1S6IA

Ca2+-regulatory region (cld) from soybean calcium-dependent protein kinase-alpha (cdpk) in the presence of ca2+ and the junction domain (jd)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
182
structure length
182
Chain Sequence
AERLSEEEIGGLKELFKMIDTDNSGTITFDELKDGLKRVGSELMESEIKDLMDAADIDKSGTIDYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHIDDMIKEIDQDNDGQIDYGEFAAMMRKRKGNGGIGRRTMRKTLNLRDALGLVDNGSNQVIEGYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, plant protein
molecule keywords Calcium-dependent protein kinase SK5
publication title Unexpected structure of the Ca2+-regulatory region from soybean calcium-dependent protein kinase-alpha
pubmed doi rcsb
source organism Glycine max
total genus 24
structure length 182
sequence length 182
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA02
2OPOA 4A4BA 1XYDA 1C7VA 5CSIA 1K9PA 3KEVA 2KFGA 1CFPA 4GFTA 5DKNA 4DS7A 2K0JA 2Y1MA 3DVMA 2JZIA 1IG5A 2LUCA 2LVKA 1QLSA 3SG6A 1LA3A 4PE1A 1H8BA 3K21A 3BXKA 4USLA 3SG5A 4XYNA 1X02A 1CLMA 1A4PA 3HX4A 3IQQA 1VRKA 2F33A 1U5IA 1YR5A 1KK8B 2MJWB 2H61C 1BJFA 3BUXB 3RLZA 1A75B 1UHHA 2QACA 2SASA 4MRXA 4ZCVA 1QASA 1XO5A 1LA0A 2BCBA 4GNKB 2M3WA 2MHHA 2GGMA 3OX5A 2JTTA 4PE7A 1KK8C 3BOWB 3GK2A 1ODBA 2Q4UA 5I8NA 1OMDA 3EKHA 1CTRA 1TOPA 3HCMA 3LK1A 1E8AA 1RTP1 1NP8A 1J7OA 4DRWA 1SL8A 2WCFA 2L51A 3LK0A 1B4CA 4UPGA 1XFYO 2LV7A 1SY9A 2ZN8A 1CDPA 2JXCA 2H2KA 3EVRA 5I2OA 1DGVA 2KNEA 2CCMA 2L2EA 1BF5A 3VRQA 1UHIA 4N5XA 1NCZA 3M0WA 1OE9B 2M49B 4U8DA 1B47A 1JBAA 5TNCA 4CFQA 5D69A 1AJ5A 1HQVA 1KWOB 3LCPC 3O4YA 4HREE 1SRAA 2Q91A 1NX3A 1K8UA 5AERA 1BT6A 3I5IB 3PATA 2BL0C 3AKBA 2HQWA 1M31A 1MUXA 3OB1B 1AUIB 2LHIA 1Y1UA 1KSOA 2L4IA 1SCMC 2M7NA 4PHJA 1TN4A 2SCPA 2JNFA 1YUTA 4N1FA 1YUUA 3CLNA 1R2UA 3TS5C 2FOTA 3I5HB 4F0ZB 3I5FC 1CFCA 2BBNA 4MN0A 1CLBA 2HPSA 3OB2B 3SG7A 1EG4A 4OKHA 2AUCA 1NPQA 4I5KA 1M39A 3BUMB 2M8UA 2LM5A 1UP5A 1K9UA 1J55A 5D7FA 3TDZA 2JNXA 1SYMA 1M63B 1N2DA 2LVIA 1FW4A 3NSLA 5CSJA 3JTDC 1K9KA 3H4SE 2LP3A 1XFVO 4M2PA 2MBXA 4JWQA 3BUNB 3VRPA 2JU0A 1TIZA 2OTGC 2KAXA 3KO0A 2K7OA 2JPTA 3BQ3A 1AJ4A 1LVCD 2NCPA 2KBIA 1K96A 2WOSA 1S36A 4YBHB 5KSZA 4MBEA 2COLB 4Q04A 1SW8A 1IGVA 1PALA 1S6JA 2WCBA 3CZTX 3EK8A 1W7JB 2I7AA 2LLSA 4M2OA 2O60A 4QJ4B 2I94A 3O78A 4YI9A 1WRZA 1S5GZ 1K94A 2KBMA 3ICBA 3NSOA 4MZKA 1YURA 3CWGA 1JUOA 1PRWA 1XK4A 1EL4A 1EXRA 1S26D 3FWCA 4NDDA 1AVSA 2PVBA 1B7TY 1SL9A 3PLFB 1DGUA 2BCXA 4PHKA 2LANA 2LCPA 2ZN9A 4N1GA 1R6PA 3EK7A 1SR6C 1TNPA 2EGDA 1BOCA 1B8RA 1XFZO 3WHUB 1AK8A 2HETA 1G33A 1RECA 4QJ3B 2JOJA 1F4OA 1XFUO 5AXIA 1KFXL 1QIWA 1IJ6A 1YVHA 1KQMC 4ORBB 3VROA 3A8RA 4D1EA 1WLZA 3O6BA 3EVUA 4AQIA 2K61A 4E68A 2ZRTA 1TNQA 1QX2A 4QJ5B 1KFUL 1DJWA 1OSAA 5AANA 5HKWA 1DJXA 1MXLC 1RFJA 2LLTA 4MVFA 2Y5IA 1IWQA 2F3YA 2KFFA 3DF0A 1FI6A 3WNXB 5PALA 1CNPA 1KK7Y 4ICBA 4PE0A 2K8MB 1OZSA 2LLUA 1FPWA 1W7IB 3GK1A 4JPZB 1WRKA 2PMYA 1HT9A 1S6IA 1YX8A 2HQ8A 3JVTC 1UURA 1F71A 1EJ3A 2BE4A 2K7CA 3DVEA 1QXPA 1TCOB 4CLNA 4OR9B 1MXEA 1J7QA 4PE4A 2JT0A 2OS8B 3VGOA 1PVBA 2JULA 2M9GA 1OMVA 2FCDA 2NXQA 2I2RE 1LKJA 1UHNA 2RGIA 1GGWA 4PDZA 4GPLB 5I2LA 2KYCA 3OHMB 3GK4X 3PN7C 1IRJA 2BL0B 3LL8B 2OS8C 1ZOTB 2PASA 1M45A 4HRHA 2L4HA 3KPXA 4BY5A 1OZOA 1F54A 2MLFC 2V53A 1SCMB 1QS7A 2BE6A 5JOLA 1JSAA 2BBMA 4MLWA 1G8IA 5DKRA 1J1DA 2KAYA 3BOWA 5JJGA 1DJYA 3TS5B 2LMVA 3AAJA 4GUKA 1CFDA 4PALA 3I5FB 2JQ6A 1QIVA 4HSZA 3NSKA 4OV2A 5ER5A 2O5GA 1B8CA 3I5GC 4NDCA 1NX2A 3SG3A 3PALA 3C1VA 2PRUA 5ER4X 2M29A 2PALA 1UUSA 1QJTA 4FTGA 1YRUB 1QVIY 3F45A 4GGNA 1DTLA 4YRUA 3JTDB 1YRTB 2L0PA 1F55A 1EG3A 1NYAA 1TNXA 1RROA 3D0YB 4YGCB 1QATA 2OTGB 2K2AA 2KGBC 1KSMA 4GAOA 3WHTB 4AOMA 1D1OA 2F2PA 3LLEA 1A29A 3VRNA 1SKTA 1OMRA 1F70A 2GV5A 1B9AA 1IQ3A 2B1UA 2BKHB 5HYDA 3A4UB 3GOFA 2LHLA 1UHKA 2BECA 2CNPA 4GGFA 4DCKA 1QX5B 5J3XA 1JWDA 1SPYA 2ZNDA 4PHNA 2KOTA 2L98A 1BMOA 5CSNA 1BR4B 2G9BA 1K95A 2MRDA 1DJHA 1V1GA 4CIDA 2MA2A 2CXJA 3KHEA 1DT7B 1ZFSA 1OQPA 5KU1A 3CR5X 1PSBA 4GBAA 2LVVA 2ZKMX 1QV1A 4XJKB 2F8PA 5DKQA 3TDUA 2KI6D 2Y4QA 3KF9A 4WQ3A 4AQJA 1XK4C 1SR6B 1ZMZA 1TCFA 1WDCC 3CTNA 3NXAA 4TNCA 3ZNIA 1JC2A 3SG2A 3CR2A 1YUSA 3SG4A 1EH2A 4MEWA 3EKJA 1AHRA 5AEQA 2Y1NA 2K7DA 2ZFDA 5CSFA 1NWDA 1KQMB 1J7RA 4OVNF 1DVIA 1OOJA 1DJZA 2M7LA 2KSPA 1PSRA 1U5IB 1J1EA 2DOQA 4MZJA 1WLMA 1BODA 4HRGA 1DF0A 1V1FA 1QTXA 1K2HA 2WORA 2I18A 2LVJA 4C0LA 2D8NA 1S1EA 1Y6WA 1CDLA 1JF2A 3CS1A 4JQ0D 2E6WA 5BPJA 2WNDA 2CTNA 3FWBA 1GGZA 1C07A 2TN4A 1FF1A 3O2PA 3BUOB 3TUYC 5K89A 3MSEB 3JVTB 1SBJA 2EC6B 2LP2A 4I5JA 1K90D 1FBVA 4ZCUA 1DJGA 2P6BB 1NCXA 1S3PA 3OX6A 1LXFC 1GJYA 2JWWA 1CKKA 5HKZA 1MR8A 1FI5A 2KI4C 1Q80A 2AMIA 2F2OA 4P5OE 2EC6C 3PM8A 2E30A 1YVLA 2HF5A 3DVJA 4A4CA 2LC5A 1PULA 3TZ1A 1RK9A 5I2QA 3PN7B 4NDBA 2H61A 2QPTA 3IQOA 3SIAA 4M2QA 5F6TA 1BLQA 1AP4A 1F4QA 2JC2A 1B7TZ 5HLOA 2CBLA 1DMOA 4MRYA 2KI6C 4PHMA 1IJ5A 4IL1A 1A75A 3DVKA 2L5XB 1G4YR 1Y1AA 1XFWO 1XA5A 2ISDA 3TDIA 2LNKA 3I5GB 1UWOA 2MLEC 2M1KB 2NCOA 1CMFA 4I5NB 3NSIA 4ORAB 1PVAA 2NZ0A 2KYFA 2K7BA 3EK4A 2K2FA 1MQ1A 1BU3A 2R2IA 1N0YA 1NIWA 1XFXO 1CMGA 1YX7A 2VRGA 1UHJA 1CM1A 1GQMA 2JTZA 1KFXS 3EVVA 2KHNA 3BUWB 4YI8A 5HLVA 5B8IB 1JFJA 1CDMA 3PFVA 2KQ6A 4I5LB 4MSPA 2EHBA 2KGRA 1SL7A 2JT3A 1SNLA 3OP0A 3CR4X 2F3ZA 4YGAA 5G08A 2FCEA 2G2BA 2KQYA 1KFUS 2M0RA 1CLLA 3BYAA 1BR1B 1KK7Z 1DJIA 3SJSA 1S5GY 3D10A 1BG1A 1NUBA 3AKAA 2IS9A 5CPVA 2AAOA 4BY4A 1F8HA 1KWOC 1ZACA 2NLNA 2CT9A 3QRXA 1Y1XA 2A4JA 4MZLA 2JRFA 3I5IC 3FS7A 5IBWA 2BCAA 1SCVA 1NCYA 1ZUZA 5AFPA 1IKUA 1H4BA 1RJVA 4GGFC 4ORCB 2KAVA 3E3RA 3AAKA 3VRRA 1TTXA 1A03A 1L2OB 1TNWA 1TRFA 1SK6D 1MWNA 1QLKA 3PSRA 1A2XA 1N65A 2LMTA 1QV0A 1LINA 1CFFA 1RWYA 1K93D 1YTZC 3I5HC 1WDCB 1KCYA 2M97A 1KQVA 4R1EA 1L2OC 5FYXA 2L50A 4ETOA 2WCEA 1NX1A 5HKYA 4OCIA 2GGZA 5KTYA 1PK0D 1CDNA 4WQ2A 2LMUA 3IF7A 4P2YB 1IQ5A 4C0JA 4DUQA 3D0YA 4DIRA 1S6CA 2PSRA 2JXLA 1JFKA 2JT8A 1SMGA 2LAPA 1B1GA 1IH0A 1DF0B 2LUXA 4FQOA 1J7PA 4CFRA 5GQQC 2MAZA 1XVJA 3DD4A 1C7WA 4WRIA 1WY9A 1QVIZ 1QX7A 2KFHA 1NSHA 3ZWHA 1B8LA 2KDHA 3SIBA 1MHOA 2FJUB 2ZNEA 4L9MA 3CGAA 3FIAA 4CPVA 4YGDB 1CB1A 3TUYB 2ZRSA 4C0KA 3WXAA 3RM1A 2M1UA 1WRLA 4NQGA 3DF0B 4YGEB 1Y0VH 1ALVA 2WC8A 1NX0A 1ALWA 1JF0A 1CM4A 4PCWA 4YGBB 2BKIB 1L7ZA 4XJKA 2KI4B 1MF8B 2LE9B 1M46A
