1S6IA

Ca2+-regulatory region (cld) from soybean calcium-dependent protein kinase-alpha (cdpk) in the presence of ca2+ and the junction domain (jd)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
182
structure length
182
Chain Sequence
AERLSEEEIGGLKELFKMIDTDNSGTITFDELKDGLKRVGSELMESEIKDLMDAADIDKSGTIDYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHIDDMIKEIDQDNDGQIDYGEFAAMMRKRKGNGGIGRRTMRKTLNLRDALGLVDNGSNQVIEGYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected structure of the Ca2+-regulatory region from soybean calcium-dependent protein kinase-alpha
pubmed doi rcsb
source organism Glycine max
molecule tags Transferase, plant protein
molecule keywords Calcium-dependent protein kinase SK5
total genus 24
structure length 182
sequence length 182
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA02
2K2FA 3I5HB 1UHIA 2M49B 3SG2A 2M8UA 1NYAA 1QV1A 1CFPA 1TNPA 4A4CA 1MF8B 2K7DA 3TDZA 2JPTA 2KBMA 1QS7A 3PN7C 3FWCA 1C7WA 2PVBA 3JVTB 5AERA 2ZKMX 3WXAA 2TN4A 1KFUL 2SCPA 2GGMA 4MZKA 3NSLA 1CDNA 1B7TZ 1TCFA 5GQQC 2ZNDA 2Y1MA 5ER4X 1SRAA 1NX1A 1QX2A 4MRXA 1K9UA 2ISDA 2G2BA 2KSPA 1Y0VH 2Q4UA 4GFTA 4L9MA 1YX8A 1QLKA 1MHOA 1WRKA 1NCZA 2LP3A 5DKQA 1FI6A 1XFVO 2JT8A 3DF0B 3WNXB 1DJGA 4FQOA 2BE4A 3CZTX 1CFDA 5IBWA 2M7NA 3NSIA 1NWDA 3VRRA 2WCBA 1YVHA 1N0YA 2BKHB 2JTZA 3JTDB 5KSZA 1OSAA 5KU1A 1KK8C 1W7IB 1IG5A 2JNXA 2L50A 2NZ0A 5I2OA 2LMUA 5HLVA 2LP2A 1XFZO 3SG5A 3VGOA 1BF5A 5CPVA 1AK8A 1WDCC 1K2HA 1CLMA 1YUTA 1WRZA 2BL0C 4MLWA 4HRGA 1B9AA 1K9PA 1NIWA 2HQ8A 2KFGA 1K95A 1S3PA 4GGFA 4YGDB 4C0JA 3AAJA 1ZOTB 2BCAA 1MWNA 2HQWA 2LLSA 1M46A 3HX4A 1YX7A 3SG7A 3I5GC 1KWOB 3ZNIA 1WDCB 1GQMA 1PRWA 1J55A 3K21A 3BUNB 3DD4A 1KK8B 4NQGA 1NCYA 3JTDC 2KNEA 1HT9A 5DKRA 2I18A 2O5GA 1NSHA 1LKJA 3SG6A 5I8NA 1F8HA 1IJ5A 1Y1UA 3KEVA 2L0PA 3EVVA 1MXEA 2Q91A 1IGVA 3OHMB 4D1EA 2OTGB 1ZUZA 1L2OC 2HETA 3CGAA 1F70A 1JSAA 1XO5A 2E30A 2COLB 4I5JA 5HKWA 2LMTA 2KAXA 1IJ6A 2Y4QA 3CTNA 2M7LA 1IWQA 3SIAA 3CR4X 1AJ4A 1DF0B 4HREE 1QIVA 1S1EA 2OTGC 1NX3A 1QX7A 2MRDA 4YBHB 1A75B 1A03A 2NXQA 1QATA 2KI6D 4JWQA 4WQ2A 3GK1A 4HRHA 5HKYA 1F55A 1JF0A 4JQ0D 1XK4A 3LK0A 1PSBA 1RFJA 1KQMC 2JU0A 1SL9A 1KFXS 5PALA 2EHBA 1TIZA 1C07A 1J7QA 1DTLA 1YTZC 2LVJA 1EL4A 2A4JA 2RGIA 2JULA 2G9BA 4GPLB 3EVUA 1G8IA 1Y6WA 1SR6C 1QVIZ 5AANA 1KQMB 1QASA 1BJFA 1ODBA 2I2RE 3RM1A 4MZJA 1JBAA 3VRPA 2M97A 3DVKA 1KSMA 2L5XB 3AAKA 1G4YR 1JUOA 1SKTA 4I5LB 1G33A 3SIBA 2JWWA 1UHJA 3EKHA 2BCXA 2WNDA 3A8RA 4YGEB 4I5NB 4PCWA 2PRUA 3AKAA 4M2OA 3TDIA 5HKZA 2CCMA 2KGBC 1WLMA 1OZSA 1QV0A 2QPTA 3BUOB 3DF0A 2OS8B 2ZRSA 4UPGA 4YGCB 4BY4A 2JXCA 5K89A 3GK4X 5D69A 1ZFSA 3M0WA 1QVIY 3O4YA 1KSOA 1QIWA 1V1FA 1S36A 1A29A 2GV5A 2M3WA 2LC5A 1H8BA 3PSRA 4M2PA 1DJYA 2PMYA 4YGBB 3JVTC 3TUYB 3LL8B 4PHJA 3PN7B 3KHEA 2JC2A 2MHHA 3EK8A 1LVCD 3PM8A 1NCXA 2P6BB 3O6BA 5HYDA 2M9GA 4XJKA 1OMVA 2H61A 2WORA 4CFRA 1CFCA 1UHNA 1EG3A 3BOWB 2LVKA 2WOSA 1CNPA 1PSRA 3KF9A 3CLNA 2K7CA 2KDHA 2OPOA 1TRFA 3BYAA 2LE9B 2F3YA 1RECA 2MLFC 1KFUS 1TNWA 5G08A 3BQ3A 1TNXA 4PHMA 1BMOA 1PALA 1M45A 4ORBB 5I2LA 3NSOA 1DVIA 3DVJA 1FPWA 1LA0A 4DS7A 1GJYA 1K96A 2JRFA 1K8UA 2KI4C 1BODA 1SK6D 1UHKA 1K90D 4PHKA 1NP8A 1LA3A 3I5HC 1QJTA 1CDPA 1QX5B 1N65A 1YRTB 1FW4A 4YGAA 4YRUA 4WQ3A 2BBNA 2BL0B 1J1DA 2MAZA 2L98A 2LLTA 2F33A 2DOQA 4MZLA 4AQIA 3GOFA 1SMGA 3CR2A 1C7VA 2AUCA 4N1FA 4DIRA 5CSNA 3NXAA 4BY5A 4PE4A 2JT0A 1TTXA 4MRYA 4TNCA 2HPSA 1SCMB 3PLFB 1XFWO 1SW8A 4MN0A 4GUKA 4R1EA 3EK4A 1Q80A 2I94A 1RROA 1DJWA 1DMOA 3TS5C 5CSFA 4CFQA 2ZNEA 5JJGA 4ICBA 4MEWA 2KFFA 3D0YB 1XK4C 2LLUA 1LINA 2JXLA 1K9KA 3OX5A 1OE9B 2JTTA 3KO0A 4GNKB 1EXRA 2KAVA 4OVNF 3WHTB 2AAOA 1X02A 1YUUA 4GAOA 3F45A 4XYNA 4CIDA 3ZWHA 1MQ1A 3OX6A 3BUXB 1FF1A 3D10A 4NDBA 1PULA 2WCFA 1DJZA 1XA5A 3EKJA 1CLLA 2L51A 1KK7Z 1MXLC 1SPYA 2ZN8A 3LLEA 1K94A 1F54A 1DJHA 2LAPA 1LXFC 1L7ZA 1WLZA 1R6PA 2JT3A 1M31A 1S26D 3I5IB 1CLBA 1WY9A 1W7JB 3OP0A 1DF0A 1XFYO 2M29A 1PVAA 3IF7A 4E68A 1DGUA 5BPJA 1B8RA 2KYFA 4PALA 3PFVA 1B8CA 3CWGA 4C0LA 1S6IA 4ORCB 1SYMA 4OCIA 2KOTA 1YVLA 4PE1A 1N2DA 3CR5X 2LHIA 2MLEC 2OS8C 2LUCA 5CSJA 4P5OE 1S5GZ 1YURA 1J7RA 1KQVA 1KCYA 5TNCA 3OB2B 2LVVA 1CFFA 4GGFC 3ICBA 2CT9A 3DVMA 2V53A 1OMDA 1DJXA 3FS7A 3HCMA 1J7PA 2BCBA 4PHNA 5FYXA 1F71A 1A4PA 2F2OA 1UUSA 1NX2A 1CM4A 1RK9A 1KFXL 3I5FC 3PALA 1UWOA 2K61A 2QACA 2HF5A 3KPXA 5F6TA 1AVSA 3IQQA 5ER5A 1E8AA 2IS9A 4CPVA 1Y1AA 5HLOA 4NDCA 1JFKA 2FJUB 1BT6A 3AKBA 2KFHA 1V1GA 4MVFA 1CDLA 1D1OA 4OV2A 3PATA 3TS5B 1CTRA 5KTYA 1NPQA 1YR5A 3BUMB 2H61C 3OB1B 1K93D 3WHUB 1SCMC 4PE0A 1CM1A 2KYCA 2LUXA 1B7TY 1IQ5A 2JOJA 1EJ3A 2KI4B 1XFUO 3D0YA 4OR9B 2F2PA 2KHNA 3TUYC 5I2QA 1ZMZA 2L4IA 4USLA 5AEQA 4IL1A 2LNKA 1JF2A 2FCDA 2KAYA 1DGVA 3LCPC 2Y5IA 1SL7A 1ALVA 4ORAB 1B4CA 1IRJA 1NX0A 1B8LA 3LK1A 2BKIB 4ZCUA 3SG3A 4CLNA 2WC8A 2KQ6A 1MR8A 1UP5A 3BXKA 1ZACA 1UHHA 2ZN9A 3I5IC 2L2EA 3VROA 1CMFA 3FIAA 2AMIA 2R2IA 4Q04A 1F4OA 2CBLA 1B47A 2L4HA 1QXPA 1R2UA 3SJSA 2K0JA 1BG1A 2SASA 1U5IB 4HSZA 1A75A 4NDDA 1S5GY 2LVIA 2MA2A 2NCOA 1J1EA 1TCOB 1DJIA 2M1UA 1NUBA 2O60A 2VRGA 2ZFDA 2LHLA 1DT7B 1EG4A 3O78A 1BLQA 5AFPA 1SNLA 1CB1A 2BECA 1EH2A 1M39A 1OOJA 2F8PA 4MSPA 1SL8A 4QJ4B 1TOPA 4QJ5B 1BOCA 1AUIB 1IH0A 5CSIA 4A4BA 2JNFA 3FWBA 4FTGA 1F4QA 2NCPA 2EC6C 2K8MB 1CDMA 4M2QA 2JQ6A 4WRIA 1H4BA 2LCPA 4AQJA 1SY9A 2BBMA 2CTNA 1M63B 1B1GA 1MUXA 3TDUA 3SG4A 1UURA 1A2XA 1XFXO 2K2AA 2FCEA 3H4SE 5J3XA 2MBXA 4AOMA 2EGDA 3QRXA 2M1KB 2BE6A 2KGRA 1QLSA 5AXIA 1BR4B 2WCEA 3C1VA 3EVRA 1KWOC 2D8NA 3IQOA 4DCKA 1PVBA 1JFJA 1GGWA 1Y1XA 3MSEB 2M0RA 3E3RA 2LMVA 4GBAA 1OMRA 2CXJA 2H2KA 3BOWA 1ALWA 3CS1A 1OQPA 3NSKA 1XVJA 1L2OB 1J7OA 1KK7Y 4I5KA 1U5IA 4C0KA 3TZ1A 2Y1NA 1TN4A 5JOLA 4PE7A 4F0ZB 1BR1B 2ZRTA 1AP4A 2LM5A 3VRQA 2PSRA 5B8IB 3VRNA 2E6WA 1PK0D 4OKHA 1S6JA 3A4UB 1JWDA 2NLNA 3EK7A 4JPZB 3RLZA 1RTP1 1GGZA 1RWYA 1IQ3A 3DVEA 2KBIA 1CKKA 1SR6B 2EC6B 4YI8A 1YUSA 1IKUA 1JC2A 2GGZA 2LANA 1S6CA 1SCVA 3I5GB 4PDZA 2PALA 4ETOA 2KQYA 4XJKB 5D7FA 1OZOA 2K7OA 4DRWA 5DKNA 2FOTA 1XYDA 3GK2A 4N1GA 4ZCVA 3O2PA 4GGNA 4P2YB 1VRKA 1RJVA 2F3ZA 4DUQA 2I7AA 1FI5A 2KI6C 2JZIA 2MJWB 2K7BA 1HQVA 2CNPA 4N5XA 1SBJA 1TNQA 1BU3A 1AHRA 1FBVA 1WRLA 1YRUB 4U8DA 2B1UA 1QTXA 1AJ5A 2LV7A 3I5FB 2PASA 4MBEA 3BUWB 4QJ3B 1CMGA 4YI9A
