1S6IA

Ca2+-regulatory region (cld) from soybean calcium-dependent protein kinase-alpha (cdpk) in the presence of ca2+ and the junction domain (jd)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
182
structure length
182
Chain Sequence
AERLSEEEIGGLKELFKMIDTDNSGTITFDELKDGLKRVGSELMESEIKDLMDAADIDKSGTIDYGEFIAATVHLNKLEREENLVSAFSYFDKDGSGYITLDEIQQACKDFGLDDIHIDDMIKEIDQDNDGQIDYGEFAAMMRKRKGNGGIGRRTMRKTLNLRDALGLVDNGSNQVIEGYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protein kinase SK5
publication title Unexpected structure of the Ca2+-regulatory region from soybean calcium-dependent protein kinase-alpha
pubmed doi rcsb
source organism Glycine max
molecule tags Transferase, plant protein
total genus 24
structure length 182
sequence length 182
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s6iA02
2KGBC 1G4YR 2H61A 2KI4C 2OTGB 3D0YA 2LMUA 1KFUS 2M7LA 1QTXA 1NX0A 1NSHA 1CFDA 1J7QA 1ODBA 4MSPA 2K61A 1M31A 4N1GA 3VRRA 4GPLB 1K96A 3EK7A 2OS8B 2WC8A 1QX5B 2LHLA 3FS7A 3SG4A 3PLFB 1PSRA 1L7ZA 1Y1UA 1WY9A 1V1FA 2B1UA 1XFZO 1GJYA 1OSAA 1QIVA 2KNEA 1J1DA 2NCOA 5CSNA 1A03A 3CTNA 2KQYA 4WQ3A 1PSBA 2AUCA 3CWGA 2IS9A 5HKZA 1SL9A 5I2QA 3SIBA 4PHKA 1CFPA 3PALA 4D1EA 1BLQA 2QPTA 2CTNA 2K7OA 1NWDA 1YRTB 1UHHA 3BOWB 1TNPA 2V53A 3BUNB 3ICBA 1WDCC 2COLB 3EVRA 1C07A 4YGDB 1A2XA 1KFXL 1AK8A 1OQPA 1CM1A 1AUIB 1MQ1A 2ZNDA 1DJIA 1EG3A 1A75B 1G8IA 1UHKA 2WORA 3NXAA 3CLNA 2LHIA 2BCXA 2M1KB 1B8CA 1PVAA 1AHRA 5KU1A 1LINA 4C0KA 1IH0A 2L51A 1MUXA 1TRFA 3FWBA 5CPVA 1BJFA 4PHJA 2JULA 2JXCA 4GUKA 3WHUB 2KAYA 1QLSA 5I2OA 2CXJA 3DD4A 1KQMC 2ISDA 2KI6C 1QIWA 1Y1XA 5FYXA 2ZFDA 2OTGC 3BUMB 1OMDA 4Q04A 1YX8A 3BXKA 3AKAA 4GFTA 2M3WA 5BPJA 3TZ1A 3LK1A 4PE7A 1GGWA 1S3PA 1S5GY 3OHMB 4PE1A 4QJ5B 5IBWA 1B7TY 1XFWO 4PALA 3LLEA 5HKWA 2OS8C 1XA5A 4OCIA 4MLWA 2ZKMX 2LVKA 4XJKB 3RM1A 4ORAB 2MRDA 1BOCA 2CNPA 1KSOA 1BR4B 1TTXA 3PFVA 1LA0A 1CB1A 1B47A 2F8PA 3PM8A 2I94A 1IQ3A 1BMOA 1K2HA 3KO0A 3VROA 2NXQA 4UPGA 2M29A 2SCPA 3VGOA 1CNPA 1K9PA 3FIAA 4ORCB 1SY9A 1H8BA 4QJ4B 1MXLC 1NPQA 2JNFA 2PRUA 1UHIA 1CLBA 1YTZC 2KYFA 4GGFA 1B8LA 2G9BA 5KTYA 1J7PA 1R2UA 1DJYA 1Y0VH 3CZTX 3TUYB 2M49B 2M9GA 2O60A 4JQ0D 5B8IB 4I5KA 1UWOA 3QRXA 1RK9A 4MEWA 2Q91A 1ZOTB 3K21A 2K0JA 1YURA 2KGRA 4ORBB 3EKJA 2JT0A 2MLEC 2JQ6A 4A4BA 1NP8A 1NCXA 1YX7A 5DKRA 2JTZA 2F33A 2LMTA 2BKIB 2PVBA 1NX3A 2LNKA 1RROA 3IF7A 2MHHA 2JPTA 2LLUA 4P5OE 1QX2A 4MVFA 1PVBA 1LVCD 2Y1NA 4HSZA 1B7TZ 2JU0A 4CIDA 1QATA 2M97A 4YGBB 5HLVA 5DKQA 1DJZA 2A4JA 3F45A 2E6WA 4MRXA 3E3RA 4QJ3B 3KHEA 2F2PA 2JOJA 1QV1A 3A4UB 2L98A 4AOMA 1XO5A 3EVUA 1DMOA 1JSAA 2M1UA 2DOQA 4XYNA 4DIRA 1XFYO 1DJHA 3I5HB 1QVIY 1GQMA 1SK6D 1ZFSA 1FBVA 4ICBA 3IQOA 5D7FA 2KFFA 3EKHA 4P2YB 1F4OA 3HCMA 1K95A 1JWDA 1SPYA 1JBAA 1IKUA 1YUUA 1DGVA 1TOPA 1UP5A 1LKJA 2E30A 4MZJA 2EGDA 4GBAA 2LC5A 2Y4QA 1M46A 1QV0A 3JTDB 3TUYC 1RWYA 5J3XA 3O6BA 3I5GB 2BCAA 5TNCA 2KBIA 2KFGA 3DF0B 2KAXA 5I8NA 1CDPA 1QJTA 1HQVA 3DVJA 2LVJA 1U5IB 2Y1MA 1N2DA 4MZKA 2SASA 1FPWA 2KBMA 2LE9B 1F4QA 1XFVO 1BODA 4GNKB 4JPZB 1K90D 3EK8A 2BL0B 4PHMA 1K94A 4C0LA 1H4BA 1SCMB 1QS7A 1MWNA 1SNLA 3WXAA 1SW8A 3SG7A 1RECA 4CLNA 3D10A 3AAJA 5CSIA 1N0YA 2L5XB 1EXRA 4ETOA 3JVTB 4USLA 1TNWA 3EK4A 1BT6A 2KI6D 1AJ5A 2WCFA 3AAKA 3CR2A 4R1EA 2OPOA 3SG6A 4N1FA 3NSKA 3SG5A 2JTTA 2D8NA 4AQJA 1DJXA 3DVKA 1CTRA 2K7BA 1SYMA 1EH2A 3I5FB 1CM4A 1AP4A 2PMYA 1XFXO 2HPSA 5ER4X 1TNXA 1OZOA 2L4IA 2L4HA 4AQIA 4PDZA 4M2OA 4HRHA 1GGZA 3D0YB 5AERA 2MLFC 3I5HC 3OB1B 1VRKA 1JF0A 4HRGA 1BU3A 1FI5A 2PALA 1NCZA 1NIWA 1QXPA 2M7NA 1QVIZ 2F3ZA 2LUXA 4I5NB 1J1EA 1OZSA 4YBHB 5D69A 1DT7B 4MRYA 1SRAA 1RFJA 2BCBA 1TCFA 2CCMA 1KFUL 3VRNA 1V1GA 1WLMA 1G33A 2M8UA 1SCVA 2FCDA 2BE6A 3JTDC 2Q4UA 2R2IA 2VRGA 3BUWB 3GK2A 1YVLA 4DS7A 1KWOB 3I5GC 1YUTA 1L2OB 2BE4A 1ALVA 2L2EA 3NSOA 5JOLA 2BBMA 1DTLA 2KFHA 4OVNF 1E8AA 1IWQA 2GGZA 4GGNA 5K89A 1FW4A 1ZUZA 3MSEB 2I7AA 1MR8A 1SCMC 2WCEA 2MAZA 3H4SE 1TIZA 4OV2A 5HLOA 1KFXS 2H2KA 2JT3A 4PE4A 4WQ2A 1AJ4A 1XK4C 3JVTC 1S1EA 1FI6A 2HETA 1YRUB 4YGEB 1WRKA 4YI9A 4PE0A 3O2PA 2ZN8A 1J7OA 4PCWA 2JXLA 2KAVA 2L0PA 3CGAA 2LP3A 1F70A 1K8UA 1A75A 1SR6B 1TNQA 2ZN9A 1M45A 2KYCA 1M39A 1DJGA 1OOJA 1KK8B 4PHNA 2Y5IA 3I5FC 3TDZA 1KQVA 1F55A 1A4PA 5AFPA 5G08A 3TS5B 1WDCB 4HREE 4JWQA 4FTGA 1BF5A 2NLNA 2NZ0A 4A4CA 1S5GZ 3O78A 1S26D 4MN0A 1EJ3A 1SL8A 3NSIA 2H61C 2PASA 1UUSA 1F54A 1JF2A 1ZMZA 1N65A 1J7RA 3BUXB 1FF1A 1JFKA 3GOFA 1SL7A 4I5JA 3WHTB 2GV5A 3LK0A 4YI8A 5F6TA 4E68A 2LVIA 4M2PA 2F2OA 2JRFA 2LLTA 3AKBA 5AANA 1L2OC 1CKKA 1MXEA 1EL4A 4XJKA 1MHOA 1W7JB 2WOSA 1QLKA 2MA2A 2O5GA 3ZWHA 3SG2A 1CMFA 1CLLA 2KOTA 4BY4A 1KK7Y 2JWWA 3SJSA 4MBEA 4F0ZB 1BG1A 1S6CA 2BBNA 2NCPA 2EC6B 1K9KA 1A29A 1YR5A 2LMVA 1SMGA 2LP2A 4BY5A 1XVJA 2LANA 1OMVA 1PULA 2ZNEA 1LA3A 1NYAA 2JC2A 5AEQA 5JJGA 4NDBA 2LV7A 1CDLA 3M0WA 1SR6C 1R6PA 4DUQA 1F8HA 3TDUA 2P6BB 3WNXB 5CSFA 1KK8C 1BR1B 1TN4A 5DKNA 3TS5C 1UHJA 4YRUA 2HF5A 1NCYA 1Q80A 1QASA 3BUOB 1NUBA 1B8RA 4OKHA 1YUSA 1DJWA 1CDMA 1UHNA 2I2RE 3GK1A 4TNCA 2LUCA 1SBJA 1DF0A 1WRLA 2LM5A 2K2FA 1B4CA 1YVHA 1AVSA 2LCPA 4N5XA 1CFFA 1UURA 2MJWB 2HQ8A 5ER5A 3RLZA 5HYDA 4CFRA 2M0RA 3DVMA 3PN7B 5AXIA 3I5IB 4ZCVA 2F3YA 3KEVA 3OX5A 4NQGA 2FJUB 4CFQA 2KSPA 1F71A 2LVVA 2K7CA 3C1VA 3PATA 2BECA 3OP0A 1EG4A 3CR4X 3CS1A 2G2BA 1CDNA 1RTP1 4C0JA 2KQ6A 4FQOA 3DVEA 1S36A 1CFCA 2KDHA 2JT8A 1JC2A 1KCYA 3NSLA 2MBXA 1XFUO 1KK7Z 1RJVA 1IGVA 1LXFC 2K7DA 2RGIA 1X02A 1ALWA 2KI4B 2PSRA 1CLMA 3A8RA 3LCPC 1W7IB 2EC6C 1OE9B 1D1OA 4GGFC 1KSMA 1C7VA 1IJ6A 3FWCA 1B9AA 1IJ5A 2LLSA 1B1GA 2BL0C 3KF9A 1WLZA 4M2QA 1IG5A 3TDIA 4YGCB 1JFJA 3EVVA 4OR9B 4U8DA 3PSRA 2LAPA 2ZRSA 3GK4X 1DGUA 1NX2A 4ZCUA 3BOWA 1J55A 2AMIA 1Y1AA 3CR5X 5CSJA 1Y6WA 5GQQC 1TCOB 3DF0A 5KSZA 2JZIA 3VRPA 1OMRA 1U5IA 2FOTA 1IRJA 2WCBA 2EHBA 4L9MA 2TN4A 3KPXA 1CMGA 1DVIA 3IQQA 1QX7A 1C7WA 1S6IA 2FCEA 4NDDA 1WRZA 1NX1A 3PN7C 1JUOA 4GAOA 2QACA 3O4YA 2JNXA 2KHNA 1XK4A 3I5IC 1PALA 4IL1A 2AAOA 3HX4A 1ZACA 2ZRTA 4DCKA 3VRQA 3BYAA 1DF0B 4NDCA 1HT9A 2CBLA 4CPVA 3BQ3A 3OB2B 5HKYA 3LL8B 1S6JA 5PALA 1IQ5A 1PK0D 1PRWA 4WRIA 2HQWA 1K9UA 1K93D 2CT9A 4YGAA 2GGMA 2WNDA 4DRWA 1MF8B 4I5LB 1XYDA 2L50A 3SIAA 2I18A 4MZLA 5I2LA 1SKTA 2K8MB 2BKHB 3SG3A 3ZNIA 1M63B 1KWOC 2K2AA 1KQMB 3OX6A
