4DRWA

Crystal structure of the ternary complex between s100a10, an annexin a2 n-terminal peptide and an ahnak peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
103
Chain Sequence
b'PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKSTVHEILSKLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10/Annexin A2 chimeric protein
publication title Structure of an asymmetric ternary protein complex provides insight for membrane interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Exocytosis/protein binding
total genus 24
structure length 103
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4drwA00
1DT7B 3EVVA 2CBLA 2CTNA 2MBXA 3OB2B 2KYFA 1DJIA 1XFXO 1GGZA 1DF0B 1MUXA 3BUNB 1SNLA 2LP3A 1M39A 3DF0A 1WLZA 4YGDB 1TCOB 1K95A 1A2XA 1V1FA 1FF1A 1QVIY 3I5GC 2NLNA 1ODBA 1MXLC 4CFRA 1XA5A 2FCDA 1BR1B 1B8LA 1OOJA 2KBIA 2BCXA 1D1OA 1Y1XA 2DOQA 2HPSA 1CDNA 1QS7A 5I8NA 3I5HB 2F3YA 1TNQA 2KDHA 4PE7A 1BODA 1N65A 4PHJA 1S5GZ 3SIAA 2LUCA 5JJGA 1MXEA 5AXIA 5HLOA 2EC6C 4A4BA 3IF7A 2NCOA 5J3XA 1J55A 3GK2A 1MHOA 3NXAA 2WC8A 1SYMA 1QLKA 4AQJA 1TIZA 1QX7A 1RROA 3TUYB 1CNPA 1YVHA 5DKNA 4R1EA 3NSOA 1R2UA 2H61A 1U5IA 1C07A 2KFFA 2VRGA 3O78A 5F6TA 3JTDC 1NCZA 1NSHA 2JT0A 4QJ5B 1S5GY 1V1GA 1W7IB 2B1UA 2LMTA 2KOTA 2KFGA 2F8PA 2JNFA 1EL4A 3BXKA 2HQWA 2F33A 3IQQA 2LMUA 1L2OC 4HRHA 3I5IC 2LLUA 2F3ZA 2M49B 2OS8C 1NP8A 2LAPA 4N1FA 3D0YA 4DS7A 1YUUA 1CLLA 3PM8A 1B7TY 4GFTA 5CSIA 3DVMA 1SCVA 1KK7Z 4MBEA 1EH2A 1Y0VH 1N2DA 2FCEA 1CFFA 4DRWA 5BPJA 1KSMA 1LXFC 1K8UA 2Y5IA 2KFHA 1CTRA 4C0LA 3LLEA 5DKRA 1SW8A 2BBMA 2L5XB 1XFWO 1YUTA 1AJ5A 1RWYA 4CPVA 3ZNIA 2ISDA 2OTGB 1CLMA 2HQ8A 3I5HC 1IQ5A 5TNCA 3I5GB 2WCFA 3KPXA 3SG6A 4BY4A 1KQVA 1JWDA 1FBVA 2WCBA 1UP5A 4PHNA 1M45A 2NXQA 5HLVA 2GGMA 3GOFA 1OZOA 1QXPA 4PE4A 1IWQA 4PHKA 1JC2A 1CM4A 2KAVA 2MRDA 3SG5A 1CFPA 2NZ0A 2K7CA 2R2IA 1J1EA 2ZN8A 5IBWA 4MZJA 3RLZA 1JFJA 5AFPA 1SY9A 1UHKA 2PASA 1QJTA 4JWQA 2E30A 3WHUB 1GJYA 2EC6B 2LLSA 1XK4C 2KI6D 2M3WA 4PALA 5GQQC 1SL8A 1NX3A 5I2OA 1XFYO 1CFDA 1DGVA 1MQ1A 