chains in the Genus database with same CATH superfamily
2K2FA 3I5HB 1UHIA 2M49B 3SG2A 2M8UA 3SS4A 1NYAA 1QV1A 1CFPA 1TNPA 4A4CA 1MF8B 2K7DA 3N7HA 3S0GA 3TDZA 2JPTA 2KBMA 1QS7A 3PN7C 3FWCA 3FE8A 1C7WA 2PVBA 3JVTB 5AERA 2ZKMX 3S0FA 3WXAA 2TN4A 1KFUL 2SCPA 2GGMA 3L47A 3NSLA 4MZKA 2WCJA 1B7TZ 1CDNA 1TCFA 5GQQC 2ZNDA 2Y1MA 5ER4X 1SRAA 1NX1A 1QX2A 4MRXA 1K9UA 2ISDA 2G2BA 2KSPA 1Y0VH 2Q4UA 4GFTA 4L9MA 1YX8A 1QLKA 1MHOA 1WRKA 1NCZA 2LP3A 2YGUA 5DKQA 1FI6A 1XFVO 2JT8A 3BFHA 3DF0B 3DY9A 3WNXB 1DJGA 4FQOA 2BE4A 3CDNA 4INWA 3CZTX 1CFDA 3D74A 5IBWA 2M7NA 3NSIA 1NWDA 4FQTA 2WCBA 1YVHA 3VRRA 1N0YA 2BKHB 2JTZA 3JTDB 5KSZA 1OSAA 5KU1A 1KK8C 1W7IB 1IG5A 2JNXA 2L50A 2NZ0A 5I2OA 2LMUA 5HLVA 2LP2A 1XFZO 3SG5A 3VGOA 1BF5A 4IJ7A 1TWOA 5CPVA 1AK8A 1WDCC 1K2HA 1CLMA 1YUTA 1WRZA 2BL0C 4MLWA 4HRGA 1B9AA 1K9PA 1NIWA 2HQ8A 2KFGA 1K95A 1S3PA 2P71A 4GGFA 4YGDB 4C0JA 3AAJA 1ZOTB 2BCAA 1MWNA 2HQWA 2LLSA 1M46A 3HX4A 1YX7A 3SG7A 3I5GC 1KWOB 3ZNIA 1WDCB 2WC5A 1GQMA 3BJHA 1PRWA 1J55A 3K21A 3BUNB 3DD4A 1KK8B 4NQGA 1NCYA 3JTDC 5FI7A 3SS5A 2KNEA 1HT9A 5DKRA 2I18A 2O5GA 1NSHA 1LKJA 3BFAA 3SG6A 5I8NA 1F8HA 1IJ5A 1Y1UA 3KEVA 3OBVA 2WCHA 2KPHA 2L0PA 3EVVA 1MXEA 2Q91A 1IGVA 3OHMB 4D1EA 2OTGB 1ZUZA 1L2OC 2HETA 3CGAA 1F70A 1JSAA 1XO5A 2E30A 2COLB 4I5JA 5HKWA 2LMTA 2KAXA 1IJ6A 2Y4QA 3CTNA 2M7LA 1IWQA 3SIAA 3CR4X 1AJ4A 1DF0B 4HREE 1T14A 1QIVA 1S1EA 5DICA 2OTGC 1NX3A 1QX7A 2MRDA 4YBHB 1A75B 1A03A 2NXQA 3L4AA 1QATA 2KI6D 4JWQA 4KYNA 4WQ2A 3GK1A 4HRHA 5HKYA 1F55A 1JF0A 4JQ0D 1XK4A 3D77A 3LK0A 1PSBA 1RFJA 1KQMC 2JU0A 1SL9A 1KFXS 5PALA 2EHBA 1TIZA 1C07A 1J7QA 1DTLA 1YTZC 2LVJA 1IIOA 1EL4A 2A4JA 3R1VA 2RGIA 2JULA 2G9BA 4GPLB 3EVUA 1G8IA 1Y6WA 1SR6C 1QVIZ 5AANA 1KQMB 1Z4HA 1QASA 1BJFA 1ODBA 2I2RE 3B7AA 3RM1A 4MZJA 1JBAA 3VRPA 2M97A 3S0AA 1ORGA 3DVKA 1KSMA 2GTEA 2L5XB 3CZ1A 3AAKA 1P28A 1G4YR 3B88A 1JUOA 1SKTA 4I5LB 1G33A 3SIBA 2JWWA 1UHJA 3EKHA 2BCXA 2PYQA 2WNDA 3A8RA 4YGEB 4I5NB 4PCWA 2PRUA 3AKAA 4M2OA 1DQEA 5HKZA 3TDIA 2CCMA 2KGBC 1WLMA 1OZSA 1QV0A 1GM0A 2QPTA 3BUOB 1DC1A 3DF0A 2OS8B 2ZRSA 4UPGA 4YGCB 4BY4A 2JXCA 5K89A 3GK4X 5D69A 1ZFSA 3B6XA 3R72A 3M0WA 1QVIY 3O4YA 1KSOA 1QIWA 1V1FA 1S36A 1A29A 2GV5A 2M3WA 2LC5A 1H8BA 3PSRA 4M2PA 1DJYA 2PMYA 4YGBB 3JVTC 1SSEB 3TUYB 3LL8B 4PHJA 2WC6A 3PN7B 3KHEA 2JC2A 2MHHA 3EK8A 3V2LA 1LVCD 3PM8A 1NCXA 2P6BB 3O6BA 5HYDA 2M9GA 4XJKA 1OMVA 2H61A 2WORA 4CFRA 1CFCA 1UHNA 1EG3A 3BOWB 2LVKA 2WOSA 1CNPA 1PSRA 3KF9A 3CLNA 3NHTA 1DEKA 2K7CA 2KDHA 2OPOA 1TRFA 3BYAA 2LE9B 2F3YA 1RECA 2MLFC 1KFUS 1TNWA 1LS8A 2L2CA 4PT1A 3BQ3A 5G08A 1C3YA 1TNXA 4PHMA 1BMOA 1PALA 1M45A 4ORBB 5I2LA 3NSOA 1DVIA 3DVJA 1FPWA 1LA0A 4DS7A 1GJYA 1K96A 2JRFA 1K8UA 2KI4C 1BODA 1SK6D 1UHKA 1K90D 4PHKA 1NP8A 1LA3A 3I5HC 1QJTA 1CDPA 1QX5B 1N65A 1YRTB 3UO9A 1FW4A 4YGAA 2P70A 4YRUA 4WQ3A 2BBNA 2BL0B 1J1DA 2MAZA 2L98A 2JPOA 2LLTA 2F33A 2DOQA 4MZLA 4AQIA 3GOFA 1SMGA 3CR2A 1C7VA 2AUCA 4N1FA 4DIRA 5CSNA 3NXAA 4BY5A 4PE4A 2JT0A 1TTXA 4MRYA 4TNCA 2HPSA 1SCMB 3PLFB 1XFWO 1SW8A 4MN0A 4GUKA 3NGVA 3R1OA 4R1EA 3EK4A 1Q80A 2I94A 1RROA 2K60A 1DJWA 1DMOA 3TS5C 5CSFA 2WCKA 2ZNEA 4CFQA 4ICBA 4MEWA 5JJGA 3UNWA 2KFFA 3D0YB 1XK4C 2LLUA 1LINA 2JXLA 1K9KA 3OX5A 1OE9B 2JTTA 3KO0A 4GNKB 1EXRA 2KAVA 4OVNF 5EL2A 3WHTB 2AAOA 1X02A 1YUUA 4GAOA 1OW4A 3F45A 4XYNA 4CIDA 3ZWHA 1MQ1A 5FI2A 3D78A 4OZDA 3OX6A 3BUXB 1FF1A 3D10A 4NDBA 1PULA 2WCFA 1DJZA 1XA5A 3EKJA 3QMEA 3DYEA 1CLLA 2L51A 1KK7Z 1MXLC 1SPYA 2ZN8A 3LLEA 1K94A 1F54A 1DJHA 2LAPA 1LXFC 3PJIA 5HL1A 1L7ZA 1WLZA 1R6PA 2JT3A 3EG5B 1M31A 1S26D 3I5IB 1CLBA 3B86A 1WY9A 1W7JB 3OP0A 1DF0A 2WCLA 1XFYO 2M29A 1PVAA 3IF7A 4E68A 1C3ZA 1DGUA 1OOIX 1B8RA 2KYFA 4PALA 5BPJA 3PFVA 1B8CA 3CWGA 3OGNA 2QEHA 4C0LA 1S6IA 4ORCB 1TUJA 1SYMA 3DXLA 4OCIA 2KOTA 1YVLA 4PE1A 1N2DA 3CR5X 2LHIA 2MLEC 2OS8C 2LUCA 5CSJA 4JD9A 4P5OE 3SS3A 3FE6A 1S5GZ 1YURA 2KLEA 1J7RA 1KQVA 1W9ZA 1KCYA 5TNCA 3OB2B 2LVVA 1CFFA 4GGFC 3ICBA 3S0BA 3L4LA 2CT9A 3DVMA 2V53A 1OMDA 1DJXA 3FS7A 3HCMA 3O4XA 2BCBA 1J7PA 4PHNA 5FYXA 1F71A 1A4PA 2F2OA 1UUSA 1NX2A 1CM4A 1DELA 3R1PA 1RK9A 1KFXL 1XFRA 3I5FC 3PALA 2WCMA 1UWOA 2K61A 2QACA 2HF5A 3KPXA 5F6TA 1AVSA 3IQQA 5ER5A 1E8AA 2IS9A 4CPVA 1Y1AA 5HLOA 2QEOA 2H8VA 1JFKA 2FJUB 4NDCA 1BT6A 3AKBA 2KFHA 1V1GA 4MVFA 1CDLA 1D1OA 4OV2A 3CYZA 3PATA 3TS5B 1CTRA 5KTYA 1NPQA 1YR5A 3BUMB 2H61C 3OB1B 3IVTA 1K93D 3WHUB 1SCMC 4PE0A 1CM1A 2KYCA 2LUXA 5I94A 1B7TY 1IQ5A 2JOJA 1EJ3A 2KI4B 1XFUO 3D0YA 4OR9B 2F2PA 2KHNA 3TUYC 3D76A 1ZMZA 5I2QA 2L4IA 4USLA 5AEQA 3K1EA 4IL1A 2LNKA 1JF2A 2FCDA 2KAYA 1DGVA 3LCPC 2Y5IA 3DZTA 1SL7A 1ALVA 4ORAB 2BNXA 1IRJA 1B4CA 1NX0A 1B8LA 3LK1A 2BKIB 3CABA 4ZCUA 3SG3A 4CLNA 2WC8A 2KQ6A 1MR8A 1UP5A 