chains in the Genus database with same CATH superfamily
2KGBC 1G4YR 2H61A 2KI4C 2OTGB 3D0YA 2LMUA 3FE6A 1KFUS 1T14A 2M7LA 1QTXA 1NX0A 1NSHA 1CFDA 3B87A 1J7QA 1ODBA 4MSPA 2K61A 1M31A 4N1GA 3VRRA 4GPLB 1K96A 3EK7A 2OS8B 2WC8A 1QX5B 2LHLA 3FS7A 3CDNA 3SG4A 3PLFB 1PSRA 1L7ZA 1Y1UA 1WY9A 1V1FA 2B1UA 1XFZO 1GJYA 3EG5B 5D3OA 1OSAA 1QIVA 2KNEA 1J1DA 2NCOA 5CSNA 1A03A 3CTNA 2KQYA 4WQ3A 1PSBA 2AUCA 3CWGA 2IS9A 5HKZA 1SL9A 5I2QA 3SIBA 4PHKA 1CFPA 3PALA 4D1EA 1BLQA 2QPTA 2CTNA 2K7OA 1NWDA 1YRTB 1UHHA 3BOWB 1TNPA 2V53A 3BUNB 3ICBA 1WDCC 2BNXA 2COLB 3EVRA 1C07A 4YGDB 4INWA 3UNWA 1A2XA 1KFXL 1AK8A 1OQPA 1CM1A 1AUIB 1MQ1A 2ZNDA 1DJIA 1EG3A 1A75B 1G8IA 1UHKA 2WORA 3NXAA 3CLNA 2LHIA 2BCXA 2M1KB 1B8CA 1PVAA 1AHRA 4FQTA 3NHIA 5KU1A 2P71A 1LINA 4C0KA 1IH0A 2L51A 1MUXA 1TRFA 2GTEA 3FWBA 5CPVA 1BJFA 4PHJA 2JULA 2JXCA 3NGVA 4GUKA 3WHUB 2KAYA 1QLSA 5I2OA 1C3ZA 1ORGA 3L4LA 2CXJA 3DD4A 1KQMC 2ISDA 2KI6C 1QIWA 1Y1XA 5FYXA 2ZFDA 2OTGC 3BUMB 1OMDA 3DZTA 4Q04A 1YX8A 3Q8IA 3SS5A 3BXKA 3AKAA 4GFTA 2M3WA 4PT1A 5BPJA 3TZ1A 3LK1A 4PE7A 1GGWA 1S3PA 1S5GY 3OHMB 4PE1A 4F7FA 4QJ5B 5IBWA 1B7TY 1XFWO 4PALA 3LLEA 5HKWA 2OS8C 1XA5A 4OCIA 4JKTA 4MLWA 2ZKMX 2LVKA 4XJKB 3RM1A 4ORAB 2MRDA 1BOCA 2CNPA 1TTXA 1KSOA 1BR4B 3PFVA 1LA0A 3S0AA 1CB1A 1B47A 2F8PA 3D77A 3PM8A 2I94A 1IQ3A 1BMOA 3N7HA 1K2HA 3KO0A 3VROA 2NXQA 4IJ7A 3D75A 4UPGA 2M29A 2SCPA 3VGOA 1CNPA 1K9PA 3FIAA 4ORCB 1SY9A 1H8BA 4QJ4B 1MXLC 1NPQA 2JNFA 2PRUA 1UHIA 1CLBA 3L47A 3NHTA 1YTZC 2PQLA 2KYFA 4GGFA 1B8LA 2G9BA 5KTYA 1J7PA 3SS3A 1R2UA 1DJYA 1Y0VH 1C3YA 3CZTX 3TUYB 2M49B 2M9GA 2O60A 4JQ0D 5B8IB 4I5KA 4OZDA 1UWOA 3QRXA 1RK9A 4MEWA 2L2CA 2Q91A 1ZOTB 3K21A 2K0JA 1YURA 2KGRA 4ORBB 3EKJA 1DEKA 2JT0A 2JQ6A 2MLEC 2QEBA 1NP8A 1NCXA 1YX7A 5DKRA 2JTZA 2F33A 2LMTA 2BKIB 2PVBA 5FI6A 1LS8A 1NX3A 2LNKA 1RROA 3IF7A 2MHHA 3S0BA 2JPTA 2LLUA 4P5OE 1QX2A 4MVFA 1PVBA 1LVCD 2Y1NA 4HSZA 1B7TZ 2JU0A 4CIDA 1QATA 2M97A 4YGBB 5FI2A 5DKQA 5HLVA 3DYEA 1DELA 1DJZA 2A4JA 3F45A 2E6WA 4MRXA 3E3RA 4QJ3B 3KHEA 2F2PA 2JOJA 1QV1A 3A4UB 2L98A 4AOMA 1XO5A 3EVUA 1DMOA 1JSAA 2M1UA 2DOQA 4XYNA 4DIRA 1TWOA 1XFYO 1DQEA 1DJHA 3I5HB 1QVIY 1GQMA 1SK6D 1ZFSA 1FBVA 3D73A 4ICBA 3IQOA 5D7FA 2KFFA 3EKHA 4P2YB 1F4OA 3HCMA 1K95A 3QMEA 1JWDA 1SPYA 1JBAA 1IKUA 1YUUA 1DGVA 1TOPA 1UP5A 1LKJA 2E30A 4MZJA 1GM0A 2EGDA 4GBAA 2LC5A 2Y4QA 1M46A 1QV0A 3JTDB 3TUYC 1RWYA 5J3XA 2FJYA 3O6BA 3I5GB 2BCAA 5TNCA 2KBIA 2KFGA 3DF0B 2KAXA 5I8NA 1CDPA 1QJTA 2BAPA 1HQVA 3DXLA 3DVJA 2LVJA 1U5IB 1OOHA 2Y1MA 1N2DA 4MZKA 3CZ1A 2SASA 1FPWA 2KBMA 3PM2A 2LE9B 3CABA 1F4QA 1XFVO 1BODA 4GNKB 4JPZB 1K90D 3EK8A 2BL0B 4PHMA 1K94A 4C0LA 1H4BA 1SCMB 1QS7A 1MWNA 1SNLA 3WXAA 1SW8A 3SG7A 1RECA 4CLNA 3BFAA 3D10A 5I94A 1Z4HA 3AAJA 5CSIA 1N0YA 2L5XB 1EXRA 1OOFA 4ETOA 3JVTB 4INXA 4USLA 1TNWA 3EK4A 1BT6A 2KI6D 1AJ5A 2WCFA 3AAKA 3CR2A 4R1EA 2OPOA 3SG6A 4N1FA 3NSKA 3SG5A 2JTTA 2D8NA 4AQJA 1DJXA 3DVKA 1CTRA 2K7BA 1SYMA 1EH2A 3I5FB 1CM4A 3B7AA 1AP4A 3R72A 2PMYA 2ERBA 1XFXO 2HPSA 5ER4X 1TNXA 1OZOA 2L4IA 2L4HA 4AQIA 4PDZA 4M2OA 4HRHA 1GGZA 3D0YB 5AERA 2MLFC 3I5HC 3OB1B 1VRKA 1JF0A 2QEHA 4HRGA 1BU3A 3SS4A 2PALA 1NCZA 1NIWA 1QXPA 1W9ZA 1QVIZ 2F3ZA 2LUXA 2M7NA 1J1EA 1OZSA 4I5NB 4YBHB 5D69A 1DT7B 4MRYA 1SRAA 1RFJA 2BCBA 1IIOA 1TCFA 2CCMA 1KFUL 3VRNA 1V1GA 1WLMA 1G33A 2M8UA 1SCVA 2FCDA 2BE6A 3JTDC 2Q4UA 2R2IA 2VRGA 3BUWB 3GK2A 1YVLA 3V2LA 1KWOB 3I5GC 4DS7A 1YUTA 1L2OB 2BE4A 1ALVA 2L2EA 3NSOA 5JOLA 2BBMA 1DTLA 2QEOA 2KFHA 2L5YA 2WCJA 4OVNF 1E8AA 1IWQA 2GGZA 4GGNA 5K89A 3FE8A 1FW4A 1ZUZA 3MSEB 3DY9A 2I7AA 1MR8A 1SCMC 2WCEA 2MAZA 3H4SE 1TIZA 4OV2A 5HLOA 1KFXS 2H2KA 2JT3A 4PE4A 4WQ2A 1AJ4A 1XK4C 3JVTC 1S1EA 1FI6A 2HETA 1YRUB 4YGEB 3D74A 1P28A 1WRKA 3BFBA 4PE0A 4YI9A 1OOGA 1XFRA 3O2PA 2ZN8A 1J7OA 4PCWA 3RZSA 2JXLA 2KAVA 2L0PA 3CGAA 2LP3A 1DC1A 1K8UA 1A75A 1F70A 1SR6B 1TNQA 5FI7A 2ZN9A 1M45A 2WCMA 3O4XA 2KYCA 1M39A 1DJGA 1OOJA 1KK8B 4PHNA 2Y5IA 3I5FC 3TDZA 1KQVA 1F55A 1A4PA 5AFPA 5G08A 3TS5B 1WDCB 4HREE 4JWQA 4FTGA 1BF5A 2KPHA 2NLNA 2NZ0A 4A4CA 1S5GZ 3O78A 1S26D 4MN0A 1Z2CB 1EJ3A 1SL8A 3NSIA 2H61C 2PASA 1UUSA 1F54A 1JF2A 1ZMZA 3B88A 1N65A 1J7RA 3BUXB 1FF1A 1JFKA 3GOFA 1SL7A 4I5JA 3WHTB 3S0GA 2GV5A 3LK0A 4YI8A 5F6TA 4E68A 2LVIA 4M2PA 2F2OA 2JRFA 2LLTA 3K1EA 3BJHA 3AKBA 5AANA 1L2OC 1CKKA 1MXEA 3UO9A 3VB1A 1EL4A 4XJKA 1MHOA 1TUJA 1W7JB 2WOSA 1QLKA 2MA2A 2O5GA 3ZWHA 3SG2A 1CMFA 1CLLA 2KOTA 1FI5A 4BY4A 1KK7Y 2JWWA 2WC6A 2WCKA 3SJSA 4MBEA 4F0ZB 1BG1A 2WCLA 1S6CA 2BBNA 2NCPA 2EC6B 1K9KA 1A29A 1YR5A 2JPOA 2LMVA 1SMGA 2LP2A 4BY5A 2WCHA 1XVJA 2LANA 1OMVA 3R1OA 1PULA 2ZNEA 1LA3A 1NYAA 2JC2A 2QDIA 5AEQA 5JJGA 4NDBA 2LV7A 1CDLA 3M0WA 1SR6C 1R6PA 4DUQA 1F8HA 3TDUA 2P6BB 