YRU A;  1XFV O;  2H2K A;  2JZI A;  2Y1M A;  1J7P A;  1R2U A;  2JT0 A;  1S6I A;  1DJX A;  2LVV A;  1RK9 A;  3E3R A;  1HQV A;  4YI9 A;  5DKR A;  1OMV A;  2M0R A;  3C1V A;  1DF0 A;  1ZUZ A;  2M1K B;  3BUM B;  2PSR A;  2ZNE A;  1TCO B;  2KAY A;  1FPW A;  1YUT A;  2K2A A;  1L2O C;  1PSR A;  1UHI A;  2ZKM X;  3OB2 B;  3FIA A;  1WRL A;  3EK7 A;  4JQ0 D;  1X02 A;  1XFZ O;  2G9B A;  1QX5 B;  1KK8 C;  2JXL A;  1G4Y R;  1NSH A;  2WND A;  1KK7 Z;  1N2D A;  2M3W A;  4XYN A;  2I18 A;  3CR2 A;  3JTD C;  1SK6 D;  3AAK A;  1UHN A;  1J55 A;  2AAO A;  2R2I A;  4CID A;  2K8M B;  1JWD A;  1CFF A;  2PAS A;  4PE4 A;  2JTT A;  2M49 B;  4QJ5 B;  1K93 D;  1YUR A;  3EKJ A;  2CCM A;  1YVL A;  2OS8 C;  5ER5 A;  3NXA A;  1A75 A;  5DKN A;  2ZRT A;  4PHJ A;  1IRJ A;  1CB1 A;  1FW4 A;  1EL4 A;  2I7A A;  1RJV A;  2MAZ A;  2PVB A;  4I5K A;  2OTG B;  1IWQ A;  3KPX A;  4MN0 A;  3I5F B;  3AAJ A;  3TUY C;  1OZO A;  4ETO A;  3BUN B;  1UWO A;  2BE6 A;  4DRW A;  3O4Y A;  2LMU A;  3VRR A;  1IJ6 A;  1S36 A;  1XA5 A;  1XK4 A;  4JWQ A;  2M97 A;  1MQ1 A;  3VRP A;  1ALW A;  4XJK B;  2LCP A;  1A03 A;  5I8N A;  2F2O A;  5B8I B;  4M2O A;  2VRG A;  1QTX A;  2PRU A;  2JQ6 A;  4GFT A;  4GNK B;  3H4S E;  1XFU O;  3PM8 A;  2Y1N A;  2KGB C;  1JSA A;  2K2F A;  2ZFD A;  2WC8 A;  1Y1U A;  3SG5 A;  1RFJ A;  2JRF A;  5I2Q A;  1AP4 A;  2NXQ A;  3EVU A;  1OMR A;  1KWO C;  3RLZ A;  3NSI A;  1K95 A;  5KSZ A;  2EHB A;  1FI5 A;  3LLE A;  2JNX A;  3NSO A;  4I5J A;  1LXF C;  4ICB A;  1S5G Z;  2JOJ A;  2O60 A;  4YGD B;  4ZCV A;  2G2B A;  1NPQ A;  2KYC A;  3SG4 A;  2L50 A;  4D1E A;  3AKA A;  3EK8 A;  1UUS A;  2JC2 A;  1WY9 A;  1PK0 D;  2JNF A;  3TS5 B;  1KQM C;  3NSL A;  3SIA A;  3CR5 X;  1B8L A;  1BG1 A;  2E6W A;  2FCD A;  5DKQ A;  3LCP C;  4M2Q A;  4DIR A;  3MSE B;  1YRT B;  4YGB B;  2CXJ A;  3I5H C;  1IQ3 A;  1OE9 B;  2EC6 C;  1J7O A;  1B7T Y;  2KI4 C;  3CR4 X;  2KAV A;  2M1U A;  1KFU L;  1QX7 A;  1NCZ A;  1B9A A;  2L0P A;  4OV2 A;  3DVM A;  1JFK A;  1JUO A;  1TNQ A;  1AJ4 A;  2LHL A;  4YGA A;  3F45 A;  2LHI A;  1NP8 A;  3BOW B;  3VRQ A;  5J3X A;  3QRX A;  4QJ3 B;  4HRE E;  1BR1 B;  1NYA A;  1MHO A;  2LE9 B;  4HSZ A;  3BYA A;  2KI6 C;  4ORB B;  2F8P A;  2LMV A;  2JUL A;  3WXA A;  2M8U A;  1SCM B;  3LK0 A;  4CPV A;  1GGW A;  1B8R A;  1SMG A;  4IL1 A;  1M63 B;  1ODB A;  3I5I C;  4CFR A;  4DCK A;  2KYF A;  1YUS A;  1TRF A;  1AK8 A;  5HKY A;  2Y5I A;  1WRK A;  1OMD A;  2KSP A;  4PHN A;  2K7O A;  1GJY A;  4C0K A;  4I5N B;  4YGE B;  1K9U A;  3ZNI A;  3IQO A;  2CNP A;  1L2O B;  1GQM A;  1XO5 A;  1JF2 A;  4P2Y B;  1DGV A;  1SW8 A;  4FQO A;  3FWB A;  1KQV A;  2WOS A;  2GGM A;  1KK8 B;  4XJK A;  2LVJ A;  2H61 C;  1JFJ A;  4NDD A;  1QVI Z;  5G08 A;  1DTL A;  4U8D A;  3TDU A;  2QPT A;  1YR5 A;  3JTD B;  1QLK A;  2KFF A;  5CSF A;  5HKZ A;  1B1G A;  1BJF A;  3A8R A;  1CLM A;  2LM5 A;  2NCO A;  1WDC C;  1CFD A;  5KU1 A;  3CZT X;  2EGD A;  1XFX