3VRPA 2KAXA 1AHRA 4OCIA 1YTZC 1PULA 2I18A 3LK0A 1NUBA 1QV0A 3EKJA 3TDZA 4ORCB 3D10A 4MN0A 2ZN9A 3SG2A 4FTGA 1YR5A 5DKQA 1KK8C 2WNDA 3I5FC 3JTDB 1FI5A 3TS5B 1SMGA 3DVKA 1J1DA 1OMDA 1Y1UA 1RFJA 3O2PA 1IKUA 2ZNEA 5CSNA 1XVJA 5K89A 3AAKA 2ZRTA 4WRIA 4E68A 1CDPA 3I5IB 2F2PA 2OS8B 2I94A 1KCYA 1BLQA 4GNKB 5KU1A 4QJ3B 1QX5B 1K9KA 4MSPA 4MRYA 3E3RA 1B47A 5AERA 2O60A 5CSFA 4YI9A 3DVJA 1WDCC 1F70A 4CFQA 1S1EA 1AJ4A 2OTGC 2JTZA 2E6WA 2BKHB 2BE4A 3O6BA 2L2EA 3PFVA 4P2YB 2PVBA 2CT9A 2LLTA 1MWNA 3FWBA 1PSRA 5AANA 4A4CA 2JT3A 3NSKA 4GGNA 2KBMA 5HKYA 4OKHA 3AKBA 2BCBA 2M9GA 3VRQA 1LVCD 4I5NB 2ZFDA 1CMGA 3HCMA 2LVJA 1J7OA 2BKIB 1CDMA 4BY5A 1DMOA 1UURA 1UUSA 2K2AA 3CR2A 5CPVA 1S6CA 1TNXA 1K2HA 3EK8A 2K0JA 2L50A 4MRXA 1YUSA 4ORAB 1B8CA 2K7BA 3BYAA 2MLFC 3PSRA 1JF0A 1NWDA 2ZRSA 2JT8A 1BF5A 4GGFC 2KI4B 2O5GA 2P6BB 4WQ3A 3GK1A 3EVRA 1A75A 1EG4A 3EK4A 1CM1A 1GQMA 1MR8A 4YGEB 1J7PA 1OMRA 1DVIA 1PALA 2COLB 1AUIB 4DIRA 4USLA 1OQPA 4ORBB 2JOJA 1BT6A 4L9MA 5KTYA 2PSRA 1LA0A 3O4YA 5ER4X 1KFXL 1NIWA 2PRUA 3TS5C 2KQ6A 4CIDA 1K93D 1WY9A 2LHIA 5I2QA 2BCAA 1DJZA 1JF2A 2JTTA 4XJKA 1W7JB 1L7ZA 1KWOC 1NX0A 2LM5A 3EKHA 3OX5A 1EJ3A 4PDZA 2HF5A 1WRLA 4ZCVA 1DJGA 2KQYA 3FIAA 1KK8B 3I5FB 1IH0A 1ALWA 1JBAA 1KQMC 2EGDA 1ZFSA 1OE9B 1K9PA 5D69A 1IJ6A 1GGWA 4M2PA 2KGRA 2IS9A 1UHIA 1B4CA 4M2QA 1SL7A 2K8MB 4YGBB 1M31A 1J7QA 3QRXA 3LK1A 3DF0B 1NCYA 1WDCB 1XFZO 2D8NA 1NCXA 2LVKA 2ZNDA 3NSIA 1RECA 2OPOA 1KK7Y 1YURA 2M7NA 1A29A 3BUMB 1UWOA 3JVTC 3RM1A 4ETOA 1C7VA 1DF0A 4N1GA 1BU3A 4PE1A 2G9BA 2KI4C 1UHJA 1A4PA 4HSZA 3EK7A 2FJUB 1KSOA 1QASA 4MVFA 2I7AA 1DJXA 3NSLA 4TNCA 4AQIA 1S36A 2LVIA 5AEQA 2JNXA 3BUXB 4MZLA 2JQ6A 3VGOA 2Y1MA 2JULA 2AMIA 1TN4A 4PE0A 3SIBA 2LVVA 2LE9B 2KGBC 3KO0A 3KHEA 1IJ5A 1XFUO 1G8IA 1U5IB 2BECA 1BG1A 2L0PA 2L4HA 3PN7B 4YRUA 1A03A 1TTXA 1DJWA 2KYCA 1ZUZA 2KSPA 2BL0B 5FYXA 2K2FA 2LC5A 3BUOB 3KEVA 3WNXB 1IGVA 1UHNA 1NX2A 1PSBA 2MAZA 1C7WA 1TCFA 1KWOB 3CGAA 3TDUA 4YI8A 3AAJA 1Q80A 1XK4A 2LV7A 1Y6WA 1SR6B 3D0YB 2LMVA 2SCPA 4NDDA 4OR9B 1DJHA 1N0YA 4DCKA 