3WNXB 5CSFA 1KK8C 3BFHA 1BR1B 1TN4A 5DKNA 3IVTA 3TS5C 1UHJA 4YRUA 2HF5A 1NCYA 1Q80A 1QASA 3BUOB 1NUBA 1B8RA 4OKHA 1YUSA 2WC5A 1DJWA 2PYQA 1CDMA 1UHNA 2I2RE 3GK1A 4TNCA 2LUCA 3OBVA 1SBJA 1DF0A 1WRLA 2LM5A 2K2FA 4JD9A 1B4CA 1YVHA 1AVSA 2LCPA 3CYZA 4N5XA 1CFFA 1UURA 2MJWB 2HQ8A 5ER5A 3RLZA 5HYDA 4CFRA 2M0RA 3OGNA 3DVMA 3PN7B 4KYNA 5AXIA 3I5IB 4ZCVA 3S0FA 2F3YA 1QWVA 3KEVA 3OX5A 4NQGA 2FJUB 4CFQA 2KSPA 2P70A 1F71A 2LVVA 2YGUA 2K7CA 3C1VA 3CZ2A 3PATA 2BECA 3OP0A 1EG4A 3CR4X 3CS1A 2G2BA 1CDNA 1RTP1 3FE9A 5EL2A 4C0JA 2KQ6A 4FQOA 3DVEA 1S36A 1CFCA 2KDHA 2JT8A 1JC2A 1KCYA 3NSLA 2MBXA 1XFUO 1KK7Z 1RJVA 1IGVA 1LXFC 2K60A 2K7DA 1X02A 1ALWA 2KI4B 2PSRA 1CLMA 2RGIA 3A8RA 1W7IB 2EC6C 3LCPC 3R1PA 1OE9B 3PJIA 1D1OA 4GGFC 1KSMA 1C7VA 1IJ6A 3FWCA 1B9AA 1IJ5A 2LLSA 1B1GA 3S0EA 2BL0C 3KF9A 1WLZA 4M2QA 1IG5A 3TDIA 4YGCB 1JFJA 3EVVA 4OR9B 4U8DA 3PSRA 2KLDA 2LAPA 2ZRSA 3GK4X 1DGUA 1NX2A 4ZCUA 3BOWA 1J55A 2AMIA 1Y1AA 3CR5X 5CSJA 1Y6WA 5GQQC 1TCOB 3DF0A 5KSZA 2JZIA 3VRPA 1OMRA 1U5IA 2FOTA 1IRJA 2WCBA 2EHBA 1OW4A 4L9MA 2TN4A 3KPXA 2KLEA 1DVIA 1CMGA 3B6XA 3IQQA 1QX7A 3S0DA 1C7WA 1S6IA 2FCEA 4NDDA 1WRZA 1NX1A 1SSEB 1JUOA 3PN7C 4GAOA 2QACA 3O4YA 2JNXA 2KHNA 1XK4A 3I5IC 1PALA 4IL1A 2AAOA 3HX4A 1ZACA 2ZRTA 4DCKA 3VRQA 3BYAA 1DF0B 3D76A 4NDCA 1HT9A 2CBLA 4CPVA 3D78A 3BQ3A 3OB2B 3B86A 3CZ0A 5HKYA 3LL8B 1S6JA 5PALA 1IQ5A 1PK0D 1PRWA 3L4AA 1OOIX 2HQWA 1K9UA 4WRIA 3R1VA 1K93D 2CT9A 4YGAA 2GGMA 2WNDA 4DRWA 1MF8B 4I5LB 1XYDA 2L50A 3SIAA 2I18A 4MZLA 5I2LA 1SKTA 2K8MB 2BKHB 3SG3A 3ZNIA 4A4BA 1M63B 1TUZA 1KWOC 2H8VA 3OX6A 2K2AA 1KQMB 5HL1A 5DICA 2QEVA
chains in the Genus database with same CATH topology
2KGBC 1G4YR 2H61A 2KI4C 2OTGB 3D0YA 2LMUA 1KFUS 2M7LA 1QTXA 1NX0A 1NSHA 1CFDA 1J7QA 1ODBA 4MSPA 2K61A 1M31A 4N1GA 3VRRA 4GPLB 1K96A 3EK7A 2OS8B 2WC8A 1QX5B 2LHLA 3FS7A 3SG4A 3PLFB 1PSRA 1L7ZA 1Y1UA 1WY9A 1V1FA 2B1UA 1XFZO 1GJYA 1OSAA 1QIVA 2KNEA 1J1DA 2NCOA 5CSNA 1A03A 3CTNA 2KQYA 4WQ3A 1PSBA 2AUCA 3CWGA 2IS9A 5HKZA 1SL9A 5I2QA 3SIBA 4PHKA 1CFPA 3PALA 4D1EA 1BLQA 2QPTA 2CTNA 2K7OA 1NWDA 1YRTB 1UHHA 3BOWB 1TNPA 2V53A 3BUNB 3ICBA 1WDCC 2COLB 3EVRA 1C07A 4YGDB 1A2XA 1KFXL 1AK8A 1OQPA 1CM1A 1AUIB 1MQ1A 2ZNDA 1DJIA 1EG3A 1A75B 1G8IA 1UHKA 2WORA 3NXAA 3CLNA 2LHIA 2BCXA 2M1KB 1B8CA 1PVAA 1AHRA 5KU1A 1LINA 4C0KA 1IH0A 2L51A 1MUXA 1TRFA 3FWBA 5CPVA 1BJFA 4PHJA 2JULA 2JXCA 4GUKA 3WHUB 2KAYA 1QLSA 5I2OA 2CXJA 3DD4A 1KQMC 2ISDA 2KI6C 1QIWA 1Y1XA 5FYXA 2ZFDA 2OTGC 3BUMB 1OMDA 4Q04A 1YX8A 3BXKA 3AKAA 4GFTA 2M3WA 5BPJA 3TZ1A 3LK1A 4PE7A 1GGWA 1S3PA 1S5GY 3OHMB 4PE1A 4QJ5B 5IBWA 1B7TY 1XFWO 4PALA 3LLEA 5HKWA 2OS8C 1XA5A 4OCIA 4MLWA 2ZKMX 2LVKA 4XJKB 3RM1A 4ORAB 2MRDA 1BOCA 2CNPA 1KSOA 1BR4B 1TTXA 3PFVA 1LA0A 1CB1A 1B47A 2F8PA 3PM8A 2I94A 1IQ3A 1BMOA 1K2HA 3KO0A 3VROA 2NXQA 4UPGA 2M29A 2SCPA 3VGOA 1CNPA 1K9PA 3FIAA 4ORCB 1SY9A 1H8BA 4QJ4B 1MXLC 1NPQA 2JNFA 2PRUA 1UHIA 1CLBA 1YTZC 2KYFA 4GGFA 1B8LA 2G9BA 5KTYA 1J7PA 1R2UA 1DJYA 1Y0VH 3CZTX 3TUYB 2M49B 2M9GA 2O60A 4JQ0D 5B8IB 4I5KA 1UWOA 3QRXA 1RK9A 4MEWA 2Q91A 1ZOTB 3K21A 2K0JA 1YURA 2KGRA 4ORBB 3EKJA 2JT0A 2MLEC 2JQ6A 4A4BA 1NP8A 1NCXA 1YX7A 5DKRA 2JTZA 2F33A 2LMTA 2BKIB 2PVBA 1NX3A 2LNKA 1RROA 3IF7A 2MHHA 2JPTA 2LLUA 4P5OE 1QX2A 4MVFA 1PVBA 1LVCD 2Y1NA 4HSZA 1B7TZ 2JU0A 4CIDA 1QATA 2M97A 4YGBB 5HLVA 5DKQA 1DJZA 2A4JA 3F45A 2E6WA 4MRXA 3E3RA 4QJ3B 3KHEA 2F2PA 2JOJA 1QV1A 3A4UB 2L98A 4AOMA 1XO5A 3EVUA 1DMOA 1JSAA 2M1UA 2DOQA 4XYNA 4DIRA 1XFYO 1DJHA 3I5HB 1QVIY 1GQMA 1SK6D 1ZFSA 1FBVA 4ICBA 3IQOA 5D7FA 2KFFA 3EKHA 4P2YB 1F4OA 3HCMA 1K95A 1JWDA 1SPYA 1JBAA 1IKUA 1YUUA 1DGVA 1TOPA 1UP5A 1LKJA 2E30A 4MZJA 2EGDA 4GBAA 2LC5A 2Y4QA 1M46A 1QV0A 3JTDB 3TUYC 1RWYA 5J3XA 3O6BA 3I5GB 2BCAA 5TNCA 2KBIA 2KFGA 3DF0B 2KAXA 5I8NA 1CDPA 1QJTA 1HQVA 3DVJA 2LVJA 1U5IB 2Y1MA 1N2DA 4MZKA 2SASA 1FPWA 2KBMA 2LE9B 1F4QA 1XFVO 1BODA 4GNKB 4JPZB 1K90D 3EK8A 2BL0B 4PHMA 1K94A 4C0LA 1H4BA 1SCMB 1QS7A 1MWNA 1SNLA 3WXAA 1SW8A 3SG7A 1RECA 4CLNA 3D10A 3AAJA 5CSIA 1N0YA 2L5XB 1EXRA 4ETOA 3JVTB 4USLA 1TNWA 3EK4A 1BT6A 2KI6D 1AJ5A 2WCFA 3AAKA 3CR2A 4R1EA 2OPOA 3SG6A 4N1FA 3NSKA 3SG5A 2JTTA 2D8NA 4AQJA 1DJXA 3DVKA 1CTRA 2K7BA 1SYMA 1EH2A 3I5FB 1CM4A 1AP4A 2PMYA 1XFXO 2HPSA 5ER4X 1TNXA 1OZOA 2L4IA 2L4HA 4AQIA 4PDZA 4M2OA 4HRHA 1GGZA 3D0YB 5AERA 2MLFC 3I5HC 3OB1B 1VRKA 1JF0A 4HRGA 1BU3A 1FI5A 2PALA 1NCZA 1NIWA 1QXPA 2M7NA 1QVIZ 2F3ZA 2LUXA 4I5NB 1J1EA 1OZSA 4YBHB 5D69A 1DT7B 4MRYA 1SRAA 1RFJA 2BCBA 1TCFA 2CCMA 1KFUL 3VRNA 1V1GA 1WLMA 1G33A 2M8UA 1SCVA 2FCDA 2BE6A 3JTDC 2Q4UA 2R2IA 2VRGA 3BUWB 3GK2A 1YVLA 4DS7A 1KWOB 3I5GC 1YUTA 1L2OB 2BE4A 1ALVA 2L2EA 3NSOA 5JOLA 2BBMA 1DTLA 2KFHA 4OVNF 1E8AA 1IWQA 2GGZA 4GGNA 5K89A 1FW4A 1ZUZA 3MSEB 2I7AA 1MR8A 1SCMC 2WCEA 2MAZA 3H4SE 1TIZA 4OV2A 5HLOA 1KFXS 2H2KA 2JT3A 4PE4A 4WQ2A 1AJ4A 1XK4C 3JVTC 1S1EA 1FI6A 2HETA 1YRUB 4YGEB 1WRKA 4YI9A 4PE0A 3O2PA 2ZN8A 1J7OA 4PCWA 2JXLA 2KAVA 2L0PA 3CGAA 2LP3A 1F70A 1K8UA 1A75A 1SR6B 1TNQA 2ZN9A 1M45A 2KYCA 1M39A 1DJGA 1OOJA 1KK8B 4PHNA 2Y5IA 3I5FC 3TDZA 1KQVA 1F55A 1A4PA 5AFPA 5G08A 3TS5B 1WDCB 4HREE 4JWQA 4FTGA 1BF5A 2NLNA 2NZ0A 4A4CA 1S5GZ 3O78A 1S26D 4MN0A 1EJ3A 1SL8A 3NSIA 2H61C 2PASA 1UUSA 1F54A 1JF2A 1ZMZA 1N65A 1J7RA 3BUXB 1FF1A 1JFKA 3GOFA 1SL7A 4I5JA 3WHTB 2GV5A 3LK0A 4YI8A 5F6TA 4E68A 2LVIA 4M2PA 2F2OA 2JRFA 2LLTA 3AKBA 5AANA 1L2OC 1CKKA 1MXEA 1EL4A 4XJKA 1MHOA 1W7JB 2WOSA 1QLKA 2MA2A 2O5GA 3ZWHA 3SG2A 1CMFA 1CLLA 2KOTA 4BY4A 1KK7Y 2JWWA 3SJSA 