4DRWA

Crystal structure of the ternary complex between s100a10, an annexin a2 n-terminal peptide and an ahnak peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
103
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKSTVHEILSKLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10/Annexin A2 chimeric protein
publication title Structure of an asymmetric ternary protein complex provides insight for membrane interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Exocytosis/protein binding
total genus 24
structure length 103
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4drwA00
3PSRA 1C7VA 2M8UA 4MLWA 5KTYA 2MA2A 4P5OE 1S6CA 4MRYA 2JQ6A 1SR6B 3GK1A 3PN7B 1DJGA 2LANA 2OS8C 1PSRA 1YRTB 4GGFA 4NQGA 1N2DA 1ZACA 3SG2A 2BCAA 4ZCUA 4R1EA 1QV0A 5I8NA 1GJYA 4CFQA 2G9BA 2R2IA 1SCVA 2KQYA 1RECA 2JU0A 2K0JA 2WCFA 1CNPA 4DS7A 2CBLA 2LLUA 1DJXA 1L2OB 1IQ3A 2LCPA 3PLFB 2KI6C 2JTTA 1FI6A 1CM1A 1NP8A 1K95A 2F2PA 2JC2A 2KYCA 1IQ5A 1QASA 1NX3A 1AVSA 2H2KA 5CPVA 1PVAA 3GK2A 1CFFA 1UHHA 1JWDA 2L51A 2KGBC 1V1FA 2NCOA 2NLNA 2FOTA 2LVJA 1IJ6A 4OR9B 1IWQA 1XFXO 3CLNA 1BU3A 3SG6A 3DD4A 4YBHB 4TNCA 2KQ6A 1DVIA 1QATA 4GNKB 1XFVO 3RLZA 2BKHB 4OCIA 3I5HC 4UPGA 4WQ2A 2OTGC 2FCEA 3I5FB 1OQPA 1Q80A 4YGDB 4AQJA 2L50A 4XJKA 2Q4UA 2NZ0A 3PATA 4YGCB 1BODA 2QACA 2JNFA 1CFDA 3JVTB 1WDCC 3KEVA 4JQ0D 1MXLC 1J7QA 5KU1A 1OE9B 1QJTA 2LVVA 3CS1A 1M46A 1CKKA 1SMGA 2NCPA 5DKRA 1W7JB 3HCMA 1EH2A 1OZSA 1MF8B 1AHRA 1KFXL 1KK7Z 1H8BA 1SCMB 4MVFA 1DJHA 3JTDB 3PM8A 1MUXA 4ZCVA 1CDMA 2KHNA 1C7WA 3NSLA 1ZMZA 1XFWO 1XVJA 1XYDA 3SG3A 4MEWA 3VROA 1RWYA 5G08A 1KQVA 2D8NA 2LMTA 2MLFC 1S6IA 1YR5A 2LNKA 1IGVA 2BL0B 1SL7A 4C0LA 1L7ZA 3KF9A 4A4BA 2F3YA 2KAYA 2L5XB 2PMYA 3WHUB 4FTGA 3CR4X 3I5GB 1C07A 4PE1A 2L0PA 3A4UB 1N0YA 1Y1AA 2KFGA 1F55A 1CLLA 2LUXA 5CSFA 1IRJA 1QIWA 3VRRA 3LCPC 2JT3A 5D69A 5HLVA 1JC2A 3BOWA 1CB1A 1UURA 1B47A 1BMOA 2NXQA 1FF1A 1X02A 2Y4QA 1DF0A 3ICBA 5AANA 1G8IA 1UHJA 1OMRA 1B7TZ 3AKBA 3IQOA 4YI8A 1QTXA 1KWOC 1PRWA 5HYDA 1LXFC 3TUYB 1A75A 1YUTA 2WCBA 1AJ4A 2LE9B 1SKTA 2F2OA 1KFXS 1KSMA 2CXJA 1A75B 4M2QA 1M63B 1CLMA 1S3PA 2JXCA 2TN4A 3E3RA 3EVUA 1PK0D 2GGZA 1AJ5A 1DMOA 1KFUL 1CDNA 4U8DA 1DJZA 2EHBA 2I18A 1QIVA 1EJ3A 1DTLA 5JOLA 2KGRA 1F71A 1TTXA 1KK8B 2CTNA 1TNXA 2LUCA 2AMIA 3EKHA 4ETOA 1WLZA 1MXEA 1NX0A 3I5IC 3NSIA 2BCXA 1NX2A 4HRHA 3IQQA 4PE7A 3EK8A 1V1GA 1QLKA 2HQWA 5JJGA 3DF0A 1K90D 3AAKA 2M97A 1LINA 1SRAA 1SR6C 2F3ZA 1XK4A 4HRGA 3PN7C 4OVNF 2ISDA 1OMVA 2FJUB 1SNLA 1SYMA 3KPXA 1K93D 3DVMA 4ORCB 3KHEA 1EG4A 1GGZA 4QJ4B 2G2BA 3CZTX 2KDHA 4JWQA 1XFZO 3EVVA 3ZNIA 5I2QA 1RJVA 1BLQA 2L2EA 2P6BB 1DT7B 2BBMA 3EVRA 4IL1A 1LKJA 1TOPA 1YTZC 1L2OC 3IF7A 1SPYA 2JT0A 1PALA 2K2AA 2AUCA 4GPLB 3GK4X 2VRGA 2EC6B 3SG5A 1S36A 1TRFA 2MRDA 4GAOA 5HKWA 2LP2A 1SBJA 2M1KB 2K7OA 2MBXA 1TNPA 2LC5A 1QVIZ 3PFVA 1F4OA 5GQQC 1BOCA 4DIRA 1M31A 2LVIA 1KFUS 1MHOA 1IG5A 3NXAA 1Y0VH 2H61A 2M7NA 2HPSA 2GGMA 5BPJA 1K94A 3ZWHA 3VRQA 1ZOTB 1UHIA 2O60A 3K21A 1SL9A 4N5XA 4F0ZB 2CT9A 3FS7A 4QJ3B 3CTNA 3AKAA 3SJSA 1WLMA 2MAZA 2ZFDA 5AERA 3I5FC 1B1GA 4D1EA 1J1EA 2BE4A 4XJKB 2KAXA 4N1FA 5HLOA 2V53A 4XYNA 2JWWA 2BKIB 1A03A 2F33A 1NCXA 2Y1MA 2M7LA 1SL8A 1PVBA 2AAOA 1KK7Y 1QX5B 2SCPA 1RK9A 3JVTC 1KCYA 3OP0A 1YX8A 1NWDA 3NSKA 1RTP1 1Y6WA 3O2PA 4ORAB 2EGDA 2HQ8A 2LMUA 1LA0A 4YGAA 1FPWA 1WY9A 4OKHA 1NCZA 1SCMC 1QLSA 1OOJA 3JTDC 2LLSA 4C0JA 1CFPA 3DVEA 1B4CA 5PALA 5HKYA 3F45A 2K2FA 1CFCA 2ZN8A 1M39A 3D0YA 4YRUA 2CCMA 4YI9A 1HT9A 2COLB 3SG7A 3BUMB 5J3XA 2KSPA 1XFUO 1BT6A 3BUNB 1S26D 2BCBA 2LHLA 1F8HA 2BL0C 3D0YB 4C0KA 2KAVA 4YGBB 4L9MA 1DGVA 4BY4A 3CR2A 3TS5B 5B8IB 3SG4A 1AUIB 2B1UA 1JSAA 1OZOA 1VRKA 3I5GC 3LK0A 3EK7A 3LK1A 2KI4B 2L98A 1Y1XA 5KSZA 2PALA 1JF0A 1B7TY 3TDUA 3BOWB 1OMDA 4GUKA 4DCKA 1K2HA 1YUUA 1YURA 1R2UA 4FQOA 2A4JA 3NSOA 4YGEB 3CGAA 5ER4X 2BE6A 2M3WA 1DF0B 4I5JA 1S1EA 3RM1A 1KQMB 1UUSA 3EK4A 4AOMA 1TNQA 2M49B 2JOJA 2HF5A 4PCWA 5TNCA 1GQMA 3KO0A 4PHNA 3DVJA 3VGOA 2I7AA 1A29A 1R6PA 2JNXA 4WQ3A 3OHMB 5IBWA 2KBIA 1EXRA 3TUYC 1IJ5A 5DKNA 1W7IB 4PHJA 1K96A 2PRUA 3SIAA 4MN0A 3O78A 2GV5A 3BQ3A 4CLNA 1ALWA 2M29A 1JFKA 2LAPA 1B8LA 4MZLA 3TZ1A 4MZKA 2KFHA 3OB1B 1DJWA 1JF2A 1PULA 3C1VA 2E6WA 1CTRA 1MR8A 4GFTA 1KK8C 1WRLA 1LVCD 1QXPA 2K7BA 3OB2B 4P2YB 4Q04A 2Y5IA 2F8PA 1DJYA 2JULA 3BUOB 2JPTA 1MQ1A 2ZRTA 3DF0B 4CIDA 5CSIA 3LL8B 1S5GZ 1WRKA 1M45A 2WORA 4CFRA 5AEQA 2OS8B 4GGFC 2KFFA 2LHIA 4N1GA 2LP3A 2M0RA 2ZRSA 1XK4C 5K89A 1H4BA 3D10A 1EL4A 4WRIA 2E30A 1QVIY 2Y1NA 3CR5X 4DRWA 1QX7A 2JTZA 2KNEA 1D1OA 1FI5A 1J7PA 1LA3A 1AP4A 2IS9A 1N65A 1NSHA 2BBNA 1BG1A 5HKZA 1DGUA 3VRPA 1BF5A 2EC6C 5D7FA 4HSZA 5DKQA 1B8CA 4PE4A 1A2XA 3H4SE 2ZNEA 4PE0A 1UWOA 3TDIA 1ODBA 4BY5A 1WRZA 4I5KA 2JZIA 4A4CA 2L4IA 2PSRA 1TN4A 2CNPA 2KYFA 4PALA 2MJWB 1F70A 1TCOB 2K61A 2L4HA 4DUQA 1RROA 3I5HB 2JXLA 5ER5A 4CPVA 3BXKA 1XFYO 2OTGB 2H61C 2PASA 3MSEB 1F54A 1K9KA 1NCYA 1JUOA 1B8RA 3FWCA 1U5IA 2I94A 1UHKA 2FCDA 2ZN9A 2ZNDA 1BJFA 4HREE 1K9PA 2LVKA 4MRXA 2HETA 2OPOA 4GGNA 3QRXA 1CDLA 1U5IB 1NUBA 4NDCA 1IH0A 2RGIA 3OX5A 2WCEA 1WDCB 5FYXA 1QX2A 1K8UA 1PSBA 1ZFSA 5AFPA 4MSPA 1JBAA 1TNWA 2O5GA 4ICBA 1MWNA 1A4PA 1CM4A 3CWGA 1KSOA 1YVHA 5AXIA 1YX7A 1G4YR 2MHHA 3GOFA 1NYAA 1YUSA 1UHNA 2KI6D 4NDBA 3SIBA 1J7RA 3BYAA 3WHTB 3EKJA 1EG3A 3LLEA 3BUXB 1J1DA 4MZJA 3AAJA 3VRNA 4AQIA 4USLA 1CMFA 3WXAA 5CSNA 3BUWB 3PALA 1GGWA 1SK6D 1HQVA 2QPTA 1B9AA 1J55A 4PDZA 1FW4A 3TS5C 1SY9A 1NX1A 2PVBA 2ZKMX 3FWBA 4E68A 1K9UA 1ZUZA 1OSAA 2K8MB 4I5NB 2LM5A 2KI4C 3O6BA 1NPQA 2BECA 1CDPA 1Y1UA 1ALVA 1S6JA 1SW8A 1YVLA 2LMVA 2K7DA 5CSJA 2LV7A 4M2PA 1JFJA 1TIZA 3WNXB 1XA5A 4JPZB 4OV2A 1QV1A 1NIWA 4PHMA 3FIAA 3OX6A 2M1UA 1TCFA 5F6TA 2WNDA 2KOTA 2WOSA 1KQMC 4M2OA 4I5LB 4MBEA 4ORBB 1IKUA 2SASA 1F4QA 3O4YA 2I2RE 2MLEC 1KWOB 1DJIA 3M0WA 3A8RA 1BR1B 1RFJA 2KBMA 1YRUB 1FBVA 4PHKA 1CMGA 1J7OA 2DOQA 1XO5A 2JT8A 4NDDA 1AK8A 4GBAA 3DVKA 1UP5A 2K7CA 2LLTA 4QJ5B 2JRFA 1G33A 2M9GA 2WC8A 2Q91A 1S5GY 3HX4A 5I2LA 5I2OA 1CLBA 1BR4B 1E8AA 3I5IB 3TDZA 1QS7A