chains in the Genus database with same CATH superfamily
2OPOA 4A4BA 1XYDA 1C7VA 5CSIA 1K9PA 3KEVA 2KFGA 1CFPA 4GFTA 5DKNA 4DS7A 2K0JA 2Y1MA 3DVMA 2JZIA 1IG5A 2LUCA 2LVKA 1QLSA 3SG6A 1LA3A 4PE1A 1H8BA 3K21A 3BXKA 3Q8IA 4USLA 3SG5A 4XYNA 1X02A 1CLMA 1A4PA 3HX4A 3IQQA 1VRKA 3S0FA 3B6XA 2F33A 1U5IA 1YR5A 1KK8B 2MJWB 2H61C 1BJFA 3BUXB 3RLZA 1A75B 1UHHA 2QACA 2SASA 3R72A 4MRXA 4ZCVA 1QASA 1XO5A 1LA0A 2BCBA 4GNKB 2M3WA 2MHHA 2GGMA 3OX5A 2JTTA 4PE7A 1KK8C 3BOWB 3GK2A 1ODBA 3OGNA 5I94A 2Q4UA 5I8NA 1OMDA 3EKHA 1CTRA 3B88A 1TOPA 3HCMA 3LK1A 1E8AA 1RTP1 1NP8A 1J7OA 4DRWA 1SL8A 2WCFA 2L51A 3SS4A 1XFRA 3LK0A 1B4CA 4UPGA 1XFYO 2LV7A 1SY9A 2ZN8A 1CDPA 2JXCA 2H2KA 3EVRA 1Z2CB 5I2OA 1DGVA 2KNEA 2CCMA 2BNXA 2L2EA 1C3YA 1BF5A 3VRQA 1UHIA 3B7AA 4N5XA 1NCZA 3M0WA 1OE9B 3RZSA 2M49B 4U8DA 1B47A 1JBAA 5TNCA 4CFQA 5D69A 1AJ5A 1HQVA 1KWOB 3LCPC 3O4YA 4HREE 1OOHA 1SRAA 2Q91A 1NX3A 2KPHA 1K8UA 2QEBA 3D74A 5AERA 2WCJA 1BT6A 3I5IB 3CYZA 1T14A 3PATA 2BL0C 3AKBA 2HQWA 1M31A 1MUXA 3OB1B 3IVTA 1P28A 1AUIB 2LHIA 1Y1UA 1KSOA 2L4IA 3NHIA 1SCMC 2M7NA 4PHJA 1TN4A 2SCPA 2JNFA 2WCMA 1YUTA 4N1FA 1YUUA 3CLNA 1R2UA 3TS5C 2FOTA 3I5HB 4F0ZB 3I5FC 1CFCA 2BBNA 4MN0A 1CLBA 3BJHA 2HPSA 3OB2B 2GTEA 1EG4A 4OKHA 3SG7A 2BAPA 3SS5A 2AUCA 2WCLA 1NPQA 4I5KA 1M39A 3BUMB 2M8UA 2LM5A 1UP5A 4PT1A 1K9UA 1J55A 5D7FA 3TDZA 2JNXA 1SYMA 1M63B 1N2DA 2LVIA 1FW4A 1TWOA 3NSLA 5CSJA 3JTDC 1K9KA 3H4SE 2LP3A 1XFVO 4M2PA 2MBXA 4JWQA 3BUNB 3VRPA 2JU0A 1TIZA 2OTGC 2KAXA 3KO0A 2K7OA 2JPTA 2KLDA 3BQ3A 1AJ4A 1LVCD 2NCPA 2PQLA 3O4XA 2KBIA 1K96A 2WOSA 1S36A 4YBHB 5KSZA 1DELA 4MBEA 2COLB 4Q04A 2WC6A 1SW8A 1IGVA 1PALA 1S6JA 2WCBA 3CZTX 3EK8A 1W7JB 2I7AA 2LLSA 4M2OA 2O60A 2QEVA 4QJ4B 2I94A 3O78A 4YI9A 1WRZA 1GM0A 1S5GZ 1K94A 2KBMA 2WCHA 3ICBA 3NSOA 1YURA 2QEOA 3CWGA 4MZKA 4OZDA 3UO9A 1JUOA 1PRWA 1XK4A 1EL4A 1EXRA 1C3ZA 1S26D 3FWCA 4NDDA 1AVSA 2PVBA 1B7TY 1SL9A 3PLFB 1TUZA 1DGUA 2BCXA 4PHKA 2LANA 2LCPA 2ZN9A 4N1GA 1R6PA 3EK7A 1SR6C 2FJYA 1TNPA 2EGDA 1BOCA 1B8RA 1XFZO 3WHUB 1AK8A 2HETA 1G33A 1RECA 3EG5B 4QJ3B 2JOJA 1F4OA 1XFUO 5AXIA 1KFXL 1QIWA 1IJ6A 1YVHA 1KQMC 3CZ0A 4ORBB 3VROA 3A8RA 4D1EA 1WLZA 3O6BA 3EVUA 4AQIA 2K61A 4E68A 2ZRTA 1TNQA 1QX2A 3NHTA 1KFUL 1DJWA 1OSAA 4QJ5B 5AANA 5HKWA 1DJXA 1MXLC 1RFJA 2LLTA 4MVFA 2Y5IA 1IWQA 2F3YA 2KFFA 3DF0A 1FI6A 3WNXB 5PALA 3L4LA 1CNPA 3OBVA 1KK7Y 3QMEA 4ICBA 4PE0A 2K8MB 1OZSA 2LLUA 1FPWA 1W7IB 3GK1A 1ORGA 4JPZB 1WRKA 2PMYA 1HT9A 1S6IA 1YX8A 2HQ8A 3JVTC 1UURA 1F71A 1EJ3A 2BE4A 2K7CA 3DVEA 4INWA 1QXPA 1TCOB 4CLNA 4OR9B 1MXEA 1J7QA 4PE4A 2JT0A 2OS8B 2K60A 3VGOA 1PVBA 2JULA 2M9GA 1OMVA 2FCDA 2L2CA 2NXQA 2I2RE 1LKJA 1UHNA 2RGIA 4JD9A 4PDZA 1GGWA 4GPLB 5I2LA 5HL1A 2KYCA 3OHMB 3GK4X 3PN7C 1IRJA 2BL0B 3PJIA 3LL8B 2OS8C 1DQEA 1ZOTB 2PASA 1M45A 3DY9A 4HRHA 2L4HA 3KPXA 3CABA 4BY5A 1OZOA 1F54A 2MLFC 2V53A 1SCMB 1QS7A 2BE6A 5JOLA 1JSAA 2BBMA 4MLWA 1G8IA 3SS3A 5DKRA 1J1DA 2KAYA 3BOWA 5JJGA 1DJYA 3TS5B 2LMVA 1DEKA 3AAJA 1CFDA 4GUKA 4PALA 3I5FB 2JQ6A 1QIVA 4HSZA 3NSKA 4OV2A 5ER5A 2O5GA 1B8CA 3I5GC 4NDCA 1NX2A 2YGUA 3PALA 3C1VA 3SG3A 2PRUA 5ER4X 5FI6A 2M29A 2PALA 1UUSA 1QJTA 4FTGA 1YRUB 1QVIY 3F45A 4GGNA 3DZTA 5D3OA 1DTLA 4YRUA 3JTDB 1YRTB 3S0BA 2L0PA 1F55A 3FE8A 1EG3A 5FI2A 1NYAA 1TNXA 3UNWA 1RROA 3D0YB 4YGCB 3FE6A 1QATA 2OTGB 2K2AA 2KGBC 1KSMA 4GAOA 3WHTB 4AOMA 1D1OA 2F2PA 3LLEA 1A29A 3VRNA 1SKTA 1OMRA 2JPOA 1F70A 4INXA 2GV5A 1B9AA 1IQ3A 2B1UA 2BKHB 5HYDA 3A4UB 4IJ7A 3GOFA 2LHLA 1UHKA 2BECA 3S0GA 2CNPA 2H8VA 4GGFA 4DCKA 1QX5B 5J3XA 1JWDA 1SPYA 2ZNDA 1LS8A 4PHNA 2KOTA 2L98A 3DXLA 1BMOA 5CSNA 1BR4B 2G9BA 1K95A 2MRDA 1DJHA 1V1GA 4CIDA 3S0DA 2MA2A 2CXJA 3KHEA 1DT7B 1ZFSA 1OQPA 5KU1A 3CR5X 1PSBA 1OOIX 4GBAA 2LVVA 2ZKMX 1QV1A 3PM2A 4XJKB 2F8PA 5DKQA 3TDUA 2KI6D 2Y4QA 2L5YA 3KF9A 4WQ3A 4AQJA 3D76A 1XK4C 3VB1A 3CZ2A 1SR6B 1ZMZA 1TCFA 1WDCC 3CTNA 3NXAA 4TNCA 3ZNIA 3BFHA 1JC2A 3SG2A 3CR2A 1YUSA 3SG4A 1EH2A 4MEWA 3EKJA 1AHRA 5AEQA 2Y1NA 2K7DA 2ZFDA 5CSFA 1NWDA 4F7FA 1KQMB 1J7RA 3R1OA 1OW4A 1DVIA 1OOJA 1DJZA 4OVNF 4FQTA 2M7LA 2KSPA 1PSRA 2P70A 1U5IB 1J1EA 2DOQA 4MZJA 1WLMA 1BODA 4HRGA 1DF0A 1V1FA 1QTXA 1K2HA 2WORA 2I18A 2LVJA 3K1EA 4C0LA 2D8NA 1S1EA 3DYEA 1Y6WA 1CDLA 1JF2A 3CS1A 4JQ0D 2E6WA 2P71A 5BPJA 2WNDA 2CTNA 3FWBA 1GGZA 3S0AA 1C07A 2WCKA 2TN4A 1FF1A 3O2PA 3BUOB 3TUYC 5K89A 3MSEB 3JVTB 1SBJA 2EC6B 2LP2A 4I5JA 1K90D 1FBVA 4ZCUA 1DJGA 2P6BB 1NCXA 1S3PA 3OX6A 1W9ZA 1LXFC 1GJYA 2JWWA 1CKKA 3CDNA 5HKZA 1MR8A 1FI5A 2KI4C 1Q80A 2AMIA 2F2OA 4P5OE 2EC6C 3PM8A 2E30A 1YVLA 2HF5A 3DVJA 4A4CA 2LC5A 1PULA 3D78A 3TZ1A 1RK9A 5I2QA 3PN7B 4NDBA 2H61A 2QPTA 3IQOA 3SIAA 4M2QA 5F6TA 1BLQA 4JKTA 1AP4A 1F4QA 2JC2A 3BFAA 1B7TZ 5HLOA 5FI7A 