4MBEA 4F0ZB 1BG1A 1S6CA 2BBNA 2NCPA 2EC6B 1K9KA 1A29A 1YR5A 2LMVA 1SMGA 2LP2A 4BY5A 1XVJA 2LANA 1OMVA 1PULA 2ZNEA 1LA3A 1NYAA 2JC2A 5AEQA 5JJGA 4NDBA 2LV7A 1CDLA 3M0WA 1SR6C 1R6PA 4DUQA 1F8HA 3TDUA 2P6BB 3WNXB 5CSFA 1KK8C 1BR1B 1TN4A 5DKNA 3TS5C 1UHJA 4YRUA 2HF5A 1NCYA 1Q80A 1QASA 3BUOB 1NUBA 1B8RA 4OKHA 1YUSA 1DJWA 1CDMA 1UHNA 2I2RE 3GK1A 4TNCA 2LUCA 1SBJA 1DF0A 1WRLA 2LM5A 2K2FA 1B4CA 1YVHA 1AVSA 2LCPA 4N5XA 1CFFA 1UURA 2MJWB 2HQ8A 5ER5A 3RLZA 5HYDA 4CFRA 2M0RA 3DVMA 3PN7B 5AXIA 3I5IB 4ZCVA 2F3YA 3KEVA 3OX5A 4NQGA 2FJUB 4CFQA 2KSPA 1F71A 2LVVA 2K7CA 3C1VA 3PATA 2BECA 3OP0A 1EG4A 3CR4X 3CS1A 2G2BA 1CDNA 1RTP1 4C0JA 2KQ6A 4FQOA 3DVEA 1S36A 1CFCA 2KDHA 2JT8A 1JC2A 1KCYA 3NSLA 2MBXA 1XFUO 1KK7Z 1RJVA 1IGVA 1LXFC 2K7DA 2RGIA 1X02A 1ALWA 2KI4B 2PSRA 1CLMA 3A8RA 3LCPC 1W7IB 2EC6C 1OE9B 1D1OA 4GGFC 1KSMA 1C7VA 1IJ6A 3FWCA 1B9AA 1IJ5A 2LLSA 1B1GA 2BL0C 3KF9A 1WLZA 4M2QA 1IG5A 3TDIA 4YGCB 1JFJA 3EVVA 4OR9B 4U8DA 3PSRA 2LAPA 2ZRSA 3GK4X 1DGUA 1NX2A 4ZCUA 3BOWA 1J55A 2AMIA 1Y1AA 3CR5X 5CSJA 1Y6WA 5GQQC 1TCOB 3DF0A 5KSZA 2JZIA 3VRPA 1OMRA 1U5IA 2FOTA 1IRJA 2WCBA 2EHBA 4L9MA 2TN4A 3KPXA 1CMGA 1DVIA 3IQQA 1QX7A 1C7WA 1S6IA 2FCEA 4NDDA 1WRZA 1NX1A 3PN7C 1JUOA 4GAOA 2QACA 3O4YA 2JNXA 2KHNA 1XK4A 3I5IC 1PALA 4IL1A 2AAOA 3HX4A 1ZACA 2ZRTA 4DCKA 3VRQA 3BYAA 1DF0B 4NDCA 1HT9A 2CBLA 4CPVA 3BQ3A 3OB2B 5HKYA 3LL8B 1S6JA 5PALA 1IQ5A 1PK0D 1PRWA 4WRIA 2HQWA 1K9UA 1K93D 2CT9A 4YGAA 2GGMA 2WNDA 4DRWA 1MF8B 4I5LB 1XYDA 2L50A 3SIAA 2I18A 4MZLA 5I2LA 1SKTA 2K8MB 2BKHB 3SG3A 3ZNIA 1M63B 1KWOC 2K2AA 1KQMB 3OX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGB C;  1G4Y R;  2H61 A;  2KI4 C;  2OTG B;  3D0Y A;  2LMU A;  1KFU S;  2M7L A;  1QTX A;  1NX0 A;  1NSH A;  1CFD A;  1J7Q A;  1ODB A;  4MSP A;  2K61 A;  1M31 A;  4N1G A;  3VRR A;  4GPL B;  1K96 A;  3EK7 A;  2OS8 B;  2WC8 A;  1QX5 B;  2LHL A;  3FS7 A;  3SG4 A;  3PLF B;  1PSR A;  1L7Z A;  1Y1U A;  1WY9 A;  1V1F A;  2B1U A;  1XFZ O;  1GJY A;  1OSA A;  1QIV A;  2KNE A;  1J1D A;  2NCO A;  5CSN A;  1A03 A;  3CTN A;  2KQY A;  4WQ3 A;  1PSB A;  2AUC A;  3CWG A;  2IS9 A;  5HKZ A;  1SL9 A;  5I2Q A;  3SIB A;  4PHK A;  1CFP A;  3PAL A;  4D1E A;  1BLQ A;  2QPT A;  2CTN A;  2K7O A;  1NWD A;  1YRT B;  1UHH A;  3BOW B;  1TNP A;  2V53 A;  3BUN B;  3ICB A;  1WDC C;  2COL B;  3EVR A;  1C07 A;  4YGD B;  1A2X A;  1KFX L;  1AK8 A;  1OQP A;  1CM1 A;  1AUI B;  1MQ1 A;  2ZND A;  1DJI A;  1EG3 A;  1A75 B;  1G8I A;  1UHK A;  2WOR A;  3NXA A;  3CLN A;  2LHI A;  2BCX A;  2M1K B;  1B8C A;  1PVA A;  1AHR A;  5KU1 A;  1LIN A;  4C0K A;  1IH0 A;  2L51 A;  1MUX A;  1TRF A;  3FWB A;  5CPV A;  1BJF A;  4PHJ A;  2JUL A;  2JXC A;  4GUK A;  3WHU B;  2KAY A;  1QLS A;  5I2O A;  2CXJ A;  3DD4 A;  1KQM C;  2ISD A;  2KI6 C;  1QIW A;  1Y1X A;  5FYX A;  2ZFD A;  2OTG C;  3BUM B;  1OMD A;  4Q04 A;  1YX8 A;  3BXK A;  3AKA A;  4GFT A;  2M3W A;  5BPJ A;  3TZ1 A;  3LK1 A;  4PE7 A;  1GGW A;  1S3P A;  1S5G Y;  3OHM B;  4PE1 A;  4QJ5 B;  5IBW A;  1B7T Y;  1XFW O;  4PAL A;  3LLE A;  5HKW A;  2OS8 C;  1XA5 A;  4OCI A;  4MLW A;  2ZKM X;  2LVK A;  4XJK B;  3RM1 A;  4ORA B;  2MRD A;  1BOC A;  2CNP A;  1KSO A;  1BR4 B;  1TTX A;  3PFV A;  1LA0 A;  1CB1 A;  1B47 A;  2F8P A;  3PM8 A;  2I94 A;  1IQ3 A;  1BMO A;  1K2H A;  3KO0 A;  3VRO A;  2NXQ A;  4UPG A;  2M29 A;  2SCP A;  3VGO A;  1CNP A;  1K9P A;  3FIA A;  4ORC B;  1SY9 A;  1H8B A;  4QJ4 B;  1MXL C;  1NPQ A;  2JNF A;  2PRU A;  1UHI A;  1CLB A;  1YTZ C;  2KYF A;  4GGF A;  1B8L A;  2G9B A;  5KTY A;  1J7P A;  1R2U A;  1DJY A;  1Y0V H;  3CZT X;  3TUY B;  2M49 B;  2M9G A;  2O60 A;  4JQ0 D;  5B8I B;  4I5K A;  1UWO A;  3QRX A;  1RK9 A;  4MEW A;  2Q91 A;  1ZOT B;  3K21 A;  2K0J A;  1YUR A;  2KGR A;  4ORB B;  3EKJ A;  2JT0 A;  2MLE C;  2JQ6 A;  4A4B A;  1NP8 A;  1NCX A;  1YX7 A;  5DKR A;  2JTZ A;  2F33 A;  2LMT A;  2BKI B;  2PVB A;  1NX3 A;  2LNK A;  1RRO A;  3IF7 A;  2MHH A;  2JPT A;  2LLU A;  4P5O E;  1QX2 A;  4MVF A;  1PVB A;  1LVC D;  2Y1N A;  4HSZ A;  1B7T Z;  2JU0 A;  4CID A;  1QAT A;  2M97 A;  4YGB B;  5HLV A;  5DKQ A;  1DJZ A;  2A4J A;  3F45 A;  2E6W A;  4MRX A;  3E3R A;  4QJ3 B;  3KHE A;  2F2P A;  2JOJ A;  1QV1 A;  3A4U B;  2L98 A;  4AOM A;  1XO5 A;  3EVU A;  1DMO A;  1JSA A;  2M1U A;  2DOQ A;  4XYN A;  4DIR A;  1XFY O;  1DJH A;  3I5H B;  1QVI Y;  1GQM A;  1SK6 D;  1ZFS A;  1FBV A;  4ICB A;  3IQO A;  5D7F A;  2KFF A;  3EKH A;  4P2Y B;  1F4O A;  3HCM A;  1K95 A;  1JWD A;  1SPY A;  1JBA A;  1IKU A;  1YUU A;  1DGV A;  1TOP A;  1UP5 A;  1LKJ A;  2E30 A;  4MZJ A;  2EGD A;  4GBA A;  2LC5 A;  2Y4Q A;  1M46 A;  1QV0 A;  3JTD B;  3TUY C;  1RWY A;  5J3X A;  3O6B A;  3I5G B;  2BCA A;  5TNC A;  2KBI A;  2KFG A;  3DF0 B;  2KAX A;  5I8N A;  1CDP A;  1QJT A;  1HQV A;  3DVJ A;  2LVJ A;  1U5I B;  2Y1M A;  1N2D A;  4MZK A;  2SAS A;  1FPW A;  2KBM A;  2LE9 B;  1F4Q A;  1XFV O;  1BOD A;  4GNK B;  4JPZ B;  1K90 D;  3EK8 A;  2BL0 B;  4PHM A;  1K94 A;  4C0L A;  1H4B A;  1SCM B;  1QS7 A;  1MWN A;  1SNL A;  3WXA A;  1SW8 A;  3SG7 A;  1REC A;  4CLN A;  3D10 A;  3AAJ A;  5CSI A;  1N0Y A;  2L5X B;  1EXR A;  4ETO A;  3JVT B;  4USL A;  1TNW A;  3EK4 A;  1BT6 A;  2KI6 D;  1AJ5 A;  2WCF A;  3AAK A;  3CR2 A;  4R1E A;  2OPO A;  3SG6 A;  4N1F A;  3NSK A;  3SG5 A;  2JTT A;  2D8N A;  4AQJ A;  1DJX A;  3DVK A;  1CTR A;  2K7B A;  1SYM A;  1EH2 A;  3I5F B;  1CM4 A;  1AP4 A;  2PMY A;  1XFX O;  2HPS A;  