3VRNA 1F55A 1KQMB 4NDCA 3CTNA 1WLMA 5B8IB 5KSZA 2Q91A 4QJ4B 1EG3A 4FQOA 1AP4A 1FW4A 1SK6D 1YX7A 3CS1A 1G4YR 3IQOA 5HKZA 4P5OE 1QVIZ 5I2LA 1J7RA 2CXJA 2PALA 1BJFA 3SG3A 5JOLA 1BR4B 1QIVA 2M1UA 1XYDA 2BE6A 4GUKA 2MJWB 2L51A 3K21A 1NYAA 4HREE 1TNPA 4IL1A 2LANA 2A4JA 3DVEA 3SG4A 2JU0A 3GK4X 4NDBA 3JVTB 1QLSA 1YX8A 4I5JA 1E8AA 4ICBA 3ICBA 4U8DA 3TDIA 3LCPC 1IRJA 1SBJA 3OHMB 1SCMB 2GGZA 1KFUL 2KI6C 1CB1A 2K7DA 1HT9A 1QIWA 4JPZB 2K61A 1SL9A 2LHLA 3PLFB 2BBNA 2Y1NA 3FWCA 1WRZA 2GV5A 2H61C 3A4UB 3ZWHA 1YRTB 3PN7C 2K7OA 1K90D 4UPGA 1CMFA 2BL0C 3CLNA 1PRWA 2LP2A 3F45A 2WORA 4I5KA 5CSJA 2LNKA 1QV1A 1XO5A 1X02A 4AOMA 2ZKMX 1OMVA 1K96A 1SR6C 2M97A 2SASA 2WOSA 1YRUB 4GGFA 1TOPA 4I5LB 1CKKA 4HRGA 1F8HA 2CNPA 1PVAA 4M2OA 4MEWA 2JXLA 4JQ0D 2KAYA 2QPTA 1ZOTB 3WHTB 1H8BA 1B7TZ 1JFKA 4NQGA 4MZKA 1BMOA 2JXCA 1SRAA 3BOWB 1JUOA 3VRRA 2LCPA 3CZTX 4C0JA 1SKTA 2EHBA 1LINA 1RTP1 1Y1AA 1K94A 1K9UA 1WRKA 5D7FA 4C0KA 1QX2A 5HYDA 2KNEA 1AK8A 5PALA 4GAOA 1B9AA 1M63B 1S6IA 2MHHA 3AKAA 1H4BA 3H4SE 1DTLA 1VRKA 2RGIA 4GBAA 1F54A 1S3PA 2TN4A 1OZSA 1JSAA 1B1GA 4PCWA 1LKJA 2Y4QA 2JRFA 1F71A 3KF9A 4MLWA 1AVSA 1SCMC 2LUXA 1BOCA 1FPWA 4Q04A 1RJVA 2FOTA 3OB1B 1LA3A 3VROA 2MA2A 3LL8B 1CDLA 1NX1A 3CWGA 1MF8B 4GPLB 1S26D 2I2RE 1FI6A 3BQ3A 1TRFA 3M0WA 2AUCA 1ALVA 1EXRA 2HETA 3OX6A 3C1VA 2AAOA 2M7LA 4OV2A 4PHMA 2M1KB 3FS7A 2MLEC 1A75B 1QTXA 5HKWA 1KFUS 3CR4X 1G33A 3WXAA 3SJSA 1UHHA 1SPYA 2F2OA 3A8RA 1DGUA 2QACA 2H2KA 2JWWA 3SG7A 4CLNA 1F4OA 4ZCUA 1R6PA 2CCMA 3TUYC 3BUWB 1NPQA 4XJKB 1ZACA 2Q4UA 1KFXS 3PATA 4D1EA 4XYNA 1DJYA 1IG5A 2JZIA 3CR5X 1OSAA 3EVUA 2PMYA 1QATA 3HX4A 4YGAA 1CFCA 4N5XA 1S6JA 4F0ZB 2KHNA 4YGCB 2G2BA 2M8UA 1IQ3A 1XFVO 1TNWA 2WCEA 1PVBA 2JC2A 1CLBA 1F4QA 1YVLA 4OVNF 3PALA 2L98A 1B8RA 2M29A 3TZ1A 4WQ2A 1HQVA 1RK9A 2V53A 3DD4A 2L4IA 1PK0D 3MSEB 3OP0A 1ZMZA 2JPTA 5ER5A 5G08A 1M46A 1L2OB 4DUQA 4YBHB 2M0RA 2NCPA 3BOWA
chains in the Genus database with same CATH superfamily