3D73A 2CBLA 1DMOA 4MRYA 1OOGA 2KI6C 4PHMA 1IJ5A 4IL1A 1Z4HA 1A75A 3DVKA 2L5XB 1G4YR 1Y1AA 1XFWO 1XA5A 2ISDA 3V2LA 3TDIA 2LNKA 3I5GB 1DC1A 1UWOA 2MLEC 2M1KB 2NCOA 5DICA 1CMFA 4I5NB 3NSIA 4ORAB 1PVAA 2NZ0A 3FE9A 2KYFA 2K7BA 3EK4A 2K2FA 1MQ1A 1BU3A 2R2IA 1N0YA 1NIWA 1XFXO 1CMGA 1YX7A 2VRGA 1UHJA 1CM1A 1GQMA 2JTZA 1KFXS 3EVVA 2KHNA 3BUWB 4YI8A 5HLVA 5B8IB 1JFJA 1CDMA 3PFVA 2KQ6A 4I5LB 4MSPA 2EHBA 2KGRA 1SL7A 2JT3A 1SNLA 3OP0A 3CR4X 2F3ZA 4YGAA 5G08A 2FCEA 2G2BA 2KQYA 1KFUS 2M0RA 1CLLA 2PYQA 3BYAA 1BR1B 1KK7Z 1DJIA 3S0EA 2ERBA 3SJSA 1S5GY 3CZ1A 3D10A 1BG1A 1NUBA 3AKAA 2IS9A 5CPVA 2AAOA 4BY4A 1F8HA 1KWOC 1ZACA 2QEHA 3L4AA 3R1VA 2NLNA 2CT9A 3QRXA 1Y1XA 2A4JA 3BFBA 4MZLA 2JRFA 3I5IC 3FS7A 5IBWA 2BCAA 1SCVA 1NCYA 1ZUZA 1QWVA 2KLEA 5AFPA 1RJVA 1TUJA 4GGFC 4ORCB 1IKUA 2KAVA 3E3RA 1H4BA 3AAKA 3VRRA 1TTXA 1A03A 3N7HA 1IIOA 1L2OB 1TNWA 1TRFA 1SK6D 1MWNA 1QLKA 3PSRA 1A2XA 1N65A 2LMTA 1QV0A 1LINA 1CFFA 1RWYA 3L47A 3D75A 1K93D 1YTZC 3I5HC 1WDCB 3B86A 1KCYA 2M97A 1KQVA 4R1EA 1L2OC 5FYXA 2L50A 3B87A 2WCEA 1NX1A 4ETOA 4OCIA 2GGZA 5HKYA 5KTYA 1PK0D 2WC5A 1CDNA 4WQ2A 2LMUA 3IF7A 4P2YB 1SSEB 1IQ5A 4C0JA 5EL2A 4DUQA 3D0YA 4DIRA 1S6CA 2PSRA 4KYNA 2JXLA 1JFKA 2JT8A 1SMGA 2LAPA 1B1GA 1IH0A 1DF0B 2LUXA 4FQOA 1J7PA 4CFRA 5GQQC 2MAZA 2QDIA 1XVJA 3DD4A 1C7WA 4WRIA 1WY9A 1QVIZ 1QX7A 2KFHA 1NSHA 3ZWHA 3R1PA 1B8LA 2KDHA 3SIBA 1MHOA 2FJUB 2ZNEA 4L9MA 3CGAA 3FIAA 3D77A 4CPVA 4YGDB 1CB1A 3TUYB 2ZRSA 4C0KA 3WXAA 3RM1A 2M1UA 1OOFA 1WRLA 4NQGA 3DF0B 4YGEB 1Y0VH 1ALVA 2WC8A 1NX0A 1ALWA 1JF0A 1CM4A 4PCWA 4YGBB 2BKIB 3NGVA 1L7ZA 4XJKA 2KI4B 1MF8B 2LE9B 1M46A
chains in the Genus database with same CATH topology
2OPOA 4A4BA 1XYDA 1C7VA 5CSIA 1K9PA 3KEVA 2KFGA 1CFPA 4GFTA 5DKNA 4DS7A 2K0JA 2Y1MA 3DVMA 2JZIA 1IG5A 2LUCA 2LVKA 1QLSA 3SG6A 1LA3A 4PE1A 1H8BA 3K21A 3BXKA 4USLA 3SG5A 4XYNA 1X02A 1CLMA 1A4PA 3HX4A 3IQQA 1VRKA 2F33A 1U5IA 1YR5A 1KK8B 2MJWB 2H61C 1BJFA 3BUXB 3RLZA 1A75B 1UHHA 2QACA 2SASA 4MRXA 4ZCVA 1QASA 1XO5A 1LA0A 2BCBA 4GNKB 2M3WA 2MHHA 2GGMA 3OX5A 2JTTA 4PE7A 1KK8C 3BOWB 3GK2A 1ODBA 2Q4UA 5I8NA 1OMDA 3EKHA 1CTRA 1TOPA 3HCMA 3LK1A 1E8AA 1RTP1 1NP8A 1J7OA 4DRWA 1SL8A 2WCFA 2L51A 3LK0A 1B4CA 4UPGA 1XFYO 2LV7A 1SY9A 2ZN8A 1CDPA 2JXCA 2H2KA 3EVRA 5I2OA 1DGVA 2KNEA 2CCMA 2L2EA 1BF5A 3VRQA 1UHIA 4N5XA 1NCZA 3M0WA 1OE9B 2M49B 4U8DA 1B47A 1JBAA 5TNCA 4CFQA 5D69A 1AJ5A 1HQVA 1KWOB 3LCPC 3O4YA 4HREE 1SRAA 2Q91A 1NX3A 1K8UA 5AERA 1BT6A 3I5IB 3PATA 2BL0C 3AKBA 2HQWA 1M31A 1MUXA 3OB1B 1AUIB 2LHIA 1Y1UA 1KSOA 2L4IA 1SCMC 2M7NA 4PHJA 1TN4A 2SCPA 2JNFA 1YUTA 4N1FA 1YUUA 3CLNA 1R2UA 3TS5C 2FOTA 3I5HB 4F0ZB 3I5FC 1CFCA 2BBNA 4MN0A 1CLBA 2HPSA 3OB2B 3SG7A 1EG4A 4OKHA 2AUCA 1NPQA 4I5KA 1M39A 3BUMB 2M8UA 2LM5A 1UP5A 1K9UA 1J55A 5D7FA 3TDZA 2JNXA 1SYMA 1M63B 1N2DA 2LVIA 1FW4A 3NSLA 5CSJA 3JTDC 1K9KA 3H4SE 2LP3A 1XFVO 4M2PA 2MBXA 4JWQA 3BUNB 3VRPA 2JU0A 1TIZA 2OTGC 2KAXA 3KO0A 2K7OA 2JPTA 3BQ3A 1AJ4A 1LVCD 2NCPA 2KBIA 1K96A 2WOSA 1S36A 4YBHB 5KSZA 4MBEA 2COLB 4Q04A 1SW8A 1IGVA 1PALA 1S6JA 2WCBA 3CZTX 3EK8A 1W7JB 2I7AA 2LLSA 4M2OA 2O60A 4QJ4B 2I94A 3O78A 4YI9A 1WRZA 1S5GZ 1K94A 2KBMA 3ICBA 3NSOA 4MZKA 1YURA 3CWGA 1JUOA 1PRWA 1XK4A 1EL4A 1EXRA 1S26D 3FWCA 4NDDA 1AVSA 2PVBA 1B7TY 1SL9A 3PLFB 1DGUA 2BCXA 4PHKA 2LANA 2LCPA 2ZN9A 4N1GA 1R6PA 3EK7A 1SR6C 1TNPA 2EGDA 1BOCA 1B8RA 1XFZO 3WHUB 1AK8A 2HETA 1G33A 1RECA 4QJ3B 2JOJA 1F4OA 1XFUO 5AXIA 1KFXL 1QIWA 1IJ6A 1YVHA 1KQMC 4ORBB 3VROA 3A8RA 4D1EA 1WLZA 3O6BA 3EVUA 4AQIA 2K61A 4E68A 2ZRTA 1TNQA 1QX2A 4QJ5B 1KFUL 1DJWA 1OSAA 5AANA 5HKWA 1DJXA 1MXLC 1RFJA 2LLTA 4MVFA 2Y5IA 1IWQA 2F3YA 2KFFA 3DF0A 1FI6A 3WNXB 5PALA 1CNPA 1KK7Y 4ICBA 4PE0A 2K8MB 1OZSA 2LLUA 1FPWA 1W7IB 3GK1A 4JPZB 1WRKA 2PMYA 1HT9A 1S6IA 1YX8A 2HQ8A 3JVTC 1UURA 1F71A 1EJ3A 2BE4A 2K7CA 3DVEA 1QXPA 1TCOB 4CLNA 4OR9B 1MXEA 1J7QA 4PE4A 2JT0A 2OS8B 3VGOA 1PVBA 2JULA 2M9GA 1OMVA 2FCDA 2NXQA 2I2RE 1LKJA 1UHNA 2RGIA 1GGWA 4PDZA 4GPLB 5I2LA 2KYCA 3OHMB 3GK4X 3PN7C 1IRJA 2BL0B 3LL8B 2OS8C 1ZOTB 2PASA 1M45A 4HRHA 2L4HA 3KPXA 4BY5A 1OZOA 1F54A 2MLFC 2V53A 1SCMB 1QS7A 2BE6A 5JOLA 1JSAA 2BBMA 4MLWA 1G8IA 5DKRA 1J1DA 2KAYA 3BOWA 5JJGA 1DJYA 3TS5B 2LMVA 3AAJA 4GUKA 1CFDA 4PALA 3I5FB 2JQ6A 1QIVA 4HSZA 3NSKA 4OV2A 5ER5A 2O5GA 1B8CA 3I5GC 4NDCA 1NX2A 3SG3A 3PALA 3C1VA 2PRUA 5ER4X 2M29A 2PALA 1UUSA 1QJTA 4FTGA 1YRUB 1QVIY 3F45A 4GGNA 1DTLA 4YRUA 3JTDB 1YRTB 2L0PA 1F55A 1EG3A 1NYAA 1TNXA 1RROA 3D0YB 4YGCB 1QATA 2OTGB 2K2AA 2KGBC 1KSMA 4GAOA 3WHTB 4AOMA 1D1OA 2F2PA 3LLEA 1A29A 3VRNA 1SKTA 1OMRA 1F70A 2GV5A 1B9AA 1IQ3A 2B1UA 2BKHB 5HYDA 3A4UB 3GOFA 2LHLA 1UHKA 2BECA 2CNPA 4GGFA 4DCKA 1QX5B 5J3XA 1JWDA 1SPYA 2ZNDA 4PHNA 2KOTA 2L98A 1BMOA 5CSNA 1BR4B 2G9BA 1K95A 2MRDA 1DJHA 1V1GA 4CIDA 2MA2A 2CXJA 3KHEA 1DT7B 1ZFSA 1OQPA 5KU1A 3CR5X 1PSBA 4GBAA 2LVVA 2ZKMX 1QV1A 4XJKB 2F8PA 5DKQA 3TDUA 2KI6D 2Y4QA 3KF9A 4WQ3A 4AQJA 1XK4C 1SR6B 1ZMZA 1TCFA 1WDCC 3CTNA 3NXAA 4TNCA 3ZNIA 1JC2A 3SG2A 3CR2A 1YUSA 3SG4A 1EH2A 4MEWA 3EKJA 1AHRA 5AEQA 2Y1NA 2K7DA 2ZFDA 5CSFA 1NWDA 1KQMB 1J7RA 4OVNF 1DVIA 1OOJA 1DJZA 2M7LA 2KSPA 1PSRA 1U5IB 1J1EA 2DOQA 4MZJA 1WLMA 1BODA 4HRGA 1DF0A 1V1FA 1QTXA 1K2HA 2WORA 2I18A 2LVJA 4C0LA 2D8NA 1S1EA 1Y6WA 1CDLA 1JF2A 3CS1A 4JQ0D 2E6WA 5BPJA 2WNDA 2CTNA 3FWBA 1GGZA 1C07A 2TN4A 1FF1A 3O2PA 3BUOB 3TUYC 5K89A 3MSEB 3JVTB 1SBJA 2EC6B 2LP2A 4I5JA 1K90D 1FBVA 4ZCUA 1DJGA 2P6BB 1NCXA 1S3PA 3OX6A 1LXFC 1GJYA 2JWWA 1CKKA 5HKZA 1MR8A 1FI5A 2KI4C 1Q80A 2AMIA 