5ER4 X;  1TNX A;  1OZO A;  2L4I A;  2L4H A;  4AQI A;  4PDZ A;  4M2O A;  4HRH A;  1GGZ A;  3D0Y B;  5AER A;  2MLF C;  3I5H C;  3OB1 B;  1VRK A;  1JF0 A;  4HRG A;  1BU3 A;  1FI5 A;  2PAL A;  1NCZ A;  1NIW A;  1QXP A;  2M7N A;  1QVI Z;  2F3Z A;  2LUX A;  4I5N B;  1J1E A;  1OZS A;  4YBH B;  5D69 A;  1DT7 B;  4MRY A;  1SRA A;  1RFJ A;  2BCB A;  1TCF A;  2CCM A;  1KFU L;  3VRN A;  1V1G A;  1WLM A;  1G33 A;  2M8U A;  1SCV A;  2FCD A;  2BE6 A;  3JTD C;  2Q4U A;  2R2I A;  2VRG A;  3BUW B;  3GK2 A;  1YVL A;  4DS7 A;  1KWO B;  3I5G C;  1YUT A;  1L2O B;  2BE4 A;  1ALV A;  2L2E A;  3NSO A;  5JOL A;  2BBM A;  1DTL A;  2KFH A;  4OVN F;  1E8A A;  1IWQ A;  2GGZ A;  4GGN A;  5K89 A;  1FW4 A;  1ZUZ A;  3MSE B;  2I7A A;  1MR8 A;  1SCM C;  2WCE A;  2MAZ A;  3H4S E;  1TIZ A;  4OV2 A;  5HLO A;  1KFX S;  2H2K A;  2JT3 A;  4PE4 A;  4WQ2 A;  1AJ4 A;  1XK4 C;  3JVT C;  1S1E A;  1FI6 A;  2HET A;  1YRU B;  4YGE B;  1WRK A;  4YI9 A;  4PE0 A;  3O2P A;  2ZN8 A;  1J7O A;  4PCW A;  2JXL A;  2KAV A;  2L0P A;  3CGA A;  2LP3 A;  1F70 A;  1K8U A;  1A75 A;  1SR6 B;  1TNQ A;  2ZN9 A;  1M45 A;  2KYC A;  1M39 A;  1DJG A;  1OOJ A;  1KK8 B;  4PHN A;  2Y5I A;  3I5F C;  3TDZ A;  1KQV A;  1F55 A;  1A4P A;  5AFP A;  5G08 A;  3TS5 B;  1WDC B;  4HRE E;  4JWQ A;  4FTG A;  1BF5 A;  2NLN A;  2NZ0 A;  4A4C A;  1S5G Z;  3O78 A;  1S26 D;  4MN0 A;  1EJ3 A;  1SL8 A;  3NSI A;  2H61 C;  2PAS A;  1UUS A;  1F54 A;  1JF2 A;  1ZMZ A;  1N65 A;  1J7R A;  3BUX B;  1FF1 A;  1JFK A;  3GOF A;  1SL7 A;  4I5J A;  3WHT B;  2GV5 A;  3LK0 A;  4YI8 A;  5F6T A;  4E68 A;  2LVI A;  4M2P A;  2F2O A;  2JRF A;  2LLT A;  3AKB A;  5AAN A;  1L2O C;  1CKK A;  1MXE A;  1EL4 A;  4XJK A;  1MHO A;  1W7J B;  2WOS A;  1QLK A;  2MA2 A;  2O5G A;  3ZWH A;  3SG2 A;  1CMF A;  1CLL A;  2KOT A;  4BY4 A;  1KK7 Y;  2JWW A;  3SJS A;  4MBE A;  4F0Z B;  1BG1 A;  1S6C A;  2BBN A;  2NCP A;  2EC6 B;  1K9K A;  1A29 A;  1YR5 A;  2LMV A;  1SMG A;  2LP2 A;  4BY5 A;  1XVJ A;  2LAN A;  1OMV A;  1PUL A;  2ZNE A;  1LA3 A;  1NYA A;  2JC2 A;  5AEQ A;  5JJG A;  4NDB A;  2LV7 A;  1CDL A;  3M0W A;  1SR6 C;  1R6P A;  4DUQ A;  1F8H A;  3TDU A;  2P6B B;  3WNX B;  5CSF A;  1KK8 C;  1BR1 B;  1TN4 A;  5DKN A;  3TS5 C;  1UHJ A;  4YRU A;  2HF5 A;  1NCY A;  1Q80 A;  1QAS A;  3BUO B;  1NUB A;  1B8R A;  4OKH A;  1YUS A;  1DJW A;  1CDM A;  1UHN A;  2I2R E;  3GK1 A;  4TNC A;  2LUC A;  1SBJ A;  1DF0 A;  1WRL A;  2LM5 A;  2K2F A;  1B4C A;  1YVH A;  1AVS A;  2LCP A;  4N5X A;  1CFF A;  1UUR A;  2MJW B;  2HQ8 A;  5ER5 A;  3RLZ A;  5HYD A;  4CFR A;  2M0R A;  3DVM A;  3PN7 B;  5AXI A;  3I5I B;  4ZCV A;  2F3Y A;  3KEV A;  3OX5 A;  4NQG A;  2FJU B;  4CFQ A;  2KSP A;  1F71 A;  2LVV A;  2K7C A;  3C1V A;  3PAT A;  2BEC A;  3OP0 A;  1EG4 A;  3CR4 X;  3CS1 A;  2G2B A;  1CDN A;  1RTP 1;  4C0J A;  2KQ6 A;  4FQO A;  3DVE A;  1S36 A;  1CFC A;  2KDH A;  2JT8 A;  1JC2 A;  1KCY A;  3NSL A;  2MBX A;  1XFU O;  1KK7 Z;  1RJV A;  1IGV A;  1LXF C;  2K7D A;  2RGI A;  1X02 A;  1ALW A;  2KI4 B;  2PSR A;  1CLM A;  3A8R A;  3LCP C;  1W7I B;  2EC6 C;  1OE9 B;  1D1O A;  4GGF C;  1KSM A;  1C7V A;  1IJ6 A;  3FWC A;  1B9A A;  1IJ5 A;  2LLS A;  1B1G A;  2BL0 C;  3KF9 A;  1WLZ A;  4M2Q A;  1IG5 A;  3TDI A;  4YGC B;  1JFJ A;  3EVV A;  4OR9 B;  4U8D A;  3PSR A;  2LAP A;  2ZRS A;  3GK4 X;  1DGU A;  1NX2 A;  4ZCU A;  3BOW A;  1J55 A;  2AMI A;  1Y1A A;  3CR5 X;  5CSJ A;  1Y6W A;  5GQQ C;  1TCO B;  3DF0 A;  5KSZ A;  2JZI A;  3VRP A;  1OMR A;  1U5I A;  2FOT A;  1IRJ A;  2WCB A;  2EHB A;  4L9M A;  2TN4 A;  3KPX A;  1CMG A;  1DVI A;  3IQQ A;  1QX7 A;  1C7W A;  1S6I A;  2FCE A;  4NDD A;  1WRZ A;  1NX1 A;  3PN7 C;  1JUO A;  4GAO A;  2QAC A;  3O4Y A;  2JNX A;  2KHN A;  1XK4 A;  3I5I C;  1PAL A;  4IL1 A;  2AAO A;  3HX4 A;  1ZAC A;  2ZRT A;  4DCK A;  3VRQ A;  3BYA A;  1DF0 B;  4NDC A;  1HT9 A;  2CBL A;  4CPV A;  3BQ3 A;  3OB2 B;  5HKY A;  3LL8 B;  1S6J A;  5PAL A;  1IQ5 A;  1PK0 D;  1PRW A;  4WRI A;  2HQW A;  1K9U A;  1K93 D;  2CT9 A;  4YGA A;  2GGM A;  2WND A;  4DRW A;  1MF8 B;  4I5L B;  1XYD A;  2L50 A;  3SIA A;  2I18 A;  4MZL A;  5I2L A;  1SKT A;  2K8M B;  2BKH B;  3SG3 A;  3ZNI A;  1M63 B;  1KWO C;  2K2A A;  1KQM B;  3OX6 A; 
#chains in the Genus database with same CATH topology
 2KGB C;  1G4Y R;  2H61 A;  2KI4 C;  2OTG B;  3D0Y A;  2LMU A;  3FE6 A;  1KFU S;  1T14 A;  2M7L A;  1QTX A;  1NX0 A;  1NSH A;  1CFD A;  3B87 A;  1J7Q A;  1ODB A;  4MSP A;  2K61 A;  1M31 A;  4N1G A;  3VRR A;  4GPL B;  1K96 A;  3EK7 A;  2OS8 B;  2WC8 A;  1QX5 B;  2LHL A;  3FS7 A;  3CDN A;  3SG4 A;  3PLF B;  1PSR A;  1L7Z A;  1Y1U A;  1WY9 A;  1V1F A;  2B1U A;  1XFZ O;  1GJY A;  3EG5 B;  5D3O A;  1OSA A;  1QIV A;  2KNE A;  1J1D A;  2NCO A;  5CSN A;  1A03 A;  3CTN A;  2KQY A;  4WQ3 A;  1PSB A;  2AUC A;  3CWG A;  2IS9 A;  5HKZ A;  1SL9 A;  5I2Q A;  3SIB A;  4PHK A;  1CFP A;  3PAL A;  4D1E A;  1BLQ A;  2QPT A;  2CTN A;  2K7O A;  1NWD A;  1YRT B;  1UHH A;  3BOW B;  1TNP A;  2V53 A;  3BUN B;  3ICB A;  1WDC C;  2BNX A;  2COL B;  3EVR A;  1C07 A;  4YGD B;  4INW A;  3UNW A;  1A2X A;  1KFX L;  1AK8 A;  1OQP A;  1CM1 A;  1AUI B;  1MQ1 A;  2ZND A;  1DJI A;  1EG3 A;  1A75 B;  1G8I A;  1UHK A;  2WOR A;  3NXA A;  3CLN A;  2LHI A;  2BCX A;  2M1K B;  1B8C A;  1PVA A;  1AHR A;  4FQT A;  3NHI A;  5KU1 A;  2P71 A;  1LIN A;  4C0K A;  1IH0 A;  2L51 A;  1MUX A;  1TRF A;  2GTE A;  3FWB A;  5CPV A;  1BJF A;  