2GTEA 1DT7B 3CDNA 3EVVA 4IJ7A 2CBLA 2CTNA 2MBXA 3OB2B 2KYFA 1DJIA 1XFXO 1GGZA 1DF0B 1MUXA 3BUNB 1SNLA 2LP3A 1DC1A 1M39A 3DF0A 5EL2A 1WLZA 4YGDB 1TCOB 1K95A 1A2XA 1V1FA 1FF1A 1QVIY 3I5GC 2NLNA 1ODBA 1MXLC 4CFRA 1XA5A 2FCDA 1OW4A 1BR1B 1B8LA 3DXLA 1OOJA 2WCKA 2KBIA 2BCXA 1D1OA 1Y1XA 2DOQA 2HPSA 1CDNA 1QS7A 5I8NA 3I5HB 3CZ1A 2F3YA 1TNQA 2KDHA 4PE7A 3CZ2A 1N65A 4PHJA 1BODA 1S5GZ 3SIAA 2LUCA 5JJGA 1MXEA 2KLEA 2WC6A 5AXIA 5HLOA 2EC6C 4A4BA 3IF7A 2NCOA 5J3XA 3D75A 1J55A 3GK2A 1MHOA 3NXAA 2WC8A 1SYMA 1QLKA 4AQJA 1TIZA 1QX7A 1RROA 4INWA 3TUYB 1YVHA 1CNPA 5DKNA 4R1EA 3NSOA 1R2UA 2H61A 1U5IA 1C07A 2KFFA 2VRGA 3O78A 2QDIA 5DICA 3JTDC 5F6TA 1NCZA 1NSHA 2ERBA 2JT0A 4QJ5B 1S5GY 1V1GA 3UO9A 1W7IB 1DEKA 2B1UA 2LMTA 2KOTA 2KFGA 2F8PA 3BFHA 2JNFA 1EL4A 3BXKA 2HQWA 2F33A 3IQQA 2LMUA 1L2OC 3NHIA 4HRHA 3I5IC 2LLUA 2F3ZA 2M49B 2OS8C 1NP8A 2LAPA 4N1FA 3D0YA 4DS7A 1YUUA 1CLLA 3PM8A 1B7TY 4GFTA 5CSIA 3DVMA 1SCVA 1KK7Z 2FJYA 4JD9A 4MBEA 1EH2A 1Y0VH 1N2DA 2FCEA 3N7HA 1CFFA 4DRWA 5BPJA 1KSMA 1LXFC 1K8UA 2Y5IA 2KFHA 1CTRA 4C0LA 3LLEA 5DKRA 1SW8A 2BBMA 2L5XB 1XFWO 1YUTA 1TUZA 1XFRA 5I94A 1AJ5A 1RWYA 4CPVA 3ZNIA 2ISDA 2OTGB 1CLMA 3UNWA 3O4XA 2HQ8A 3I5HC 1IQ5A 5TNCA 3I5GB 2WCFA 3KPXA 3SG6A 4BY4A 1KQVA 1JWDA 1FBVA 3SS3A 2WCBA 2QEHA 1UP5A 4PHNA 1M45A 2NXQA 5HLVA 2GGMA 3CABA 1OZOA 1QXPA 3GOFA 4PE4A 1GM0A 1IWQA 4PHKA 1JC2A 1CM4A 2KAVA 2MRDA 2WCHA 3SG5A 1CFPA 2NZ0A 2K7CA 2R2IA 1J1EA 2ZN8A 5IBWA 4MZJA 3RLZA 1JFJA 5AFPA 1SY9A 1OOFA 1UHKA 3L47A 2PASA 1QJTA 4JWQA 2E30A 3WHUB 1GJYA 2EC6B 2LLSA 1XK4C 2KI6D 2M3WA 4PALA 1W9ZA 5GQQC 1SL8A 1NX3A 5I2OA 1XFYO 1CFDA 1DGVA 1MQ1A 3K1EA 3VRPA 2KAXA 1AHRA 4OCIA 1YTZC 1PULA 2I18A 2WCJA 1NUBA 3LK0A 1QV0A 3EKJA 3TDZA 4ORCB 3D10A 4MN0A 3BFAA 2ZN9A 3IVTA 3SG2A 4FTGA 1YR5A 1OOHA 5DKQA 1KK8C 2WNDA 3I5FC 3JTDB 1FI5A 3TS5B 1SMGA 3DVKA 1J1DA 1OMDA 1Y1UA 1RFJA 3O2PA 1IKUA 2ZNEA 5CSNA 1XVJA 5K89A 2L5YA 2ZRTA 3AAKA 3FE9A 3OGNA 4WRIA 4E68A 1CDPA 3I5IB 3R1VA 2F2PA 2OS8B 2I94A 1KCYA 1BLQA 3L4AA 4GNKB 4QJ3B 5KU1A 3S0FA 1QX5B 1K9KA 4MSPA 2L2CA 4MRYA 3E3RA 1B47A 5AERA 2O60A 3S0GA 5CSFA 4YI9A 3DVJA 1WDCC 1F70A 4CFQA 1S1EA 1AJ4A 