O;  1XFY O;  3IF7 A;  2OS8 B;  2O5G A;  1VRK A;  1SL9 A;  4AQJ A;  1PVA A;  2LLS A;  3CTN A;  3K21 A;  1IG5 A;  1J1E A;  4M2P A;  3DVK A;  4GUK A;  1QX2 A;  4N1F A;  4GGF C;  1AHR A;  1V1F A;  4P5O E;  3KO0 A;  4Q04 A;  4OVN F;  3TUY B;  1A2X A;  3JVT C;  4C0L A;  4HRH A;  1QS7 A;  3SG3 A;  3CGA A;  1AVS A;  1RWY A;  1K9P A;  1TCF A;  1SKT A;  1MUX A;  3EK4 A;  1S3P A;  1MWN A;  1F71 A;  1YVH A;  2BKI B;  2F3Z A;  2P6B B;  2BE4 A;  1F4O A;  1QV0 A;  2KFH A;  2ZND A;  2A4J A;  4F0Z B;  1LVC D;  1KFU S;  4MZJ A;  5FYX A;  1J7Q A;  1Y0V H;  1JF0 A;  4ORA B;  4JPZ B;  3OB1 B;  1IKU A;  2KAX A;  1KFX L;  2K0J A;  4CLN A;  4ORC B;  4USL A;  2BBN A;  2OPO A;  3I5G C;  4E68 A;  1MR8 A;  2L5X B;  1C7V A;  2I94 A;  2JWW A;  1K96 A;  1DMO A;  4OCI A;  1YRU B;  2IS9 A;  4PCW A;  1CM1 A;  1OQP A;  1PRW A;  4PE7 A;  5JOL A;  2NCP A;  1NCY A;  3BOW A;  1WRZ A;  2LVI A;  3DVJ A;  4MVF A;  2WCE A;  1KWO B;  2LAN A;  3PN7 C;  3LL8 B;  4PHM A;  1B8C A;  1H4B A;  1Y6W A;  3KEV A;  3CLN A;  3EKH A;  1KK7 Y;  1UHK A;  2GV5 A;  1PUL A;  1PVB A;  1KQM B;  3NSK A;  2WCF A;  3SG7 A;  5CSJ A;  1BU3 A;  1ALV A;  2DOQ A;  5AFP A;  5HYD A;  4OR9 B;  4AQI A;  3PSR A;  1UHJ A;  5GQQ C;  2MRD A;  1FBV A;  3I5H B;  3PFV A;  1JBA A;  1SL7 A;  2EC6 B;  2KI4 B;  1PSB A;  1SNL A;  1SYM A;  2MA2 A;  1XVJ A;  4R1E A;  3SG2 A;  1B4C A;  2ZN9 A;  5JJG A;  4MLW A;  5AAN A;  1NX1 A;  1AJ5 A;  2JT3 A;  1QAS A;  2JT8 A;  1XFW O;  1GGZ A;  2B1U A;  1F55 A;  2KI6 D;  1SPY A;  5BPJ A;  1Y1X A;  1TNP A;  2BL0 C;  2WOR A;  2LC5 A;  1QJT A;  1TTX A;  2L4H A;  2L51 A;  3BXK A;  5PAL A;  3FWC A;  1OOJ A;  3I5I B;  1BOD A;  1PAL A;  2AUC A;  4MSP A;  1BOC A;  4GAO A;  4DUQ A;  3VRO A;  2F33 A;  1QLS A;  2JU0 A;  1WLM A;  2FCE A;  1RRO A;  1DJZ A;  1LA0 A;  2LUX A;  3BUX B;  4YBH B;  1ZAC A;  4OKH A;  2I2R E;  2L2E A;  1MF8 B;  1CDN A;  4GPL B;  4MBE A;  1DGU A;  2SAS A;  1M39 A;  1U5I B;  2M7N A;  1CFP A;  1UUR A;  1IH0 A;  1QIV A;  2BCX A;  4BY4 A;  3O78 A;  1TIZ A;  3CS1 A;  2K7C A;  1SBJ A;  2ZRS A;  1CDL A;  1N0Y A;  1DJW A;  1XYD A;  2GGZ A;  1S5G Y;  2KOT A;  5ER4 X;  2NLN A;  2KDH A;  2RGI A;  3OX6 A;  1XK4 C;  1EG4 A;  1K9K A;  1CNP A;  2BCA A;  1SR6 C;  2MJW B;  5CSI A;  1BLQ A;  1NCX A;  3A4U B;  1WDC B;  1QIW A;  2JPT A;  4WRI A;  2Q4U A;  1FI6 A;  1K8U A;  2CTN A;  1LA3 A;  2L98 A;  1NX2 A;  5AER A;  1ZMZ A;  2LP2 A;  2SCP A;  2CT9 A;  1REC A;  1K94 A;  1DJI A;  1EG3 A;  1M46 A;  4HRG A;  5D7F A;  1M45 A;  1DT7 B;  3SIB A;  1J1D A;  2HET A;  1DVI A;  2M9G A;  2ISD A;  1SCV A;  2KFG A;  1KCY A;  4PAL A;  1CKK A;  3D0Y B;  1OZS A;  3JVT B;  3SJS A;  1AUI B;  2KGR A;  1BT6 A;  5I2L A;  3PAT A;  2MHH A;  1SRA A;  1JC2 A;  5CSN A;  5F6T A;  2KQ6 A;  2M29 A;  3OX5 A;  1ZOT B;  2HQ8 A;  3KHE A;  2LLU A;  2HPS A;  1E8A A;  1S6C A;  4NDB A;  1H8B A;  1K2H A;  1TNX A;  1A4P A;  3I5G B;  2NZ0 A;  3GK1 A;  1NX0 A;  1YX7 A;  1LKJ A;  2KHN A;  1CLB A;  1QAT A;  1K90 D;  1KSM A;  1W7I B;  3DF0 B;  1TN4 A;  2HF5 A;  1F8H A;  1R6P A;  1SY9 A;  3PN7 B;  4MZL A;  1CMG A;  5IBW A;  1DJG A;  3TDI A;  4NDC A;  2WCB A;  4NQG A; 