chains in the Genus database with same CATH superfamily
3PSRA 1C7VA 3FE6A 2M8UA 4MLWA 5KTYA 2MA2A 4P5OE 1S6CA 4MRYA 2JQ6A 1SR6B 3GK1A 3B87A 3PN7B 1DJGA 3QMEA 2LANA 2OS8C 1PSRA 1YRTB 2L2CA 3L47A 1N2DA 4GGFA 4NQGA 1TWOA 1ZACA 3SG2A 2BCAA 2QDIA 4ZCUA 4R1EA 1QV0A 1QWVA 5I8NA 1GJYA 4CFQA 2G9BA 2R2IA 1SCVA 2KQYA 1RECA 2JU0A 2K0JA 2WCFA 1CNPA 4DS7A 2CBLA 2LLUA 1DJXA 1L2OB 2ERBA 1IQ3A 2LCPA 3PLFB 2KI6C 2JTTA 1FI6A 1CM1A 1NP8A 1K95A 2F2PA 2JC2A 2KYCA 1IQ5A 1QASA 1NX3A 1AVSA 2H2KA 5CPVA 1PVAA 3GK2A 1CFFA 1UHHA 1JWDA 2L51A 2KGBC 1V1FA 5EL2A 2NCOA 2NLNA 2FOTA 2LVJA 3N7HA 1IJ6A 4OR9B 1IWQA 1XFXO 3CLNA 1BU3A 3SG6A 3DD4A 4YBHB 4TNCA 2KQ6A 1DVIA 1QATA 4GNKB 3S0DA 1XFVO 3RLZA 2BKHB 4OCIA 3I5HC 3BJHA 4UPGA 4WQ2A 2OTGC 2FCEA 3I5FB 1OQPA 1Q80A 4YGDB 4AQJA 2L50A 4XJKA 3DXLA 2Q4UA 2BNXA 2NZ0A 3PATA 3PM2A 4YGCB 1BODA 2QACA 2JNFA 1CFDA 3JVTB 1WDCC 3KEVA 4JQ0D 1MXLC 1J7QA 5KU1A 1OE9B 1QJTA 2LVVA 3CS1A 1M46A 1CKKA 1SMGA 2NCPA 5DKRA 1W7JB 3HCMA 3SS3A 1EH2A 1OZSA 3D75A 1MF8B 1AHRA 1KFXL 3L4LA 1KK7Z 1H8BA 1SCMB 4MVFA 1DJHA 3JTDB 3PM8A 5DICA 1MUXA 3FE8A 4ZCVA 1CDMA 2KHNA 1C7WA 1Z2CB 3NSLA 1ZMZA 1XFWO 1XVJA 1XYDA 3SG3A 4MEWA 3VROA 1RWYA 5G08A 1KQVA 2D8NA 2LMTA 2MLFC 1S6IA 1YR5A 2LNKA 1IGVA 2BL0B 1SL7A 4C0LA 1L7ZA 3D74A 3KF9A 4A4BA 2F3YA 2KAYA 2KLEA 3BFBA 2L5XB 2PMYA 3WHUB 4FTGA 3CR4X 3I5GB 1C07A 2WCKA 2L0PA 4PE1A 3A4UB 1N0YA 1Y1AA 5HL1A 2H8VA 2KFGA 1F55A 1CLLA 2LUXA 3DZTA 5CSFA 1IRJA 1QIWA 3VRRA 3LCPC 2JT3A 5D69A 5HLVA 1JC2A 3BOWA 1CB1A 1UURA 3SS4A 3VB1A 1B47A 1BMOA 3S0EA 2NXQA 1LS8A 1FF1A 1X02A 2Y4QA 1DF0A 3ICBA 5AANA 1G8IA 1UHJA 1OMRA 1B7TZ 3AKBA 3IQOA 4YI8A 1QTXA 1KWOC 1PRWA 5HYDA 1LXFC 3TUYB 1A75A 1YUTA 2WCBA 1AJ4A 2LE9B 1SKTA 2F2OA 1KFXS 1KSMA 2CXJA 1A75B 4M2QA 1M63B 1CLMA 1S3PA 2JXCA 2TN4A 1TUZA 2P70A 3B6XA 3D73A 2QEHA 1PK0D 2GGZA 1AJ5A 3E3RA 3EVUA 1KFUL 5FI6A 1CDNA 1DMOA 4U8DA 1DJZA 2EHBA 2I18A 1QIVA 1EJ3A 1DTLA 2WC5A 5JOLA 2KGRA 1F71A 1TTXA 1KK8B 2CTNA 1TNXA 2LUCA 2AMIA 3EKHA 4ETOA 1WLZA 1MXEA 1NX0A 3I5IC 3NSIA 2BCXA 1NX2A 2QEVA 4HRHA 3IQQA 4PE7A 3EK8A 3NGVA 1V1GA 1QLKA 2HQWA 3OGNA 5JJGA 3DF0A 1K90D 3AAKA 2M97A 2PYQA 3UO9A 1LINA 1SRAA 1SR6C 2F3ZA 1XK4A 4HRGA 4F7FA 3PN7C 4OVNF 2ISDA 1OMVA 2FJUB 1SNLA 1SYMA 3KPXA 1K93D 3DVMA 4FQTA 4ORCB 3KHEA 1EG4A 1GGZA 4QJ4B 2G2BA 3CZTX 2KDHA 4JWQA 2QEBA 2BAPA 1XFZO 3EVVA 1T14A 3NHTA 3Q8IA 3ZNIA 5I2QA 1RJVA 1BLQA 2L2EA 2P6BB 1DT7B 2BBMA 1ORGA 3EVRA 4JD9A 4IL1A 1LKJA 1TOPA 1YTZC 1L2OC 3IF7A 1SPYA 2JT0A 1PALA 2K2AA 2AUCA 4GPLB 3GK4X 2VRGA 2EC6B 3SG5A 2WCLA 1S36A 1TRFA 2MRDA 4GAOA 5HKWA 2LP2A 1SBJA 2M1KB 2K7OA 2WCHA 2MBXA 1TNPA 2LC5A 1QVIZ 1SSEB 2FJYA 3PFVA 1F4OA 5GQQC 1BOCA 4DIRA 1M31A 2LVIA 3CABA 1KFUS 1MHOA 1IG5A 3NXAA 1Y0VH 2H61A 2M7NA 3V2LA 2HPSA 5D3OA 2GGMA 5BPJA 1K94A 3ZWHA 3VRQA 1ZOTB 1UHIA 3IVTA 2O60A 3K21A 1SL9A 4N5XA 4F0ZB 2CT9A 3B86A 3FS7A 3CTNA 4QJ3B 3AKAA 3DY9A 1WLMA 2MAZA 2ZFDA 3SJSA 5AERA 3I5FC 1B1GA 4D1EA 1J1EA 2BE4A 2L5YA 4XJKB 3S0AA 2K60A 2KAXA 4N1FA 5HLOA 2V53A 4XYNA 2JWWA 2BKIB 1A03A 2F33A 1NCXA 2Y1MA 2M7LA 1SL8A 1PVBA 2AAOA 1KK7Y 1QX5B 2SCPA 1RK9A 3JVTC 1KCYA 3CZ2A 3OP0A 3PJIA 1YX8A 1NWDA 3NSKA 1RTP1 1Y6WA 1OOIX 3O2PA 4ORAB 2EGDA 2HQ8A 2LMUA 1LA0A 4YGAA 1FPWA 2P71A 1WY9A 4OKHA 1NCZA 1SCMC 1QLSA 1OOJA 3JTDC 2LLSA 4C0JA 1CFPA 3DVEA 1B4CA 5PALA 5HKYA 3F45A 2K2FA 1CFCA 2ZN8A 1M39A 3D0YA 4YRUA 2CCMA 4YI9A 1HT9A 2COLB 3SG7A 3BUMB 5J3XA 3CYZA 2KSPA 1XFUO 5I94A 1BT6A 3BUNB 1S26D 2BCBA 2LHLA 1F8HA 2BL0C 3D0YB 4C0KA 2KAVA 4YGBB 4L9MA 3D77A 1DGVA 4BY4A 2GTEA 3CR2A 3TS5B 5B8IB 3SG4A 1AUIB 2B1UA 1JSAA 1OZOA 1VRKA 3I5GC 3LK0A 3EK7A 3LK1A 2KI4B 2L98A 1OOHA 1Y1XA 5KSZA 4IJ7A 2PALA 1JF0A 3R1OA 1B7TY 3TDUA 3BOWB 1OMDA 4GUKA 4DCKA 3CZ0A 1K2HA 1OW4A 2QEOA 1YUUA 1YURA 1R2UA 4FQOA 2A4JA 3NSOA 4OZDA 4YGEB 3CGAA 5ER4X 2BE6A 2M3WA 1DF0B 4I5JA 3S0FA 1S1EA 3RM1A 1KQMB 1UUSA 3EK4A 4AOMA 1TNQA 2M49B 2JOJA 2HF5A 4PCWA 5TNCA 1GQMA 3KO0A 4PHNA 3DVJA 3VGOA 2I7AA 1A29A 1R6PA 2JNXA 4WQ3A 3OHMB 5IBWA 2KBIA 1EXRA 3OBVA 3TUYC 1IJ5A 5DKNA 1W7IB 4PHJA 1K96A 2PRUA 1P28A 3SIAA 4MN0A 3O78A 2GV5A 2KLDA 3BQ3A 3S0BA 1ALWA 4CLNA 2M29A 1C3ZA 1JFKA 2LAPA 1B8LA 3DYEA 4MZLA 3TZ1A 4MZKA 2KFHA 3OB1B 1DJWA 1JF2A 3CZ1A 1PULA 3C1VA 2E6WA 1CTRA 1MR8A 4GFTA 1KK8C 1WRLA 1LVCD 1QXPA 2K7BA 3OB2B 4P2YB 4Q04A 2Y5IA 2F8PA 1DJYA 2JULA 3BUOB 2JPTA 1MQ1A 2ZRTA 3DF0B 4CIDA 5CSIA 3SS5A 3LL8B 1S5GZ 1WRKA 1M45A 2WORA 4CFRA 5AEQA 2OS8B 4GGFC 2KFFA 2LHIA 4N1GA 2LP3A 2M0RA 2ZRSA 1XK4C 5K89A 1H4BA 2KPHA 3D10A 1EL4A 4WRIA 2E30A 3K1EA 1QVIY 2Y1NA 3CR5X 4INWA 4PT1A 1QX7A 2JTZA 2KNEA 4DRWA 1D1OA 3RZSA 1FI5A 3FE9A 1J7PA 1LA3A 3D78A 1AP4A 2IS9A 1N65A 1NSHA 2BBNA 1BG1A 5HKZA 1DGUA 3VRPA 1BF5A 2EC6C 5D7FA 4HSZA 5DKQA 1B8CA 4PE4A 1A2XA 3R1PA 2WCMA 3H4SE 3NHIA 2ZNEA 4PE0A 1UWOA 3TDIA 1ODBA 4BY5A 1WRZA 4I5KA 2JZIA 4A4CA 3BFAA 2L4IA 2PSRA 1TN4A 2CNPA 2KYFA 4PALA 2MJWB 