2OTGC 2JTZA 2E6WA 2BKHB 2BE4A 3O6BA 2L2EA 3PFVA 4P2YB 2PVBA 2CT9A 2LLTA 1MWNA 3FWBA 1PSRA 3OBVA 5AANA 4A4CA 2JT3A 3NSKA 4GGNA 3B86A 2KBMA 5HKYA 3FE6A 2P71A 3AKBA 2BCBA 2M9GA 4OKHA 3VRQA 1LVCD 4I5NB 2ZFDA 1CMGA 3HCMA 2LVJA 2WCMA 1J7OA 2BKIB 1CDMA 4BY5A 1DMOA 1UURA 1UUSA 2K2AA 3CR2A 5CPVA 1S6CA 1TNXA 1K2HA 3EK8A 2K0JA 2L50A 4MRXA 1YUSA 4ORAB 1B8CA 2K7BA 3BYAA 2MLFC 3PSRA 1DQEA 1JF0A 1NWDA 2ZRSA 2JT8A 3S0AA 3D76A 1BF5A 4GGFC 2KI4B 2O5GA 2P6BB 2PQLA 4WQ3A 3GK1A 3EVRA 1A75A 1EG4A 3RZSA 3EK4A 1CM1A 1GQMA 1MR8A 4YGEB 1J7PA 1OMRA 1DVIA 1PALA 2COLB 1AUIB 4KYNA 4DIRA 4USLA 1OQPA 4ORBB 2JOJA 1BT6A 4L9MA 3D77A 5KTYA 2PSRA 1LA0A 3O4YA 5ER4X 1KFXL 1NIWA 2PRUA 3TS5C 2KQ6A 4CIDA 1K93D 1WY9A 2LHIA 1TWOA 2BCAA 5I2QA 1DJZA 1JF2A 2JTTA 4XJKA 1W7JB 1L7ZA 1KWOC 1NX0A 2LM5A 3EKHA 3OX5A 2YGUA 1EJ3A 4PDZA 2HF5A 1WRLA 3S0DA 4ZCVA 1DJGA 1QWVA 2KQYA 3FIAA 1KK8B 1LS8A 3I5FB 1IH0A 1ALWA 1JBAA 1KQMC 2EGDA 1ZFSA 1OE9B 2JPOA 1K9PA 5D69A 1IJ6A 1GGWA 4M2PA 2KGRA 2IS9A 1UHIA 1B4CA 4M2QA 1SL7A 2K8MB 4YGBB 1M31A 1J7QA 3QRXA 3LK1A 3DF0B 1NCYA 1WDCB 1XFZO 3L4LA 2D8NA 1NCXA 2LVKA 2ZNDA 3NSIA 1RECA 2OPOA 1KK7Y 1YURA 2M7NA 1A29A 3BUMB 3V2LA 3BJHA 3R1PA 1UWOA 3JVTC 3RM1A 1IIOA 4ETOA 1C7VA 1DF0A 4N1GA 1BU3A 4PE1A 2G9BA 2KI4C 3R1OA 1UHJA 1A4PA 4HSZA 3EK7A 2FJUB 1KSOA 1QASA 4MVFA 2I7AA 1DJXA 3DZTA 3NSLA 4TNCA 1S36A 2LVIA 5AEQA 4AQIA 4JKTA 2JNXA 3BUXB 4MZLA 2JQ6A 3VGOA 2Y1MA 2JULA 2AMIA 3D78A 1TN4A 4PE0A 3SIBA 2LVVA 2LE9B 2KGBC 3KO0A 3KHEA 4INXA 1IJ5A 1XFUO 1G8IA 1U5IB 2BECA 1BG1A 2L0PA 2L4HA 3PN7B 4YRUA 1A03A 1TTXA 1DJWA 2KYCA 2H8VA 1ZUZA 4FQTA 2KSPA 2BL0B 5FYXA 4OZDA 2K2FA 2LC5A 3BUOB 3KEVA 3B88A 3WNXB 1IGVA 1UHNA 1NX2A 1PSBA 2MAZA 1C7WA 1TCFA 1KWOB 3CGAA 3TDUA 4YI8A 3AAJA 1Q80A 1XK4A 2LV7A 1Y6WA 2QEVA 1SR6B 3D0YB 4F7FA 2LMVA 2SCPA 4NDDA 4OR9B 1DJHA 1N0YA 4DCKA 3VRNA 1F55A 1KQMB 4NDCA 3CTNA 1WLMA 5B8IB 5KSZA 2Q91A 4QJ4B 1EG3A 1SSEB 4FQOA 1AP4A 1FW4A 1SK6D 1YX7A 3CS1A 1G4YR 3IQOA 5HKZA 4P5OE 1QVIZ 5I2LA 1J7RA 2CXJA 2PALA 3VB1A 1BJFA 3SG3A 5JOLA 1BR4B 1ORGA 1QIVA 