2F2OA 4P5OE 2EC6C 3PM8A 2E30A 1YVLA 2HF5A 3DVJA 4A4CA 2LC5A 1PULA 3TZ1A 1RK9A 5I2QA 3PN7B 4NDBA 2H61A 2QPTA 3IQOA 3SIAA 4M2QA 5F6TA 1BLQA 1AP4A 1F4QA 2JC2A 1B7TZ 5HLOA 2CBLA 1DMOA 4MRYA 2KI6C 4PHMA 1IJ5A 4IL1A 1A75A 3DVKA 2L5XB 1G4YR 1Y1AA 1XFWO 1XA5A 2ISDA 3TDIA 2LNKA 3I5GB 1UWOA 2MLEC 2M1KB 2NCOA 1CMFA 4I5NB 3NSIA 4ORAB 1PVAA 2NZ0A 2KYFA 2K7BA 3EK4A 2K2FA 1MQ1A 1BU3A 2R2IA 1N0YA 1NIWA 1XFXO 1CMGA 1YX7A 2VRGA 1UHJA 1CM1A 1GQMA 2JTZA 1KFXS 3EVVA 2KHNA 3BUWB 4YI8A 5HLVA 5B8IB 1JFJA 1CDMA 3PFVA 2KQ6A 4I5LB 4MSPA 2EHBA 2KGRA 1SL7A 2JT3A 1SNLA 3OP0A 3CR4X 2F3ZA 4YGAA 5G08A 2FCEA 2G2BA 2KQYA 1KFUS 2M0RA 1CLLA 3BYAA 1BR1B 1KK7Z 1DJIA 3SJSA 1S5GY 3D10A 1BG1A 1NUBA 3AKAA 2IS9A 5CPVA 2AAOA 4BY4A 1F8HA 1KWOC 1ZACA 2NLNA 2CT9A 3QRXA 1Y1XA 2A4JA 4MZLA 2JRFA 3I5IC 3FS7A 5IBWA 2BCAA 1SCVA 1NCYA 1ZUZA 5AFPA 1IKUA 1H4BA 1RJVA 4GGFC 4ORCB 2KAVA 3E3RA 3AAKA 3VRRA 1TTXA 1A03A 1L2OB 1TNWA 1TRFA 1SK6D 1MWNA 1QLKA 3PSRA 1A2XA 1N65A 2LMTA 1QV0A 1LINA 1CFFA 1RWYA 1K93D 1YTZC 3I5HC 1WDCB 1KCYA 2M97A 1KQVA 4R1EA 1L2OC 5FYXA 2L50A 4ETOA 2WCEA 1NX1A 5HKYA 4OCIA 2GGZA 5KTYA 1PK0D 1CDNA 4WQ2A 2LMUA 3IF7A 4P2YB 1IQ5A 4C0JA 4DUQA 3D0YA 4DIRA 1S6CA 2PSRA 2JXLA 1JFKA 2JT8A 1SMGA 2LAPA 1B1GA 1IH0A 1DF0B 2LUXA 4FQOA 1J7PA 4CFRA 5GQQC 2MAZA 1XVJA 3DD4A 1C7WA 4WRIA 1WY9A 1QVIZ 1QX7A 2KFHA 1NSHA 3ZWHA 1B8LA 2KDHA 3SIBA 1MHOA 2FJUB 2ZNEA 4L9MA 3CGAA 3FIAA 4CPVA 4YGDB 1CB1A 3TUYB 2ZRSA 4C0KA 3WXAA 3RM1A 2M1UA 1WRLA 4NQGA 3DF0B 4YGEB 1Y0VH 1ALVA 2WC8A 1NX0A 1ALWA 1JF0A 1CM4A 4PCWA 4YGBB 2BKIB 1L7ZA 4XJKA 2KI4B 1MF8B 2LE9B 1M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPO A;  4A4B A;  1XYD A;  1C7V A;  5CSI A;  1K9P A;  3KEV A;  2KFG A;  1CFP A;  4GFT A;  5DKN A;  4DS7 A;  2K0J A;  2Y1M A;  3DVM A;  2JZI A;  1IG5 A;  2LUC A;  2LVK A;  1QLS A;  3SG6 A;  1LA3 A;  4PE1 A;  1H8B A;  3K21 A;  3BXK A;  4USL A;  3SG5 A;  4XYN A;  1X02 A;  1CLM A;  1A4P A;  3HX4 A;  3IQQ A;  1VRK A;  2F33 A;  1U5I A;  1YR5 A;  1KK8 B;  2MJW B;  2H61 C;  1BJF A;  3BUX B;  3RLZ A;  1A75 B;  1UHH A;  2QAC A;  2SAS A;  4MRX A;  4ZCV A;  1QAS A;  1XO5 A;  1LA0 A;  2BCB A;  4GNK B;  2M3W A;  2MHH A;  2GGM A;  3OX5 A;  2JTT A;  4PE7 A;  1KK8 C;  3BOW B;  3GK2 A;  1ODB A;  2Q4U A;  5I8N A;  1OMD A;  3EKH A;  1CTR A;  1TOP A;  3HCM A;  3LK1 A;  1E8A A;  1RTP 1;  1NP8 A;  1J7O A;  4DRW A;  1SL8 A;  2WCF A;  2L51 A;  3LK0 A;  1B4C A;  4UPG A;  1XFY O;  2LV7 A;  1SY9 A;  2ZN8 A;  1CDP A;  2JXC A;  2H2K A;  3EVR A;  5I2O A;  1DGV A;  2KNE A;  2CCM A;  2L2E A;  1BF5 A;  3VRQ A;  1UHI A;  4N5X A;  1NCZ A;  3M0W A;  1OE9 B;  2M49 B;  4U8D A;  1B47 A;  1JBA A;  5TNC A;  4CFQ A;  5D69 A;  1AJ5 A;  1HQV A;  1KWO B;  3LCP C;  3O4Y A;  4HRE E;  1SRA A;  2Q91 A;  1NX3 A;  1K8U A;  5AER A;  1BT6 A;  3I5I B;  3PAT A;  2BL0 C;  3AKB A;  2HQW A;  1M31 A;  1MUX A;  3OB1 B;  1AUI B;  2LHI A;  1Y1U A;  1KSO A;  2L4I A;  1SCM C;  2M7N A;  4PHJ A;  1TN4 A;  2SCP A;  2JNF A;  1YUT A;  4N1F A;  1YUU A;  3CLN A;  1R2U A;  3TS5 C;  2FOT A;  3I5H B;  4F0Z B;  3I5F C;  1CFC A;  2BBN A;  4MN0 A;  1CLB A;  2HPS A;  3OB2 B;  3SG7 A;  1EG4 A;  4OKH A;  2AUC A;  1NPQ A;  4I5K A;  1M39 A;  3BUM B;  2M8U A;  2LM5 A;  1UP5 A;  1K9U A;  1J55 A;  5D7F A;  3TDZ A;  2JNX A;  1SYM A;  1M63 B;  1N2D A;  2LVI A;  1FW4 A;  3NSL A;  5CSJ A;  3JTD C;  1K9K A;  3H4S E;  2LP3 A;  1XFV O;  4M2P A;  2MBX A;  4JWQ A;  3BUN B;  3VRP A;  2JU0 A;  1TIZ A;  2OTG C;  2KAX A;  3KO0 A;  2K7O A;  2JPT A;  3BQ3 A;  1AJ4 A;  1LVC D;  2NCP A;  2KBI A;  1K96 A;  2WOS A;  1S36 A;  4YBH B;  5KSZ A;  4MBE A;  2COL B;  4Q04 A;  1SW8 A;  1IGV A;  1PAL A;  1S6J A;  2WCB A;  3CZT X;  3EK8 A;  1W7J B;  2I7A A;  2LLS A;  4M2O A;  2O60 A;  4QJ4 B;  2I94 A;  3O78 A;  4YI9 A;  1WRZ A;  1S5G Z;  1K94 A;  2KBM A;  3ICB A;  3NSO A;  4MZK A;  1YUR A;  3CWG A;  1JUO A;  1PRW A;  1XK4 A;  1EL4 A;  1EXR A;  1S26 D;  3FWC A;  4NDD A;  1AVS A;  2PVB A;  1B7T Y;  1SL9 A;  3PLF B;  1DGU A;  2BCX A;  4PHK A;  2LAN A;  2LCP A;  2ZN9 A;  4N1G A;  1R6P A;  3EK7 A;  1SR6 C;  1TNP A;  2EGD A;  1BOC A;  1B8R A;  1XFZ O;  3WHU B;  1AK8 A;  2HET A;  1G33 A;  1REC A;  4QJ3 B;  2JOJ A;  1F4O A;  1XFU O;  5AXI A;  1KFX L;  1QIW A;  1IJ6 A;  1YVH A;  1KQM C;  4ORB B;  3VRO A;  3A8R A;  4D1E A;  1WLZ A;  3O6B A;  3EVU A;  4AQI A;  2K61 A;  4E68 A;  2ZRT A;  1TNQ A;  1QX2 A;  4QJ5 B;  1KFU L;  1DJW A;  1OSA A;  5AAN A;  5HKW A;  1DJX A;  1MXL C;  1RFJ A;  2LLT A;  4MVF A;  2Y5I A;  1IWQ A;  2F3Y A;  2KFF A;  3DF0 A;  1FI6 A;  3WNX B;  5PAL A;  1CNP A;  1KK7 Y;  4ICB A;  4PE0 A;  2K8M B;  1OZS A;  2LLU A;  1FPW A;  1W7I B;  3GK1 A;  4JPZ B;  1WRK A;  2PMY A;  1HT9 A;  1S6I A;  1YX8 A;  2HQ8 A;  3JVT C;  1UUR A;  1F71 A;  1EJ3 A;  2BE4 A;  2K7C A;  3DVE A;  1QXP A;  1TCO B;  4CLN A;  4OR9 B;  1MXE A;  1J7Q A;  4PE4 A;  2JT0 A;  2OS8 B;  3VGO A;  1PVB A;  2JUL A;  2M9G A;  1OMV A;  2FCD A;  2NXQ A;  2I2R E;  1LKJ A;  1UHN A;  2RGI A;  1GGW A;  4PDZ A;  4GPL B;  5I2L A;  2KYC A;  3OHM B;  3GK4 X;  3PN7 C;  1IRJ A;  2BL0 B;  3LL8 B;  2OS8 C;  1ZOT B;  2PAS A;  1M45 A;  4HRH A;  2L4H A;  3KPX A;  4BY5 A;  1OZO A;  1F54 A;  2MLF C;  2V53 A;  1SCM B;  1QS7 A;  2BE6 A;  5JOL A;  1JSA A;  2BBM A;  4MLW A;  1G8I A;  5DKR A;  1J1D A;  2KAY A;  3BOW A;  5JJG A;  1DJY A;  3TS5 B;  2LMV A;  3AAJ A;  4GUK A;  1CFD A;  4PAL A;  3I5F B;  2JQ6 A;  1QIV A;  4HSZ A;  3NSK A;  4OV2 A;  5ER5 A;  2O5G A;  1B8C A;  3I5G C;  4NDC A;  1NX2 A;  3SG3 A;  3PAL A;  3C1V A;  2PRU A;  5ER4 X;  2M29 A;  2PAL A;  1UUS A;  1QJT A;  4FTG A;  1YRU B;  1QVI Y;  3F45 A;  4GGN A;  1DTL A;  4YRU A;  3JTD B;  1YRT B;  2L0P A;  1F55 A;  1EG3 A;  1NYA A;  1TNX A;  1RRO A;  3D0Y B;  4YGC B;  1QAT A;  2OTG B;  2K2A A;  2KGB C;  1KSM A;  4GAO A;  3WHT B;  4AOM A;  1D1O A;  2F2P A;  3LLE A;  1A29 A;  3VRN A;  1SKT A;  1OMR A;  1F70 A;  2GV5 A;  1B9A A;  1IQ3 A;  2B1U A;  2BKH B;  5HYD A;  3A4U B;  3GOF A;  2LHL A;  1UHK A;  2BEC A;  2CNP A;  4GGF A;  4DCK A;  1QX5 B;  5J3X A;  1JWD A;  1SPY A;  2ZND A;  4PHN A;  2KOT A;  2L98 A;  1BMO A;  5CSN A;  1BR4 B;  2G9B A;  1K95 A;  2MRD A;  1DJH A;  1V1G A;  4CID A;  2MA2 A;  2CXJ A;  3KHE A;  1DT7 B;  1ZFS A;  1OQP A;  5KU1 A;  3CR5 X;  1PSB A;  4GBA A;  2LVV A;  2ZKM X;  1QV1 A;  4XJK B;  2F8P A;  5DKQ A;  3TDU A;  2KI6 D;  2Y4Q A;  3KF9 A;  4WQ3 A;  4AQJ A;  1XK4 C;  1SR6 B;  1ZMZ A;  1TCF A;  1WDC C;  3CTN A;  3NXA A;  4TNC A;  3ZNI A;  1JC2 A;  3SG2 A;  3CR2 A;  1YUS A;  3SG4 A;  1EH2 A;  4MEW A;  3EKJ A;  1AHR A;  5AEQ A;  2Y1N A;  2K7D A;  2ZFD A;  5CSF A;  1NWD A;  1KQM B;  1J7R A;  4OVN F;  1DVI A;  1OOJ A;  1DJZ A;  2M7L A;  2KSP A;  1PSR A;  1U5I B;  1J1E A;  2DOQ A;  4MZJ A;  1WLM A;  1BOD A;  4HRG A;  1DF0 A;  1V1F A;  1QTX A;  1K2H A;  2WOR A;  2I18 A;  2LVJ A;  4C0L A;  2D8N A;  1S1E A;  1Y6W A;  1CDL A;  1JF2 A;  3CS1 A;  4JQ0 D;  2E6W A;  5BPJ A;  2WND A;  2CTN A;  3FWB A;  1GGZ A;  1C07 A;  2TN4 A;  1FF1 A;  3O2P A;  3BUO B;  3TUY C;  5K89 A;  3MSE B;  3JVT B;  1SBJ A;  2EC6 B;  2LP2 A;  4I5J A;  1K90 D;  1FBV A;  4ZCU A;  1DJG A;  2P6B B;  1NCX A;  1S3P A;  3OX6 A;  1LXF C;  1GJY A;  2JWW A;  1CKK A;  5HKZ A;  1MR8 A;  1FI5 A;  2KI4 C;  1Q80 A;  2AMI A;  2F2O A;  4P5O E;  2EC6 C;  3PM8 A;  2E30 A;  1YVL A;  2HF5 A;  3DVJ A;  4A4C A;  2LC5 A;  1PUL A;  3TZ1 A;  1RK9 A;  5I2Q A;  3PN7 B;  4NDB A;  2H61 A;  2QPT A;  3IQO A;  3SIA A;  4M2Q A;  5F6T A;  1BLQ A;  1AP4 A;  1F4Q A;  2JC2 A;  1B7T Z;  5HLO A;  2CBL A;  1DMO A;  4MRY A;  2KI6 C;  4PHM A;  1IJ5 A;  4IL1 A;  1A75 A;  3DVK A;  2L5X B;  1G4Y R;  1Y1A A;  1XFW O;  1XA5 A;  2ISD A;  3TDI A;  2LNK A;  3I5G B;  1UWO A;  2MLE C;  2M1K B;  2NCO A;  1CMF A;  4I5N B;  3NSI A;  4ORA B;  1PVA A;  2NZ0 A;  2KYF A;  2K7B A;  3EK4 A;  2K2F A;  1MQ1 A;  1BU3 A;  2R2I A;  1N0Y A;  1NIW A;  1XFX O;  1CMG A;  1YX7 A;  2VRG A;  1UHJ A;  1CM1 A;  1GQM A;  2JTZ A;  1KFX S;  3EVV A;  2KHN A;  3BUW B;  4YI8 A;  5HLV A;  5B8I B;  1JFJ A;  1CDM A;  3PFV A;  2KQ6 A;  4I5L B;  4MSP A;  2EHB A;  2KGR A;  1SL7 A;  2JT3 A;  1SNL A;  3OP0 A;  3CR4 X;  2F3Z A;  4YGA A;  5G08 A;  2FCE A;  2G2B A;  2KQY A;  1KFU S;  2M0R A;  1CLL A;  3BYA A;  1BR1 B;  1KK7 Z;  1DJI A;  3SJS A;  1S5G Y;  3D10 A;  1BG1 A;  1NUB A;  3AKA A;  2IS9 A;  5CPV A;  2AAO A;  4BY4 A;  1F8H A;  1KWO C;  1ZAC A;  2NLN A;  2CT9 A;  3QRX A;  1Y1X A;  2A4J A;  4MZL A;  2JRF A;  3I5I C;  3FS7 A;  5IBW A;  2BCA A;  1SCV A;  1NCY A;  1ZUZ A;  5AFP A;  1IKU A;  1H4B A;  1RJV A;  4GGF C;  4ORC B;  2KAV A;  3E3R A;  3AAK A;  3VRR A;  1TTX A;  1A03 A;  1L2O B;  1TNW A;  1TRF A;  1SK6 D;  1MWN A;  1QLK A;  3PSR A;  1A2X A;  1N65 A;  2LMT A;  1QV0 A;  1LIN A;  1CFF A;  1RWY A;  1K93 D;  1YTZ C;  3I5H C;  1WDC B;  1KCY A;  2M97 A;  1KQV A;  4R1E A;  1L2O C;  5FYX A;  2L50 A;  4ETO A;  2WCE A;  1NX1 A;  5HKY A;  4OCI A;  2GGZ A;  5KTY A;  1PK0 D;  1CDN A;  4WQ2 A;  2LMU A;  3IF7 A;  4P2Y B;  1IQ5 A;  4C0J A;  4DUQ A;  3D0Y A;  4DIR A;  1S6C A;  2PSR A;  2JXL A;  1JFK A;  2JT8 A;  1SMG A;  2LAP A;  1B1G A;  1IH0 A;  1DF0 B;  2LUX A;  4FQO A;  1J7P A;  4CFR A;  5GQQ C;  2MAZ A;  1XVJ A;  3DD4 A;  1C7W A;  4WRI A;  1WY9 A;  1QVI Z;  1QX7 A;  2KFH A;  1NSH A;  3ZWH A;  1B8L A;  2KDH A;  3SIB A;  1MHO A;  2FJU B;  2ZNE A;  4L9M A;  3CGA A;  3FIA A;  4CPV A;  4YGD B;  1CB1 A;  3TUY B;  2ZRS A;  4C0K A;  3WXA A;  3RM1 A;  2M1U A;  1WRL A;  4NQG A;  3DF0 B;  4YGE B;  1Y0V H;  1ALV A;  2WC8 A;  1NX0 A;  1ALW A;  1JF0 A;  1CM4 A;  4PCW A;  4YGB B;  2BKI B;  1L7Z A;  4XJK A;  2KI4 B;  1MF8 B;  2LE9 B;  1M46 A; 
#chains in the Genus database with same CATH topology
 2OPO A;  4A4B A;  1XYD A;  1C7V A;  5CSI A;  1K9P A;  3KEV A;  2KFG A;  1CFP A;  4GFT A;  5DKN A;  4DS7 A;  2K0J A;  2Y1M A;  3DVM A;  2JZI A;  1IG5 A;  2LUC A;  2LVK A;  1QLS A;  3SG6 A;  1LA3 A;  4PE1 A;  1H8B A;  3K21 A;  3BXK A;  3Q8I A;  4USL A;  3SG5 A;  4XYN A;  1X02 A;  1CLM A;  1A4P A;  3HX4 A;  3IQQ A;  1VRK A;  3S0F A;  3B6X A;  2F33 A;  1U5I A;  1YR5 A;  1KK8 B;  2MJW B;  2H61 C;  1BJF A;  3BUX B;  3RLZ A;  1A75 B;  1UHH A;  2QAC A;  2SAS A;  3R72 A;  4MRX A;  4ZCV A;  1QAS A;  1XO5 A;  1LA0 A;  2BCB A;  4GNK B;  2M3W A;  2MHH A;  2GGM A;  3OX5 A;  2JTT A;  4PE7 A;  1KK8 C;  3BOW B;  3GK2 A;  1ODB A;  3OGN A;  5I94 A;  2Q4U A;  5I8N A;  1OMD A;  3EKH A;  1CTR A;  3B88 A;  1TOP A;  3HCM A;  3LK1 A;  1E8A A;  1RTP 1;  1NP8 A;  1J7O A;  4DRW A;  1SL8 A;  2WCF A;  2L51 A;  3SS4 A;  1XFR A;  3LK0 A;  1B4C A;  4UPG A;  1XFY O;  2LV7 A;  1SY9 A;  2ZN8 A;  1CDP A;  2JXC A;  2H2K A;  3EVR A;  1Z2C B;  5I2O A;  1DGV A;  2KNE A;  2CCM A;  2BNX A;  2L2E A;  1C3Y A;  1BF5 A;  3VRQ A;  1UHI A;  3B7A A;  4N5X A;  1NCZ A;  3M0W A;  1OE9 B;  3RZS A;  2M49 B;  4U8D A;  1B47 A;  1JBA