#chains in the Genus database with same CATH topology
 3VRN A;  2L4I A;  3OHM B;  1J7R A;  1NUB A;  2BBM A;  1QVI Y;  2F2P A;  2FJU B;  2KQY A;  3L4A A;  3RM1 A;  4CFQ A;  3DVE A;  2MLF C;  2BEC A;  2HQW A;  2V53 A;  3DZT A;  3M0W A;  3GOF A;  1D1O A;  1BR4 B;  1CM4 A;  2QAC A;  1BF5 A;  1N65 A;  3ICB A;  3D73 A;  2JXC A;  3HX4 A;  1CFC A;  1S26 D;  1B7T Z;  1EJ3 A;  1YTZ C;  2K7D A;  1HT9 A;  2KBI A;  3WHU B;  1U5I A;  1MXL C;  2JPO A;  3CZ0 A;  1DF0 B;  2Q91 A;  5TNC A;  5HLO A;  1T14 A;  3BQ3 A;  2OTG C;  2FOT A;  5HLV A;  3RZS A;  2COL B;  1IJ5 A;  1IGV A;  2LNK A;  1MXE A;  3I5F C;  1L7Z A;  3DY9 A;  2LP3 A;  2H61 A;  1KSO A;  2H8V A;  1C07 A;  2CBL A;  1QXP A;  2MLE C;  4WQ2 A;  2BCB A;  2K60 A;  2LAP A;  3OBV A;  4N5X A;  4TNC A;  3ZWH A;  4UPG A;  2E30 A;  5KTY A;  1G8I A;  3O6B A;  1ZFS A;  3TDZ A;  2K7B A;  1Q80 A;  1UHH A;  4WQ3 A;  2BL0 B;  4L9M A;  2KBM A;  4PDZ A;  2LV7 A;  3CWG A;  1CTR A;  3R72 A;  3LK1 A;  3CYZ A;  5FI2 A;  1NIW A;  2LMT A;  4QJ4 B;  2WCM A;  3BFB A;  3GK2 A;  1BMO A;  5AEQ A;  5HKW A;  3WHT B;  1LIN A;  1IQ5 A;  1Z2C B;  4A4C A;  1TNW A;  3S0E A;  3WNX B;  1F70 A;  2LUC A;  3EVV A;  4YGC B;  1CDP A;  2AMI A;  3D10 A;  2LVK A;  4GGF A;  2KNE A;  1F54 A;  1EXR A;  1A75 B;  3PAL A;  2PAL A;  1M31 A;  2KPH A;  3AKB A;  1W7J B;  3BUW B;  3D0Y A;  5K89 A;  5I2O A;  1Y1A A;  1S6J A;  4PE0 A;  1DJH A;  5CPV A;  2MBX A;  4YI8 A;  1C3Z A;  4ZCU A;  2F3Y A;  2LLT A;  3S0F A;  1G33 A;  1DJY A;  4GBA A;  3KF9 A;  2BKH B;  1OOH A;  1YX8 A;  3FS7 A;  4DS7 A;  1C7W A;  1EH2 A;  4FTG A;  5AXI A;  1CMF A;  3TS5 C;  4MRX A;  4MZK A;  1S1E A;  5HL1 A;  1SL8 A;  5D69 A;  1KFX S;  1FF1 A;  1SR6 B;  4N1G A;  1TOP A;  1B47 A;  1OSA A;  3TZ1 A;  1YUU A;  2Y4Q A;  1V1G A;  3SG6 A;  1LS8 A;  1NWD A;  3BUO B;  3PLF B;  2PMY A;  3DD4 A;  5D3O A;  4F7F A;  4MEW A;  1A29 A;  2KLD A;  3DF0 A;  4I5L B;  1NX3 A;  3EVR A;  4MRY A;  1UP5 A;  2K61 A;  2JTZ A;  4PE1 A;  3S0B A;  2M7L A;  3VGO A;  2TN4 A;  3O2P A;  1CLL A;  3GK4 X;  1RTP 1;  1CDM A;  1WLZ A;  3HCM A;  4C0J A;  3IQQ A;  4PHK A;  1QV1 A;  4A4B A;  2ZN8 A;  4AOM A;  1F4Q A;  4BY5 A;  2D8N A;  1SCM C;  3OP0 A;  4GGN A;  4YRU A;  1XFV O;  2H2K A;  2JZI A;  2Y1M A;  1J7P A;  1R2U A;  2JT0 A;  1S6I A;  1DJX A;  2LVV A;  1RK9 A;  3E3R A;  1HQV A;  4YI9 A;  5DKR A;  1OMV A;  2M0R A;  3C1V A;  1DF0 A;  1ZUZ A;  2M1K B;  3BUM B;  2PSR A;  2ZNE A;  1TCO B;  1OOG A;  2KAY A;  1YUT A;  2K2A A;  3FE8 A;  1FPW A;  1L2O C;  3B88 A;  1PSR A;  1UHI A;  2ZKM X;  3OB2 B;  3FIA A;  1WRL A;  3NGV A;  3EK7 A;  4JQ0 D;  3CZ1 A;  1X02 A;  1XFZ O;  2G9B A;  1QX5 B;  2QEH A;  1KK8 C;  2JXL A;  2L2C A;  3B86 A;  3R1O A;  3SS5 