3BXKA 1ZACA 2QDIA 1UHHA 2ZN9A 3I5IC 2L2EA 3VROA 1CMFA 3FIAA 2AMIA 2R2IA 3D75A 4Q04A 1F4OA 2CBLA 1B47A 2L4HA 3B87A 1QXPA 5FI6A 3VB1A 1R2UA 3SJSA 2K0JA 1BG1A 2SASA 1U5IB 4HSZA 1A75A 4NDDA 1S5GY 2LVIA 2MA2A 2NCOA 1J1EA 1TCOB 1DJIA 2M1UA 1NUBA 2O60A 2VRGA 2ZFDA 2LHLA 1DT7B 1EG4A 3O78A 1BLQA 5AFPA 1SNLA 1CB1A 2BECA 1EH2A 1M39A 1OOJA 2F8PA 4MSPA 1SL8A 4QJ4B 1TOPA 4QJ5B 1BOCA 1AUIB 1IH0A 5CSIA 4A4BA 2JNFA 3FWBA 4FTGA 1F4QA 2NCPA 2EC6C 5D3OA 2K8MB 1CDMA 2ERBA 4M2QA 2JQ6A 4WRIA 1H4BA 2LCPA 4AQJA 1SY9A 2BBMA 2CTNA 1M63B 2KLDA 3S0EA 1B1GA 1MUXA 3TDUA 1QWVA 3SG4A 1UURA 1A2XA 1XFXO 2K2AA 2FCEA 2QEBA 3H4SE 5J3XA 2MBXA 2EGDA 4AOMA 3QRXA 2M1KB 2BE6A 1OOHA 2KGRA 1QLSA 2L5YA 5AXIA 3Q8IA 1BR4B 2WCEA 3C1VA 1OOGA 3EVRA 1KWOC 2D8NA 3IQOA 4DCKA 1PVBA 1JFJA 1GGWA 1Y1XA 3MSEB 2M0RA 3E3RA 2LMVA 4GBAA 1OMRA 4INXA 2CXJA 2H2KA 3BOWA 3CZ0A 3PM2A 1ALWA 3CS1A 1OQPA 3NSKA 1XVJA 1L2OB 1OOFA 1J7OA 1KK7Y 4I5KA 1U5IA 4C0KA 3TZ1A 2Y1NA 1TN4A 5JOLA 4PE7A 4F0ZB 1BR1B 3S0DA 2ZRTA 1AP4A 2LM5A 1TUZA 2PSRA 3VRQA 5B8IB 3VRNA 4F7FA 2E6WA 1PK0D 2FJYA 4OKHA 1S6JA 3A4UB 1JWDA 2NLNA 3EK7A 4JPZB 3RLZA 1RTP1 2BAPA 1GGZA 1RWYA 1IQ3A 3DVEA 2KBIA 1CKKA 1SR6B 2EC6B 4YI8A 1YUSA 1IKUA 1JC2A 2GGZA 2LANA 1S6CA 1SCVA 3D73A 3CZ2A 3I5GB 2QEVA 4PDZA 2PALA 4ETOA 2KQYA 4XJKB 5D7FA 1OZOA 2K7OA 4DRWA 5DKNA 2FOTA 1XYDA 3GK2A 4N1GA 3BFBA 4JKTA 4ZCVA 3O2PA 1Z2CB 3NHIA 4GGNA 1VRKA 1RJVA 2F3ZA 4P2YB 2PQLA 2I7AA 4DUQA 1FI5A 2KI6C 2JZIA 2MJWB 2K7BA 1HQVA 2CNPA 4N5XA 1SBJA 1TNQA 1BU3A 3FE9A 1AHRA 1FBVA 1WRLA 1YRUB 4U8DA 2B1UA 1QTXA 3RZSA 1AJ5A 2LV7A 3I5FB 2PASA 4MBEA 3BUWB 4QJ3B 1CMGA 4YI9A
chains in the Genus database with same CATH topology
2K2FA 3I5HB 1UHIA 2M49B 3SG2A 2M8UA 1NYAA 1QV1A 1CFPA 1TNPA 4A4CA 1MF8B 2K7DA 3TDZA 2JPTA 2KBMA 1QS7A 3PN7C 3FWCA 1C7WA 2PVBA 3JVTB 5AERA 2ZKMX 3WXAA 2TN4A 1KFUL 2SCPA 2GGMA 4MZKA 3NSLA 1CDNA 1B7TZ 1TCFA 5GQQC 2ZNDA 2Y1MA 5ER4X 1SRAA 1NX1A 1QX2A 4MRXA 1K9UA 2ISDA 2G2BA 2KSPA 1Y0VH 2Q4UA 4GFTA 4L9MA 1YX8A 1QLKA 1MHOA 1WRKA 1NCZA 2LP3A 5DKQA 1FI6A 1XFVO 2JT8A 3DF0B 3WNXB 1DJGA 4FQOA 2BE4A 3CZTX 1CFDA 5IBWA 2M7NA 3NSIA 1NWDA 3VRRA 2WCBA 1YVHA 1N0YA 2BKHB 2JTZA 3JTDB 5KSZA 1OSAA 5KU1A 1KK8C 1W7IB 1IG5A 2JNXA 2L50A 2NZ0A 5I2OA 2LMUA 5HLVA 2LP2A 1XFZO 3SG5A 3VGOA 1BF5A 5CPVA 1AK8A 1WDCC 1K2HA 1CLMA 1YUTA 1WRZA 2BL0C 4MLWA 4HRGA 1B9AA 1K9PA 1NIWA 2HQ8A 2KFGA 1K95A 1S3PA 4GGFA 4YGDB 4C0JA 3AAJA 1ZOTB 2BCAA 1MWNA 2HQWA 2LLSA 1M46A 3HX4A 1YX7A 3SG7A 3I5GC 1KWOB 3ZNIA 1WDCB 1GQMA 1PRWA 1J55A 3K21A 3BUNB 3DD4A 1KK8B 4NQGA 1NCYA 3JTDC 2KNEA 1HT9A 5DKRA 2I18A 2O5GA 1NSHA 1LKJA 3SG6A 5I8NA 1F8HA 1IJ5A 1Y1UA 3KEVA 2L0PA 3EVVA 1MXEA 2Q91A 1IGVA 3OHMB 4D1EA 2OTGB 1ZUZA 1L2OC 2HETA 3CGAA 1F70A 1JSAA 1XO5A 2E30A 2COLB 4I5JA 5HKWA 2LMTA 2KAXA 1IJ6A 2Y4QA 3CTNA 2M7LA 1IWQA 3SIAA 3CR4X 1AJ4A 1DF0B 4HREE 1QIVA 1S1EA 2OTGC 1NX3A 1QX7A 2MRDA 4YBHB 1A75B 1A03A 2NXQA 1QATA 2KI6D 4JWQA 4WQ2A 3GK1A 4HRHA 5HKYA 1F55A 1JF0A 4JQ0D 1XK4A 3LK0A 1PSBA 1RFJA 1KQMC 2JU0A 1SL9A 1KFXS 5PALA 2EHBA 1TIZA 1C07A 1J7QA 1DTLA 1YTZC 2LVJA 1EL4A 2A4JA 2RGIA 2JULA 2G9BA 4GPLB 3EVUA 1G8IA 1Y6WA 1SR6C 1QVIZ 5AANA 1KQMB 1QASA 1BJFA 1ODBA 2I2RE 3RM1A 4MZJA 1JBAA 3VRPA 2M97A 3DVKA 1KSMA 2L5XB 3AAKA 1G4YR 1JUOA 1SKTA 4I5LB 1G33A 3SIBA 2JWWA 1UHJA 3EKHA 2BCXA 2WNDA 3A8RA 4YGEB 4I5NB 4PCWA 2PRUA 3AKAA 4M2OA 3TDIA 5HKZA 2CCMA 2KGBC 1WLMA 1OZSA 1QV0A 2QPTA 3BUOB 3DF0A 2OS8B 2ZRSA 4UPGA 4YGCB 4BY4A 2JXCA 5K89A 3GK4X 5D69A 1ZFSA 3M0WA 1QVIY 3O4YA 1KSOA 1QIWA 1V1FA 1S36A 1A29A 2GV5A 2M3WA 2LC5A 1H8BA 3PSRA 4M2PA 1DJYA 2PMYA 4YGBB 3JVTC 3TUYB 3LL8B 4PHJA 3PN7B 3KHEA 2JC2A 2MHHA 3EK8A 1LVCD 3PM8A 1NCXA 2P6BB 3O6BA 5HYDA 2M9GA 4XJKA 1OMVA 2H61A 2WORA 4CFRA 1CFCA 1UHNA 1EG3A 3BOWB 2LVKA 2WOSA 1CNPA 1PSRA 3KF9A 3CLNA 2K7CA 2KDHA 2OPOA 1TRFA 3BYAA 2LE9B 2F3YA 1RECA 2MLFC 1KFUS 1TNWA 5G08A 3BQ3A 1TNXA 4PHMA 1BMOA 1PALA 1M45A 4ORBB 5I2LA 3NSOA 1DVIA 3DVJA 1FPWA 1LA0A 4DS7A 1GJYA 1K96A 2JRFA 1K8UA 2KI4C 1BODA 1SK6D 1UHKA 1K90D 4PHKA 1NP8A 1LA3A 3I5HC 1QJTA 1CDPA 1QX5B 1N65A 1YRTB 1FW4A 4YGAA 4YRUA 4WQ3A 2BBNA 2BL0B 1J1DA 2MAZA 2L98A 2LLTA 2F33A 2DOQA 4MZLA 4AQIA 3GOFA 1SMGA 3CR2A 1C7VA 2AUCA 4N1FA 4DIRA 5CSNA 3NXAA 4BY5A 4PE4A 2JT0A 1TTXA 4MRYA 4TNCA 2HPSA 1SCMB 3PLFB 1XFWO 1SW8A 4MN0A 4GUKA 4R1EA 3EK4A 1Q80A 2I94A 1RROA 1DJWA 1DMOA 3TS5C 5CSFA 4CFQA 2ZNEA 5JJGA 4ICBA 4MEWA 2KFFA 3D0YB 1XK4C 2LLUA 1LINA 2JXLA 1K9KA 3OX5A 1OE9B 2JTTA 3KO0A 4GNKB 1EXRA 2KAVA 4OVNF 3WHTB 2AAOA 1X02A 1YUUA 4GAOA 3F45A 4XYNA 4CIDA 3ZWHA 1MQ1A 3OX6A 3BUXB 1FF1A 3D10A 4NDBA 1PULA 2WCFA 1DJZA 1XA5A 3EKJA 1CLLA 2L51A 1KK7Z 1MXLC 1SPYA 2ZN8A 3LLEA 1K94A 1F54A 1DJHA 2LAPA 1LXFC 1L7ZA 1WLZA 1R6PA 2JT3A 1M31A 1S26D 3I5IB 1CLBA 1WY9A 1W7JB 3OP0A 1DF0A 1XFYO 2M29A 1PVAA 3IF7A 4E68A 1DGUA 5BPJA 1B8RA 2KYFA 4PALA 3PFVA 1B8CA 3CWGA 4C0LA 1S6IA 4ORCB 1SYMA 4OCIA 2KOTA 1YVLA 4PE1A 1N2DA 3CR5X 2LHIA 2MLEC 2OS8C 2LUCA 5CSJA 4P5OE 1S5GZ 1YURA 1J7RA 1KQVA 1KCYA 5TNCA 3OB2B 2LVVA 1CFFA 4GGFC 3ICBA 2CT9A 3DVMA 2V53A 1OMDA 1DJXA 3FS7A 3HCMA 1J7PA 2BCBA 4PHNA 5FYXA 1F71A 1A4PA 2F2OA 1UUSA 1NX2A 1CM4A 1RK9A 1KFXL 3I5FC 3PALA 1UWOA 2K61A 2QACA 2HF5A 3KPXA 5F6TA 1AVSA 3IQQA 5ER5A 1E8AA 2IS9A 4CPVA 1Y1AA 5HLOA 4NDCA 1JFKA 2FJUB 1BT6A 3AKBA 2KFHA 1V1GA 4MVFA 1CDLA 1D1OA 4OV2A 3PATA 3TS5B 1CTRA 5KTYA 1NPQA 1YR5A 3BUMB 2H61C 3OB1B 1K93D 3WHUB 1SCMC 4PE0A 1CM1A 2KYCA 2LUXA 1B7TY 1IQ5A 2JOJA 1EJ3A 2KI4B 1XFUO 3D0YA 4OR9B 2F2PA 2KHNA 3TUYC 