A;  5TNC A;  4CFQ A;  5D69 A;  1AJ5 A;  1HQV A;  1KWO B;  3LCP C;  3O4Y A;  4HRE E;  1OOH A;  1SRA A;  2Q91 A;  1NX3 A;  2KPH A;  1K8U A;  2QEB A;  3D74 A;  5AER A;  2WCJ A;  1BT6 A;  3I5I B;  3CYZ A;  1T14 A;  3PAT A;  2BL0 C;  3AKB A;  2HQW A;  1M31 A;  1MUX A;  3OB1 B;  3IVT A;  1P28 A;  1AUI B;  2LHI A;  1Y1U A;  1KSO A;  2L4I A;  3NHI A;  1SCM C;  2M7N A;  4PHJ A;  1TN4 A;  2SCP A;  2JNF A;  2WCM A;  1YUT A;  4N1F A;  1YUU A;  3CLN A;  1R2U A;  3TS5 C;  2FOT A;  3I5H B;  4F0Z B;  3I5F C;  1CFC A;  2BBN A;  4MN0 A;  1CLB A;  3BJH A;  2HPS A;  3OB2 B;  2GTE A;  1EG4 A;  4OKH A;  3SG7 A;  2BAP A;  3SS5 A;  2AUC A;  2WCL A;  1NPQ A;  4I5K A;  1M39 A;  3BUM B;  2M8U A;  2LM5 A;  1UP5 A;  4PT1 A;  1K9U A;  1J55 A;  5D7F A;  3TDZ A;  2JNX A;  1SYM A;  1M63 B;  1N2D A;  2LVI A;  1FW4 A;  1TWO A;  3NSL A;  5CSJ A;  3JTD C;  1K9K A;  3H4S E;  2LP3 A;  1XFV O;  4M2P A;  2MBX A;  4JWQ A;  3BUN B;  3VRP A;  2JU0 A;  1TIZ A;  2OTG C;  2KAX A;  3KO0 A;  2K7O A;  2JPT A;  2KLD A;  3BQ3 A;  1AJ4 A;  1LVC D;  2NCP A;  2PQL A;  3O4X A;  2KBI A;  1K96 A;  2WOS A;  1S36 A;  4YBH B;  5KSZ A;  1DEL A;  4MBE A;  2COL B;  4Q04 A;  2WC6 A;  1SW8 A;  1IGV A;  1PAL A;  1S6J A;  2WCB A;  3CZT X;  3EK8 A;  1W7J B;  2I7A A;  2LLS A;  4M2O A;  2O60 A;  2QEV A;  4QJ4 B;  2I94 A;  3O78 A;  4YI9 A;  1WRZ A;  1GM0 A;  1S5G Z;  1K94 A;  2KBM A;  2WCH A;  3ICB A;  3NSO A;  1YUR A;  2QEO A;  3CWG A;  4MZK A;  4OZD A;  3UO9 A;  1JUO A;  1PRW A;  1XK4 A;  1EL4 A;  1EXR A;  1C3Z A;  1S26 D;  3FWC A;  4NDD A;  1AVS A;  2PVB A;  1B7T Y;  1SL9 A;  3PLF B;  1TUZ A;  1DGU A;  2BCX A;  4PHK A;  2LAN A;  2LCP A;  2ZN9 A;  4N1G A;  1R6P A;  3EK7 A;  1SR6 C;  2FJY A;  1TNP A;  2EGD A;  1BOC A;  1B8R A;  1XFZ O;  3WHU B;  1AK8 A;  2HET A;  1G33 A;  1REC A;  3EG5 B;  4QJ3 B;  2JOJ A;  1F4O A;  1XFU O;  5AXI A;  1KFX L;  1QIW A;  1IJ6 A;  1YVH A;  1KQM C;  3CZ0 A;  4ORB B;  3VRO A;  3A8R A;  4D1E A;  1WLZ A;  3O6B A;  3EVU A;  4AQI A;  2K61 A;  4E68 A;  2ZRT A;  1TNQ A;  1QX2 A;  3NHT A;  1KFU L;  1DJW A;  1OSA A;  4QJ5 B;  5AAN A;  5HKW A;  1DJX A;  1MXL C;  1RFJ A;  2LLT A;  4MVF A;  2Y5I A;  1IWQ A;  2F3Y A;  2KFF A;  3DF0 A;  1FI6 A;  3WNX B;  5PAL A;  3L4L A;  1CNP A;  3OBV A;  1KK7 Y;  3QME A;  4ICB A;  4PE0 A;  2K8M B;  1OZS A;  2LLU A;  1FPW A;  1W7I B;  3GK1 A;  1ORG A;  4JPZ B;  1WRK A;  2PMY A;  1HT9 A;  1S6I A;  1YX8 A;  2HQ8 A;  3JVT C;  1UUR A;  1F71 A;  1EJ3 A;  2BE4 A;  2K7C A;  3DVE A;  4INW A;  1QXP A;  1TCO B;  4CLN A;  4OR9 B;  1MXE A;  1J7Q A;  4PE4 A;  2JT0 A;  2OS8 B;  2K60 A;  3VGO A;  1PVB A;  2JUL A;  2M9G A;  1OMV A;  2FCD A;  2L2C A;  2NXQ A;  2I2R E;  1LKJ A;  1UHN A;  2RGI A;  4JD9 A;  4PDZ A;  1GGW A;  4GPL B;  5I2L A;  5HL1 A;  2KYC A;  3OHM B;  3GK4 X;  3PN7 C;  1IRJ A;  2BL0 B;  3PJI A;  3LL8 B;  2OS8 C;  1DQE A;  1ZOT B;  2PAS A;  1M45 A;  3DY9 A;  4HRH A;  2L4H A;  3KPX A;  3CAB A;  4BY5 A;  1OZO A;  1F54 A;  2MLF C;  2V53 A;  1SCM B;  1QS7 A;  2BE6 A;  5JOL A;  1JSA A;  2BBM A;  4MLW A;  1G8I A;  3SS3 A;  5DKR A;  1J1D A;  2KAY A;  3BOW A;  5JJG A;  1DJY A;  3TS5 B;  2LMV A;  1DEK A;  3AAJ A;  1CFD A;  4GUK A;  4PAL A;  3I5F B;  2JQ6 A;  1QIV A;  4HSZ A;  3NSK A;  4OV2 A;  5ER5 A;  2O5G A;  1B8C A;  3I5G C;  4NDC A;  1NX2 A;  2YGU A;  3PAL A;  3C1V A;  3SG3 A;  2PRU A;  5ER4 X;  5FI6 A;  2M29 A;  2PAL A;  1UUS A;  1QJT A;  4FTG A;  1YRU B;  1QVI Y;  3F45 A;  4GGN A;  3DZT A;  5D3O A;  1DTL A;  4YRU A;  3JTD B;  1YRT B;  3S0B A;  2L0P A;  1F55 A;  3FE8 A;  1EG3 A;  5FI2 A;  1NYA A;  1TNX A;  3UNW A;  1RRO A;  3D0Y B;  4YGC B;  3FE6 A;  1QAT A;  2OTG B;  2K2A A;  2KGB C;  1KSM A;  4GAO A;  3WHT B;  4AOM A;  1D1O A;  2F2P A;  3LLE A;  1A29 A;  3VRN A;  1SKT A;  1OMR A;  2JPO A;  1F70 A;  4INX A;  2GV5 A;  1B9A A;  1IQ3 A;  2B1U A;  2BKH B;  5HYD A;  3A4U B;  4IJ7 A;  3GOF A;  2LHL A;  1UHK A;  2BEC A;  3S0G A;  2CNP A;  2H8V A;  4GGF A;  4DCK A;  1QX5 B;  5J3X A;  1JWD A;  1SPY A;  2ZND A;  1LS8 A;  4PHN A;  2KOT A;  2L98 A;  3DXL A;  1BMO A;  5CSN A;  1BR4 B;  2G9B A;  1K95 A;  2MRD A;  1DJH A;  1V1G A;  4CID A;  3S0D A;  2MA2 A;  2CXJ A;  3KHE A;  1DT7 B;  1ZFS A;  1OQP A;  5KU1 A;  3CR5 X;  1PSB A;  1OOI X;  4GBA A;  2LVV A;  2ZKM X;  1QV1 A;  3PM2 A;  4XJK B;  2F8P A;  5DKQ A;  3TDU A;  2KI6 D;  2Y4Q A;  2L5Y A;  3KF9 A;  4WQ3 A;  4AQJ A;  3D76 A;  1XK4 C;  3VB1 A;  3CZ2 A;  1SR6 B;  1ZMZ A;  1TCF A;  1WDC C;  3CTN A;  3NXA A;  4TNC A;  3ZNI A;  3BFH A;  1JC2 A;  3SG2 A;  3CR2 A;  1YUS A;  3SG4 A;  1EH2 A;  4MEW A;  3EKJ A;  1AHR A;  5AEQ A;  2Y1N A;  2K7D A;  2ZFD A;  5CSF A;  1NWD A;  4F7F A;  1KQM B;  1J7R A;  3R1O A;  1OW4 A;  1DVI A;  1OOJ A;  1DJZ A;  4OVN F;  4FQT A;  2M7L A;  2KSP A;  1PSR A;  2P70 A;  1U5I B;  1J1E A;  2DOQ A;  4MZJ A;  1WLM A;  1BOD A;  4HRG A;  1DF0 A;  1V1F A;  1QTX A;  1K2H A;  2WOR A;  2I18 A;  2LVJ A;  3K1E A;  4C0L A;  2D8N A;  1S1E A;  3DYE A;  1Y6W A;  1CDL A;  1JF2 A;  3CS1 A;  4JQ0 D;  2E6W A;  2P71 A;  5BPJ A;  2WND A;  2CTN A;  3FWB A;  1GGZ A;  3S0A A;  1C07 A;  2WCK A;  2TN4 A;  1FF1 A;  3O2P A;  3BUO B;  3TUY C;  5K89 A;  3MSE B;  3JVT B;  1SBJ A;  2EC6 B;  2LP2 A;  4I5J A;  1K90 D;  1FBV A;  4ZCU A;  1DJG A;  2P6B B;  1NCX A;  1S3P A;  3OX6 A;  1W9Z A;  1LXF C;  1GJY A;  2JWW A;  1CKK A;  3CDN A;  5HKZ A;  1MR8 A;  1FI5 A;  2KI4 C;  1Q80 A;  2AMI