A;  1G4Y R;  1NSH A;  2WND A;  1TUZ A;  1KK7 Z;  1N2D A;  2M3W A;  4XYN A;  2I18 A;  3CR2 A;  3JTD C;  1SK6 D;  3AAK A;  1UHN A;  1J55 A;  2AAO A;  2R2I A;  4CID A;  2K8M B;  1JWD A;  1CFF A;  2PAS A;  2BAP A;  4PE4 A;  2JTT A;  2M49 B;  4QJ5 B;  1K93 D;  1YUR A;  3EKJ A;  3S0D A;  2CCM A;  1YVL A;  2OS8 C;  5ER5 A;  3NXA A;  1A75 A;  5DKN A;  2ZRT A;  4PHJ A;  1IRJ A;  1CB1 A;  1FW4 A;  1EL4 A;  2I7A A;  1RJV A;  2MAZ A;  2PVB A;  4I5K A;  2OTG B;  1IWQ A;  3DYE A;  3KPX A;  4MN0 A;  3I5F B;  3AAJ A;  3TUY C;  1OZO A;  1GM0 A;  4ETO A;  4PT1 A;  3OGN A;  3BUN B;  1UWO A;  2BE6 A;  4DRW A;  3O4Y A;  2LMU A;  3VRR A;  1IJ6 A;  1ORG A;  1S36 A;  1XA5 A;  1XK4 A;  4JWQ A;  2M97 A;  1MQ1 A;  3VRP A;  1ALW A;  4XJK B;  2LCP A;  1A03 A;  3K1E A;  5I8N A;  2F2O A;  5B8I B;  3PJI A;  4M2O A;  2VRG A;  1J7Q A;  4INW A;  1QTX A;  3L4L A;  2PRU A;  2JQ6 A;  3N7H A;  4GFT A;  4GNK B;  3H4S E;  3S0A A;  1XFU O;  3PM8 A;  4INX A;  2Y1N A;  2KGB C;  1JSA A;  2K2F A;  2ZFD A;  2WC8 A;  1Y1U A;  3SG5 A;  3VB1 A;  1RFJ A;  2JRF A;  5I2Q A;  1AP4 A;  2NXQ A;  3EVU A;  1OMR A;  1KWO C;  3RLZ A;  3NSI A;  4JKT A;  3QME A;  1K95 A;  2QEO A;  2EHB A;  5KSZ A;  1FI5 A;  3LLE A;  2JNX A;  3NSO A;  4I5J A;  1LXF C;  4ICB A;  1S5G Z;  2JOJ A;  2O60 A;  4YGD B;  4ZCV A;  2G2B A;  3R1P A;  1NPQ A;  2KYC A;  3SG4 A;  2L50 A;  4D1E A;  3AKA A;  3EK8 A;  1UUS A;  1XFR A;  2JC2 A;  1WY9 A;  1PK0 D;  2JNF A;  3TS5 B;  1KQM C;  3NSL A;  3SIA A;  3CR5 X;  1B8L A;  1BG1 A;  2E6W A;  2FCD A;  5DKQ A;  3LCP C;  4M2Q A;  4DIR A;  2WC5 A;  3EG5 B;  3MSE B;  1YRT B;  4YGB B;  2CXJ A;  3I5H C;  1IQ3 A;  1OE9 B;  2EC6 C;  1J7O A;  1B7T Y;  2KI4 C;  3CR4 X;  1IIO A;  2KAV A;  2M1U A;  1KFU L;  1QX7 A;  3B87 A;  3D77 A;  1NCZ A;  1B9A A;  2L0P A;  4OV2 A;  3DVM A;  1JFK A;  1JUO A;  1TNQ A;  1AJ4 A;  2LHL A;  4YGA A;  3F45 A;  2LHI A;  1NP8 A;  3BOW B;  4IJ7 A;  3VRQ A;  5J3X A;  3QRX A;  4QJ3 B;  4HRE E;  1BR1 B;  1NYA A;  1MHO A;  2YGU A;  2LE9 B;  4HSZ A;  3BYA A;  2KI6 C;  4ORB B;  2F8P A;  3CAB A;  2LMV A;  2JUL A;  3WXA A;  2M8U A;  1SCM B;  3LK0 A;  4CPV A;  1GGW A;  1B8R A;  1SMG A;  4IL1 A;  1M63 B;  1ODB A;  3I5I C;  4CFR A;  4DCK A;  2KYF A;  1YUS A;  1TRF A;  3NHT A;  1AK8 A;  5HKY A;  2Y5I A;  1WRK A;  1OMD A;  2WCH A;  2KSP A;  4PHN A;  2K7O A;  1GJY A;  4C0K A;  5I94 A;  4I5N B;  4YGE B;  1K9U A;  3ZNI A;  3CZ2 A;  3IQO A;  2CNP A;  1L2O B;  1DEK A;  1GQM A;  1XO5 A;  1JF2 A;  4P2Y B;  1DGV A;  1SW8 A;  4FQO A;  3FWB A;  1KQV A;  2WOS A;  2GGM A;  1KK8 B;  4XJK A;  2LVJ A;  3UO9 A;  3UNW A;  2H61 C;  1JFJ A;  4NDD A;  3FE6 A;  1QVI Z;  5G08 A;  3D78 A;  1DTL A;  4U8D A;  5FI6 A;  3TDU A;  2QPT A;  1YR5 A;  3JTD B;  1QLK A;  2KFF A;  2L5Y A;  5CSF A;  5HKZ A;  1B1G A;  2ERB A;  1BJF A;  3A8R A;  1CLM A;  2LM5 A;  2NCO A;  1WDC C;  1CFD A;  1OOI X;  5KU1 A;  3CZT X;  2EGD A;  1XFX O;  1XFY O;  3IF7 A;  2OS8 B;  5EL2 A;  2O5G A;  1VRK A;  1SL9 A;  3B6X A;  4AQJ A;  5FI7 A;  3SS3 A;  1PVA A;  2LLS A;  1DEL A;  3CTN A;  3K21 A;  1IG5 A;  1J1E A;  4M2P A;  3DVK A;  4GUK A;  1QX2 A;  4N1F A;  4GGF C;  1AHR A;  1V1F A;  3BJH A;  3KO0 A;  4P5O E;  4Q04 A;  4OVN F;  1P28 A;  3TUY B;  1A2X A;  3JVT C;  4C0L A;  4HRH A;  1QS7 A;  2KLE A;  3SG3 A;  3CGA A;  2P70 A;  1AVS A;  1RWY A;  1K9P A;  1TCF A;  1SKT A;  1MUX A;  3EK4 A;  1S3P A;  1MWN A;  1F71 A;  1YVH A;  2BKI B;  2F3Z A;  2P6B B;  1F4O A;  2BE4 A;  1QV0 A;  2KFH A;  2ZND A;  2A4J A;  3B7A A;  1LVC D;  1KFU S;  3IVT A;  4MZJ A;  5FYX A;  4F0Z B;  1Y0V H;  1JF0 A;  4ORA B;  4JPZ B;  3OB1 B;  1TWO A;  1IKU A;  2KAX A;  1KFX L;  2K0J A;  3SS4 A;  4CLN A;  4ORC B;  4USL A;  2BBN A;  2OPO A;  3I5G C;  4E68 A;  1MR8 A;  3S0G A;  2L5X B;  1C7V A;  2I94 A;  2JWW A;  1K96 A;  1DMO A;  4OCI A;  1YRU B;  2IS9 A;  4PCW A;  1DQE A;  1CM1 A;  1OQP A;  1PRW A;  2QEV A;  2WCL A;  2NCP A;  4PE7 A;  5JOL A;  1NCY A;  3BOW A;  1WRZ A;  5DIC A;  1SSE B;  2LVI A;  3D76 A;  3DVJ A;  3O4X A;  2WCE A;  4MVF A;  1KWO B;  2LAN A;  3PN7 C;  3LL8 B;  1DC1 A;  3D75 A;  2BNX A;  4PHM A;  1B8C A;  4JD9 A;  2QDI A;  1H4B A;  1Y6W A;  3KEV A;  3CLN A;  3EKH A;  1KK7 Y;  1UHK A;  2GV5 A;  1PUL A;  1PVB A;  1KQM B;  3NSK A;  2WCF A;  3SG7 A;  5CSJ A;  1BU3 A;  1ALV A;  2DOQ A;  5AFP A;  5HYD A;  4OR9 B;  4AQI A;  3PSR A;  1UHJ A;  5GQQ C;  2MRD A;  1C3Y A;  1FBV A;  3I5H B;  3PFV A;  1JBA A;  1SL7 A;  2EC6 B;  2KI4 B;  1PSB A;  1SNL A;  1SYM A;  2MA2 A;  1XVJ A;  4R1E A;  3SG2 A;  1B4C A;  2ZN9 A;  3R1V A;  5JJG A;  4MLW A;  5AAN A;  1NX1 A;  1AJ5 A;  2JT3 A;  1QAS A;  2JT8 A;  1XFW O;  1GGZ A;  2B1U A;  2WCJ A;  1F55 A;  2KI6 D;  3NHI A;  1SPY A;  5BPJ A;  1Y1X A;  1TNP A;  2BL0 C;  2WOR A;  2LC5 A;  1QJT A;  1TTX A;  2L4H A;  2L51 A;  3BXK A;  5PAL A;  3FWC A;  1OOJ A;  3I5I B;  1BOD A;  1PAL A;  2AUC A;  4MSP A;  1BOC A;  4GAO A;  4DUQ A;  3VRO A;  2F33 A;  1QLS A;  2JU0 A;  1WLM A;  2FCE A;  1RRO A;  1DJZ A;  1LA0 A;  2LUX A;  3BUX B;  3CDN A;  4YBH B;  1ZAC A;  4OKH A;  3V2L A;  2I2R E;  2L2E A;  1MF8 B;  1CDN A;  3L47 A;  4GPL B;  4MBE A;  1DGU A;  2SAS A;  2WC6 A;  1M39 A;  1U5I B;  1Z4H A;  2M7N A;  1CFP A;  1UUR A;  1IH0 A;  1QIV A;  2BCX A;  4BY4 A;  3O78 A;  1TIZ A;  3BFA A;  3CS1 A;  2K7C A;  1SBJ A;  4OZD A;  1QWV A;  2ZRS A;  1CDL A;  1N0Y A;  1DJW A;  1XYD A;  2GGZ A;  1S5G Y;  2KOT A;  2PQL A;  5ER4 X;  2NLN A;  2KDH A;  3BFH A;  2RGI A;  3OX6 A;  1XK4 C;  1EG4 A;  1K9K A;  1CNP A;  2BCA A;  1SR6 C;  2MJW B;  5CSI A;  1BLQ A;  1NCX A;  3A4U B;  1WDC B;  1QIW A;  2JPT A;  4WRI A;  2Q4U A;  1FI6 A;  1K8U A;  2CTN A;  1LA3 A;  2L98 A;  1NX2 A;  5AER A;  1ZMZ A;  2LP2 A;  2GTE A;  2SCP A;  2CT9 A;  1REC A;  1K94 A;  1DJI A;  1EG3 A;  1M46 A;  4HRG A;  5D7F A;  1M45 A;  1DT7 B;  3SIB A;  1J1D A;  2HET A;  1DVI A;  2M9G A;  1W9Z A;  