5FI2A 1F70A 1TCOB 2K61A 2L4HA 4INXA 1RROA 4DUQA 3I5HB 2JXLA 2WC6A 5ER5A 4CPVA 3BXKA 1XFYO 2OTGB 2H61C 2PASA 3MSEB 1F54A 1K9KA 3O4XA 1NCYA 1JUOA 1B8RA 3FWCA 1U5IA 2I94A 1UHKA 2FCDA 2ZN9A 2ZNDA 1BJFA 4HREE 1K9PA 2LVKA 4MRXA 2HETA 2OPOA 4GGNA 3QRXA 1CDLA 1U5IB 1NUBA 4NDCA 1IH0A 2RGIA 3EG5B 3OX5A 2WCEA 1WDCB 5FYXA 1QX2A 1DEKA 3L4AA 1K8UA 1PSBA 1GM0A 1ZFSA 5AFPA 2YGUA 4MSPA 1JBAA 1TNWA 2O5GA 4ICBA 1MWNA 1IIOA 1A4PA 1CM4A 3CWGA 1KSOA 1YVHA 5AXIA 1YX7A 1G4YR 2MHHA 1TUJA 3GOFA 1NYAA 1YUSA 1UHNA 2KI6D 4NDBA 3SIBA 1J7RA 3BYAA 3WHTB 3EKJA 3R72A 1EG3A 3LLEA 3BUXB 1J1DA 4MZJA 3AAJA 3VRNA 4AQIA 4USLA 1CMFA 1DQEA 3WXAA 3R1VA 5CSNA 3BUWB 3PALA 1GGWA 1SK6D 1DC1A 1HQVA 2QPTA 1B9AA 1J55A 2PQLA 4PDZA 1FW4A 3TS5C 1SY9A 3D76A 1NX1A 2PVBA 2ZKMX 3B7AA 3FWBA 4E68A 1K9UA 1ZUZA 3BFHA 1OSAA 2K8MB 4I5NB 2LM5A 2KI4C 3O6BA 1NPQA 2BECA 1CDPA 1Y1UA 1ALVA 1S6JA 1SW8A 1YVLA 2LMVA 2K7DA 5CSJA 2LV7A 4M2PA 1JFJA 1TIZA 3WNXB 1XA5A 4JPZB 1XFRA 4OV2A 1QV1A 1NIWA 4PHMA 3FIAA 3OX6A 1OOFA 2M1UA 1TCFA 5F6TA 2WNDA 2KOTA 2WOSA 1KQMC 1OOGA 4I5LB 4M2OA 4MBEA 4ORBB 1IKUA 2SASA 1F4QA 3O4YA 2I2RE 2MLEC 4KYNA 1KWOB 4JKTA 1DJIA 3M0WA 3A8RA 1BR1B 1W9ZA 3CDNA 1DELA 1RFJA 2KBMA 1YRUB 1FBVA 3S0GA 4PHKA 1CMGA 1J7OA 1Z4HA 1XO5A 2DOQA 5FI7A 3UNWA 2JPOA 2JT8A 4NDDA 1AK8A 4GBAA 3DVKA 1UP5A 2WCJA 2K7CA 2LLTA 3B88A 4QJ5B 2JRFA 1G33A 2M9GA 2WC8A 2Q91A 1C3YA 1S5GY 3HX4A 5I2LA 5I2OA 1CLBA 1BR4B 1E8AA 3I5IB 3TDZA 1QS7A
chains in the Genus database with same CATH topology
3PSRA 1C7VA 2M8UA 4MLWA 5KTYA 2MA2A 4P5OE 1S6CA 4MRYA 2JQ6A 1SR6B 3GK1A 3PN7B 1DJGA 2LANA 2OS8C 1PSRA 1YRTB 4GGFA 4NQGA 1N2DA 1ZACA 3SG2A 2BCAA 4ZCUA 4R1EA 1QV0A 5I8NA 1GJYA 4CFQA 2G9BA 2R2IA 1SCVA 2KQYA 1RECA 2JU0A 2K0JA 2WCFA 1CNPA 4DS7A 2CBLA 2LLUA 1DJXA 1L2OB 1IQ3A 2LCPA 3PLFB 2KI6C 2JTTA 1FI6A 1CM1A 1NP8A 1K95A 2F2PA 2JC2A 2KYCA 1IQ5A 1QASA 1NX3A 1AVSA 2H2KA 5CPVA 1PVAA 3GK2A 1CFFA 1UHHA 1JWDA 2L51A 2KGBC 1V1FA 2NCOA 2NLNA 2FOTA 2LVJA 1IJ6A 4OR9B 1IWQA 1XFXO 3CLNA 1BU3A 3SG6A 3DD4A 4YBHB 4TNCA 2KQ6A 1DVIA 1QATA 4GNKB 1XFVO 3RLZA 2BKHB 4OCIA 3I5HC 4UPGA 4WQ2A 2OTGC 2FCEA 3I5FB 1OQPA 1Q80A 4YGDB 4AQJA 2L50A 4XJKA 2Q4UA 2NZ0A 3PATA 4YGCB 1BODA 2QACA 2JNFA 1CFDA 3JVTB 1WDCC 3KEVA 4JQ0D 1MXLC 1J7QA 5KU1A 1OE9B 1QJTA 2LVVA 3CS1A 1M46A 1CKKA 1SMGA 2NCPA 5DKRA 1W7JB 3HCMA 1EH2A 1OZSA 1MF8B 1AHRA 1KFXL 1KK7Z 1H8BA 1SCMB 4MVFA 1DJHA 3JTDB 3PM8A 1MUXA 4ZCVA 1CDMA 2KHNA 1C7WA 3NSLA 1ZMZA 1XFWO 1XVJA 1XYDA 3SG3A 4MEWA 3VROA 1RWYA 5G08A 1KQVA 2D8NA 2LMTA 2MLFC 1S6IA 1YR5A 2LNKA 1IGVA 2BL0B 1SL7A 4C0LA 1L7ZA 3KF9A 4A4BA 2F3YA 2KAYA 2L5XB 2PMYA 3WHUB 4FTGA 3CR4X 3I5GB 1C07A 4PE1A 2L0PA 3A4UB 1N0YA 1Y1AA 2KFGA 1F55A 1CLLA 2LUXA 5CSFA 1IRJA 1QIWA 3VRRA 3LCPC 2JT3A 5D69A 5HLVA 1JC2A 3BOWA 1CB1A 1UURA 1B47A 1BMOA 2NXQA 1FF1A 1X02A 2Y4QA 1DF0A 3ICBA 5AANA 1G8IA 1UHJA 1OMRA 1B7TZ 3AKBA 3IQOA 4YI8A 1QTXA 1KWOC 1PRWA 5HYDA 1LXFC 3TUYB 1A75A 1YUTA 2WCBA 1AJ4A 2LE9B 1SKTA 2F2OA 1KFXS 1KSMA 2CXJA 1A75B 4M2QA 1M63B 1CLMA 1S3PA 2JXCA 2TN4A 3E3RA 3EVUA 1PK0D 2GGZA 1AJ5A 1DMOA 1KFUL 1CDNA 4U8DA 1DJZA 2EHBA 2I18A 1QIVA 1EJ3A 1DTLA 5JOLA 2KGRA 1F71A 1TTXA 1KK8B 2CTNA 1TNXA 2LUCA 2AMIA 3EKHA 4ETOA 1WLZA 1MXEA 1NX0A 3I5IC 3NSIA 2BCXA 1NX2A 4HRHA 3IQQA 4PE7A 3EK8A 1V1GA 1QLKA 2HQWA 5JJGA 3DF0A 1K90D 3AAKA 2M97A 1LINA 1SRAA 1SR6C 2F3ZA 1XK4A 4HRGA 3PN7C 4OVNF 2ISDA 1OMVA 2FJUB 1SNLA 1SYMA 3KPXA 1K93D 3DVMA 4ORCB 3KHEA 1EG4A 1GGZA 4QJ4B 2G2BA 3CZTX 2KDHA 4JWQA 1XFZO 3EVVA 3ZNIA 5I2QA 1RJVA 1BLQA 2L2EA 2P6BB 1DT7B 2BBMA 3EVRA 4IL1A 1LKJA 1TOPA 1YTZC 1L2OC 3IF7A 1SPYA 2JT0A 1PALA 2K2AA 2AUCA 4GPLB 3GK4X 2VRGA 2EC6B 3SG5A 1S36A 1TRFA 2MRDA 4GAOA 5HKWA 2LP2A 1SBJA 2M1KB 2K7OA 2MBXA 1TNPA 2LC5A 1QVIZ 3PFVA 1F4OA 5GQQC 1BOCA 4DIRA 1M31A 2LVIA 1KFUS 1MHOA 1IG5A 3NXAA 1Y0VH 2H61A 2M7NA 2HPSA 2GGMA 5BPJA 1K94A 3ZWHA 3VRQA 1ZOTB 1UHIA 2O60A 3K21A 1SL9A 4N5XA 4F0ZB 2CT9A 3FS7A 4QJ3B 3CTNA 3AKAA 3SJSA 1WLMA 2MAZA 2ZFDA 5AERA 3I5FC 1B1GA 4D1EA 1J1EA 2BE4A 4XJKB 2KAXA 4N1FA 5HLOA 2V53A 4XYNA 2JWWA 2BKIB 1A03A 2F33A 1NCXA 2Y1MA 2M7LA 1SL8A 1PVBA 2AAOA 1KK7Y 1QX5B 2SCPA 1RK9A 3JVTC 1KCYA 3OP0A 1YX8A 1NWDA 3NSKA 1RTP1 1Y6WA 3O2PA 4ORAB 2EGDA 2HQ8A 2LMUA 1LA0A 4YGAA 1FPWA 1WY9A 4OKHA 1NCZA 1SCMC 1QLSA 1OOJA 3JTDC 2LLSA 4C0JA 1CFPA 3DVEA 1B4CA 5PALA 5HKYA 3F45A 2K2FA 1CFCA 2ZN8A 1M39A 3D0YA 4YRUA 2CCMA 4YI9A 1HT9A 2COLB 3SG7A 3BUMB 5J3XA 2KSPA 1XFUO 1BT6A 3BUNB 1S26D 2BCBA 2LHLA 1F8HA 2BL0C 3D0YB 4C0KA 2KAVA 4YGBB 4L9MA 1DGVA 4BY4A 3CR2A 3TS5B 5B8IB 3SG4A 1AUIB 2B1UA 1JSAA 1OZOA 1VRKA 3I5GC 3LK0A 3EK7A 3LK1A 2KI4B 2L98A 1Y1XA 5KSZA 2PALA 1JF0A 1B7TY 3TDUA 3BOWB 1OMDA 4GUKA 4DCKA 1K2HA 1YUUA 1YURA 1R2UA 4FQOA 2A4JA 3NSOA 4YGEB 3CGAA 5ER4X 2BE6A 2M3WA 1DF0B 4I5JA 1S1EA 3RM1A 1KQMB 1UUSA 3EK4A 4AOMA 1TNQA 2M49B 2JOJA 2HF5A 4PCWA 5TNCA 1GQMA 3KO0A 4PHNA 3DVJA 3VGOA 2I7AA 1A29A 1R6PA 2JNXA 4WQ3A 3OHMB 5IBWA 2KBIA 1EXRA 3TUYC 1IJ5A 5DKNA 1W7IB 4PHJA 1K96A 2PRUA 3SIAA 4MN0A 3O78A 2GV5A 3BQ3A 4CLNA 1ALWA 2M29A 1JFKA 2LAPA 1B8LA 4MZLA 3TZ1A 4MZKA 2KFHA 3OB1B 1DJWA 1JF2A 1PULA 3C1VA 2E6WA 1CTRA 1MR8A 4GFTA 1KK8C 1WRLA 1LVCD 1QXPA 2K7BA 3OB2B 4P2YB 4Q04A 2Y5IA 2F8PA 1DJYA 2JULA 3BUOB 2JPTA 1MQ1A 2ZRTA 3DF0B 4CIDA 5CSIA 3LL8B 1S5GZ 1WRKA 1M45A 2WORA 4CFRA 5AEQA 2OS8B 4GGFC 2KFFA 2LHIA 4N1GA 2LP3A 2M0RA 2ZRSA 1XK4C 5K89A 1H4BA 3D10A 1EL4A 4WRIA 2E30A 1QVIY 2Y1NA 3CR5X 4DRWA 1QX7A 2JTZA 2KNEA 1D1OA 1FI5A 1J7PA 1LA3A 