A;  2F2O A;  4P5O E;  2EC6 C;  3PM8 A;  2E30 A;  1YVL A;  2HF5 A;  3DVJ A;  4A4C A;  2LC5 A;  1PUL A;  3D78 A;  3TZ1 A;  1RK9 A;  5I2Q A;  3PN7 B;  4NDB A;  2H61 A;  2QPT A;  3IQO A;  3SIA A;  4M2Q A;  5F6T A;  1BLQ A;  4JKT A;  1AP4 A;  1F4Q A;  2JC2 A;  3BFA A;  1B7T Z;  5HLO A;  5FI7 A;  3D73 A;  2CBL A;  1DMO A;  4MRY A;  1OOG A;  2KI6 C;  4PHM A;  1IJ5 A;  4IL1 A;  1Z4H A;  1A75 A;  3DVK A;  2L5X B;  1G4Y R;  1Y1A A;  1XFW O;  1XA5 A;  2ISD A;  3V2L A;  3TDI A;  2LNK A;  3I5G B;  1DC1 A;  1UWO A;  2MLE C;  2M1K B;  2NCO A;  5DIC A;  1CMF A;  4I5N B;  3NSI A;  4ORA B;  1PVA A;  2NZ0 A;  3FE9 A;  2KYF A;  2K7B A;  3EK4 A;  2K2F A;  1MQ1 A;  1BU3 A;  2R2I A;  1N0Y A;  1NIW A;  1XFX O;  1CMG A;  1YX7 A;  2VRG A;  1UHJ A;  1CM1 A;  1GQM A;  2JTZ A;  1KFX S;  3EVV A;  2KHN A;  3BUW B;  4YI8 A;  5HLV A;  5B8I B;  1JFJ A;  1CDM A;  3PFV A;  2KQ6 A;  4I5L B;  4MSP A;  2EHB A;  2KGR A;  1SL7 A;  2JT3 A;  1SNL A;  3OP0 A;  3CR4 X;  2F3Z A;  4YGA A;  5G08 A;  2FCE A;  2G2B A;  2KQY A;  1KFU S;  2M0R A;  1CLL A;  2PYQ A;  3BYA A;  1BR1 B;  1KK7 Z;  1DJI A;  3S0E A;  2ERB A;  3SJS A;  1S5G Y;  3CZ1 A;  3D10 A;  1BG1 A;  1NUB A;  3AKA A;  2IS9 A;  5CPV A;  2AAO A;  4BY4 A;  1F8H A;  1KWO C;  1ZAC A;  2QEH A;  3L4A A;  3R1V A;  2NLN A;  2CT9 A;  3QRX A;  1Y1X A;  2A4J A;  3BFB A;  4MZL A;  2JRF A;  3I5I C;  3FS7 A;  5IBW A;  2BCA A;  1SCV A;  1NCY A;  1ZUZ A;  1QWV A;  2KLE A;  5AFP A;  1RJV A;  1TUJ A;  4GGF C;  4ORC B;  1IKU A;  2KAV A;  3E3R A;  1H4B A;  3AAK A;  3VRR A;  1TTX A;  1A03 A;  3N7H A;  1IIO A;  1L2O B;  1TNW A;  1TRF A;  1SK6 D;  1MWN A;  1QLK A;  3PSR A;  1A2X A;  1N65 A;  2LMT A;  1QV0 A;  1LIN A;  1CFF A;  1RWY A;  3L47 A;  3D75 A;  1K93 D;  1YTZ C;  3I5H C;  1WDC B;  3B86 A;  1KCY A;  2M97 A;  1KQV A;  4R1E A;  1L2O C;  5FYX A;  2L50 A;  3B87 A;  2WCE A;  1NX1 A;  4ETO A;  4OCI A;  2GGZ A;  5HKY A;  5KTY A;  1PK0 D;  2WC5 A;  1CDN A;  4WQ2 A;  2LMU A;  3IF7 A;  4P2Y B;  1SSE B;  1IQ5 A;  4C0J A;  5EL2 A;  4DUQ A;  3D0Y A;  4DIR A;  1S6C A;  2PSR A;  4KYN A;  2JXL A;  1JFK A;  2JT8 A;  1SMG A;  2LAP A;  1B1G A;  1IH0 A;  1DF0 B;  2LUX A;  4FQO A;  1J7P A;  4CFR A;  5GQQ C;  2MAZ A;  2QDI A;  1XVJ A;  3DD4 A;  1C7W A;  4WRI A;  1WY9 A;  1QVI Z;  1QX7 A;  2KFH A;  1NSH A;  3ZWH A;  3R1P A;  1B8L A;  2KDH A;  3SIB A;  1MHO A;  2FJU B;  2ZNE A;  4L9M A;  3CGA A;  3FIA A;  3D77 A;  4CPV A;  4YGD B;  1CB1 A;  3TUY B;  2ZRS A;  4C0K A;  3WXA A;  3RM1 A;  2M1U A;  1OOF A;  1WRL A;  4NQG A;  3DF0 B;  4YGE B;  1Y0V H;  1ALV A;  2WC8 A;  1NX0 A;  1ALW A;  1JF0 A;  1CM4 A;  4PCW A;  4YGB B;  2BKI B;  3NGV A;  1L7Z A;  4XJK A;  2KI4 B;  1MF8 B;  2LE9 B;  1M46 A; 
#chains in the Genus database with same CATH homology
 2OPO A;  4A4B A;  1XYD A;  1C7V A;  5CSI A;  1K9P A;  3KEV A;  2KFG A;  1CFP A;  4GFT A;  5DKN A;  4DS7 A;  2K0J A;  2Y1M A;  3DVM A;  2JZI A;  1IG5 A;  2LUC A;  2LVK A;  1QLS A;  3SG6 A;  1LA3 A;  4PE1 A;  1H8B A;  3K21 A;  3BXK A;  4USL A;  3SG5 A;  4XYN A;  1X02 A;  1CLM A;  1A4P A;  3HX4 A;  3IQQ A;  1VRK A;  2F33 A;  1U5I A;  1YR5 A;  1KK8 B;  2MJW B;  2H61 C;  1BJF A;  3BUX B;  3RLZ A;  1A75 B;  1UHH A;  2QAC A;  2SAS A;  4MRX A;  4ZCV A;  1QAS A;  1XO5 A;  1LA0 A;  2BCB A;  4GNK B;  2M3W A;  2MHH A;  2GGM A;  3OX5 A;  2JTT A;  4PE7 A;  1KK8 C;  3BOW B;  3GK2 A;  1ODB A;  2Q4U A;  5I8N A;  1OMD A;  3EKH A;  1CTR A;  1TOP A;  3HCM A;  3LK1 A;  1E8A A;  1RTP 1;  1NP8 A;  1J7O A;  4DRW A;  1SL8 A;  2WCF A;  2L51 A;  3LK0 A;  1B4C A;  4UPG A;  1XFY O;  2LV7 A;  1SY9 A;  2ZN8 A;  1CDP A;  2JXC A;  2H2K A;  3EVR A;  5I2O A;  1DGV A;  2KNE A;  2CCM A;  2L2E A;  1BF5 A;  3VRQ A;  1UHI A;  4N5X A;  1NCZ A;  3M0W A;  1OE9 B;  2M49 B;  4U8D A;  1B47 A;  1JBA A;  5TNC A;  4CFQ A;  5D69 A;  1AJ5 A;  1HQV A;  1KWO B;  3LCP C;  3O4Y A;  4HRE E;  1SRA A;  2Q91 A;  1NX3 A;  1K8U A;  5AER A;  1BT6 A;  3I5I B;  3PAT A;  2BL0 C;  3AKB A;  2HQW A;  1M31 A;  1MUX A;  3OB1 B;  1AUI B;  2LHI A;  1Y1U A;  1KSO A;  2L4I A;  1SCM C;  2M7N A;  4PHJ A;  1TN4 A;  2SCP A;  2JNF A;  1YUT A;  4N1F A;  1YUU A;  3CLN A;  1R2U A;  3TS5 C;  2FOT A;  3I5H B;  4F0Z B;  3I5F C;  1CFC A;  2BBN A;  4MN0 A;  1CLB A;  2HPS A;  3OB2 B;  3SG7 A;  1EG4 A;  4OKH A;  2AUC A;  1NPQ A;  4I5K A;  1M39 A;  3BUM B;  2M8U A;  2LM5 A;  1UP5 A;  1K9U A;  1J55 A;  5D7F A;  3TDZ A;  2JNX A;  1SYM A;  1M63 B;  1N2D A;  2LVI A;  1FW4 A;  3NSL A;  5CSJ A;  3JTD C;  1K9K A;  3H4S E;  2LP3 A;  1XFV O;  4M2P A;  2MBX A;  4JWQ A;  3BUN B;  3VRP A;  2JU0 A;  1TIZ A;  2OTG C;  2KAX A;  3KO0 A;  2K7O A;  2JPT A;  3BQ3 A;  1AJ4 A;  1LVC D;  2NCP A;  2KBI A;  1K96 A;  2WOS A;  1S36 A;  4YBH B;  5KSZ A;  4MBE A;  2COL B;  4Q04 A;  1SW8 A;  1IGV A;  1PAL A;  1S6J A;  2WCB A;  3CZT X;  3EK8 A;  1W7J B;  2I7A A;  2LLS A;  4M2O A;  2O60 A;  4QJ4 B;  2I94 A;  3O78 A;  4YI9 A;  1WRZ A;  1S5G Z;  1K94 A;  2KBM A;  3ICB A;  3NSO A;  4MZK A;  1YUR A;  3CWG A;  1JUO A;  1PRW A;  1XK4 A;  1EL4 A;  1EXR A;  1S26 D;  3FWC A;  4NDD A;  1AVS A;  2PVB A;  1B7T Y;  1SL9 A;  3PLF B;  1DGU A;  2BCX A;  4PHK A;  2LAN A;  2LCP A;  2ZN9 A;  4N1G A;  1R6P A;  3EK7 A;  1SR6 C;  1TNP A;  2EGD A;  1BOC A;  1B8R A;  1XFZ O;  3WHU B;  1AK8 A;  2HET A;  1G33 A;  1REC A;  4QJ3 B;  2JOJ A;  1F4O A;  1XFU O;  5AXI A;  1KFX L;  1QIW A;  1IJ6 A;  1YVH A;  1KQM C;  4ORB