2ISD A;  1SCV A;  2KFG A;  1KCY A;  1TUJ A;  4PAL A;  1CKK A;  3D0Y B;  1OZS A;  3JVT B;  3SJS A;  1AUI B;  2KGR A;  2QEB A;  3FE9 A;  1BT6 A;  5I2L A;  2WCK A;  3PAT A;  2MHH A;  1SRA A;  1JC2 A;  5CSN A;  5F6T A;  2KQ6 A;  2M29 A;  3OX5 A;  1ZOT B;  2HQ8 A;  3KHE A;  2LLU A;  3Q8I A;  2HPS A;  1E8A A;  1S6C A;  4NDB A;  1H8B A;  1K2H A;  1TNX A;  3D74 A;  3DXL A;  1A4P A;  1OOF A;  3I5G B;  2NZ0 A;  3PM2 A;  3GK1 A;  4KYN A;  1NX0 A;  1YX7 A;  1LKJ A;  2KHN A;  1CLB A;  1QAT A;  1K90 D;  1KSM A;  1OW4 A;  4FQT A;  1W7I B;  3DF0 B;  1TN4 A;  2HF5 A;  1F8H A;  1R6P A;  1SY9 A;  3PN7 B;  4MZL A;  1CMG A;  2P71 A;  5IBW A;  1DJG A;  3TDI A;  2FJY A;  2PYQ A;  4NDC A;  2WCB A;  4NQG A; 
#chains in the Genus database with same CATH homology
 3VRN A;  2L4I A;  3OHM B;  1J7R A;  1NUB A;  2BBM A;  1QVI Y;  2F2P A;  2FJU B;  2KQY A;  3RM1 A;  4CFQ A;  3DVE A;  2MLF C;  2BEC A;  2HQW A;  2V53 A;  3M0W A;  3GOF A;  1D1O A;  1BR4 B;  1CM4 A;  2QAC A;  1BF5 A;  1N65 A;  3ICB A;  2JXC A;  3HX4 A;  1CFC A;  1S26 D;  1B7T Z;  1EJ3 A;  1YTZ C;  2K7D A;  1HT9 A;  2KBI A;  3WHU B;  1U5I A;  1MXL C;  1DF0 B;  2Q91 A;  5TNC A;  5HLO A;  5HLV A;  3BQ3 A;  2OTG C;  2FOT A;  2COL B;  1IJ5 A;  1IGV A;  2LNK A;  1MXE A;  3I5F C;  1L7Z A;  2LP3 A;  2H61 A;  1KSO A;  1C07 A;  2CBL A;  1QXP A;  2MLE C;  4WQ2 A;  2BCB A;  2LAP A;  4N5X A;  4TNC A;  3ZWH A;  4UPG A;  2E30 A;  5KTY A;  1G8I A;  3O6B A;  1ZFS A;  3TDZ A;  2K7B A;  1Q80 A;  1UHH A;  4WQ3 A;  2BL0 B;  4L9M A;  2KBM A;  4PDZ A;  2LV7 A;  3CWG A;  1CTR A;  3LK1 A;  1NIW A;  2LMT A;  4QJ4 B;  3GK2 A;  5AEQ A;  1BMO A;  5HKW A;  3WHT B;  1LIN A;  1IQ5 A;  4A4C A;  1TNW A;  3WNX B;  1F70 A;  2LUC A;  3EVV A;  4YGC B;  1CDP A;  2AMI A;  3D10 A;  2LVK A;  4GGF A;  2KNE A;  1F54 A;  1EXR A;  1A75 B;  3PAL A;  2PAL A;  1M31 A;  3AKB A;  1W7J B;  3BUW B;  3D0Y A;  5K89 A;  5I2O A;  1Y1A A;  1S6J A;  4PE0 A;  1DJH A;  5CPV A;  2MBX A;  4YI8 A;  4ZCU A;  2F3Y A;  2LLT A;  1G33 A;  1DJY A;  4GBA A;  3KF9 A;  2BKH B;  1YX8 A;  3FS7 A;  4DS7 A;  1C7W A;  1EH2 A;  4FTG A;  5AXI A;  1CMF A;  3TS5 C;  4MRX A;  4MZK A;  1S1E A;  1SL8 A;  5D69 A;  1KFX S;  1FF1 A;  1SR6 B;  4N1G A;  1TOP A;  1B47 A;  1OSA A;  3TZ1 A;  1YUU A;  2Y4Q A;  1V1G A;  3SG6 A;  1NWD A;  3BUO B;  3PLF B;  2PMY A;  3DD4 A;  4MEW A;  1A29 A;  3DF0 A;  4I5L B;  1NX3 A;  3EVR A;  4MRY A;  1UP5 A;  2K61 A;  2JTZ A;  4PE1 A;  2M7L A;  3VGO A;  2TN4 A;  3O2P A;  1CLL A;  3GK4 X;  1RTP 1;  1CDM A;  1WLZ A;  3HCM A;  4C0J A;  3IQQ A;  4PHK A;  1QV1 A;  4A4B A;  2ZN8 A;  4AOM A;  1F4Q A;  4BY5 A;  2D8N A;  1SCM C;  3OP0 A;  4GGN A;  4YRU A;  1XFV O;  2H2K A;  2JZI A;  2Y1M A;  1J7P A;  1R2U A;  2JT0 A;  1S6I A;  1DJX A;  2LVV A;  1RK9 A;  3E3R A;  1HQV A;  4YI9 A;  5DKR A;  1OMV A;  2M0R A;  3C1V A;  1DF0 A;  1ZUZ A;  2M1K B;  3BUM B;  2PSR A;  2ZNE A;  1TCO B;  2KAY A;  1FPW A;  1YUT