2M1UA 1XYDA 3CZ0A 2BE6A 4GUKA 2MJWB 2L51A 3K21A 1NYAA 4HREE 1TNPA 1P28A 2LANA 4IL1A 2A4JA 3DVEA 3SG4A 2JU0A 3GK4X 4NDBA 3JVTB 1QLSA 1YX8A 3R72A 1E8AA 4I5JA 3ICBA 4ICBA 4U8DA 3TDIA 3LCPC 1IRJA 1SBJA 3OHMB 1SCMB 2GGZA 1KFUL 2K60A 2KI6C 3PJIA 1CB1A 2K7DA 1HT9A 1QIWA 4JPZB 2K61A 1Z2CB 1SL9A 2LHLA 3PLFB 2BBNA 1TUJA 2Y1NA 3FWCA 1WRZA 2GV5A 2H61C 3A4UB 3ZWHA 1YRTB 3DYEA 3PN7C 2K7OA 1K90D 4UPGA 1CMFA 2BL0C 3CLNA 1PRWA 2LP2A 1OOGA 2PYQA 3F45A 2WORA 3CYZA 4I5KA 5CSJA 2LNKA 1C3YA 3B87A 1QV1A 1XO5A 1X02A 3SS4A 4AOMA 2ZKMX 1OMVA 1K96A 1SR6C 2M97A 2SASA 2WOSA 3D74A 1YRUB 4GGFA 1TOPA 4I5LB 1CKKA 4HRGA 1F8HA 2CNPA 1PVAA 4M2OA 4MEWA 2JXLA 4JQ0D 2KAYA 2QPTA 1ZOTB 3WHTB 1H8BA 3B6XA 2WCLA 1B7TZ 1JFKA 4NQGA 4MZKA 1BMOA 2JXCA 1SRAA 3BOWB 1JUOA 3VRRA 2LCPA 3CZTX 4C0JA 5FI7A 1SKTA 2EHBA 3SS5A 1LINA 1RTP1 1Y1AA 1K94A 1K9UA 1WRKA 5D7FA 4C0KA 1QX2A 5HYDA 2KNEA 3EG5B 5PALA 1AK8A 4GAOA 4PT1A 3S0EA 1B9AA 1M63B 1OOIX 1S6IA 2MHHA 2WC5A 3AKAA 1H4BA 3H4SE 1DTLA 2QEBA 1VRKA 2RGIA 4GBAA 1F54A 1S3PA 2TN4A 1OZSA 1JSAA 1B1GA 2BNXA 4PCWA 1LKJA 3NHTA 2Y4QA 2JRFA 1F71A 3KF9A 4MLWA 1AVSA 1SCMC 2LUXA 1BOCA 1FPWA 4Q04A 1RJVA 2FOTA 3FE8A 3OB1B 1LA3A 3VROA 2MA2A 3LL8B 1CDLA 1NX1A 3CWGA 1MF8B 4GPLB 1DELA 1S26D 2I2RE 3QMEA 1FI6A 2KLDA 3BQ3A 1TRFA 3M0WA 2AUCA 1ALVA 1EXRA 1T14A 2HETA 3OX6A 3C1VA 2AAOA 2M7LA 4OV2A 4PHMA 2M1KB 3FS7A 2MLEC 1A75B 1QTXA 3PM2A 5HKWA 1KFUS 5HL1A 3CR4X 1G33A 3WXAA 1C3ZA 3SJSA 1UHHA 1SPYA 2F2OA 3A8RA 1DGUA 2P70A 2QACA 2H2KA 2JWWA 3SG7A 4CLNA 1F4OA 4ZCUA 1R6PA 2CCMA 3TUYC 3S0BA 3BUWB 1NPQA 4XJKB 1ZACA 2M0RA 2Q4UA 1KFXS 2BAPA 3PATA 4XYNA 4D1EA 5FI2A 3B7AA 1DJYA 1IG5A 2JZIA 3CR5X 1OSAA 3EVUA 2PMYA 1QATA 3HX4A 4YGAA 1CFCA 3BFBA 4N5XA 1S6JA 4F0ZB 2KHNA 4YGCB 2G2BA 5D3OA 2QEOA 2M8UA 1IQ3A 1XFVO 1TNWA 2WCEA 5FI6A 1PVBA 2JC2A 1CLBA 1F4QA 3NGVA 1Z4HA 1YVLA 4OVNF 3D73A 2L98A 3PALA 1B8RA 2M29A 3TZ1A 4WQ2A 1HQVA 1RK9A 2V53A 3DD4A 2L4IA 1PK0D 3MSEB 3OP0A 3DY9A 1ZMZA 2JPTA 5ER5A 3Q8IA 1M46A 5G08A 1L2OB 4DUQA 4YBHB 2KPHA 2NCPA 3BOWA