4PHJ A;  2JUL A;  2JXC A;  3NGV A;  4GUK A;  3WHU B;  2KAY A;  1QLS A;  5I2O A;  1C3Z A;  1ORG A;  3L4L A;  2CXJ A;  3DD4 A;  1KQM C;  2ISD A;  2KI6 C;  1QIW A;  1Y1X A;  5FYX A;  2ZFD A;  2OTG C;  3BUM B;  1OMD A;  3DZT A;  4Q04 A;  1YX8 A;  3Q8I A;  3SS5 A;  3BXK A;  3AKA A;  4GFT A;  2M3W A;  4PT1 A;  5BPJ A;  3TZ1 A;  3LK1 A;  4PE7 A;  1GGW A;  1S3P A;  1S5G Y;  3OHM B;  4PE1 A;  4F7F A;  4QJ5 B;  5IBW A;  1B7T Y;  1XFW O;  4PAL A;  3LLE A;  5HKW A;  2OS8 C;  1XA5 A;  4OCI A;  4JKT A;  4MLW A;  2ZKM X;  2LVK A;  4XJK B;  3RM1 A;  4ORA B;  2MRD A;  1BOC A;  2CNP A;  1TTX A;  1KSO A;  1BR4 B;  3PFV A;  1LA0 A;  3S0A A;  1CB1 A;  1B47 A;  2F8P A;  3D77 A;  3PM8 A;  2I94 A;  1IQ3 A;  1BMO A;  3N7H A;  1K2H A;  3KO0 A;  3VRO A;  2NXQ A;  4IJ7 A;  3D75 A;  4UPG A;  2M29 A;  2SCP A;  3VGO A;  1CNP A;  1K9P A;  3FIA A;  4ORC B;  1SY9 A;  1H8B A;  4QJ4 B;  1MXL C;  1NPQ A;  2JNF A;  2PRU A;  1UHI A;  1CLB A;  3L47 A;  3NHT A;  1YTZ C;  2PQL A;  2KYF A;  4GGF A;  1B8L A;  2G9B A;  5KTY A;  1J7P A;  3SS3 A;  1R2U A;  1DJY A;  1Y0V H;  1C3Y A;  3CZT X;  3TUY B;  2M49 B;  2M9G A;  2O60 A;  4JQ0 D;  5B8I B;  4I5K A;  4OZD A;  1UWO A;  3QRX A;  1RK9 A;  4MEW A;  2L2C A;  2Q91 A;  1ZOT B;  3K21 A;  2K0J A;  1YUR A;  2KGR A;  4ORB B;  3EKJ A;  1DEK A;  2JT0 A;  2JQ6 A;  2MLE C;  2QEB A;  1NP8 A;  1NCX A;  1YX7 A;  5DKR A;  2JTZ A;  2F33 A;  2LMT A;  2BKI B;  2PVB A;  5FI6 A;  1LS8 A;  1NX3 A;  2LNK A;  1RRO A;  3IF7 A;  2MHH A;  3S0B A;  2JPT A;  2LLU A;  4P5O E;  1QX2 A;  4MVF A;  1PVB A;  1LVC D;  2Y1N A;  4HSZ A;  1B7T Z;  2JU0 A;  4CID A;  1QAT A;  2M97 A;  4YGB B;  5FI2 A;  5DKQ A;  5HLV A;  3DYE A;  1DEL A;  1DJZ A;  2A4J A;  3F45 A;  2E6W A;  4MRX A;  3E3R A;  4QJ3 B;  3KHE A;  2F2P A;  2JOJ A;  1QV1 A;  3A4U B;  2L98 A;  4AOM A;  1XO5 A;  3EVU A;  1DMO A;  1JSA A;  2M1U A;  2DOQ A;  4XYN A;  4DIR A;  1TWO A;  1XFY O;  1DQE A;  1DJH A;  3I5H B;  1QVI Y;  1GQM A;  1SK6 D;  1ZFS A;  1FBV A;  3D73 A;  4ICB A;  3IQO A;  5D7F A;  2KFF A;  3EKH A;  4P2Y B;  1F4O A;  3HCM A;  1K95 A;  3QME A;  1JWD A;  1SPY A;  1JBA A;  1IKU A;  1YUU A;  1DGV A;  1TOP A;  1UP5 A;  1LKJ A;  2E30 A;  4MZJ A;  1GM0 A;  2EGD A;  4GBA A;  2LC5 A;  2Y4Q A;  1M46 A;  1QV0 A;  3JTD B;  3TUY C;  1RWY A;  5J3X A;  2FJY A;  3O6B A;  3I5G B;  2BCA A;  5TNC A;  2KBI A;  2KFG A;  3DF0 B;  2KAX A;  5I8N A;  1CDP A;  1QJT A;  2BAP A;  1HQV A;  3DXL A;  3DVJ A;  2LVJ A;  1U5I B;  1OOH A;  2Y1M A;  1N2D A;  4MZK A;  3CZ1 A;  2SAS A;  1FPW A;  2KBM A;  3PM2 A;  2LE9 B;  3CAB A;  1F4Q A;  1XFV O;  1BOD A;  4GNK B;  4JPZ B;  1K90 D;  3EK8 A;  2BL0 B;  4PHM A;  1K94 A;  4C0L A;  1H4B A;  1SCM B;  1QS7 A;  1MWN A;  1SNL A;  3WXA A;  1SW8 A;  3SG7 A;  1REC A;  4CLN A;  3BFA A;  3D10 A;  5I94 A;  1Z4H A;  3AAJ A;  5CSI A;  1N0Y A;  2L5X B;  1EXR A;  1OOF A;  4ETO A;  3JVT B;  4INX A;  4USL A;  1TNW A;  3EK4 A;  1BT6 A;  2KI6 D;  1AJ5 A;  2WCF A;  3AAK A;  3CR2 A;  4R1E A;  2OPO A;  3SG6 A;  4N1F A;  3NSK A;  3SG5 A;  2JTT A;  2D8N A;  4AQJ A;  1DJX A;  3DVK A;  1CTR A;  2K7B A;  1SYM A;  1EH2 A;  3I5F B;  1CM4 A;  3B7A A;  1AP4 A;  3R72 A;  2PMY A;  2ERB A;  1XFX O;  2HPS A;  5ER4 X;  1TNX A;  1OZO A;  2L4I A;  2L4H A;  4AQI A;  4PDZ A;  4M2O A;  4HRH A;  1GGZ A;  3D0Y B;  5AER A;  2MLF C;  3I5H C;  3OB1 B;  1VRK A;  1JF0 A;  2QEH A;  4HRG A;  1BU3 A;  3SS4 A;  2PAL A;  1NCZ A;  1NIW A;  1QXP A;  1W9Z A;  1QVI Z;  2F3Z A;  2LUX A;  2M7N A;  1J1E A;  1OZS A;  4I5N B;  4YBH B;  5D69 A;  1DT7 B;  4MRY A;  1SRA A;  1RFJ A;  2BCB A;  1IIO A;  1TCF A;  2CCM A;  1KFU L;  3VRN A;  1V1G A;  1WLM A;  1G33 A;  2M8U A;  1SCV A;  2FCD A;  2BE6 A;  3JTD C;  2Q4U A;  2R2I A;  2VRG A;  3BUW B;  3GK2 A;  1YVL A;  3V2L A;  1KWO B;  3I5G C;  4DS7 A;  1YUT A;  1L2O B;  2BE4 A;  1ALV A;  2L2E A;  3NSO A;  5JOL A;  2BBM A;  1DTL A;  2QEO A;  2KFH A;  2L5Y A;  2WCJ A;  4OVN F;  1E8A A;  1IWQ A;  2GGZ A;  4GGN A;  5K89 A;  3FE8 A;  1FW4 A;  1ZUZ A;  3MSE B;  3DY9 A;  2I7A A;  1MR8 A;  1SCM C;  2WCE A;  2MAZ A;  3H4S E;  1TIZ A;  4OV2 A;  5HLO A;  1KFX S;  2H2K A;  2JT3 A;  4PE4 A;  4WQ2 A;  1AJ4 A;  1XK4 C;  3JVT C;  1S1E A;  1FI6 A;  2HET A;  1YRU B;  4YGE B;  3D74 A;  1P28 A;  1WRK A;  3BFB A;  4PE0 A;  4YI9 A;  1OOG A;  1XFR A;  3O2P A;  2ZN8 A;  1J7O A;  4PCW A;  3RZS A;  2JXL A;  2KAV A;  2L0P A;  3CGA A;  2LP3 A;  1DC1 A;  1K8U A;  1A75 A;  1F70 A;  1SR6 B;  1TNQ A;  5FI7 A;  2ZN9 A;  1M45 A;  2WCM A;  3O4X A;  2KYC A;  1M39 A;  1DJG A;  1OOJ A;  1KK8 B;  4PHN A;  2Y5I A;  3I5F C;  3TDZ A;  1KQV A;  1F55 A;  1A4P A;  5AFP A;  5G08 A;  3TS5 B;  1WDC B;  4HRE E;  4JWQ A;  4FTG A;  1BF5 A;  2KPH A;  2NLN A;  2NZ0 A;  4A4C A;  1S5G Z;  3O78 A;  1S26 D;  4MN0 A;  1Z2C B;  1EJ3 A;  1SL8 A;  3NSI A;  2H61 C;  2PAS A;  1UUS A;  1F54 A;  1JF2 A;  1ZMZ A;  3B88 A;  1N65 A;  1J7R A;  3BUX B;  1FF1 A;  1JFK A;  3GOF A;  1SL7 A;  4I5J A;  3WHT B;  3S0G A;  2GV5 A;  3LK0 A;  4YI8 A;  5F6T A;  4E68 A;  2LVI A;  4M2P A;  2F2O A;  2JRF A;  2LLT A;  3K1E A;  3BJH A;  3AKB A;  5AAN A;  1L2O C;  1CKK A;  1MXE A;  3UO9 A;  3VB1 A;  1EL4 A;  4XJK A;  1MHO A;  1TUJ A;  1W7J B;  2WOS A;  1QLK A;  2MA2 A;  2O5G A;  3ZWH A;  3SG2 A;  1CMF A;  1CLL A;  2KOT A;  1FI5 A;  4BY4 A;  1KK7 Y;  2JWW A;  2WC6 A;  2WCK A;  3SJS A;  4MBE A;  4F0Z B;  1BG1 A;  2WCL A;  1S6C A;  2BBN A;  