5I2QA 1ZMZA 2L4IA 4USLA 5AEQA 4IL1A 2LNKA 1JF2A 2FCDA 2KAYA 1DGVA 3LCPC 2Y5IA 1SL7A 1ALVA 4ORAB 1B4CA 1IRJA 1NX0A 1B8LA 3LK1A 2BKIB 4ZCUA 3SG3A 4CLNA 2WC8A 2KQ6A 1MR8A 1UP5A 3BXKA 1ZACA 1UHHA 2ZN9A 3I5IC 2L2EA 3VROA 1CMFA 3FIAA 2AMIA 2R2IA 4Q04A 1F4OA 2CBLA 1B47A 2L4HA 1QXPA 1R2UA 3SJSA 2K0JA 1BG1A 2SASA 1U5IB 4HSZA 1A75A 4NDDA 1S5GY 2LVIA 2MA2A 2NCOA 1J1EA 1TCOB 1DJIA 2M1UA 1NUBA 2O60A 2VRGA 2ZFDA 2LHLA 1DT7B 1EG4A 3O78A 1BLQA 5AFPA 1SNLA 1CB1A 2BECA 1EH2A 1M39A 1OOJA 2F8PA 4MSPA 1SL8A 4QJ4B 1TOPA 4QJ5B 1BOCA 1AUIB 1IH0A 5CSIA 4A4BA 2JNFA 3FWBA 4FTGA 1F4QA 2NCPA 2EC6C 2K8MB 1CDMA 4M2QA 2JQ6A 4WRIA 1H4BA 2LCPA 4AQJA 1SY9A 2BBMA 2CTNA 1M63B 1B1GA 1MUXA 3TDUA 3SG4A 1UURA 1A2XA 1XFXO 2K2AA 2FCEA 3H4SE 5J3XA 2MBXA 4AOMA 2EGDA 3QRXA 2M1KB 2BE6A 2KGRA 1QLSA 5AXIA 1BR4B 2WCEA 3C1VA 3EVRA 1KWOC 2D8NA 3IQOA 4DCKA 1PVBA 1JFJA 1GGWA 1Y1XA 3MSEB 2M0RA 3E3RA 2LMVA 4GBAA 1OMRA 2CXJA 2H2KA 3BOWA 1ALWA 3CS1A 1OQPA 3NSKA 1XVJA 1L2OB 1J7OA 1KK7Y 4I5KA 1U5IA 4C0KA 3TZ1A 2Y1NA 1TN4A 5JOLA 4PE7A 4F0ZB 1BR1B 2ZRTA 1AP4A 2LM5A 3VRQA 2PSRA 5B8IB 3VRNA 2E6WA 1PK0D 4OKHA 1S6JA 3A4UB 1JWDA 2NLNA 3EK7A 4JPZB 3RLZA 1RTP1 1GGZA 1RWYA 1IQ3A 3DVEA 2KBIA 1CKKA 1SR6B 2EC6B 4YI8A 1YUSA 1IKUA 1JC2A 2GGZA 2LANA 1S6CA 1SCVA 3I5GB 4PDZA 2PALA 4ETOA 2KQYA 4XJKB 5D7FA 1OZOA 2K7OA 4DRWA 5DKNA 2FOTA 1XYDA 3GK2A 4N1GA 4ZCVA 3O2PA 4GGNA 4P2YB 1VRKA 1RJVA 2F3ZA 4DUQA 2I7AA 1FI5A 2KI6C 2JZIA 2MJWB 2K7BA 1HQVA 2CNPA 4N5XA 1SBJA 1TNQA 1BU3A 1AHRA 1FBVA 1WRLA 1YRUB 4U8DA 2B1UA 1QTXA 1AJ5A 2LV7A 3I5FB 2PASA 4MBEA 3BUWB 4QJ3B 1CMGA 4YI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2F A;  3I5H B;  1UHI A;  2M49 B;  3SG2 A;  2M8U A;  1NYA A;  1QV1 A;  1CFP A;  1TNP A;  4A4C A;  1MF8 B;  2K7D A;  3TDZ A;  2JPT A;  2KBM A;  1QS7 A;  3PN7 C;  3FWC A;  1C7W A;  2PVB A;  3JVT B;  5AER A;  2ZKM X;  3WXA A;  2TN4 A;  1KFU L;  2SCP A;  2GGM A;  4MZK A;  3NSL A;  1CDN A;  1B7T Z;  1TCF A;  5GQQ C;  2ZND A;  2Y1M A;  5ER4 X;  1SRA A;  1NX1 A;  1QX2 A;  4MRX A;  1K9U A;  2ISD A;  2G2B A;  2KSP A;  1Y0V H;  2Q4U A;  4GFT A;  4L9M A;  1YX8 A;  1QLK A;  1MHO A;  1WRK A;  1NCZ A;  2LP3 A;  5DKQ A;  1FI6 A;  1XFV O;  2JT8 A;  3DF0 B;  3WNX B;  1DJG A;  4FQO A;  2BE4 A;  3CZT X;  1CFD A;  5IBW A;  2M7N A;  3NSI A;  1NWD A;  3VRR A;  2WCB A;  1YVH A;  1N0Y A;  2BKH B;  2JTZ A;  3JTD B;  5KSZ A;  1OSA A;  5KU1 A;  1KK8 C;  1W7I B;  1IG5 A;  2JNX A;  2L50 A;  2NZ0 A;  5I2O A;  2LMU A;  5HLV A;  2LP2 A;  1XFZ O;  3SG5 A;  3VGO A;  1BF5 A;  5CPV A;  1AK8 A;  1WDC C;  1K2H A;  1CLM A;  1YUT A;  1WRZ A;  2BL0 C;  4MLW A;  4HRG A;  1B9A A;  1K9P A;  1NIW A;  2HQ8 A;  2KFG A;  1K95 A;  1S3P A;  4GGF A;  4YGD B;  4C0J A;  3AAJ A;  1ZOT B;  2BCA A;  1MWN A;  2HQW A;  2LLS A;  1M46 A;  3HX4 A;  1YX7 A;  3SG7 A;  3I5G C;  1KWO B;  3ZNI A;  1WDC B;  1GQM A;  1PRW A;  1J55 A;  3K21 A;  3BUN B;  3DD4 A;  1KK8 B;  4NQG A;  1NCY A;  3JTD C;  2KNE A;  1HT9 A;  5DKR A;  2I18 A;  2O5G A;  1NSH A;  1LKJ A;  3SG6 A;  5I8N A;  1F8H A;  1IJ5 A;  1Y1U A;  3KEV A;  2L0P A;  3EVV A;  1MXE A;  2Q91 A;  1IGV A;  3OHM B;  4D1E A;  2OTG B;  1ZUZ A;  1L2O C;  2HET A;  3CGA A;  1F70 A;  1JSA A;  1XO5 A;  2E30 A;  2COL B;  4I5J A;  5HKW A;  2LMT A;  2KAX A;  1IJ6 A;  2Y4Q A;  3CTN A;  2M7L A;  1IWQ A;  3SIA A;  3CR4 X;  1AJ4 A;  1DF0 B;  4HRE E;  1QIV A;  1S1E A;  2OTG C;  1NX3 A;  1QX7 A;  2MRD A;  4YBH B;  1A75 B;  1A03 A;  2NXQ A;  1QAT A;  2KI6 D;  4JWQ A;  4WQ2 A;  3GK1 A;  4HRH A;  5HKY A;  1F55 A;  1JF0 A;  4JQ0 D;  1XK4 A;  3LK0 A;  1PSB A;  1RFJ A;  1KQM C;  2JU0 A;  1SL9 A;  1KFX S;  5PAL A;  2EHB A;  1TIZ A;  1C07 A;  1J7Q A;  1DTL A;  1YTZ C;  2LVJ A;  1EL4 A;  2A4J A;  2RGI A;  2JUL A;  2G9B A;  4GPL B;  3EVU A;  1G8I A;  1Y6W A;  1SR6 C;  1QVI Z;  5AAN A;  1KQM B;  1QAS A;  1BJF A;  1ODB A;  2I2R E;  3RM1 A;  4MZJ A;  1JBA A;  3VRP A;  2M97 A;  3DVK A;  1KSM A;  2L5X B;  3AAK A;  1G4Y R;  1JUO A;  1SKT A;  4I5L B;  1G33 A;  3SIB A;  2JWW A;  1UHJ A;  3EKH A;  2BCX A;  2WND A;  3A8R A;  4YGE B;  4I5N B;  4PCW A;  2PRU A;  3AKA A;  4M2O A;  3TDI A;  5HKZ A;  2CCM A;  2KGB C;  1WLM A;  1OZS A;  1QV0 A;  2QPT A;  3BUO B;  3DF0 A;  2OS8 B;  2ZRS A;  4UPG A;  4YGC B;  4BY4 A;  2JXC A;  5K89 A;  3GK4 X;  5D69 A;  1ZFS A;  3M0W A;  1QVI Y;  3O4Y A;  1KSO A;  1QIW A;  1V1F A;  1S36 A;  1A29 A;  2GV5 A;  2M3W A;  2LC5 A;  1H8B A;  3PSR A;  4M2P A;  1DJY A;  2PMY A;  4YGB B;  3JVT C;  3TUY B;  3LL8 B;  4PHJ A;  3PN7 B;  3KHE A;  2JC2 A;  2MHH A;  3EK8 A;  1LVC D;  3PM8 A;  1NCX A;  2P6B B;  3O6B A;  5HYD A;  2M9G A;  4XJK A;  1OMV A;  2H61 A;  2WOR A;  4CFR A;  1CFC A;  1UHN A;  1EG3 A;  3BOW B;  2LVK A;  2WOS A;  1CNP A;  1PSR A;  3KF9 A;  3CLN A;  2K7C A;  2KDH A;  2OPO A;  1TRF A;  3BYA A;  2LE9 B;  2F3Y A;  1REC A;  2MLF C;  1KFU S;  1TNW A;  5G08 A;  3BQ3 A;  1TNX A;  4PHM A;  1BMO A;  1PAL A;  1M45 A;  4ORB B;  5I2L A;  3NSO A;  1DVI A;  3DVJ A;  1FPW A;  1LA0 A;  4DS7 A;  1GJY A;  1K96 A;  2JRF A;  1K8U A;  2KI4 C;  1BOD A;  1SK6 D;  1UHK A;  1K90 D;  4PHK A;  1NP8 A;  1LA3 A;  3I5H C;  1QJT A;  1CDP A;  1QX5 B;  1N65 A;  1YRT B;  1FW4 A;  4YGA A;  4YRU A;  4WQ3 A;  2BBN A;  2BL0 B;  1J1D A;  2MAZ A;  2L98 A;  2LLT A;  2F33 A;  2DOQ A;  4MZL A;  4AQI A;  3GOF A;  1SMG A;  3CR2 A;  1C7V A;  2AUC A;  4N1F A;  4DIR A;  5CSN A;  3NXA A;  4BY5 A;  4PE4 A;  2JT0 A;  1TTX