chains in the Genus database with same CATH topology
1DT7B 3EVVA 2CBLA 2CTNA 2MBXA 3OB2B 2KYFA 1DJIA 1XFXO 1GGZA 1DF0B 1MUXA 3BUNB 1SNLA 2LP3A 1M39A 3DF0A 1WLZA 4YGDB 1TCOB 1K95A 1A2XA 1V1FA 1FF1A 1QVIY 3I5GC 2NLNA 1ODBA 1MXLC 4CFRA 1XA5A 2FCDA 1BR1B 1B8LA 1OOJA 2KBIA 2BCXA 1D1OA 1Y1XA 2DOQA 2HPSA 1CDNA 1QS7A 5I8NA 3I5HB 2F3YA 1TNQA 2KDHA 4PE7A 1BODA 1N65A 4PHJA 1S5GZ 3SIAA 2LUCA 5JJGA 1MXEA 5AXIA 5HLOA 2EC6C 4A4BA 3IF7A 2NCOA 5J3XA 1J55A 3GK2A 1MHOA 3NXAA 2WC8A 1SYMA 1QLKA 4AQJA 1TIZA 1QX7A 1RROA 3TUYB 1CNPA 1YVHA 5DKNA 4R1EA 3NSOA 1R2UA 2H61A 1U5IA 1C07A 2KFFA 2VRGA 3O78A 5F6TA 3JTDC 1NCZA 1NSHA 2JT0A 4QJ5B 1S5GY 1V1GA 1W7IB 2B1UA 2LMTA 2KOTA 2KFGA 2F8PA 2JNFA 1EL4A 3BXKA 2HQWA 2F33A 3IQQA 2LMUA 1L2OC 4HRHA 3I5IC 2LLUA 2F3ZA 2M49B 2OS8C 1NP8A 2LAPA 4N1FA 3D0YA 4DS7A 1YUUA 1CLLA 3PM8A 1B7TY 4GFTA 5CSIA 3DVMA 1SCVA 1KK7Z 4MBEA 1EH2A 1Y0VH 1N2DA 2FCEA 1CFFA 4DRWA 5BPJA 1KSMA 1LXFC 1K8UA 2Y5IA 2KFHA 1CTRA 4C0LA 3LLEA 5DKRA 1SW8A 2BBMA 2L5XB 1XFWO 1YUTA 1AJ5A 1RWYA 4CPVA 3ZNIA 2ISDA 2OTGB 1CLMA 2HQ8A 3I5HC 1IQ5A 5TNCA 3I5GB 2WCFA 3KPXA 3SG6A 4BY4A 1KQVA 1JWDA 1FBVA 2WCBA 1UP5A 4PHNA 1M45A 2NXQA 5HLVA 2GGMA 3GOFA 1OZOA 1QXPA 4PE4A 1IWQA 4PHKA 1JC2A 1CM4A 2KAVA 2MRDA 3SG5A 1CFPA 2NZ0A 2K7CA 2R2IA 1J1EA 2ZN8A 5IBWA 4MZJA 3RLZA 1JFJA 5AFPA 1SY9A 1UHKA 2PASA 1QJTA 4JWQA 2E30A 3WHUB 1GJYA 2EC6B 2LLSA 1XK4C 2KI6D 2M3WA 4PALA 5GQQC 1SL8A 1NX3A 5I2OA 1XFYO 1CFDA 1DGVA 1MQ1A 3VRPA 2KAXA 1AHRA 4OCIA 1YTZC 1PULA 2I18A 3LK0A 1NUBA 1QV0A 3EKJA 3TDZA 4ORCB 3D10A 4MN0A 2ZN9A 3SG2A 4FTGA 1YR5A 5DKQA 1KK8C 2WNDA 3I5FC 3JTDB 1FI5A 3TS5B 1SMGA 3DVKA 1J1DA 1OMDA 1Y1UA 1RFJA 3O2PA 1IKUA 2ZNEA 5CSNA 1XVJA 5K89A 3AAKA 2ZRTA 4WRIA 4E68A 1CDPA 3I5IB 2F2PA 2OS8B 2I94A 1KCYA 1BLQA 4GNKB 5KU1A 4QJ3B 1QX5B 1K9KA 4MSPA 4MRYA 3E3RA 1B47A 5AERA 2O60A 5CSFA 4YI9A 3DVJA 1WDCC 1F70A 4CFQA 1S1EA 1AJ4A 2OTGC 2JTZA 2E6WA 2BKHB 2BE4A 3O6BA 2L2EA 3PFVA 4P2YB 2PVBA 2CT9A 2LLTA 1MWNA 3FWBA 1PSRA 5AANA 4A4CA 2JT3A 3NSKA 4GGNA 2KBMA 5HKYA 4OKHA 3AKBA 2BCBA 2M9GA 3VRQA 1LVCD 4I5NB 2ZFDA 1CMGA 