B;  3VRO A;  3A8R A;  4D1E A;  1WLZ A;  3O6B A;  3EVU A;  4AQI A;  2K61 A;  4E68 A;  2ZRT A;  1TNQ A;  1QX2 A;  4QJ5 B;  1KFU L;  1DJW A;  1OSA A;  5AAN A;  5HKW A;  1DJX A;  1MXL C;  1RFJ A;  2LLT A;  4MVF A;  2Y5I A;  1IWQ A;  2F3Y A;  2KFF A;  3DF0 A;  1FI6 A;  3WNX B;  5PAL A;  1CNP A;  1KK7 Y;  4ICB A;  4PE0 A;  2K8M B;  1OZS A;  2LLU A;  1FPW A;  1W7I B;  3GK1 A;  4JPZ B;  1WRK A;  2PMY A;  1HT9 A;  1S6I A;  1YX8 A;  2HQ8 A;  3JVT C;  1UUR A;  1F71 A;  1EJ3 A;  2BE4 A;  2K7C A;  3DVE A;  1QXP A;  1TCO B;  4CLN A;  4OR9 B;  1MXE A;  1J7Q A;  4PE4 A;  2JT0 A;  2OS8 B;  3VGO A;  1PVB A;  2JUL A;  2M9G A;  1OMV A;  2FCD A;  2NXQ A;  2I2R E;  1LKJ A;  1UHN A;  2RGI A;  1GGW A;  4PDZ A;  4GPL B;  5I2L A;  2KYC A;  3OHM B;  3GK4 X;  3PN7 C;  1IRJ A;  2BL0 B;  3LL8 B;  2OS8 C;  1ZOT B;  2PAS A;  1M45 A;  4HRH A;  2L4H A;  3KPX A;  4BY5 A;  1OZO A;  1F54 A;  2MLF C;  2V53 A;  1SCM B;  1QS7 A;  2BE6 A;  5JOL A;  1JSA A;  2BBM A;  4MLW A;  1G8I A;  5DKR A;  1J1D A;  2KAY A;  3BOW A;  5JJG A;  1DJY A;  3TS5 B;  2LMV A;  3AAJ A;  4GUK A;  1CFD A;  4PAL A;  3I5F B;  2JQ6 A;  1QIV A;  4HSZ A;  3NSK A;  4OV2 A;  5ER5 A;  2O5G A;  1B8C A;  3I5G C;  4NDC A;  1NX2 A;  3SG3 A;  3PAL A;  3C1V A;  2PRU A;  5ER4 X;  2M29 A;  2PAL A;  1UUS A;  1QJT A;  4FTG A;  1YRU B;  1QVI Y;  3F45 A;  4GGN A;  1DTL A;  4YRU A;  3JTD B;  1YRT B;  2L0P A;  1F55 A;  1EG3 A;  1NYA A;  1TNX A;  1RRO A;  3D0Y B;  4YGC B;  1QAT A;  2OTG B;  2K2A A;  2KGB C;  1KSM A;  4GAO A;  3WHT B;  4AOM A;  1D1O A;  2F2P A;  3LLE A;  1A29 A;  3VRN A;  1SKT A;  1OMR A;  1F70 A;  2GV5 A;  1B9A A;  1IQ3 A;  2B1U A;  2BKH B;  5HYD A;  3A4U B;  3GOF A;  2LHL A;  1UHK A;  2BEC A;  2CNP A;  4GGF A;  4DCK A;  1QX5 B;  5J3X A;  1JWD A;  1SPY A;  2ZND A;  4PHN A;  2KOT A;  2L98 A;  1BMO A;  5CSN A;  1BR4 B;  2G9B A;  1K95 A;  2MRD A;  1DJH A;  1V1G A;  4CID A;  2MA2 A;  2CXJ A;  3KHE A;  1DT7 B;  1ZFS A;  1OQP A;  5KU1 A;  3CR5 X;  1PSB A;  4GBA A;  2LVV A;  2ZKM X;  1QV1 A;  4XJK B;  2F8P A;  5DKQ A;  3TDU A;  2KI6 D;  2Y4Q A;  3KF9 A;  4WQ3 A;  4AQJ A;  1XK4 C;  1SR6 B;  1ZMZ A;  1TCF A;  1WDC C;  3CTN A;  3NXA A;  4TNC A;  3ZNI A;  1JC2 A;  3SG2 A;  3CR2 A;  1YUS A;  3SG4 A;  1EH2 A;  4MEW A;  3EKJ A;  1AHR A;  5AEQ A;  2Y1N A;  2K7D A;  2ZFD A;  5CSF A;  1NWD A;  1KQM B;  1J7R A;  4OVN F;  1DVI A;  1OOJ A;  1DJZ A;  2M7L A;  2KSP A;  1PSR A;  1U5I B;  1J1E A;  2DOQ A;  4MZJ A;  1WLM A;  1BOD A;  4HRG A;  1DF0 A;  1V1F A;  1QTX A;  1K2H A;  2WOR A;  2I18 A;  2LVJ A;  4C0L A;  2D8N A;  1S1E A;  1Y6W A;  1CDL A;  1JF2 A;  3CS1 A;  4JQ0 D;  2E6W A;  5BPJ A;  2WND A;  2CTN A;  3FWB A;  1GGZ A;  1C07 A;  2TN4 A;  1FF1 A;  3O2P A;  3BUO B;  3TUY C;  5K89 A;  3MSE B;  3JVT B;  1SBJ A;  2EC6 B;  2LP2 A;  4I5J A;  1K90 D;  1FBV A;  4ZCU A;  1DJG A;  2P6B B;  1NCX A;  1S3P A;  3OX6 A;  1LXF C;  1GJY A;  2JWW A;  1CKK A;  5HKZ A;  1MR8 A;  1FI5 A;  2KI4 C;  1Q80 A;  2AMI A;  2F2O A;  4P5O E;  2EC6 C;  3PM8 A;  2E30 A;  1YVL A;  2HF5 A;  3DVJ A;  4A4C A;  2LC5 A;  1PUL A;  3TZ1 A;  1RK9 A;  5I2Q A;  3PN7 B;  4NDB A;  2H61 A;  2QPT A;  3IQO A;  3SIA A;  4M2Q A;  5F6T A;  1BLQ A;  1AP4 A;  1F4Q A;  2JC2 A;  1B7T Z;  5HLO A;  2CBL A;  1DMO A;  4MRY A;  2KI6 C;  4PHM A;  1IJ5 A;  4IL1 A;  1A75 A;  3DVK A;  2L5X B;  1G4Y R;  1Y1A A;  1XFW O;  1XA5 A;  2ISD A;  3TDI A;  2LNK A;  3I5G B;  1UWO A;  2MLE C;  2M1K B;  2NCO A;  1CMF A;  4I5N B;  3NSI A;  4ORA B;  1PVA A;  2NZ0 A;  2KYF A;  2K7B A;  3EK4 A;  2K2F A;  1MQ1 A;  1BU3 A;  2R2I A;  1N0Y A;  1NIW A;  1XFX O;  1CMG A;  1YX7 A;  2VRG A;  1UHJ A;  1CM1 A;  1GQM A;  2JTZ A;  1KFX S;  3EVV A;  2KHN A;  3BUW B;  4YI8 A;  5HLV A;  5B8I B;  1JFJ A;  1CDM A;  3PFV A;  2KQ6 A;  4I5L B;  4MSP A;  2EHB A;  2KGR A;  1SL7 A;  2JT3 A;  1SNL A;  3OP0 A;  3CR4 X;  2F3Z A;  4YGA A;  5G08 A;  2FCE A;  2G2B A;  2KQY A;  1KFU S;  2M0R A;  1CLL A;  3BYA A;  1BR1 B;  1KK7 Z;  1DJI A;  3SJS A;  1S5G Y;  3D10 A;  1BG1 A;  1NUB A;  3AKA A;  2IS9 A;  5CPV A;  2AAO A;  4BY4 A;  1F8H A;  1KWO C;  1ZAC A;  2NLN A;  2CT9 A;  3QRX A;  1Y1X A;  2A4J A;  4MZL A;  2JRF A;  3I5I C;  3FS7 A;  5IBW A;  2BCA A;  1SCV A;  1NCY A;  1ZUZ A;  5AFP A;  1IKU A;  1H4B A;  1RJV A;  4GGF C;  4ORC B;  2KAV A;  3E3R A;  3AAK A;  3VRR A;  1TTX A;  1A03 A;  1L2O B;  1TNW A;  1TRF A;  1SK6 D;  1MWN A;  1QLK A;  3PSR A;  1A2X A;  1N65 A;  2LMT A;  1QV0 A;  1LIN A;  1CFF A;  1RWY A;  1K93 D;  1YTZ C;  3I5H C;  1WDC B;  1KCY A;  2M97 A;  1KQV A;  4R1E A;  1L2O C;  5FYX A;  2L50 A;  4ETO A;  2WCE A;  1NX1 A;  5HKY A;  4OCI A;  2GGZ A;  5KTY A;  1PK0 D;  1CDN A;  4WQ2 A;  2LMU A;  3IF7 A;  4P2Y B;  1IQ5 A;  4C0J A;  4DUQ A;  3D0Y A;  4DIR A;  1S6C A;  2PSR A;  2JXL A;  1JFK A;  2JT8 A;  1SMG A;  2LAP A;  1B1G A;  1IH0 A;  1DF0 B;  2LUX A;  4FQO A;  1J7P A;  4CFR A;  5GQQ C;  2MAZ A;  1XVJ A;  3DD4 A;  1C7W A;  4WRI A;  1WY9 A;  1QVI Z;  1QX7 A;  2KFH A;  1NSH A;  3ZWH A;  1B8L A;  2KDH A;  3SIB A;  1MHO A;  2FJU B;  2ZNE A;  4L9M A;  3CGA A;  3FIA A;  4CPV A;  4YGD B;  1CB1 A;  3TUY B;  2ZRS A;  4C0K A;  3WXA A;  3RM1 A;  2M1U A;  1WRL A;  4NQG A;  3DF0 B;  4YGE B;  1Y0V H;  1ALV A;  2WC8 A;  1NX0 A;  1ALW A;  1JF0 A;  1CM4 A;  4PCW A;  4YGB B;  2BKI B;  1L7Z A;  4XJK A;  2KI4 B;  1MF8 B;  2LE9 B;  1M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...