2NCP A;  2EC6 B;  1K9K A;  1A29 A;  1YR5 A;  2JPO A;  2LMV A;  1SMG A;  2LP2 A;  4BY5 A;  2WCH A;  1XVJ A;  2LAN A;  1OMV A;  3R1O A;  1PUL A;  2ZNE A;  1LA3 A;  1NYA A;  2JC2 A;  2QDI A;  5AEQ A;  5JJG A;  4NDB A;  2LV7 A;  1CDL A;  3M0W A;  1SR6 C;  1R6P A;  4DUQ A;  1F8H A;  3TDU A;  2P6B B;  3WNX B;  5CSF A;  1KK8 C;  3BFH A;  1BR1 B;  1TN4 A;  5DKN A;  3IVT A;  3TS5 C;  1UHJ A;  4YRU A;  2HF5 A;  1NCY A;  1Q80 A;  1QAS A;  3BUO B;  1NUB A;  1B8R A;  4OKH A;  1YUS A;  2WC5 A;  1DJW A;  2PYQ A;  1CDM A;  1UHN A;  2I2R E;  3GK1 A;  4TNC A;  2LUC A;  3OBV A;  1SBJ A;  1DF0 A;  1WRL A;  2LM5 A;  2K2F A;  4JD9 A;  1B4C A;  1YVH A;  1AVS A;  2LCP A;  3CYZ A;  4N5X A;  1CFF A;  1UUR A;  2MJW B;  2HQ8 A;  5ER5 A;  3RLZ A;  5HYD A;  4CFR A;  2M0R A;  3OGN A;  3DVM A;  3PN7 B;  4KYN A;  5AXI A;  3I5I B;  4ZCV A;  3S0F A;  2F3Y A;  1QWV A;  3KEV A;  3OX5 A;  4NQG A;  2FJU B;  4CFQ A;  2KSP A;  2P70 A;  1F71 A;  2LVV A;  2YGU A;  2K7C A;  3C1V A;  3CZ2 A;  3PAT A;  2BEC A;  3OP0 A;  1EG4 A;  3CR4 X;  3CS1 A;  2G2B A;  1CDN A;  1RTP 1;  3FE9 A;  5EL2 A;  4C0J A;  2KQ6 A;  4FQO A;  3DVE A;  1S36 A;  1CFC A;  2KDH A;  2JT8 A;  1JC2 A;  1KCY A;  3NSL A;  2MBX A;  1XFU O;  1KK7 Z;  1RJV A;  1IGV A;  1LXF C;  2K60 A;  2K7D A;  1X02 A;  1ALW A;  2KI4 B;  2PSR A;  1CLM A;  2RGI A;  3A8R A;  1W7I B;  2EC6 C;  3LCP C;  3R1P A;  1OE9 B;  3PJI A;  1D1O A;  4GGF C;  1KSM A;  1C7V A;  1IJ6 A;  3FWC A;  1B9A A;  1IJ5 A;  2LLS A;  1B1G A;  3S0E A;  2BL0 C;  3KF9 A;  1WLZ A;  4M2Q A;  1IG5 A;  3TDI A;  4YGC B;  1JFJ A;  3EVV A;  4OR9 B;  4U8D A;  3PSR A;  2KLD A;  2LAP A;  2ZRS A;  3GK4 X;  1DGU A;  1NX2 A;  4ZCU A;  3BOW A;  1J55 A;  2AMI A;  1Y1A A;  3CR5 X;  5CSJ A;  1Y6W A;  5GQQ C;  1TCO B;  3DF0 A;  5KSZ A;  2JZI A;  3VRP A;  1OMR A;  1U5I A;  2FOT A;  1IRJ A;  2WCB A;  2EHB A;  1OW4 A;  4L9M A;  2TN4 A;  3KPX A;  2KLE A;  1DVI A;  1CMG A;  3B6X A;  3IQQ A;  1QX7 A;  3S0D A;  1C7W A;  1S6I A;  2FCE A;  4NDD A;  1WRZ A;  1NX1 A;  1SSE B;  1JUO A;  3PN7 C;  4GAO A;  2QAC A;  3O4Y A;  2JNX A;  2KHN A;  1XK4 A;  3I5I C;  1PAL A;  4IL1 A;  2AAO A;  3HX4 A;  1ZAC A;  2ZRT A;  4DCK A;  3VRQ A;  3BYA A;  1DF0 B;  3D76 A;  4NDC A;  1HT9 A;  2CBL A;  4CPV A;  3D78 A;  3BQ3 A;  3OB2 B;  3B86 A;  3CZ0 A;  5HKY A;  3LL8 B;  1S6J A;  5PAL A;  1IQ5 A;  1PK0 D;  1PRW A;  3L4A A;  1OOI X;  2HQW A;  1K9U A;  4WRI A;  3R1V A;  1K93 D;  2CT9 A;  4YGA A;  2GGM A;  2WND A;  4DRW A;  1MF8 B;  4I5L B;  1XYD A;  2L50 A;  3SIA A;  2I18 A;  4MZL A;  5I2L A;  1SKT A;  2K8M B;  2BKH B;  3SG3 A;  3ZNI A;  4A4B A;  1M63 B;  1TUZ A;  1KWO C;  2H8V A;  3OX6 A;  2K2A A;  1KQM B;  5HL1 A;  5DIC A;  2QEV A; 
#chains in the Genus database with same CATH homology
 2KGB C;  1G4Y R;  2H61 A;  2KI4 C;  2OTG B;  3D0Y A;  2LMU A;  1KFU S;  2M7L A;  1QTX A;  1NX0 A;  1NSH A;  1CFD A;  1J7Q A;  1ODB A;  4MSP A;  2K61 A;  1M31 A;  4N1G A;  3VRR A;  4GPL B;  1K96 A;  3EK7 A;  2OS8 B;  2WC8 A;  1QX5 B;  2LHL A;  3FS7 A;  3SG4 A;  3PLF B;  1PSR A;  1L7Z A;  1Y1U A;  1WY9 A;  1V1F A;  2B1U A;  1XFZ O;  1GJY A;  1OSA A;  1QIV A;  2KNE A;  1J1D A;  2NCO A;  5CSN A;  1A03 A;  3CTN A;  2KQY A;  4WQ3 A;  1PSB A;  2AUC A;  3CWG A;  2IS9 A;  5HKZ A;  1SL9 A;  5I2Q A;  3SIB A;  4PHK A;  1CFP A;  3PAL A;  4D1E A;  1BLQ A;  2QPT A;  2CTN A;  2K7O A;  1NWD A;  1YRT B;  1UHH A;  3BOW B;  1TNP A;  2V53 A;  3BUN B;  3ICB A;  1WDC C;  2COL B;  3EVR A;  1C07 A;  4YGD B;  1A2X A;  1KFX L;  1AK8 A;  1OQP A;  1CM1 A;  1AUI B;  1MQ1 A;  2ZND A;  1DJI A;  1EG3 A;  1A75 B;  1G8I A;  1UHK A;  2WOR A;  3NXA A;  3CLN A;  2LHI A;  2BCX A;  2M1K B;  1B8C A;  1PVA A;  1AHR A;  5KU1 A;  1LIN A;  4C0K A;  1IH0 A;  2L51 A;  1MUX A;  1TRF A;  3FWB A;  5CPV A;  1BJF A;  4PHJ A;  2JUL A;  2JXC A;  4GUK A;  3WHU B;  2KAY A;  1QLS A;  5I2O A;  2CXJ A;  3DD4 A;  1KQM C;  2ISD A;  2KI6 C;  1QIW A;  1Y1X A;  5FYX A;  2ZFD A;  2OTG C;  3BUM B;  1OMD A;  4Q04 A;  1YX8 A;  3BXK A;  3AKA A;  4GFT A;  2M3W A;  5BPJ A;  3TZ1 A;  3LK1 A;  4PE7 A;  1GGW A;  1S3P A;  1S5G Y;  3OHM B;  4PE1 A;  4QJ5 B;  5IBW A;  1B7T Y;  1XFW O;  4PAL A;  3LLE A;  5HKW A;  2OS8 C;  1XA5 A;  4OCI A;  4MLW A;  2ZKM X;  2LVK A;  4XJK B;  3RM1 A;  4ORA B;  2MRD A;  1BOC A;  2CNP A;  1KSO A;  1BR4 B;  1TTX A;  3PFV A;  1LA0 A;  1CB1 A;  1B47 A;  2F8P A;  3PM8 A;  2I94 A;  1IQ3 A;  1BMO A;  1K2H A;  3KO0 A;  3VRO A;  2NXQ A;  4UPG A;  2M29 A;  2SCP A;  3VGO A;  1CNP A;  1K9P A;  3FIA A;  4ORC B;  1SY9 A;  1H8B A;  4QJ4 B;  1MXL C;  1NPQ A;  2JNF A;  2PRU A;  1UHI A;  1CLB A;  1YTZ C;  2KYF A;  4GGF A;  1B8L A;  2G9B A;  5KTY A;  1J7P A;  1R2U A;  1DJY A;  1Y0V H;  3CZT X;  3TUY B;  2M49 B;  2M9G A;  2O60 A;  4JQ0 D;  5B8I B;  4I5K A;  1UWO A;  3QRX A;  1RK9 A;  4MEW A;  2Q91 A;  1ZOT B;  3K21 A;  2K0J A;  1YUR A;  2KGR A;  4ORB B;  3EKJ A;  2JT0 A;  2MLE C;  2JQ6 A;  4A4B A;  1NP8 A;  1NCX A;  1YX7 A;  5DKR A;  2JTZ A;  2F33 A;  2LMT A;  2BKI B;  2PVB A;  1NX3 A;  2LNK A;  1RRO A;  3IF7 A;  2MHH A;  2JPT A;  2LLU A;  4P5O E;  1QX2 A;  4MVF A;  1PVB A;  1LVC D;  2Y1N A;  4HSZ A;  1B7T Z;  2JU0 A;  4CID A;  1QAT A;  2M97 A;  4YGB B;  5HLV A;  5DKQ A;  1DJZ A;  2A4J A;  3F45 A;  2E6W A;  4MRX A;  3E3R A;  4QJ3 B;  3KHE A;  2F2P A;  2JOJ A;  1QV1 A;  3A4U B;  2L98 A;  4AOM A;  1XO5 A;  3EVU A;  1DMO A;  1JSA A;  2M1U