1AP4A 2IS9A 1N65A 1NSHA 2BBNA 1BG1A 5HKZA 1DGUA 3VRPA 1BF5A 2EC6C 5D7FA 4HSZA 5DKQA 1B8CA 4PE4A 1A2XA 3H4SE 2ZNEA 4PE0A 1UWOA 3TDIA 1ODBA 4BY5A 1WRZA 4I5KA 2JZIA 4A4CA 2L4IA 2PSRA 1TN4A 2CNPA 2KYFA 4PALA 2MJWB 1F70A 1TCOB 2K61A 2L4HA 4DUQA 1RROA 3I5HB 2JXLA 5ER5A 4CPVA 3BXKA 1XFYO 2OTGB 2H61C 2PASA 3MSEB 1F54A 1K9KA 1NCYA 1JUOA 1B8RA 3FWCA 1U5IA 2I94A 1UHKA 2FCDA 2ZN9A 2ZNDA 1BJFA 4HREE 1K9PA 2LVKA 4MRXA 2HETA 2OPOA 4GGNA 3QRXA 1CDLA 1U5IB 1NUBA 4NDCA 1IH0A 2RGIA 3OX5A 2WCEA 1WDCB 5FYXA 1QX2A 1K8UA 1PSBA 1ZFSA 5AFPA 4MSPA 1JBAA 1TNWA 2O5GA 4ICBA 1MWNA 1A4PA 1CM4A 3CWGA 1KSOA 1YVHA 5AXIA 1YX7A 1G4YR 2MHHA 3GOFA 1NYAA 1YUSA 1UHNA 2KI6D 4NDBA 3SIBA 1J7RA 3BYAA 3WHTB 3EKJA 1EG3A 3LLEA 3BUXB 1J1DA 4MZJA 3AAJA 3VRNA 4AQIA 4USLA 1CMFA 3WXAA 5CSNA 3BUWB 3PALA 1GGWA 1SK6D 1HQVA 2QPTA 1B9AA 1J55A 4PDZA 1FW4A 3TS5C 1SY9A 1NX1A 2PVBA 2ZKMX 3FWBA 4E68A 1K9UA 1ZUZA 1OSAA 2K8MB 4I5NB 2LM5A 2KI4C 3O6BA 1NPQA 2BECA 1CDPA 1Y1UA 1ALVA 1S6JA 1SW8A 1YVLA 2LMVA 2K7DA 5CSJA 2LV7A 4M2PA 1JFJA 1TIZA 3WNXB 1XA5A 4JPZB 4OV2A 1QV1A 1NIWA 4PHMA 3FIAA 3OX6A 2M1UA 1TCFA 5F6TA 2WNDA 2KOTA 2WOSA 1KQMC 4M2OA 4I5LB 4MBEA 4ORBB 1IKUA 2SASA 1F4QA 3O4YA 2I2RE 2MLEC 1KWOB 1DJIA 3M0WA 3A8RA 1BR1B 1RFJA 2KBMA 1YRUB 1FBVA 4PHKA 1CMGA 1J7OA 2DOQA 1XO5A 2JT8A 4NDDA 1AK8A 4GBAA 3DVKA 1UP5A 2K7CA 2LLTA 4QJ5B 2JRFA 1G33A 2M9GA 2WC8A 2Q91A 1S5GY 3HX4A 5I2LA 5I2OA 1CLBA 1BR4B 1E8AA 3I5IB 3TDZA 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSR A;  1C7V A;  2M8U A;  4MLW A;  5KTY A;  2MA2 A;  4P5O E;  1S6C A;  4MRY A;  2JQ6 A;  1SR6 B;  3GK1 A;  3PN7 B;  1DJG A;  2LAN A;  2OS8 C;  1PSR A;  1YRT B;  4GGF A;  4NQG A;  1N2D A;  1ZAC A;  3SG2 A;  2BCA A;  4ZCU A;  4R1E A;  1QV0 A;  5I8N A;  1GJY A;  4CFQ A;  2G9B A;  2R2I A;  1SCV A;  2KQY A;  1REC A;  2JU0 A;  2K0J A;  2WCF A;  1CNP A;  4DS7 A;  2CBL A;  2LLU A;  1DJX A;  1L2O B;  1IQ3 A;  2LCP A;  3PLF B;  2KI6 C;  2JTT A;  1FI6 A;  1CM1 A;  1NP8 A;  1K95 A;  2F2P A;  2JC2 A;  2KYC A;  1IQ5 A;  1QAS A;  1NX3 A;  1AVS A;  2H2K A;  5CPV A;  1PVA A;  3GK2 A;  1CFF A;  1UHH A;  1JWD A;  2L51 A;  2KGB C;  1V1F A;  2NCO A;  2NLN A;  2FOT A;  2LVJ A;  1IJ6 A;  4OR9 B;  1IWQ A;  1XFX O;  3CLN A;  1BU3 A;  3SG6 A;  3DD4 A;  4YBH B;  4TNC A;  2KQ6 A;  1DVI A;  1QAT A;  4GNK B;  1XFV O;  3RLZ A;  2BKH B;  4OCI A;  3I5H C;  4UPG A;  4WQ2 A;  2OTG C;  2FCE A;  3I5F B;  1OQP A;  1Q80 A;  4YGD B;  4AQJ A;  2L50 A;  4XJK A;  2Q4U A;  2NZ0 A;  3PAT A;  4YGC B;  1BOD A;  2QAC A;  2JNF A;  1CFD A;  3JVT B;  1WDC C;  3KEV A;  4JQ0 D;  1MXL C;  1J7Q A;  5KU1 A;  1OE9 B;  1QJT A;  2LVV A;  3CS1 A;  1M46 A;  1CKK A;  1SMG A;  2NCP A;  5DKR A;  1W7J B;  3HCM A;  1EH2 A;  1OZS A;  1MF8 B;  1AHR A;  1KFX L;  1KK7 Z;  1H8B A;  1SCM B;  4MVF A;  1DJH A;  3JTD B;  3PM8 A;  1MUX A;  4ZCV A;  1CDM A;  2KHN A;  1C7W A;  3NSL A;  1ZMZ A;  1XFW O;  1XVJ A;  1XYD A;  3SG3 A;  4MEW A;  3VRO A;  1RWY A;  5G08 A;  1KQV A;  2D8N A;  2LMT A;  2MLF C;  1S6I A;  1YR5 A;  2LNK A;  1IGV A;  2BL0 B;  1SL7 A;  4C0L A;  1L7Z A;  3KF9 A;  4A4B A;  2F3Y A;  2KAY A;  2L5X B;  2PMY A;  3WHU B;  4FTG A;  3CR4 X;  3I5G B;  1C07 A;  4PE1 A;  2L0P A;  3A4U B;  1N0Y A;  1Y1A A;  2KFG A;  1F55 A;  1CLL A;  2LUX A;  5CSF A;  1IRJ A;  1QIW A;  3VRR A;  3LCP C;  2JT3 A;  5D69 A;  5HLV A;  1JC2 A;  3BOW A;  1CB1 A;  1UUR A;  1B47 A;  1BMO A;  2NXQ A;  1FF1 A;  1X02 A;  2Y4Q A;  1DF0 A;  3ICB A;  5AAN A;  1G8I A;  1UHJ A;  1OMR A;  1B7T Z;  3AKB A;  3IQO A;  4YI8 A;  1QTX A;  1KWO C;  1PRW A;  5HYD A;  1LXF C;  3TUY B;  1A75 A;  1YUT A;  2WCB A;  1AJ4 A;  2LE9 B;  1SKT A;  2F2O A;  1KFX S;  1KSM A;  2CXJ A;  1A75 B;  4M2Q A;  1M63 B;  1CLM A;  1S3P A;  2JXC A;  2TN4 A;  3E3R A;  3EVU A;  1PK0 D;  2GGZ A;  1AJ5 A;  1DMO A;  1KFU L;  1CDN A;  4U8D A;  1DJZ A;  2EHB A;  2I18 A;  1QIV A;  1EJ3 A;  1DTL A;  5JOL A;  2KGR A;  1F71 A;  1TTX A;  1KK8 B;  2CTN A;  1TNX A;  2LUC A;  2AMI A;  3EKH A;  4ETO A;  1WLZ A;  1MXE A;  1NX0 A;  3I5I C;  3NSI A;  2BCX A;  1NX2 A;  4HRH A;  3IQQ A;  4PE7 A;  3EK8 A;  1V1G A;  1QLK A;  2HQW A;  5JJG A;  3DF0 A;  1K90 D;  3AAK A;  2M97 A;  1LIN A;  1SRA A;  1SR6 C;  2F3Z A;  1XK4 A;  4HRG A;  3PN7 C;  4OVN F;  2ISD A;  1OMV A;  2FJU B;  1SNL A;  1SYM A;  3KPX A;  1K93 D;  3DVM A;  4ORC B;  3KHE A;  1EG4 A;  1GGZ A;  4QJ4 B;  2G2B A;  3CZT X;  2KDH A;  4JWQ A;  1XFZ O;  3EVV A;  3ZNI A;  5I2Q A;  1RJV A;  1BLQ A;  2L2E A;  2P6B B;  1DT7 B;  2BBM A;  3EVR A;  4IL1 A;  1LKJ A;  1TOP A;  1YTZ C;  1L2O C;  3IF7 A;  1SPY A;  2JT0 A;  1PAL A;  2K2A A;  2AUC A;  4GPL B;  3GK4 X;  2VRG A;  2EC6 B;  3SG5 A;  1S36 A;  1TRF A;  2MRD A;  4GAO A;  5HKW A;  2LP2 A;  1SBJ A;  2M1K B;  2K7O A;  2MBX A;  1TNP A;  2LC5 A;  1QVI Z;  3PFV A;  1F4O A;  5GQQ C;  1BOC A;  4DIR A;  1M31 A;  2LVI A;  1KFU S;  1MHO A;  1IG5 A;  3NXA A;  1Y0V H;  2H61 A;  2M7N A;  2HPS A;  2GGM A;  5BPJ A;  1K94 A;  3ZWH A;  3VRQ A;  1ZOT B;  1UHI A;  2O60 A;  3K21 A;  1SL9 A;  4N5X A;  4F0Z B;  2CT9 A;  3FS7 A;  4QJ3 B;  3CTN A;  3AKA A;  3SJS A;  1WLM A;  2MAZ A;  2ZFD A;  5AER A;  3I5F C;  1B1G A;  4D1E A;  1J1E A;  2BE4 A;  4XJK B;  2KAX A;  4N1F A;  5HLO A;  2V53 A;  4XYN A;  2JWW A;  2BKI B;  1A03 A;  2F33 A;  1NCX A;  2Y1M A;  2M7L A;  1SL8 A;  1PVB A;  2AAO A;  1KK7 Y;  1QX5 B;  2SCP A;  1RK9 A;  3JVT C;  1KCY A;  