A;  4MRY A;  4TNC A;  2HPS A;  1SCM B;  3PLF B;  1XFW O;  1SW8 A;  4MN0 A;  4GUK A;  4R1E A;  3EK4 A;  1Q80 A;  2I94 A;  1RRO A;  1DJW A;  1DMO A;  3TS5 C;  5CSF A;  4CFQ A;  2ZNE A;  5JJG A;  4ICB A;  4MEW A;  2KFF A;  3D0Y B;  1XK4 C;  2LLU A;  1LIN A;  2JXL A;  1K9K A;  3OX5 A;  1OE9 B;  2JTT A;  3KO0 A;  4GNK B;  1EXR A;  2KAV A;  4OVN F;  3WHT B;  2AAO A;  1X02 A;  1YUU A;  4GAO A;  3F45 A;  4XYN A;  4CID A;  3ZWH A;  1MQ1 A;  3OX6 A;  3BUX B;  1FF1 A;  3D10 A;  4NDB A;  1PUL A;  2WCF A;  1DJZ A;  1XA5 A;  3EKJ A;  1CLL A;  2L51 A;  1KK7 Z;  1MXL C;  1SPY A;  2ZN8 A;  3LLE A;  1K94 A;  1F54 A;  1DJH A;  2LAP A;  1LXF C;  1L7Z A;  1WLZ A;  1R6P A;  2JT3 A;  1M31 A;  1S26 D;  3I5I B;  1CLB A;  1WY9 A;  1W7J B;  3OP0 A;  1DF0 A;  1XFY O;  2M29 A;  1PVA A;  3IF7 A;  4E68 A;  1DGU A;  5BPJ A;  1B8R A;  2KYF A;  4PAL A;  3PFV A;  1B8C A;  3CWG A;  4C0L A;  1S6I A;  4ORC B;  1SYM A;  4OCI A;  2KOT A;  1YVL A;  4PE1 A;  1N2D A;  3CR5 X;  2LHI A;  2MLE C;  2OS8 C;  2LUC A;  5CSJ A;  4P5O E;  1S5G Z;  1YUR A;  1J7R A;  1KQV A;  1KCY A;  5TNC A;  3OB2 B;  2LVV A;  1CFF A;  4GGF C;  3ICB A;  2CT9 A;  3DVM A;  2V53 A;  1OMD A;  1DJX A;  3FS7 A;  3HCM A;  1J7P A;  2BCB A;  4PHN A;  5FYX A;  1F71 A;  1A4P A;  2F2O A;  1UUS A;  1NX2 A;  1CM4 A;  1RK9 A;  1KFX L;  3I5F C;  3PAL A;  1UWO A;  2K61 A;  2QAC A;  2HF5 A;  3KPX A;  5F6T A;  1AVS A;  3IQQ A;  5ER5 A;  1E8A A;  2IS9 A;  4CPV A;  1Y1A A;  5HLO A;  4NDC A;  1JFK A;  2FJU B;  1BT6 A;  3AKB A;  2KFH A;  1V1G A;  4MVF A;  1CDL A;  1D1O A;  4OV2 A;  3PAT A;  3TS5 B;  1CTR A;  5KTY A;  1NPQ A;  1YR5 A;  3BUM B;  2H61 C;  3OB1 B;  1K93 D;  3WHU B;  1SCM C;  4PE0 A;  1CM1 A;  2KYC A;  2LUX A;  1B7T Y;  1IQ5 A;  2JOJ A;  1EJ3 A;  2KI4 B;  1XFU O;  3D0Y A;  4OR9 B;  2F2P A;  2KHN A;  3TUY C;  5I2Q A;  1ZMZ A;  2L4I A;  4USL A;  5AEQ A;  4IL1 A;  2LNK A;  1JF2 A;  2FCD A;  2KAY A;  1DGV A;  3LCP C;  2Y5I A;  1SL7 A;  1ALV A;  4ORA B;  1B4C A;  1IRJ A;  1NX0 A;  1B8L A;  3LK1 A;  2BKI B;  4ZCU A;  3SG3 A;  4CLN A;  2WC8 A;  2KQ6 A;  1MR8 A;  1UP5 A;  3BXK A;  1ZAC A;  1UHH A;  2ZN9 A;  3I5I C;  2L2E A;  3VRO A;  1CMF A;  3FIA A;  2AMI A;  2R2I A;  4Q04 A;  1F4O A;  2CBL A;  1B47 A;  2L4H A;  1QXP A;  1R2U A;  3SJS A;  2K0J A;  1BG1 A;  2SAS A;  1U5I B;  4HSZ A;  1A75 A;  4NDD A;  1S5G Y;  2LVI A;  2MA2 A;  2NCO A;  1J1E A;  1TCO B;  1DJI A;  2M1U A;  1NUB A;  2O60 A;  2VRG A;  2ZFD A;  2LHL A;  1DT7 B;  1EG4 A;  3O78 A;  1BLQ A;  5AFP A;  1SNL A;  1CB1 A;  2BEC A;  1EH2 A;  1M39 A;  1OOJ A;  2F8P A;  4MSP A;  1SL8 A;  4QJ4 B;  1TOP A;  4QJ5 B;  1BOC A;  1AUI B;  1IH0 A;  5CSI A;  4A4B A;  2JNF A;  3FWB A;  4FTG A;  1F4Q A;  2NCP A;  2EC6 C;  2K8M B;  1CDM A;  4M2Q A;  2JQ6 A;  4WRI A;  1H4B A;  2LCP A;  4AQJ A;  1SY9 A;  2BBM A;  2CTN A;  1M63 B;  1B1G A;  1MUX A;  3TDU A;  3SG4 A;  1UUR A;  1A2X A;  1XFX O;  2K2A A;  2FCE A;  3H4S E;  5J3X A;  2MBX A;  4AOM A;  2EGD A;  3QRX A;  2M1K B;  2BE6 A;  2KGR A;  1QLS A;  5AXI A;  1BR4 B;  2WCE A;  3C1V A;  3EVR A;  1KWO C;  2D8N A;  3IQO A;  4DCK A;  1PVB A;  1JFJ A;  1GGW A;  1Y1X A;  3MSE B;  2M0R A;  3E3R A;  2LMV A;  4GBA A;  1OMR A;  2CXJ A;  2H2K A;  3BOW A;  1ALW A;  3CS1 A;  1OQP A;  3NSK A;  1XVJ A;  1L2O B;  1J7O A;  1KK7 Y;  4I5K A;  1U5I A;  4C0K A;  3TZ1 A;  2Y1N A;  1TN4 A;  5JOL A;  4PE7 A;  4F0Z B;  1BR1 B;  2ZRT A;  1AP4 A;  2LM5 A;  3VRQ A;  2PSR A;  5B8I B;  3VRN A;  2E6W A;  1PK0 D;  4OKH A;  1S6J A;  3A4U B;  1JWD A;  2NLN A;  3EK7 A;  4JPZ B;  3RLZ A;  1RTP 1;  1GGZ A;  1RWY A;  1IQ3 A;  3DVE A;  2KBI A;  1CKK A;  1SR6 B;  2EC6 B;  4YI8 A;  1YUS A;  1IKU A;  1JC2 A;  2GGZ A;  2LAN A;  1S6C A;  1SCV A;  3I5G B;  4PDZ A;  2PAL A;  4ETO A;  2KQY A;  4XJK B;  5D7F A;  1OZO A;  2K7O A;  4DRW A;  5DKN A;  2FOT A;  1XYD A;  3GK2 A;  4N1G A;  4ZCV A;  3O2P A;  4GGN A;  4P2Y B;  1VRK A;  1RJV A;  2F3Z A;  4DUQ A;  2I7A A;  1FI5 A;  2KI6 C;  2JZI A;  2MJW B;  2K7B A;  1HQV A;  2CNP A;  4N5X A;  1SBJ A;  1TNQ A;  1BU3 A;  1AHR A;  1FBV A;  1WRL A;  1YRU B;  4U8D A;  2B1U A;  1QTX A;  1AJ5 A;  2LV7 A;  3I5F B;  2PAS A;  4MBE A;  3BUW B;  4QJ3 B;  1CMG A;  4YI9 A; 
#chains in the Genus database with same CATH topology
 2K2F A;  3I5H B;  1UHI A;  2M49 B;  3SG2 A;  2M8U A;  3SS4 A;  1NYA A;  1QV1 A;  1CFP A;  1TNP A;  4A4C A;  1MF8 B;  2K7D A;  3N7H A;  3S0G A;  3TDZ A;  2JPT A;  2KBM A;  1QS7 A;  3PN7 C;  3FWC A;  3FE8 A;  1C7W A;  2PVB A;  3JVT B;  5AER A;  2ZKM X;  3S0F A;  3WXA A;  2TN4 A;  1KFU L;  2SCP A;  2GGM A;  3L47 A;  3NSL A;  4MZK A;  2WCJ A;  1B7T Z;  1CDN A;  1TCF A;  5GQQ C;  2ZND A;  2Y1M A;  5ER4 X;  1SRA A;  1NX1 A;  1QX2 A;  4MRX A;  1K9U A;  2ISD A;  2G2B A;  2KSP A;  1Y0V H;  2Q4U A;  4GFT A;  4L9M A;  1YX8 A;  1QLK A;  1MHO A;  1WRK A;  1NCZ A;  2LP3 A;  2YGU A;  5DKQ A;  1FI6 A;  1XFV O;  2JT8 A;  3BFH A;  3DF0 B;  3DY9 A;  3WNX B;  1DJG A;  4FQO A;  2BE4 A;  3CDN A;  4INW A;  3CZT X;  1CFD A;  3D74 A;  5IBW A;  2M7N A;  3NSI A;  1NWD A;  4FQT A;  2WCB A;  1YVH A;  3VRR A;  1N0Y A;  2BKH B;  2JTZ A;  3JTD B;  5KSZ A;  1OSA A;  5KU1 A;  1KK8 C;  1W7I B;  1IG5 A;  2JNX A;  2L50 A;  2NZ0 A;  5I2O A;  2LMU A;  5HLV A;  2LP2 A;  1XFZ O;  3SG5 A;  3VGO A;  1BF5 A;  4IJ7 A;  1TWO A;  5CPV A;  1AK8 A;  1WDC C;  1K2H A;  1CLM A;  1YUT A;  1WRZ A;  2BL0 C;  4MLW A;  4HRG A;  1B9A