A;  2K2A A;  1L2O C;  1PSR A;  1UHI A;  2ZKM X;  3OB2 B;  3FIA A;  1WRL A;  3EK7 A;  4JQ0 D;  1X02 A;  1XFZ O;  2G9B A;  1QX5 B;  1KK8 C;  2JXL A;  1G4Y R;  1NSH A;  2WND A;  1KK7 Z;  1N2D A;  2M3W A;  4XYN A;  2I18 A;  3CR2 A;  3JTD C;  1SK6 D;  3AAK A;  1UHN A;  1J55 A;  2AAO A;  2R2I A;  4CID A;  2K8M B;  1JWD A;  1CFF A;  2PAS A;  4PE4 A;  2JTT A;  2M49 B;  4QJ5 B;  1K93 D;  1YUR A;  3EKJ A;  2CCM A;  1YVL A;  2OS8 C;  5ER5 A;  3NXA A;  1A75 A;  5DKN A;  2ZRT A;  4PHJ A;  1IRJ A;  1CB1 A;  1FW4 A;  1EL4 A;  2I7A A;  1RJV A;  2MAZ A;  2PVB A;  4I5K A;  2OTG B;  1IWQ A;  3KPX A;  4MN0 A;  3I5F B;  3AAJ A;  3TUY C;  1OZO A;  4ETO A;  3BUN B;  1UWO A;  2BE6 A;  4DRW A;  3O4Y A;  2LMU A;  3VRR A;  1IJ6 A;  1S36 A;  1XA5 A;  1XK4 A;  4JWQ A;  2M97 A;  1MQ1 A;  3VRP A;  1ALW A;  4XJK B;  2LCP A;  1A03 A;  5I8N A;  2F2O A;  5B8I B;  4M2O A;  2VRG A;  1QTX A;  2PRU A;  2JQ6 A;  4GFT A;  4GNK B;  3H4S E;  1XFU O;  3PM8 A;  2Y1N A;  2KGB C;  1JSA A;  2K2F A;  2ZFD A;  2WC8 A;  1Y1U A;  3SG5 A;  1RFJ A;  2JRF A;  5I2Q A;  1AP4 A;  2NXQ A;  3EVU A;  1OMR A;  1KWO C;  3RLZ A;  3NSI A;  1K95 A;  5KSZ A;  2EHB A;  1FI5 A;  3LLE A;  2JNX A;  3NSO A;  4I5J A;  1LXF C;  4ICB A;  1S5G Z;  2JOJ A;  2O60 A;  4YGD B;  4ZCV A;  2G2B A;  1NPQ A;  2KYC A;  3SG4 A;  2L50 A;  4D1E A;  3AKA A;  3EK8 A;  1UUS A;  2JC2 A;  1WY9 A;  1PK0 D;  2JNF A;  3TS5 B;  1KQM C;  3NSL A;  3SIA A;  3CR5 X;  1B8L A;  1BG1 A;  2E6W A;  2FCD A;  5DKQ A;  3LCP C;  4M2Q A;  4DIR A;  3MSE B;  1YRT B;  4YGB B;  2CXJ A;  3I5H C;  1IQ3 A;  1OE9 B;  2EC6 C;  1J7O A;  1B7T Y;  2KI4 C;  3CR4 X;  2KAV A;  2M1U A;  1KFU L;  1QX7 A;  1NCZ A;  1B9A A;  2L0P A;  4OV2 A;  3DVM A;  1JFK A;  1JUO A;  1TNQ A;  1AJ4 A;  2LHL A;  4YGA A;  3F45 A;  2LHI A;  1NP8 A;  3BOW B;  3VRQ A;  5J3X A;  3QRX A;  4QJ3 B;  4HRE E;  1BR1 B;  1NYA A;  1MHO A;  2LE9 B;  4HSZ A;  3BYA A;  2KI6 C;  4ORB B;  2F8P A;  2LMV A;  2JUL A;  3WXA A;  2M8U A;  1SCM B;  3LK0 A;  4CPV A;  1GGW A;  1B8R A;  1SMG A;  4IL1 A;  1M63 B;  1ODB A;  3I5I C;  4CFR A;  4DCK A;  2KYF A;  1YUS A;  1TRF A;  1AK8 A;  5HKY A;  2Y5I A;  1WRK A;  1OMD A;  2KSP A;  4PHN A;  2K7O A;  1GJY A;  4C0K A;  4I5N B;  4YGE B;  1K9U A;  3ZNI A;  3IQO A;  2CNP A;  1L2O B;  1GQM A;  1XO5 A;  1JF2 A;  4P2Y B;  1DGV A;  1SW8 A;  4FQO A;  3FWB A;  1KQV A;  2WOS A;  2GGM A;  1KK8 B;  4XJK A;  2LVJ A;  2H61 C;  1JFJ A;  4NDD A;  1QVI Z;  5G08 A;  1DTL A;  4U8D A;  3TDU A;  2QPT A;  1YR5 A;  3JTD B;  1QLK A;  2KFF A;  5CSF A;  5HKZ A;  1B1G A;  1BJF A;  3A8R A;  1CLM A;  2LM5 A;  2NCO A;  1WDC C;  1CFD A;  5KU1 A;  3CZT X;  2EGD A;  1XFX O;  1XFY O;  3IF7 A;  2OS8 B;  2O5G A;  1VRK A;  1SL9 A;  4AQJ A;  1PVA A;  2LLS A;  3CTN A;  3K21 A;  1IG5 A;  1J1E A;  4M2P A;  3DVK A;  4GUK A;  1QX2 A;  4N1F A;  4GGF C;  1AHR A;  1V1F A;  4P5O E;  3KO0 A;  4Q04 A;  4OVN F;  3TUY B;  1A2X A;  3JVT C;  