3OP0 A;  1YX8 A;  1NWD A;  3NSK A;  1RTP 1;  1Y6W A;  3O2P A;  4ORA B;  2EGD A;  2HQ8 A;  2LMU A;  1LA0 A;  4YGA A;  1FPW A;  1WY9 A;  4OKH A;  1NCZ A;  1SCM C;  1QLS A;  1OOJ A;  3JTD C;  2LLS A;  4C0J A;  1CFP A;  3DVE A;  1B4C A;  5PAL A;  5HKY A;  3F45 A;  2K2F A;  1CFC A;  2ZN8 A;  1M39 A;  3D0Y A;  4YRU A;  2CCM A;  4YI9 A;  1HT9 A;  2COL B;  3SG7 A;  3BUM B;  5J3X A;  2KSP A;  1XFU O;  1BT6 A;  3BUN B;  1S26 D;  2BCB A;  2LHL A;  1F8H A;  2BL0 C;  3D0Y B;  4C0K A;  2KAV A;  4YGB B;  4L9M A;  1DGV A;  4BY4 A;  3CR2 A;  3TS5 B;  5B8I B;  3SG4 A;  1AUI B;  2B1U A;  1JSA A;  1OZO A;  1VRK A;  3I5G C;  3LK0 A;  3EK7 A;  3LK1 A;  2KI4 B;  2L98 A;  1Y1X A;  5KSZ A;  2PAL A;  1JF0 A;  1B7T Y;  3TDU A;  3BOW B;  1OMD A;  4GUK A;  4DCK A;  1K2H A;  1YUU A;  1YUR A;  1R2U A;  4FQO A;  2A4J A;  3NSO A;  4YGE B;  3CGA A;  5ER4 X;  2BE6 A;  2M3W A;  1DF0 B;  4I5J A;  1S1E A;  3RM1 A;  1KQM B;  1UUS A;  3EK4 A;  4AOM A;  1TNQ A;  2M49 B;  2JOJ A;  2HF5 A;  4PCW A;  5TNC A;  1GQM A;  3KO0 A;  4PHN A;  3DVJ A;  3VGO A;  2I7A A;  1A29 A;  1R6P A;  2JNX A;  4WQ3 A;  3OHM B;  5IBW A;  2KBI A;  1EXR A;  3TUY C;  1IJ5 A;  5DKN A;  1W7I B;  4PHJ A;  1K96 A;  2PRU A;  3SIA A;  4MN0 A;  3O78 A;  2GV5 A;  3BQ3 A;  4CLN A;  1ALW A;  2M29 A;  1JFK A;  2LAP A;  1B8L A;  4MZL A;  3TZ1 A;  4MZK A;  2KFH A;  3OB1 B;  1DJW A;  1JF2 A;  1PUL A;  3C1V A;  2E6W A;  1CTR A;  1MR8 A;  4GFT A;  1KK8 C;  1WRL A;  1LVC D;  1QXP A;  2K7B A;  3OB2 B;  4P2Y B;  4Q04 A;  2Y5I A;  2F8P A;  1DJY A;  2JUL A;  3BUO B;  2JPT A;  1MQ1 A;  2ZRT A;  3DF0 B;  4CID A;  5CSI A;  3LL8 B;  1S5G Z;  1WRK A;  1M45 A;  2WOR A;  4CFR A;  5AEQ A;  2OS8 B;  4GGF C;  2KFF A;  2LHI A;  4N1G A;  2LP3 A;  2M0R A;  2ZRS A;  1XK4 C;  5K89 A;  1H4B A;  3D10 A;  1EL4 A;  4WRI A;  2E30 A;  1QVI Y;  2Y1N A;  3CR5 X;  4DRW A;  1QX7 A;  2JTZ A;  2KNE A;  1D1O A;  1FI5 A;  1J7P A;  1LA3 A;  1AP4 A;  2IS9 A;  1N65 A;  1NSH A;  2BBN A;  1BG1 A;  5HKZ A;  1DGU A;  3VRP A;  1BF5 A;  2EC6 C;  5D7F A;  4HSZ A;  5DKQ A;  1B8C A;  4PE4 A;  1A2X A;  3H4S E;  2ZNE A;  4PE0 A;  1UWO A;  3TDI A;  1ODB A;  4BY5 A;  1WRZ A;  4I5K A;  2JZI A;  4A4C A;  2L4I A;  2PSR A;  1TN4 A;  2CNP A;  2KYF A;  4PAL A;  2MJW B;  1F70 A;  1TCO B;  2K61 A;  2L4H A;  4DUQ A;  1RRO A;  3I5H B;  2JXL A;  5ER5 A;  4CPV A;  3BXK A;  1XFY O;  2OTG B;  2H61 C;  2PAS A;  3MSE B;  1F54 A;  1K9K A;  1NCY A;  1JUO A;  1B8R A;  3FWC A;  1U5I A;  2I94 A;  1UHK A;  2FCD A;  2ZN9 A;  2ZND A;  1BJF A;  4HRE E;  1K9P A;  2LVK A;  4MRX A;  2HET A;  2OPO A;  4GGN A;  3QRX A;  1CDL A;  1U5I B;  1NUB A;  4NDC A;  1IH0 A;  2RGI A;  3OX5 A;  2WCE A;  1WDC B;  5FYX A;  1QX2 A;  1K8U A;  1PSB A;  1ZFS A;  5AFP A;  4MSP A;  1JBA A;  1TNW A;  2O5G A;  4ICB A;  1MWN A;  1A4P A;  1CM4 A;  3CWG A;  1KSO A;  1YVH A;  5AXI A;  1YX7 A;  1G4Y R;  2MHH A;  3GOF A;  1NYA A;  1YUS A;  1UHN A;  2KI6 D;  4NDB A;  3SIB A;  1J7R A;  3BYA A;  3WHT B;  3EKJ A;  1EG3 A;  3LLE A;  3BUX B;  1J1D A;  4MZJ A;  3AAJ A;  3VRN A;  4AQI A;  4USL A;  1CMF A;  3WXA A;  5CSN A;  3BUW B;  3PAL A;  1GGW A;  1SK6 D;  1HQV A;  2QPT A;  1B9A A;  1J55 A;  4PDZ A;  1FW4 A;  3TS5 C;  1SY9 A;  1NX1 A;  2PVB A;  2ZKM X;  3FWB A;  4E68 A;  1K9U A;  1ZUZ A;  1OSA A;  2K8M B;  4I5N B;  2LM5 A;  2KI4 C;  3O6B A;  1NPQ A;  2BEC A;  1CDP A;  1Y1U A;  1ALV A;  1S6J A;  1SW8 A;  1YVL A;  2LMV A;  2K7D A;  5CSJ A;  2LV7 A;  4M2P A;  1JFJ A;  1TIZ A;  3WNX B;  1XA5 A;  4JPZ B;  4OV2 A;  1QV1 A;  1NIW A;  4PHM A;  3FIA A;  3OX6 A;  2M1U A;  1TCF A;  5F6T A;  2WND A;  2KOT A;  2WOS A;  1KQM C;  4M2O A;  4I5L B;  4MBE A;  4ORB B;  1IKU A;  2SAS A;  1F4Q A;  3O4Y A;  2I2R E;  2MLE C;  1KWO B;  1DJI A;  3M0W A;  3A8R A;  1BR1 B;  1RFJ A;  2KBM A;  1YRU B;  1FBV A;  4PHK A;  1CMG A;  1J7O A;  2DOQ A;  1XO5 A;  2JT8 A;  4NDD A;  1AK8 A;  4GBA A;  3DVK A;  1UP5 A;  2K7C A;  2LLT A;  4QJ5 B;  2JRF A;  1G33 A;  2M9G A;  2WC8 A;  2Q91 A;  1S5G Y;  3HX4 A;  5I2L A;  5I2O A;  1CLB A;  1BR4 B;  1E8A A;  3I5I B;  3TDZ A;  1QS7 A; 
#chains in the Genus database with same CATH topology
 3PSR A;  1C7V A;  3FE6 A;  2M8U A;  4MLW A;  5KTY A;  2MA2 A;  4P5O E;  1S6C A;  4MRY A;  2JQ6 A;  1SR6 B;  3GK1 A;  3B87 A;  3PN7 B;  1DJG A;  3QME A;  2LAN A;  2OS8 C;  1PSR A;  1YRT B;  2L2C A;  3L47 A;  1N2D A;  4GGF A;  4NQG A;  1TWO A;  1ZAC A;  3SG2 A;  2BCA A;  2QDI A;  4ZCU A;  4R1E A;  1QV0 A;  1QWV A;  5I8N A;  1GJY A;  4CFQ A;  2G9B A;  2R2I A;  1SCV A;  2KQY A;  1REC A;  2JU0 A;  2K0J A;  2WCF A;  1CNP A;  4DS7 A;  2CBL A;  2LLU A;  1DJX A;  1L2O B;  2ERB A;  1IQ3 A;  2LCP A;  3PLF B;  2KI6 C;  2JTT A;  1FI6 A;  1CM1 A;  1NP8 A;  1K95 A;  2F2P A;  2JC2 A;  2KYC A;  1IQ5 A;  1QAS A;  1NX3 A;  1AVS A;  2H2K A;  5CPV A;  1PVA A;  3GK2 A;  1CFF A;  1UHH A;  1JWD A;  2L51 A;  2KGB C;  1V1F A;  5EL2 A;  2NCO A;  2NLN A;  2FOT A;  2LVJ A;  3N7H A;  1IJ6 A;  4OR9 B;  1IWQ A;  1XFX O;  3CLN A;  1BU3 A;  3SG6 A;  3DD4 A;  4YBH B;  4TNC A;  2KQ6 A;  1DVI A;  1QAT A;  4GNK B;  3S0D A;  1XFV O;  3RLZ A;  2BKH B;  4OCI A;  3I5H C;  3BJH A;  4UPG A;  4WQ2 A;  2OTG C;  2FCE A;  3I5F B;  1OQP A;  1Q80 A;  4YGD B;  4AQJ A;  2L50 A;  4XJK A;  3DXL A;  2Q4U A;  2BNX A;  2NZ0 A;  3PAT A;  3PM2 A;  4YGC B;  1BOD A;  2QAC A;  2JNF A;  1CFD A;  3JVT B;  1WDC C;  3KEV A;  4JQ0 D;  1MXL C;  1J7Q A;  5KU1 A;  1OE9 B;  1QJT A;  2LVV A;  3CS1 A;  1M46 A;  1CKK A;  1SMG A;  2NCP A;  5DKR A;  1W7J B;  3HCM A;  3SS3 A;  1EH2 A;  1OZS A;  3D75 A;  1MF8 B;  1AHR A;  1KFX L;  3L4L A;  1KK7 Z;  1H8B A;  1SCM B;  4MVF A;  1DJH A;  3JTD B;  3PM8 A;  5DIC A;  1MUX A;  3FE8 A;  4ZCV A;  1CDM A;  2KHN A;  1C7W A;  1Z2C B;  3NSL A;  1ZMZ A;  1XFW O;  1XVJ A;  1XYD A;  3SG3 A;  4MEW A;  3VRO A;  1RWY A;  5G08 A;  1KQV A;  2D8N A;  2LMT A;  2MLF C;  1S6I A;  1YR5 A;  2LNK A;  1IGV A;  2BL0 B;  1SL7 A;  4C0L A;  1L7Z A;  3D74 A;  3KF9 A;  4A4B A;  2F3Y A;  2KAY A;  2KLE A;  3BFB A;  2L5X B;  2PMY A;  3WHU B;  4FTG A;  3CR4 X;  3I5G B;  1C07 A;  2WCK A;  2L0P A;  4PE1 A;  3A4U B;  1N0Y A;  1Y1A A;  5HL1 A;  2H8V A;  2KFG A;  1F55 A;  1CLL A;  2LUX A;  3DZT A;  5CSF A;  1IRJ A;  1QIW A;  3VRR A;  3LCP C;  2JT3 A;  5D69 A;  5HLV A;  1JC2 A;  3BOW A;  1CB1 A;  1UUR A;  3SS4 A;  3VB1 A;  1B47 A;  1BMO A;  3S0E A;  2NXQ A;  1LS8 A;  1FF1 A;  1X02 A;  2Y4Q A;  1DF0 A;  3ICB A;  5AAN A;  1G8I A;  1UHJ A;  1OMR A;  1B7T Z;  3AKB A;  3IQO A;  4YI8 A;  1QTX A;  1KWO C;  1PRW A;  5HYD A;  1LXF C;  3TUY B;  1A75 A;  1YUT A;  2WCB A;  1AJ4 A;  2LE9 B;  1SKT A;  2F2O A;  1KFX S;  1KSM A;  2CXJ A;  1A75 B;  4M2Q A;  1M63 B;  1CLM A;  1S3P A;  2JXC A;  2TN4 A;  1TUZ A;  2P70 A;  3B6X A;  3D73 A;  2QEH A;  1PK0 D;  2GGZ A;  1AJ5 A;  3E3R A;  3EVU A;  1KFU L;  5FI6 A;  1CDN A;  1DMO A;  4U8D A;  1DJZ A;  2EHB A;  2I18 A;  1QIV A;  1EJ3 A;  1DTL A;  2WC5 A;  5JOL A;  2KGR A;  1F71 A;  1TTX A;  1KK8 B;  2CTN A;  1TNX A;  2LUC A;  2AMI A;  3EKH A;  4ETO A;  1WLZ A;  1MXE A;  1NX0 A;  3I5I C;  3NSI A;  2BCX A;  1NX2 A;  2QEV A;  4HRH A;  3IQQ A;  4PE7 A;  3EK8 A;  3NGV A;  1V1G A;  1QLK A;  2HQW A;  3OGN A;  5JJG A;  3DF0 A;  1K90 D;  3AAK A;  2M97 A;  2PYQ A;  3UO9 A;  1LIN A;  1SRA A;  1SR6 C;  2F3Z A;  1XK4 A;  4HRG A;  4F7F A;  3PN7 C;  4OVN F;  2ISD A;  1OMV A;  2FJU B;  1SNL A;  1SYM A;  3KPX A;  1K93 D;  3DVM A;  4FQT A;  4ORC B;  3KHE A;  1EG4 A;  1GGZ A;  4QJ4 B;  2G2B A;  3CZT X;  2KDH A;  4JWQ A;  2QEB A;  2BAP A;  1XFZ O;  3EVV A;  1T14 A;  3NHT A;  3Q8I A;  3ZNI A;  5I2Q A;  1RJV A;  1BLQ A;  2L2E A;  2P6B B;  1DT7 B;  2BBM A;  1ORG A;  3EVR A;  4JD9 A;  4IL1 A;  1LKJ A;  1TOP A;  1YTZ C;  1L2O C;  3IF7 A;  1SPY A;  2JT0 A;  1PAL A;  2K2A A;  2AUC A;  4GPL B;  3GK4 X;  2VRG A;  2EC6 B;  3SG5 A;  2WCL A;  1S36 A;  1TRF A;  2MRD A;  4GAO A;  5HKW A;  2LP2 A;  1SBJ A;  2M1K B;  2K7O A;  2WCH A;  2MBX A;  1TNP A;  2LC5 A;  1QVI Z;  1SSE B;  2FJY A;  3PFV A;  1F4O A;  5GQQ C;  1BOC A;  4DIR A;  1M31 A;  2LVI A;  3CAB A;  1KFU S;  1MHO A;  1IG5 A;  3NXA A;  1Y0V H;  2H61 A;  2M7N A;  3V2L A;  2HPS A;  5D3O A;  2GGM A;  5BPJ A;  1K94 A;  3ZWH A;  3VRQ A;  1ZOT B;  1UHI A;  3IVT A;  2O60 A;  3K21 A;  1SL9 A;  4N5X A;  4F0Z B;  2CT9 A;  3B86 A;  3FS7 A;  3CTN A;  4QJ3 B;  3AKA A;  3DY9 A;  1WLM A;  2MAZ A;  2ZFD A;  3SJS A;  5AER A;  3I5F C;  1B1G A;  4D1E A;  1J1E A;  2BE4 A;  2L5Y A;  4XJK B;  3S0A A;  2K60 A;  2KAX A;  4N1F A;  5HLO A;  2V53 A;  4XYN A;  2JWW A;  2BKI B;  1A03 A;  2F33 A;  1NCX A;  2Y1M A;  2M7L A;  1SL8 A;  1PVB A;  2AAO A;  1KK7 Y;  1QX5 B;  2SCP A;  1RK9 A;  3JVT C;  1KCY A;  3CZ2 A;  3OP0 A;  3PJI A;  1YX8 A;  1NWD A;  3NSK A;  1RTP 1;  1Y6W A;  1OOI X;  3O2P A;  4ORA B;  2EGD A;  2HQ8 A;  2LMU A;  1LA0 A;  4YGA A;  1FPW A;  2P71 A;  1WY9 A;  4OKH A;  1NCZ A;  1SCM C;  1QLS A;  1OOJ A;  3JTD C;  2LLS A;  4C0J A;  1CFP A;  3DVE A;  1B4C A;  5PAL A;  5HKY A;  3F45 A;  2K2F A;  1CFC A;  2ZN8 A;  1M39 A;  3D0Y A;  4YRU A;  2CCM A;  4YI9 A;  1HT9 A;  2COL B;  3SG7 A;  3BUM B;  5J3X A;  3CYZ A;  2KSP A;  1XFU O;  5I94 A;  1BT6 A;  3BUN B;  1S26 D;  2BCB A;  2LHL A;  1F8H A;  2BL0 C;  3D0Y B;  4C0K A;  2KAV A;  4YGB B;  4L9M A;  3D77 A;  1DGV A;  4BY4 A;  2GTE A;  3CR2 A;  3TS5 B;  5B8I B;  3SG4 A;  1AUI B;  2B1U A;  1JSA A;  1OZO A;  1VRK A;  3I5G C;  3LK0 A;  3EK7 A;  3LK1 A;  2KI4 B;  2L98 A;  1OOH A;  1Y1X A;  5KSZ A;  4IJ7 A;  2PAL A;  1JF0 A;  3R1O A;  1B7T Y;  3TDU A;  3BOW B;  1OMD A;  4GUK A;  4DCK A;  3CZ0 A;  1K2H A;  1OW4 A;  2QEO A;  1YUU A;  1YUR A;  1R2U A;  4FQO A;  2A4J A;  3NSO A;  4OZD A;  4YGE B;  3CGA A;  5ER4 X;  2BE6 A;  2M3W A;  1DF0 B;  4I5J A;  3S0F A;  1S1E A;  3RM1 A;  1KQM B;  1UUS A;  3EK4 A;  4AOM A;  1TNQ A;  2M49 B;  2JOJ A;  2HF5 A;  4PCW A;  5TNC A;  1GQM A;  3KO0 A;  4PHN A;  3DVJ A;  3VGO A;  2I7A A;  1A29 A;  1R6P A;  2JNX A;  4WQ3 A;  3OHM B;  5IBW A;  2KBI A;  1EXR A;  3OBV A;  3TUY C;  1IJ5 A;  5DKN A;  1W7I B;  4PHJ A;  1K96 A;  2PRU A;  1P28 A;  3SIA A;  4MN0 A;  3O78 A;  2GV5 A;  2KLD A;  3BQ3 A;  3S0B A;  1ALW A;  4CLN A;  2M29 A;  1C3Z A;  1JFK A;  2LAP A;  1B8L A;  3DYE A;  4MZL A;  3TZ1 A;  4MZK A;  2KFH A;  3OB1 B;  1DJW A;  1JF2 A;  3CZ1 A;  1PUL A;  3C1V A;  2E6W A;  1CTR A;  1MR8 A;  4GFT A;  1KK8 C;  1WRL A;  1LVC D;  1QXP A;  2K7B A;  3OB2 B;  4P2Y B;  4Q04 A;  2Y5I A;  2F8P A;  1DJY A;  2JUL A;  3BUO B;  2JPT A;  1MQ1 A;  2ZRT A;  3DF0 B;  4CID A;  5CSI A;  3SS5 A;  3LL8 B;  1S5G Z;  1WRK A;  1M45 A;  2WOR A;  4CFR A;  5AEQ A;  2OS8 B;  4GGF C;  2KFF A;  2LHI A;  4N1G A;  2LP3 A;  2M0R A;  2ZRS A;  1XK4 C;  5K89 A;  1H4B A;  2KPH A;  3D10 A;  1EL4 A;  4WRI A;  2E30 A;  3K1E A;  1QVI