A;  1K9P A;  1NIW A;  2HQ8 A;  2KFG A;  1K95 A;  1S3P A;  2P71 A;  4GGF A;  4YGD B;  4C0J A;  3AAJ A;  1ZOT B;  2BCA A;  1MWN A;  2HQW A;  2LLS A;  1M46 A;  3HX4 A;  1YX7 A;  3SG7 A;  3I5G C;  1KWO B;  3ZNI A;  1WDC B;  2WC5 A;  1GQM A;  3BJH A;  1PRW A;  1J55 A;  3K21 A;  3BUN B;  3DD4 A;  1KK8 B;  4NQG A;  1NCY A;  3JTD C;  5FI7 A;  3SS5 A;  2KNE A;  1HT9 A;  5DKR A;  2I18 A;  2O5G A;  1NSH A;  1LKJ A;  3BFA A;  3SG6 A;  5I8N A;  1F8H A;  1IJ5 A;  1Y1U A;  3KEV A;  3OBV A;  2WCH A;  2KPH A;  2L0P A;  3EVV A;  1MXE A;  2Q91 A;  1IGV A;  3OHM B;  4D1E A;  2OTG B;  1ZUZ A;  1L2O C;  2HET A;  3CGA A;  1F70 A;  1JSA A;  1XO5 A;  2E30 A;  2COL B;  4I5J A;  5HKW A;  2LMT A;  2KAX A;  1IJ6 A;  2Y4Q A;  3CTN A;  2M7L A;  1IWQ A;  3SIA A;  3CR4 X;  1AJ4 A;  1DF0 B;  4HRE E;  1T14 A;  1QIV A;  1S1E A;  5DIC A;  2OTG C;  1NX3 A;  1QX7 A;  2MRD A;  4YBH B;  1A75 B;  1A03 A;  2NXQ A;  3L4A A;  1QAT A;  2KI6 D;  4JWQ A;  4KYN A;  4WQ2 A;  3GK1 A;  4HRH A;  5HKY A;  1F55 A;  1JF0 A;  4JQ0 D;  1XK4 A;  3D77 A;  3LK0 A;  1PSB A;  1RFJ A;  1KQM C;  2JU0 A;  1SL9 A;  1KFX S;  5PAL A;  2EHB A;  1TIZ A;  1C07 A;  1J7Q A;  1DTL A;  1YTZ C;  2LVJ A;  1IIO A;  1EL4 A;  2A4J A;  3R1V A;  2RGI A;  2JUL A;  2G9B A;  4GPL B;  3EVU A;  1G8I A;  1Y6W A;  1SR6 C;  1QVI Z;  5AAN A;  1KQM B;  1Z4H A;  1QAS A;  1BJF A;  1ODB A;  2I2R E;  3B7A A;  3RM1 A;  4MZJ A;  1JBA A;  3VRP A;  2M97 A;  3S0A A;  1ORG A;  3DVK A;  1KSM A;  2GTE A;  2L5X B;  3CZ1 A;  3AAK A;  1P28 A;  1G4Y R;  3B88 A;  1JUO A;  1SKT A;  4I5L B;  1G33 A;  3SIB A;  2JWW A;  1UHJ A;  3EKH A;  2BCX A;  2PYQ A;  2WND A;  3A8R A;  4YGE B;  4I5N B;  4PCW A;  2PRU A;  3AKA A;  4M2O A;  1DQE A;  5HKZ A;  3TDI A;  2CCM A;  2KGB C;  1WLM A;  1OZS A;  1QV0 A;  1GM0 A;  2QPT A;  3BUO B;  1DC1 A;  3DF0 A;  2OS8 B;  2ZRS A;  4UPG A;  4YGC B;  4BY4 A;  2JXC A;  5K89 A;  3GK4 X;  5D69 A;  1ZFS A;  3B6X A;  3R72 A;  3M0W A;  1QVI Y;  3O4Y A;  1KSO A;  1QIW A;  1V1F A;  1S36 A;  1A29 A;  2GV5 A;  2M3W A;  2LC5 A;  1H8B A;  3PSR A;  4M2P A;  1DJY A;  2PMY A;  4YGB B;  3JVT C;  1SSE B;  3TUY B;  3LL8 B;  4PHJ A;  2WC6 A;  3PN7 B;  3KHE A;  2JC2 A;  2MHH A;  3EK8 A;  3V2L A;  1LVC D;  3PM8 A;  1NCX A;  2P6B B;  3O6B A;  5HYD A;  2M9G A;  4XJK A;  1OMV A;  2H61 A;  2WOR A;  4CFR A;  1CFC A;  1UHN A;  1EG3 A;  3BOW B;  2LVK A;  2WOS A;  1CNP A;  1PSR A;  3KF9 A;  3CLN A;  3NHT A;  1DEK A;  2K7C A;  2KDH A;  2OPO A;  1TRF A;  3BYA A;  2LE9 B;  2F3Y A;  1REC A;  2MLF C;  1KFU S;  1TNW A;  1LS8 A;  2L2C A;  4PT1 A;  3BQ3 A;  5G08 A;  1C3Y A;  1TNX A;  4PHM A;  1BMO A;  1PAL A;  1M45 A;  4ORB B;  5I2L A;  3NSO A;  1DVI A;  3DVJ A;  1FPW A;  1LA0 A;  4DS7 A;  1GJY A;  1K96 A;  2JRF A;  1K8U A;  2KI4 C;  1BOD A;  1SK6 D;  1UHK A;  1K90 D;  4PHK A;  1NP8 A;  1LA3 A;  3I5H C;  1QJT A;  1CDP A;  1QX5 B;  1N65 A;  1YRT B;  3UO9 A;  1FW4 A;  4YGA A;  2P70 A;  4YRU A;  4WQ3 A;  2BBN A;  2BL0 B;  1J1D A;  2MAZ A;  2L98 A;  2JPO A;  2LLT A;  2F33 A;  2DOQ A;  4MZL A;  4AQI A;  3GOF A;  1SMG A;  3CR2 A;  1C7V A;  2AUC A;  4N1F A;  4DIR A;  5CSN A;  3NXA A;  4BY5 A;  4PE4 A;  2JT0 A;  1TTX A;  4MRY A;  4TNC A;  2HPS A;  1SCM B;  3PLF B;  1XFW O;  1SW8 A;  4MN0 A;  4GUK A;  3NGV A;  3R1O A;  4R1E A;  3EK4 A;  1Q80 A;  2I94 A;  1RRO A;  2K60 A;  1DJW A;  1DMO A;  3TS5 C;  5CSF A;  2WCK A;  2ZNE A;  4CFQ A;  4ICB A;  4MEW A;  5JJG A;  3UNW A;  2KFF A;  3D0Y B;  1XK4 C;  2LLU A;  1LIN A;  2JXL A;  1K9K A;  3OX5 A;  1OE9 B;  2JTT A;  3KO0 A;  4GNK B;  1EXR A;  2KAV A;  4OVN F;  5EL2 A;  3WHT B;  2AAO A;  1X02 A;  1YUU A;  4GAO A;  1OW4 A;  3F45 A;  4XYN A;  4CID A;  3ZWH A;  1MQ1 A;  5FI2 A;  3D78 A;  4OZD A;  3OX6 A;  3BUX B;  1FF1 A;  3D10 A;  4NDB A;  1PUL A;  2WCF A;  1DJZ A;  1XA5 A;  3EKJ A;  3QME A;  3DYE A;  1CLL A;  2L51 A;  1KK7 Z;  1MXL C;  1SPY A;  2ZN8 A;  3LLE A;  1K94 A;  1F54 A;  1DJH A;  2LAP A;  1LXF C;  3PJI A;  5HL1 A;  1L7Z A;  1WLZ A;  1R6P A;  2JT3 A;  3EG5 B;  1M31 A;  1S26 D;  3I5I B;  1CLB A;  3B86 A;  1WY9 A;  1W7J B;  3OP0 A;  1DF0 A;  2WCL A;  1XFY O;  2M29 A;  1PVA A;  3IF7 A;  4E68 A;  1C3Z A;  1DGU A;  1OOI X;  1B8R A;  2KYF A;  4PAL A;  5BPJ A;  3PFV A;  1B8C A;  3CWG A;  3OGN A;  2QEH A;  4C0L A;  1S6I A;  4ORC B;  1TUJ A;  1SYM A;  3DXL A;  4OCI A;  2KOT A;  1YVL A;  4PE1 A;  1N2D A;  3CR5 X;  2LHI A;  2MLE C;  2OS8 C;  2LUC A;  5CSJ A;  4JD9 A;  4P5O E;  3SS3 A;  3FE6 A;  1S5G Z;  1YUR A;  2KLE A;  1J7R A;  1KQV A;  1W9Z A;  1KCY A;  5TNC A;  3OB2 B;  2LVV A;  1CFF A;  4GGF C;  3ICB A;  3S0B A;  3L4L A;  2CT9 A;  3DVM A;  2V53 A;  1OMD A;  1DJX A;  3FS7 A;  3HCM A;  3O4X A;  2BCB A;  1J7P A;  4PHN A;  5FYX A;  1F71 A;  1A4P A;  2F2O A;  1UUS A;  1NX2 A;  1CM4 A;  1DEL A;  3R1P A;  1RK9 A;  1KFX L;  1XFR A;  3I5F C;  3PAL A;  2WCM A;  1UWO A;  2K61 A;  2QAC A;  2HF5 A;  3KPX A;  5F6T A;  1AVS A;  3IQQ A;  5ER5 A;  1E8A A;  2IS9 A;  4CPV A;  1Y1A A;  5HLO A;  2QEO A;  2H8V A;  1JFK A;  2FJU B;  4NDC A;  1BT6 A;  3AKB A;  2KFH A;  1V1G A;  4MVF A;  1CDL A;  1D1O A;  4OV2 A;  3CYZ A;  3PAT A;  3TS5 B;  1CTR A;  5KTY A;  1NPQ A;  1YR5 A;  3BUM B;  2H61 C;  3OB1 B;  3IVT A;  1K93 D;  3WHU B;  1SCM C;  4PE0 A;  1CM1 A;  2KYC A;  2LUX A;  5I94 A;  1B7T Y;  1IQ5 A;  2JOJ A;  1EJ3 A;  2KI4 B;  1XFU O;  3D0Y A;  4OR9 B;  2F2P A;  2KHN A;  3TUY C;  3D76 A;  1ZMZ A;  5I2Q A;  2L4I A;  4USL A;  5AEQ A;  3K1E A;  4IL1 A;  2LNK A;  1JF2 A;  2FCD A;  2KAY A;  1DGV A;  3LCP C;  2Y5I A;  3DZT A;  1SL7 A;  1ALV A;  4ORA B;  2BNX A;  1IRJ A;  1B4C A;  1NX0 A;  1B8L A;  3LK1 A;  2BKI B;  3CAB A;  4ZCU A;  3SG3 A;  4CLN A;  2WC8 A;  2KQ6 A;  1MR8 A;  1UP5 A;  3BXK A;  1ZAC A;  2QDI A;  1UHH A;  2ZN9 A;  3I5I C;  2L2E A;  3VRO A;  1CMF A;  3FIA A;  2AMI A;  2R2I A;  3D75 A;  4Q04 A;  1F4O A;  2CBL A;  1B47 A;  2L4H A;  3B87 A;  1QXP A;  5FI6 A;  3VB1 A;  1R2U A;  3SJS A;  2K0J A;  1BG1 A;  2SAS A;  1U5I B;  4HSZ A;  1A75 A;  4NDD A;  1S5G Y;  2LVI A;  2MA2 A;  2NCO A;  1J1E A;  1TCO B;  1DJI A;  2M1U A;  1NUB A;  2O60 A;  2VRG A;  2ZFD A;  2LHL A;  1DT7 B;  1EG4 A;  3O78 A;  1BLQ A;  5AFP A;  1SNL A;  1CB1 A;  2BEC A;  1EH2 A;  1M39 A;  1OOJ A;  2F8P A;  4MSP A;  1SL8 A;  4QJ4 B;  1TOP A;  4QJ5 B;  1BOC A;  1AUI B;  1IH0 A;  5CSI A;  4A4B A;  2JNF A;  3FWB A;  4FTG A;  1F4Q A;  2NCP A;  2EC6 C;  5D3O A;  2K8M B;  1CDM A;  2ERB A;  4M2Q A;  2JQ6 A;  4WRI A;  1H4B A;  2LCP A;  4AQJ A;  1SY9 A;  2BBM A;  2CTN A;  1M63 B;  2KLD A;  3S0E A;  1B1G A;  1MUX A;  3TDU A;  1QWV A;  3SG4 A;  1UUR A;  1A2X A;  1XFX O;  2K2A A;  2FCE A;  2QEB A;  3H4S E;  5J3X A;  2MBX A;  2EGD A;  4AOM A;  3QRX A;  2M1K B;  2BE6 A;  1OOH A;  2KGR A;  1QLS A;  2L5Y A;  5AXI A;  3Q8I A;  1BR4 B;  2WCE A;  3C1V A;  1OOG A;  3EVR A;  1KWO C;  2D8N A;  3IQO A;  4DCK A;  1PVB A;  1JFJ A;  1GGW A;  1Y1X A;  3MSE B;  2M0R A;  3E3R A;  2LMV A;  4GBA A;  1OMR A;  4INX A;  2CXJ A;  2H2K A;  3BOW A;  3CZ0 A;  3PM2 A;  1ALW A;  3CS1 A;  1OQP A;  3NSK A;  1XVJ A;  1L2O B;  1OOF A;  1J7O A;  1KK7 Y;  4I5K A;  1U5I A;  4C0K A;  3TZ1 A;  2Y1N A;  1TN4 A;  5JOL A;  4PE7 A;  4F0Z B;  1BR1 B;  3S0D A;  2ZRT A;  1AP4 A;  2LM5 A;  1TUZ A;  2PSR A;  3VRQ A;  5B8I B;  3VRN A;  4F7F A;  2E6W A;  1PK0 D;  2FJY A;  4OKH A;  1S6J A;  3A4U B;  1JWD A;  2NLN A;  3EK7 A;  4JPZ B;  3RLZ A;  1RTP 1;  2BAP A;  1GGZ A;  1RWY A;  1IQ3 A;  3DVE A;  2KBI A;  1CKK A;  1SR6 B;  2EC6 B;  4YI8 A;  1YUS A;  1IKU A;  1JC2 A;  2GGZ A;  2LAN A;  1S6C A;  1SCV A;  3D73 A;  3CZ2 A;  3I5G B;  2QEV A;  4PDZ A;  2PAL A;  4ETO A;  2KQY A;  4XJK B;  5D7F A;  1OZO A;  2K7O A;  4DRW A;  5DKN A;  2FOT A;  1XYD A;  3GK2 A;  4N1G A;  3BFB A;  4JKT A;  4ZCV A;  3O2P A;  1Z2C B;  3NHI A;  4GGN A;  1VRK A;  1RJV A;  2F3Z A;  4P2Y B;  2PQL A;  2I7A A;  4DUQ A;  1FI5 A;  2KI6 C;  2JZI A;  2MJW B;  2K7B A;  1HQV A;  2CNP A;  4N5X A;  1SBJ A;  1TNQ A;  1BU3 A;  3FE9 A;  1AHR A;  1FBV A;  1WRL A;  1YRU B;  4U8D A;  2B1U A;  1QTX A;  3RZS A;  1AJ5 A;  2LV7 A;  3I5F B;  2PAS A;  4MBE A;  3BUW B;  4QJ3 B;  1CMG A;  4YI9 A; 
#chains in the Genus database with same CATH homology
 2K2F A;  3I5H B;  1UHI A;  2M49 B;  3SG2 A;  2M8U A;  1NYA A;  1QV1 A;  1CFP A;  1TNP A;  4A4C A;  1MF8 B;  2K7D A;  3TDZ A;  2JPT A;  2KBM A;  1QS7 A;  3PN7 C;  3FWC A;  1C7W A;  2PVB A;  3JVT B;  5AER A;  2ZKM X;  3WXA A;  2TN4 A;  1KFU L;  2SCP A;  2GGM A;  4MZK A;  3NSL A;  1CDN A;  1B7T Z;  1TCF A;  5GQQ C;  2ZND A;  2Y1M A;  5ER4 X;  1SRA A;  1NX1 A;  1QX2 A;  4MRX A;  1K9U A;  2ISD A;  2G2B A;  2KSP A;  1Y0V H;  2Q4U A;  4GFT A;  4L9M A;  1YX8 A;  1QLK A;  1MHO A;  1WRK A;  1NCZ A;  2LP3 A;  5DKQ A;  1FI6 A;  1XFV O;  2JT8 A;  3DF0 B;  3WNX B;  1DJG A;  4FQO A;  2BE4 A;  3CZT X;  1CFD A;  5IBW A;  2M7N A;  3NSI A;  1NWD A;  3VRR A;  2WCB A;  1YVH A;  1N0Y A;  2BKH B;  2JTZ A;  3JTD B;  5KSZ A;  1OSA A;  5KU1 A;  1KK8 C;  1W7I B;  1IG5 A;  2JNX A;  2L50 A;  2NZ0 A;  5I2O A;  2LMU A;  5HLV A;  2LP2 A;  1XFZ O;  3SG5 A;  3VGO A;  1BF5 A;  5CPV A;  1AK8 A;  1WDC C;  1K2H A;  1CLM A;  1YUT A;  1WRZ A;  2BL0 C;  4MLW A;  4HRG A;  1B9A A;  1K9P A;  1NIW A;  2HQ8 A;  2KFG A;  1K95 A;  1S3P A;  4GGF A;  4YGD B;  4C0J A;  3AAJ A;  1ZOT B;  2BCA A;  1MWN A;  2HQW A;  2LLS A;  1M46 A;  3HX4 A;  1YX7 A;  3SG7 A;  3I5G C;  1KWO B;  3ZNI A;  1WDC B;  1GQM A;  1PRW A;  1J55 A;  3K21 A;  3BUN B;  3DD4 A;  1KK8 B;  4NQG A;  1NCY A;  3JTD C;  2KNE A;  1HT9 A;  5DKR A;  2I18 A;  2O5G A;  1NSH A;  1LKJ A;  3SG6 A;  5I8N A;  1F8H A;  1IJ5 A;  1Y1U A;  3KEV A;  2L0P A;  3EVV A;  1MXE A;  2Q91 A;  1IGV A;  3OHM B;  4D1E A;  2OTG B;  1ZUZ A;  1L2O C;  2HET A;  3CGA A;  1F70 A;  1JSA A;  1XO5 A;  2E30 A;  2COL B;  4I5J A;  5HKW A;  2LMT A;  2KAX A;  1IJ6 A;  2Y4Q A;  3CTN A;  2M7L A;  1IWQ A;  3SIA A;  3CR4 X;  1AJ4 A;  1DF0 B;  4HRE E;  1QIV A;  1S1E A;  2OTG C;  1NX3 A;  1QX7 A;  2MRD A;  4YBH B;  1A75 B;  1A03 A;  2NXQ A;  1QAT A;  2KI6 D;  4JWQ A;  4WQ2 A;  3GK1 A;  4HRH A;  5HKY A;  1F55 A;  1JF0 A;  4JQ0 D;  1XK4 A;  3LK0 A;  1PSB A;  1RFJ A;  1KQM C;  2JU0 A;  1SL9 A;  1KFX S;  5PAL A;  2EHB A;  1TIZ A;  1C07 A;  1J7Q A;  1DTL A;  1YTZ C;  2LVJ A;  1EL4 A;  2A4J A;  2RGI A;  2JUL A;  2G9B A;  4GPL B;  3EVU A;  1G8I A;  1Y6W A;  1SR6 C;  1QVI Z;  5AAN A;  1KQM B;  1QAS A;  1BJF A;  1ODB A;  2I2R E;  3RM1 A;  4MZJ A;  1JBA A;  3VRP A;  2M97 A;  3DVK A;  1KSM A;  2L5X B;  3AAK A;  1G4Y R;  1JUO A;  1SKT A;  4I5L B;  1G33 A;  3SIB A;  2JWW A;  1UHJ A;  3EKH A;  2BCX A;  2WND A;  3A8R A;  4YGE B;  4I5N B;  4PCW A;  2PRU A;  3AKA A;  4M2O A;  3TDI A;  5HKZ A;  2CCM A;  2KGB C;  1WLM A;  1OZS A;  1QV0 A;  2QPT A;  3BUO B;  3DF0 A;  2OS8 B;  2ZRS A;  4UPG A;  4YGC B;  4BY4 A;  2JXC A;  5K89 