4C0L A;  4HRH A;  1QS7 A;  3SG3 A;  3CGA A;  1AVS A;  1RWY A;  1K9P A;  1TCF A;  1SKT A;  1MUX A;  3EK4 A;  1S3P A;  1MWN A;  1F71 A;  1YVH A;  2BKI B;  2F3Z A;  2P6B B;  2BE4 A;  1F4O A;  1QV0 A;  2KFH A;  2ZND A;  2A4J A;  4F0Z B;  1LVC D;  1KFU S;  4MZJ A;  5FYX A;  1J7Q A;  1Y0V H;  1JF0 A;  4ORA B;  4JPZ B;  3OB1 B;  1IKU A;  2KAX A;  1KFX L;  2K0J A;  4CLN A;  4ORC B;  4USL A;  2BBN A;  2OPO A;  3I5G C;  4E68 A;  1MR8 A;  2L5X B;  1C7V A;  2I94 A;  2JWW A;  1K96 A;  1DMO A;  4OCI A;  1YRU B;  2IS9 A;  4PCW A;  1CM1 A;  1OQP A;  1PRW A;  4PE7 A;  5JOL A;  2NCP A;  1NCY A;  3BOW A;  1WRZ A;  2LVI A;  3DVJ A;  4MVF A;  2WCE A;  1KWO B;  2LAN A;  3PN7 C;  3LL8 B;  4PHM A;  1B8C A;  1H4B A;  1Y6W A;  3KEV A;  3CLN A;  3EKH A;  1KK7 Y;  1UHK A;  2GV5 A;  1PUL A;  1PVB A;  1KQM B;  3NSK A;  2WCF A;  3SG7 A;  5CSJ A;  1BU3 A;  1ALV A;  2DOQ A;  5AFP A;  5HYD A;  4OR9 B;  4AQI A;  3PSR A;  1UHJ A;  5GQQ C;  2MRD A;  1FBV A;  3I5H B;  3PFV A;  1JBA A;  1SL7 A;  2EC6 B;  2KI4 B;  1PSB A;  1SNL A;  1SYM A;  2MA2 A;  1XVJ A;  4R1E A;  3SG2 A;  1B4C A;  2ZN9 A;  5JJG A;  4MLW A;  5AAN A;  1NX1 A;  1AJ5 A;  2JT3 A;  1QAS A;  2JT8 A;  1XFW O;  1GGZ A;  2B1U A;  1F55 A;  2KI6 D;  1SPY A;  5BPJ A;  1Y1X A;  1TNP A;  2BL0 C;  2WOR A;  2LC5 A;  1QJT A;  1TTX A;  2L4H A;  2L51 A;  3BXK A;  5PAL A;  3FWC A;  1OOJ A;  3I5I B;  1BOD A;  1PAL A;  2AUC A;  4MSP A;  1BOC A;  4GAO A;  4DUQ A;  3VRO A;  2F33 A;  1QLS A;  2JU0 A;  1WLM A;  2FCE A;  1RRO A;  1DJZ A;  1LA0 A;  2LUX A;  3BUX B;  4YBH B;  1ZAC A;  4OKH A;  2I2R E;  2L2E A;  1MF8 B;  1CDN A;  4GPL B;  4MBE A;  1DGU A;  2SAS A;  1M39 A;  1U5I B;  2M7N A;  1CFP A;  1UUR A;  1IH0 A;  1QIV A;  2BCX A;  4BY4 A;  3O78 A;  1TIZ A;  3CS1 A;  2K7C A;  1SBJ A;  2ZRS A;  1CDL A;  1N0Y A;  1DJW A;  1XYD A;  2GGZ A;  1S5G Y;  2KOT A;  5ER4 X;  2NLN A;  2KDH A;  2RGI A;  3OX6 A;  1XK4 C;  1EG4 A;  1K9K A;  1CNP A;  2BCA A;  1SR6 C;  2MJW B;  5CSI A;  1BLQ A;  1NCX A;  3A4U B;  1WDC B;  1QIW A;  2JPT A;  4WRI A;  2Q4U A;  1FI6 A;  1K8U A;  2CTN A;  1LA3 A;  2L98 A;  1NX2 A;  5AER A;  1ZMZ A;  2LP2 A;  2SCP A;  2CT9 A;  1REC A;  1K94 A;  1DJI A;  1EG3 A;  1M46 A;  4HRG A;  5D7F A;  1M45 A;  1DT7 B;  3SIB A;  1J1D A;  2HET A;  1DVI A;  2M9G A;  2ISD A;  1SCV A;  2KFG A;  1KCY A;  4PAL A;  1CKK A;  3D0Y B;  1OZS A;  3JVT B;  3SJS A;  1AUI B;  2KGR A;  1BT6 A;  5I2L A;  3PAT A;  2MHH A;  1SRA A;  1JC2 A;  5CSN A;  5F6T A;  2KQ6 A;  2M29 A;  3OX5 A;  1ZOT B;  2HQ8 A;  3KHE A;  2LLU A;  2HPS A;  1E8A A;  1S6C A;  4NDB A;  1H8B A;  1K2H A;  1TNX A;  1A4P A;  3I5G B;  2NZ0 A;  3GK1 A;  1NX0 A;  1YX7 A;  1LKJ A;  2KHN A;  1CLB A;  1QAT A;  1K90 D;  1KSM A;  1W7I B;  3DF0 B;  1TN4 A;  2HF5 A;  1F8H A;  1R6P A;  1SY9 A;  3PN7 B;  4MZL A;  1CMG A;  5IBW A;  1DJG A;  3TDI A;  4NDC A;  2WCB A;  4NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...