Y;  2Y1N A;  3CR5 X;  4INW A;  4PT1 A;  1QX7 A;  2JTZ A;  2KNE A;  4DRW A;  1D1O A;  3RZS A;  1FI5 A;  3FE9 A;  1J7P A;  1LA3 A;  3D78 A;  1AP4 A;  2IS9 A;  1N65 A;  1NSH A;  2BBN A;  1BG1 A;  5HKZ A;  1DGU A;  3VRP A;  1BF5 A;  2EC6 C;  5D7F A;  4HSZ A;  5DKQ A;  1B8C A;  4PE4 A;  1A2X A;  3R1P A;  2WCM A;  3H4S E;  3NHI A;  2ZNE A;  4PE0 A;  1UWO A;  3TDI A;  1ODB A;  4BY5 A;  1WRZ A;  4I5K A;  2JZI A;  4A4C A;  3BFA A;  2L4I A;  2PSR A;  1TN4 A;  2CNP A;  2KYF A;  4PAL A;  2MJW B;  5FI2 A;  1F70 A;  1TCO B;  2K61 A;  2L4H A;  4INX A;  1RRO A;  4DUQ A;  3I5H B;  2JXL A;  2WC6 A;  5ER5 A;  4CPV A;  3BXK A;  1XFY O;  2OTG B;  2H61 C;  2PAS A;  3MSE B;  1F54 A;  1K9K A;  3O4X A;  1NCY A;  1JUO A;  1B8R A;  3FWC A;  1U5I A;  2I94 A;  1UHK A;  2FCD A;  2ZN9 A;  2ZND A;  1BJF A;  4HRE E;  1K9P A;  2LVK A;  4MRX A;  2HET A;  2OPO A;  4GGN A;  3QRX A;  1CDL A;  1U5I B;  1NUB A;  4NDC A;  1IH0 A;  2RGI A;  3EG5 B;  3OX5 A;  2WCE A;  1WDC B;  5FYX A;  1QX2 A;  1DEK A;  3L4A A;  1K8U A;  1PSB A;  1GM0 A;  1ZFS A;  5AFP A;  2YGU A;  4MSP A;  1JBA A;  1TNW A;  2O5G A;  4ICB A;  1MWN A;  1IIO A;  1A4P A;  1CM4 A;  3CWG A;  1KSO A;  1YVH A;  5AXI A;  1YX7 A;  1G4Y R;  2MHH A;  1TUJ A;  3GOF A;  1NYA A;  1YUS A;  1UHN A;  2KI6 D;  4NDB A;  3SIB A;  1J7R A;  3BYA A;  3WHT B;  3EKJ A;  3R72 A;  1EG3 A;  3LLE A;  3BUX B;  1J1D A;  4MZJ A;  3AAJ A;  3VRN A;  4AQI A;  4USL A;  1CMF A;  1DQE A;  3WXA A;  3R1V A;  5CSN A;  3BUW B;  3PAL A;  1GGW A;  1SK6 D;  1DC1 A;  1HQV A;  2QPT A;  1B9A A;  1J55 A;  2PQL A;  4PDZ A;  1FW4 A;  3TS5 C;  1SY9 A;  3D76 A;  1NX1 A;  2PVB A;  2ZKM X;  3B7A A;  3FWB A;  4E68 A;  1K9U A;  1ZUZ A;  3BFH A;  1OSA A;  2K8M B;  4I5N B;  2LM5 A;  2KI4 C;  3O6B A;  1NPQ A;  2BEC A;  1CDP A;  1Y1U A;  1ALV A;  1S6J A;  1SW8 A;  1YVL A;  2LMV A;  2K7D A;  5CSJ A;  2LV7 A;  4M2P A;  1JFJ A;  1TIZ A;  3WNX B;  1XA5 A;  4JPZ B;  1XFR A;  4OV2 A;  1QV1 A;  1NIW A;  4PHM A;  3FIA A;  3OX6 A;  1OOF A;  2M1U A;  1TCF A;  5F6T A;  2WND A;  2KOT A;  2WOS A;  1KQM C;  1OOG A;  4I5L B;  4M2O A;  4MBE A;  4ORB B;  1IKU A;  2SAS A;  1F4Q A;  3O4Y A;  2I2R E;  2MLE C;  4KYN A;  1KWO B;  4JKT A;  1DJI A;  3M0W A;  3A8R A;  1BR1 B;  1W9Z A;  3CDN A;  1DEL A;  1RFJ A;  2KBM A;  1YRU B;  1FBV A;  3S0G A;  4PHK A;  1CMG A;  1J7O A;  1Z4H A;  1XO5 A;  2DOQ A;  5FI7 A;  3UNW A;  2JPO A;  2JT8 A;  4NDD A;  1AK8 A;  4GBA A;  3DVK A;  1UP5 A;  2WCJ A;  2K7C A;  2LLT A;  3B88 A;  4QJ5 B;  2JRF A;  1G33 A;  2M9G A;  2WC8 A;  2Q91 A;  1C3Y A;  1S5G Y;  3HX4 A;  5I2L A;  5I2O A;  1CLB A;  1BR4 B;  1E8A A;  3I5I B;  3TDZ A;  1QS7 A; 
#chains in the Genus database with same CATH homology
 3PSR A;  1C7V A;  2M8U A;  4MLW A;  5KTY A;  2MA2 A;  4P5O E;  1S6C A;  4MRY A;  2JQ6 A;  1SR6 B;  3GK1 A;  3PN7 B;  1DJG A;  2LAN A;  2OS8 C;  1PSR A;  1YRT B;  4GGF A;  4NQG A;  1N2D A;  1ZAC A;  3SG2 A;  2BCA A;  4ZCU A;  4R1E A;  1QV0 A;  5I8N A;  1GJY A;  4CFQ A;  2G9B A;  2R2I A;  1SCV A;  2KQY A;  1REC A;  2JU0 A;  2K0J A;  2WCF A;  1CNP A;  4DS7 A;  2CBL A;  2LLU A;  1DJX A;  1L2O B;  1IQ3 A;  2LCP A;  3PLF B;  2KI6 C;  2JTT A;  1FI6 A;  1CM1 A;  1NP8 A;  1K95 A;  2F2P A;  2JC2 A;  2KYC A;  1IQ5 A;  1QAS A;  1NX3 A;  1AVS A;  2H2K A;  5CPV A;  1PVA A;  3GK2 A;  1CFF A;  1UHH A;  1JWD A;  2L51 A;  2KGB C;  1V1F A;  2NCO A;  2NLN A;  2FOT A;  2LVJ A;  1IJ6 A;  4OR9 B;  1IWQ A;  1XFX O;  3CLN A;  1BU3 A;  3SG6 A;  3DD4 A;  4YBH B;  4TNC A;  2KQ6 A;  1DVI A;  1QAT A;  4GNK B;  1XFV O;  3RLZ A;  2BKH B;  4OCI A;  3I5H C;  4UPG A;  4WQ2 A;  2OTG C;  2FCE A;  3I5F B;  1OQP A;  1Q80 A;  4YGD B;  4AQJ A;  2L50 A;  4XJK A;  2Q4U A;  2NZ0 A;  3PAT A;  4YGC B;  1BOD A;  2QAC A;  2JNF A;  1CFD A;  3JVT B;  1WDC C;  3KEV A;  4JQ0 D;  1MXL C;  1J7Q A;  5KU1 A;  1OE9 B;  1QJT A;  2LVV A;  3CS1 A;  1M46 A;  1CKK A;  1SMG A;  2NCP A;  5DKR A;  1W7J B;  3HCM A;  1EH2 A;  1OZS A;  1MF8 B;  1AHR A;  1KFX L;  1KK7 Z;  1H8B A;  1SCM B;  4MVF A;  1DJH A;  3JTD B;  3PM8 A;  1MUX A;  4ZCV A;  1CDM A;  2KHN A;  1C7W A;  3NSL A;  1ZMZ A;  1XFW O;  1XVJ A;  1XYD A;  3SG3 A;  4MEW A;  3VRO A;  1RWY A;  5G08 A;  1KQV A;  2D8N A;  2LMT A;  2MLF C;  1S6I A;  1YR5 A;  2LNK A;  1IGV A;  2BL0 B;  1SL7 A;  4C0L A;  1L7Z A;  3KF9 A;  4A4B A;  2F3Y A;  2KAY A;  2L5X B;  2PMY A;  3WHU B;  4FTG A;  3CR4 X;  3I5G B;  1C07 A;  4PE1 A;  2L0P A;  3A4U B;  1N0Y A;  1Y1A A;  2KFG A;  1F55 A;  1CLL A;  2LUX A;  5CSF A;  1IRJ A;  1QIW A;  3VRR A;  3LCP C;  2JT3 A;  5D69 A;  5HLV A;  1JC2 A;  3BOW A;  1CB1 A;  1UUR A;  1B47 A;  1BMO A;  2NXQ A;  1FF1 A;  1X02 A;  2Y4Q A;  1DF0 A;  3ICB A;  5AAN A;  1G8I A;  1UHJ A;  1OMR A;  1B7T Z;  3AKB A;  3IQO A;  4YI8 A;  1QTX A;  1KWO C;  1PRW A;  5HYD A;  1LXF C;  3TUY B;  1A75 A;  1YUT A;  2WCB A;  1AJ4 A;  2LE9 B;  1SKT A;  2F2O A;  1KFX S;  1KSM A;  2CXJ A;  1A75 B;  4M2Q A;  1M63 B;  1CLM A;  1S3P A;  2JXC A;  2TN4 A;  3E3R A;  3EVU A;  1PK0 D;  2GGZ A;  1AJ5 A;  1DMO A;  1KFU L;  1CDN A;  4U8D A;  1DJZ A;  2EHB A;  2I18 A;  1QIV A;  1EJ3 A;  1DTL A;  5JOL A;  2KGR A;  1F71 A;  1TTX A;  1KK8 B;  2CTN A;  1TNX A;  2LUC A;  2AMI A;  3EKH A;  4ETO A;  1WLZ A;  1MXE A;  1NX0 A;  3I5I C;  3NSI A;  2BCX A;  1NX2 A;  4HRH A;  3IQQ A;  4PE7 A;  3EK8 A;  1V1G A;  1QLK A;  2HQW A;  5JJG A;  3DF0 A;  