A;  2DOQ A;  4XYN A;  4DIR A;  1XFY O;  1DJH A;  3I5H B;  1QVI Y;  1GQM A;  1SK6 D;  1ZFS A;  1FBV A;  4ICB A;  3IQO A;  5D7F A;  2KFF A;  3EKH A;  4P2Y B;  1F4O A;  3HCM A;  1K95 A;  1JWD A;  1SPY A;  1JBA A;  1IKU A;  1YUU A;  1DGV A;  1TOP A;  1UP5 A;  1LKJ A;  2E30 A;  4MZJ A;  2EGD A;  4GBA A;  2LC5 A;  2Y4Q A;  1M46 A;  1QV0 A;  3JTD B;  3TUY C;  1RWY A;  5J3X A;  3O6B A;  3I5G B;  2BCA A;  5TNC A;  2KBI A;  2KFG A;  3DF0 B;  2KAX A;  5I8N A;  1CDP A;  1QJT A;  1HQV A;  3DVJ A;  2LVJ A;  1U5I B;  2Y1M A;  1N2D A;  4MZK A;  2SAS A;  1FPW A;  2KBM A;  2LE9 B;  1F4Q A;  1XFV O;  1BOD A;  4GNK B;  4JPZ B;  1K90 D;  3EK8 A;  2BL0 B;  4PHM A;  1K94 A;  4C0L A;  1H4B A;  1SCM B;  1QS7 A;  1MWN A;  1SNL A;  3WXA A;  1SW8 A;  3SG7 A;  1REC A;  4CLN A;  3D10 A;  3AAJ A;  5CSI A;  1N0Y A;  2L5X B;  1EXR A;  4ETO A;  3JVT B;  4USL A;  1TNW A;  3EK4 A;  1BT6 A;  2KI6 D;  1AJ5 A;  2WCF A;  3AAK A;  3CR2 A;  4R1E A;  2OPO A;  3SG6 A;  4N1F A;  3NSK A;  3SG5 A;  2JTT A;  2D8N A;  4AQJ A;  1DJX A;  3DVK A;  1CTR A;  2K7B A;  1SYM A;  1EH2 A;  3I5F B;  1CM4 A;  1AP4 A;  2PMY A;  1XFX O;  2HPS A;  5ER4 X;  1TNX A;  1OZO A;  2L4I A;  2L4H A;  4AQI A;  4PDZ A;  4M2O A;  4HRH A;  1GGZ A;  3D0Y B;  5AER A;  2MLF C;  3I5H C;  3OB1 B;  1VRK A;  1JF0 A;  4HRG A;  1BU3 A;  1FI5 A;  2PAL A;  1NCZ A;  1NIW A;  1QXP A;  2M7N A;  1QVI Z;  2F3Z A;  2LUX A;  4I5N B;  1J1E A;  1OZS A;  4YBH B;  5D69 A;  1DT7 B;  4MRY A;  1SRA A;  1RFJ A;  2BCB A;  1TCF A;  2CCM A;  1KFU L;  3VRN A;  1V1G A;  1WLM A;  1G33 A;  2M8U A;  1SCV A;  2FCD A;  2BE6 A;  3JTD C;  2Q4U A;  2R2I A;  2VRG A;  3BUW B;  3GK2 A;  1YVL A;  4DS7 A;  1KWO B;  3I5G C;  1YUT A;  1L2O B;  2BE4 A;  1ALV A;  2L2E A;  3NSO A;  5JOL A;  2BBM A;  1DTL A;  2KFH A;  4OVN F;  1E8A A;  1IWQ A;  2GGZ A;  4GGN A;  5K89 A;  1FW4 A;  1ZUZ A;  3MSE B;  2I7A A;  1MR8 A;  1SCM C;  2WCE A;  2MAZ A;  3H4S E;  1TIZ A;  4OV2 A;  5HLO A;  1KFX S;  2H2K A;  2JT3 A;  4PE4 A;  4WQ2 A;  1AJ4 A;  1XK4 C;  3JVT C;  1S1E A;  1FI6 A;  2HET A;  1YRU B;  4YGE B;  1WRK A;  4YI9 A;  4PE0 A;  3O2P A;  2ZN8 A;  1J7O A;  4PCW A;  2JXL A;  2KAV A;  2L0P A;  3CGA A;  2LP3 A;  1F70 A;  1K8U A;  1A75 A;  1SR6 B;  1TNQ A;  2ZN9 A;  1M45 A;  2KYC A;  1M39 A;  1DJG A;  1OOJ A;  1KK8 B;  4PHN A;  2Y5I A;  3I5F C;  3TDZ A;  1KQV A;  1F55 A;  1A4P A;  5AFP A;  5G08 A;  3TS5 B;  1WDC B;  4HRE E;  4JWQ A;  4FTG A;  1BF5 A;  2NLN A;  2NZ0 A;  4A4C A;  1S5G Z;  3O78 A;  1S26 D;  4MN0 A;  1EJ3 A;  1SL8 A;  3NSI A;  2H61 C;  2PAS A;  1UUS A;  1F54 A;  1JF2 A;  1ZMZ A;  1N65 A;  1J7R A;  3BUX B;  1FF1 A;  1JFK A;  3GOF A;  1SL7 A;  4I5J A;  3WHT B;  2GV5 A;  3LK0 A;  4YI8 A;  5F6T A;  4E68 A;  2LVI A;  4M2P A;  2F2O A;  2JRF A;  2LLT A;  3AKB A;  5AAN A;  1L2O C;  1CKK A;  1MXE A;  1EL4 A;  4XJK A;  1MHO A;  1W7J B;  2WOS A;  1QLK A;  2MA2 A;  2O5G A;  3ZWH A;  3SG2 A;  1CMF A;  1CLL A;  2KOT A;  4BY4 A;  1KK7 Y;  2JWW A;  3SJS A;  4MBE A;  4F0Z B;  1BG1 A;  1S6C A;  2BBN A;  2NCP A;  2EC6 B;  1K9K A;  1A29 A;  1YR5 A;  2LMV A;  1SMG A;  2LP2 A;  4BY5 A;  1XVJ A;  2LAN A;  1OMV A;  1PUL A;  2ZNE A;  1LA3 A;  1NYA A;  2JC2 A;  5AEQ A;  5JJG A;  4NDB A;  2LV7 A;  1CDL A;  3M0W A;  1SR6 C;  1R6P A;  4DUQ A;  1F8H A;  3TDU A;  2P6B B;  3WNX B;  5CSF A;  1KK8 C;  1BR1 B;  1TN4 A;  5DKN A;  3TS5 C;  1UHJ A;  4YRU A;  2HF5 A;  1NCY A;  1Q80 A;  1QAS A;  3BUO B;  1NUB A;  1B8R A;  4OKH A;  1YUS A;  1DJW A;  1CDM A;  1UHN A;  2I2R E;  3GK1 A;  4TNC A;  2LUC A;  1SBJ A;  1DF0 A;  1WRL A;  2LM5 A;  2K2F A;  1B4C A;  1YVH A;  1AVS A;  2LCP A;  4N5X A;  1CFF A;  1UUR A;  2MJW B;  2HQ8 A;  5ER5 A;  3RLZ A;  5HYD A;  4CFR A;  2M0R A;  3DVM A;  3PN7 B;  5AXI A;  3I5I B;  4ZCV A;  2F3Y A;  3KEV A;  3OX5 A;  4NQG A;  2FJU B;  4CFQ A;  2KSP A;  1F71 A;  2LVV A;  2K7C A;  3C1V A;  3PAT A;  2BEC A;  3OP0 A;  1EG4 A;  3CR4 X;  3CS1 A;  2G2B A;  1CDN A;  1RTP 1;  4C0J A;  2KQ6 A;  4FQO A;  3DVE A;  1S36 A;  1CFC A;  2KDH A;  2JT8 A;  1JC2 A;  1KCY A;  3NSL A;  2MBX A;  1XFU O;  1KK7 Z;  1RJV A;  1IGV A;  1LXF C;  2K7D A;  2RGI A;  1X02 A;  1ALW A;  2KI4 B;  2PSR A;  1CLM A;  3A8R A;  3LCP C;  1W7I B;  2EC6 C;  1OE9 B;  1D1O A;  4GGF C;  1KSM A;  1C7V A;  1IJ6 A;  3FWC A;  1B9A A;  1IJ5 A;  2LLS A;  1B1G A;  2BL0 C;  3KF9 A;  1WLZ A;  4M2Q A;  1IG5 A;  3TDI A;  4YGC B;  1JFJ A;  3EVV A;  4OR9 B;  4U8D A;  3PSR A;  2LAP A;  2ZRS A;  3GK4 X;  1DGU A;  1NX2 A;  4ZCU A;  3BOW A;  1J55 A;  2AMI A;  1Y1A A;  3CR5 X;  5CSJ A;  1Y6W A;  5GQQ C;  1TCO B;  3DF0 A;  5KSZ A;  2JZI A;  3VRP A;  1OMR A;  1U5I A;  2FOT A;  1IRJ A;  2WCB A;  2EHB A;  4L9M A;  2TN4 A;  3KPX A;  1CMG A;  1DVI A;  3IQQ A;  1QX7 A;  1C7W A;  1S6I A;  2FCE A;  4NDD A;  1WRZ A;  1NX1 A;  3PN7 C;  1JUO A;  4GAO A;  2QAC A;  3O4Y A;  2JNX A;  2KHN A;  1XK4 A;  3I5I C;  1PAL A;  4IL1 A;  2AAO A;  3HX4 A;  1ZAC A;  2ZRT A;  4DCK A;  3VRQ A;  3BYA A;  1DF0 B;  4NDC A;  1HT9 A;  2CBL A;  4CPV A;  3BQ3 A;  3OB2 B;  5HKY A;  3LL8 B;  1S6J A;  5PAL A;  1IQ5 A;  1PK0 D;  1PRW A;  4WRI A;  2HQW A;  1K9U A;  1K93 D;  2CT9 A;  4YGA A;  2GGM A;  2WND A;  4DRW A;  1MF8 B;  4I5L B;  1XYD A;  2L50 A;  3SIA A;  2I18 A;  4MZL A;  5I2L A;  1SKT A;  2K8M B;  2BKH B;  3SG3 A;  3ZNI A;  1M63 B;  1KWO C;  2K2A A;  1KQM B;  3OX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...