A;  3GK4 X;  5D69 A;  1ZFS A;  3M0W A;  1QVI Y;  3O4Y A;  1KSO A;  1QIW A;  1V1F A;  1S36 A;  1A29 A;  2GV5 A;  2M3W A;  2LC5 A;  1H8B A;  3PSR A;  4M2P A;  1DJY A;  2PMY A;  4YGB B;  3JVT C;  3TUY B;  3LL8 B;  4PHJ A;  3PN7 B;  3KHE A;  2JC2 A;  2MHH A;  3EK8 A;  1LVC D;  3PM8 A;  1NCX A;  2P6B B;  3O6B A;  5HYD A;  2M9G A;  4XJK A;  1OMV A;  2H61 A;  2WOR A;  4CFR A;  1CFC A;  1UHN A;  1EG3 A;  3BOW B;  2LVK A;  2WOS A;  1CNP A;  1PSR A;  3KF9 A;  3CLN A;  2K7C A;  2KDH A;  2OPO A;  1TRF A;  3BYA A;  2LE9 B;  2F3Y A;  1REC A;  2MLF C;  1KFU S;  1TNW A;  5G08 A;  3BQ3 A;  1TNX A;  4PHM A;  1BMO A;  1PAL A;  1M45 A;  4ORB B;  5I2L A;  3NSO A;  1DVI A;  3DVJ A;  1FPW A;  1LA0 A;  4DS7 A;  1GJY A;  1K96 A;  2JRF A;  1K8U A;  2KI4 C;  1BOD A;  1SK6 D;  1UHK A;  1K90 D;  4PHK A;  1NP8 A;  1LA3 A;  3I5H C;  1QJT A;  1CDP A;  1QX5 B;  1N65 A;  1YRT B;  1FW4 A;  4YGA A;  4YRU A;  4WQ3 A;  2BBN A;  2BL0 B;  1J1D A;  2MAZ A;  2L98 A;  2LLT A;  2F33 A;  2DOQ A;  4MZL A;  4AQI A;  3GOF A;  1SMG A;  3CR2 A;  1C7V A;  2AUC A;  4N1F A;  4DIR A;  5CSN A;  3NXA A;  4BY5 A;  4PE4 A;  2JT0 A;  1TTX A;  4MRY A;  4TNC A;  2HPS A;  1SCM B;  3PLF B;  1XFW O;  1SW8 A;  4MN0 A;  4GUK A;  4R1E A;  3EK4 A;  1Q80 A;  2I94 A;  1RRO A;  1DJW A;  1DMO A;  3TS5 C;  5CSF A;  4CFQ A;  2ZNE A;  5JJG A;  4ICB A;  4MEW A;  2KFF A;  3D0Y B;  1XK4 C;  2LLU A;  1LIN A;  2JXL A;  1K9K A;  3OX5 A;  1OE9 B;  2JTT A;  3KO0 A;  4GNK B;  1EXR A;  2KAV A;  4OVN F;  3WHT B;  2AAO A;  1X02 A;  1YUU A;  4GAO A;  3F45 A;  4XYN A;  4CID A;  3ZWH A;  1MQ1 A;  3OX6 A;  3BUX B;  1FF1 A;  3D10 A;  4NDB A;  1PUL A;  2WCF A;  1DJZ A;  1XA5 A;  3EKJ A;  1CLL A;  2L51 A;  1KK7 Z;  1MXL C;  1SPY A;  2ZN8 A;  3LLE A;  1K94 A;  1F54 A;  1DJH A;  2LAP A;  1LXF C;  1L7Z A;  1WLZ A;  1R6P A;  2JT3 A;  1M31 A;  1S26 D;  3I5I B;  1CLB A;  1WY9 A;  1W7J B;  3OP0 A;  1DF0 A;  1XFY O;  2M29 A;  1PVA A;  3IF7 A;  4E68 A;  1DGU A;  5BPJ A;  1B8R A;  2KYF A;  4PAL A;  3PFV A;  1B8C A;  3CWG A;  4C0L A;  1S6I A;  4ORC B;  1SYM A;  4OCI A;  2KOT A;  1YVL A;  4PE1 A;  1N2D A;  3CR5 X;  2LHI A;  2MLE C;  2OS8 C;  2LUC A;  5CSJ A;  4P5O E;  1S5G Z;  1YUR A;  1J7R A;  1KQV A;  1KCY A;  5TNC A;  3OB2 B;  2LVV A;  1CFF A;  4GGF C;  3ICB A;  2CT9 A;  3DVM A;  2V53 A;  1OMD A;  1DJX A;  3FS7 A;  3HCM A;  1J7P A;  2BCB A;  4PHN A;  5FYX A;  1F71 A;  1A4P A;  2F2O A;  1UUS A;  1NX2 A;  1CM4 A;  1RK9 A;  1KFX L;  3I5F C;  3PAL A;  1UWO A;  2K61 A;  2QAC A;  2HF5 A;  3KPX A;  5F6T A;  1AVS A;  3IQQ A;  5ER5 A;  1E8A A;  2IS9 A;  4CPV A;  1Y1A A;  5HLO A;  4NDC A;  1JFK A;  2FJU B;  1BT6 A;  3AKB A;  2KFH A;  1V1G A;  4MVF A;  1CDL A;  1D1O A;  4OV2 A;  3PAT A;  3TS5 B;  1CTR A;  5KTY A;  1NPQ A;  1YR5 A;  3BUM B;  2H61 C;  3OB1 B;  1K93 D;  3WHU B;  1SCM C;  4PE0 A;  1CM1 A;  2KYC A;  2LUX A;  1B7T Y;  1IQ5 A;  2JOJ A;  1EJ3 A;  2KI4 B;  1XFU O;  3D0Y A;  4OR9 B;  2F2P A;  2KHN A;  3TUY C;  5I2Q A;  1ZMZ A;  2L4I A;  4USL A;  5AEQ A;  4IL1 A;  2LNK A;  1JF2 A;  2FCD A;  2KAY A;  1DGV A;  3LCP C;  2Y5I A;  1SL7 A;  1ALV A;  4ORA B;  1B4C A;  1IRJ A;  1NX0 A;  1B8L A;  3LK1 A;  2BKI B;  4ZCU A;  3SG3 A;  4CLN A;  2WC8 A;  2KQ6 A;  1MR8 A;  1UP5 A;  3BXK A;  1ZAC A;  1UHH A;  2ZN9 A;  3I5I C;  2L2E A;  3VRO A;  1CMF A;  3FIA A;  2AMI A;  2R2I A;  4Q04 A;  1F4O A;  2CBL A;  1B47 A;  2L4H A;  1QXP A;  1R2U A;  3SJS A;  2K0J A;  1BG1 A;  2SAS A;  1U5I B;  4HSZ A;  1A75 A;  4NDD A;  1S5G Y;  2LVI A;  2MA2 A;  2NCO A;  1J1E A;  1TCO B;  1DJI A;  2M1U A;  1NUB A;  2O60 A;  2VRG A;  2ZFD A;  2LHL A;  1DT7 B;  1EG4 A;  3O78 A;  1BLQ A;  5AFP A;  1SNL A;  1CB1 A;  2BEC A;  1EH2 A;  1M39 A;  1OOJ A;  2F8P A;  4MSP A;  1SL8 A;  4QJ4 B;  1TOP A;  4QJ5 B;  1BOC A;  1AUI B;  1IH0 A;  5CSI A;  4A4B A;  2JNF A;  3FWB A;  4FTG A;  1F4Q A;  2NCP A;  2EC6 C;  2K8M B;  1CDM A;  4M2Q A;  2JQ6 A;  4WRI A;  1H4B A;  2LCP A;  4AQJ A;  1SY9 A;  2BBM A;  2CTN A;  1M63 B;  1B1G A;  1MUX A;  3TDU A;  3SG4 A;  1UUR A;  1A2X A;  1XFX O;  2K2A A;  2FCE A;  3H4S E;  5J3X A;  2MBX A;  4AOM A;  2EGD A;  3QRX A;  2M1K B;  2BE6 A;  2KGR A;  1QLS A;  5AXI A;  1BR4 B;  2WCE A;  3C1V A;  3EVR A;  1KWO C;  2D8N A;  3IQO A;  4DCK A;  1PVB A;  1JFJ A;  1GGW A;  1Y1X A;  3MSE B;  2M0R A;  3E3R A;  2LMV A;  4GBA A;  1OMR A;  2CXJ A;  2H2K A;  3BOW A;  1ALW A;  3CS1 A;  1OQP A;  3NSK A;  1XVJ A;  1L2O B;  1J7O A;  1KK7 Y;  4I5K A;  1U5I A;  4C0K A;  3TZ1 A;  2Y1N A;  1TN4 A;  5JOL A;  4PE7 A;  4F0Z B;  1BR1 B;  2ZRT A;  1AP4 A;  2LM5 A;  3VRQ A;  2PSR A;  5B8I B;  3VRN A;  2E6W A;  1PK0 D;  4OKH A;  1S6J A;  3A4U B;  1JWD A;  2NLN A;  3EK7 A;  4JPZ B;  3RLZ A;  1RTP 1;  1GGZ A;  1RWY A;  1IQ3 A;  3DVE A;  2KBI A;  1CKK A;  1SR6 B;  2EC6 B;  4YI8 A;  1YUS A;  1IKU A;  1JC2 A;  2GGZ A;  2LAN A;  1S6C A;  1SCV A;  3I5G B;  4PDZ A;  2PAL A;  4ETO A;  2KQY A;  4XJK B;  5D7F A;  1OZO A;  2K7O A;  4DRW A;  5DKN A;  2FOT A;  1XYD A;  3GK2 A;  4N1G A;  4ZCV A;  3O2P A;  4GGN A;  4P2Y B;  1VRK A;  1RJV A;  2F3Z A;  4DUQ A;  2I7A A;  1FI5 A;  2KI6 C;  2JZI A;  2MJW B;  2K7B A;  1HQV A;  2CNP A;  4N5X A;  1SBJ A;  1TNQ A;  1BU3 A;  1AHR A;  1FBV A;  1WRL A;  1YRU B;  4U8D A;  2B1U A;  1QTX A;  1AJ5 A;  2LV7 A;  3I5F B;  2PAS A;  4MBE A;  3BUW B;  4QJ3 B;  1CMG A;  4YI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...