1K90 D;  3AAK A;  2M97 A;  1LIN A;  1SRA A;  1SR6 C;  2F3Z A;  1XK4 A;  4HRG A;  3PN7 C;  4OVN F;  2ISD A;  1OMV A;  2FJU B;  1SNL A;  1SYM A;  3KPX A;  1K93 D;  3DVM A;  4ORC B;  3KHE A;  1EG4 A;  1GGZ A;  4QJ4 B;  2G2B A;  3CZT X;  2KDH A;  4JWQ A;  1XFZ O;  3EVV A;  3ZNI A;  5I2Q A;  1RJV A;  1BLQ A;  2L2E A;  2P6B B;  1DT7 B;  2BBM A;  3EVR A;  4IL1 A;  1LKJ A;  1TOP A;  1YTZ C;  1L2O C;  3IF7 A;  1SPY A;  2JT0 A;  1PAL A;  2K2A A;  2AUC A;  4GPL B;  3GK4 X;  2VRG A;  2EC6 B;  3SG5 A;  1S36 A;  1TRF A;  2MRD A;  4GAO A;  5HKW A;  2LP2 A;  1SBJ A;  2M1K B;  2K7O A;  2MBX A;  1TNP A;  2LC5 A;  1QVI Z;  3PFV A;  1F4O A;  5GQQ C;  1BOC A;  4DIR A;  1M31 A;  2LVI A;  1KFU S;  1MHO A;  1IG5 A;  3NXA A;  1Y0V H;  2H61 A;  2M7N A;  2HPS A;  2GGM A;  5BPJ A;  1K94 A;  3ZWH A;  3VRQ A;  1ZOT B;  1UHI A;  2O60 A;  3K21 A;  1SL9 A;  4N5X A;  4F0Z B;  2CT9 A;  3FS7 A;  4QJ3 B;  3CTN A;  3AKA A;  3SJS A;  1WLM A;  2MAZ A;  2ZFD A;  5AER A;  3I5F C;  1B1G A;  4D1E A;  1J1E A;  2BE4 A;  4XJK B;  2KAX A;  4N1F A;  5HLO A;  2V53 A;  4XYN A;  2JWW A;  2BKI B;  1A03 A;  2F33 A;  1NCX A;  2Y1M A;  2M7L A;  1SL8 A;  1PVB A;  2AAO A;  1KK7 Y;  1QX5 B;  2SCP A;  1RK9 A;  3JVT C;  1KCY A;  3OP0 A;  1YX8 A;  1NWD A;  3NSK A;  1RTP 1;  1Y6W A;  3O2P A;  4ORA B;  2EGD A;  2HQ8 A;  2LMU A;  1LA0 A;  4YGA A;  1FPW A;  1WY9 A;  4OKH A;  1NCZ A;  1SCM C;  1QLS A;  1OOJ A;  3JTD C;  2LLS A;  4C0J A;  1CFP A;  3DVE A;  1B4C A;  5PAL A;  5HKY A;  3F45 A;  2K2F A;  1CFC A;  2ZN8 A;  1M39 A;  3D0Y A;  4YRU A;  2CCM A;  4YI9 A;  1HT9 A;  2COL B;  3SG7 A;  3BUM B;  5J3X A;  2KSP A;  1XFU O;  1BT6 A;  3BUN B;  1S26 D;  2BCB A;  2LHL A;  1F8H A;  2BL0 C;  3D0Y B;  4C0K A;  2KAV A;  4YGB B;  4L9M A;  1DGV A;  4BY4 A;  3CR2 A;  3TS5 B;  5B8I B;  3SG4 A;  1AUI B;  2B1U A;  1JSA A;  1OZO A;  1VRK A;  3I5G C;  3LK0 A;  3EK7 A;  3LK1 A;  2KI4 B;  2L98 A;  1Y1X A;  5KSZ A;  2PAL A;  1JF0 A;  1B7T Y;  3TDU A;  3BOW B;  1OMD A;  4GUK A;  4DCK A;  1K2H A;  1YUU A;  1YUR A;  1R2U A;  4FQO A;  2A4J A;  3NSO A;  4YGE B;  3CGA A;  5ER4 X;  2BE6 A;  2M3W A;  1DF0 B;  4I5J A;  1S1E A;  3RM1 A;  1KQM B;  1UUS A;  3EK4 A;  4AOM A;  1TNQ A;  2M49 B;  2JOJ A;  2HF5 A;  4PCW A;  5TNC A;  1GQM A;  3KO0 A;  4PHN A;  3DVJ A;  3VGO A;  2I7A A;  1A29 A;  1R6P A;  2JNX A;  4WQ3 A;  3OHM B;  5IBW A;  2KBI A;  1EXR A;  3TUY C;  1IJ5 A;  5DKN A;  1W7I B;  4PHJ A;  1K96 A;  2PRU A;  3SIA A;  4MN0 A;  3O78 A;  2GV5 A;  3BQ3 A;  4CLN A;  1ALW A;  2M29 A;  1JFK A;  2LAP A;  1B8L A;  4MZL A;  3TZ1 A;  4MZK A;  2KFH A;  3OB1 B;  1DJW A;  1JF2 A;  1PUL A;  3C1V A;  2E6W A;  1CTR A;  1MR8 A;  4GFT A;  1KK8 C;  1WRL A;  1LVC D;  1QXP A;  2K7B A;  3OB2 B;  4P2Y B;  4Q04 A;  2Y5I A;  2F8P A;  1DJY A;  2JUL A;  3BUO B;  2JPT A;  1MQ1 A;  2ZRT A;  3DF0 B;  4CID A;  5CSI A;  3LL8 B;  1S5G Z;  1WRK A;  1M45 A;  2WOR A;  4CFR A;  5AEQ A;  2OS8 B;  4GGF C;  2KFF A;  2LHI A;  4N1G A;  2LP3 A;  2M0R A;  2ZRS A;  1XK4 C;  5K89 A;  1H4B A;  3D10 A;  1EL4 A;  4WRI A;  2E30 A;  1QVI Y;  2Y1N A;  3CR5 X;  4DRW A;  1QX7 A;  2JTZ A;  2KNE A;  1D1O A;  1FI5 A;  1J7P A;  1LA3 A;  1AP4 A;  2IS9 A;  1N65 A;  1NSH A;  2BBN A;  1BG1 A;  5HKZ A;  1DGU A;  3VRP A;  1BF5 A;  2EC6 C;  5D7F A;  4HSZ A;  5DKQ A;  1B8C A;  4PE4 A;  1A2X A;  3H4S E;  2ZNE A;  4PE0 A;  1UWO A;  3TDI A;  1ODB A;  4BY5 A;  1WRZ A;  4I5K A;  2JZI A;  4A4C A;  2L4I A;  2PSR A;  1TN4 A;  2CNP A;  2KYF A;  4PAL A;  2MJW B;  1F70 A;  1TCO B;  2K61 A;  2L4H A;  4DUQ A;  1RRO A;  3I5H B;  2JXL A;  5ER5 A;  4CPV A;  3BXK A;  1XFY O;  2OTG B;  2H61 C;  2PAS A;  3MSE B;  1F54 A;  1K9K A;  1NCY A;  1JUO A;  1B8R A;  3FWC A;  1U5I A;  2I94 A;  1UHK A;  2FCD A;  2ZN9 A;  2ZND A;  1BJF A;  4HRE E;  1K9P A;  2LVK A;  4MRX A;  2HET A;  2OPO A;  4GGN A;  3QRX A;  1CDL A;  1U5I B;  1NUB A;  4NDC A;  1IH0 A;  2RGI A;  3OX5 A;  2WCE A;  1WDC B;  5FYX A;  1QX2 A;  1K8U A;  1PSB A;  1ZFS A;  5AFP A;  4MSP A;  1JBA A;  1TNW A;  2O5G A;  4ICB A;  1MWN A;  1A4P A;  1CM4 A;  3CWG A;  1KSO A;  1YVH A;  5AXI A;  1YX7 A;  1G4Y R;  2MHH A;  3GOF A;  1NYA A;  1YUS A;  1UHN A;  2KI6 D;  4NDB A;  3SIB A;  1J7R A;  3BYA A;  3WHT B;  3EKJ A;  1EG3 A;  3LLE A;  3BUX B;  1J1D A;  4MZJ A;  3AAJ A;  3VRN A;  4AQI A;  4USL A;  1CMF A;  3WXA A;  5CSN A;  3BUW B;  3PAL A;  1GGW A;  1SK6 D;  1HQV A;  2QPT A;  1B9A A;  1J55 A;  4PDZ A;  1FW4 A;  3TS5 C;  1SY9 A;  1NX1 A;  2PVB A;  2ZKM X;  3FWB A;  4E68 A;  1K9U A;  1ZUZ A;  1OSA A;  2K8M B;  4I5N B;  2LM5 A;  2KI4 C;  3O6B A;  1NPQ A;  2BEC A;  1CDP A;  1Y1U A;  1ALV A;  1S6J A;  1SW8 A;  1YVL A;  2LMV A;  2K7D A;  5CSJ A;  2LV7 A;  4M2P A;  1JFJ A;  1TIZ A;  3WNX B;  1XA5 A;  4JPZ B;  4OV2 A;  1QV1 A;  1NIW A;  4PHM A;  3FIA A;  3OX6 A;  2M1U A;  1TCF A;  5F6T A;  2WND A;  2KOT A;  2WOS A;  1KQM C;  4M2O A;  4I5L B;  4MBE A;  4ORB B;  1IKU A;  2SAS A;  1F4Q A;  3O4Y A;  2I2R E;  2MLE C;  1KWO B;  1DJI A;  3M0W A;  3A8R A;  1BR1 B;  1RFJ A;  2KBM A;  1YRU B;  1FBV A;  4PHK A;  1CMG A;  1J7O A;  2DOQ A;  1XO5 A;  2JT8 A;  4NDD A;  1AK8 A;  4GBA A;  3DVK A;  1UP5 A;  2K7C A;  2LLT A;  4QJ5 B;  2JRF A;  1G33 A;  2M9G A;  2WC8 A;  2Q91 A;  1S5G Y;  3HX4 A;  5I2L A;  5I2O A;  1CLB A;  1BR4 B;  1E8A A;  3I5I B;  3TDZ A;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...