3HCMA 2LVJA 1J7OA 2BKIB 1CDMA 4BY5A 1DMOA 1UURA 1UUSA 2K2AA 3CR2A 5CPVA 1S6CA 1TNXA 1K2HA 3EK8A 2K0JA 2L50A 4MRXA 1YUSA 4ORAB 1B8CA 2K7BA 3BYAA 2MLFC 3PSRA 1JF0A 1NWDA 2ZRSA 2JT8A 1BF5A 4GGFC 2KI4B 2O5GA 2P6BB 4WQ3A 3GK1A 3EVRA 1A75A 1EG4A 3EK4A 1CM1A 1GQMA 1MR8A 4YGEB 1J7PA 1OMRA 1DVIA 1PALA 2COLB 1AUIB 4DIRA 4USLA 1OQPA 4ORBB 2JOJA 1BT6A 4L9MA 5KTYA 2PSRA 1LA0A 3O4YA 5ER4X 1KFXL 1NIWA 2PRUA 3TS5C 2KQ6A 4CIDA 1K93D 1WY9A 2LHIA 5I2QA 2BCAA 1DJZA 1JF2A 2JTTA 4XJKA 1W7JB 1L7ZA 1KWOC 1NX0A 2LM5A 3EKHA 3OX5A 1EJ3A 4PDZA 2HF5A 1WRLA 4ZCVA 1DJGA 2KQYA 3FIAA 1KK8B 3I5FB 1IH0A 1ALWA 1JBAA 1KQMC 2EGDA 1ZFSA 1OE9B 1K9PA 5D69A 1IJ6A 1GGWA 4M2PA 2KGRA 2IS9A 1UHIA 1B4CA 4M2QA 1SL7A 2K8MB 4YGBB 1M31A 1J7QA 3QRXA 3LK1A 3DF0B 1NCYA 1WDCB 1XFZO 2D8NA 1NCXA 2LVKA 2ZNDA 3NSIA 1RECA 2OPOA 1KK7Y 1YURA 2M7NA 1A29A 3BUMB 1UWOA 3JVTC 3RM1A 4ETOA 1C7VA 1DF0A 4N1GA 1BU3A 4PE1A 2G9BA 2KI4C 1UHJA 1A4PA 4HSZA 3EK7A 2FJUB 1KSOA 1QASA 4MVFA 2I7AA 1DJXA 3NSLA 4TNCA 4AQIA 1S36A 2LVIA 5AEQA 2JNXA 3BUXB 4MZLA 2JQ6A 3VGOA 2Y1MA 2JULA 2AMIA 1TN4A 4PE0A 3SIBA 2LVVA 2LE9B 2KGBC 3KO0A 3KHEA 1IJ5A 1XFUO 1G8IA 1U5IB 2BECA 1BG1A 2L0PA 2L4HA 3PN7B 4YRUA 1A03A 1TTXA 1DJWA 2KYCA 1ZUZA 2KSPA 2BL0B 5FYXA 2K2FA 2LC5A 3BUOB 3KEVA 3WNXB 1IGVA 1UHNA 1NX2A 1PSBA 2MAZA 1C7WA 1TCFA 1KWOB 3CGAA 3TDUA 4YI8A 3AAJA 1Q80A 1XK4A 2LV7A 1Y6WA 1SR6B 3D0YB 2LMVA 2SCPA 4NDDA 4OR9B 1DJHA 1N0YA 4DCKA 3VRNA 1F55A 1KQMB 4NDCA 3CTNA 1WLMA 5B8IB 5KSZA 2Q91A 4QJ4B 1EG3A 4FQOA 1AP4A 1FW4A 1SK6D 1YX7A 3CS1A 1G4YR 3IQOA 5HKZA 4P5OE 1QVIZ 5I2LA 1J7RA 2CXJA 2PALA 1BJFA 3SG3A 5JOLA 1BR4B 1QIVA 2M1UA 1XYDA 2BE6A 4GUKA 2MJWB 2L51A 3K21A 1NYAA 4HREE 1TNPA 4IL1A 2LANA 2A4JA 3DVEA 3SG4A 2JU0A 3GK4X 4NDBA 3JVTB 1QLSA 1YX8A 4I5JA 1E8AA 4ICBA 3ICBA 4U8DA 3TDIA 3LCPC 1IRJA 1SBJA 3OHMB 1SCMB 2GGZA 1KFUL 2KI6C 1CB1A 2K7DA 1HT9A 1QIWA 4JPZB 2K61A 1SL9A 2LHLA 3PLFB 2BBNA 2Y1NA 3FWCA 1WRZA 2GV5A 2H61C 3A4UB 3ZWHA 1YRTB 3PN7C 2K7OA 1K90D 4UPGA 1CMFA 2BL0C 3CLNA 1PRWA 2LP2A 3F45A 2WORA 4I5KA 5CSJA 2LNKA 1QV1A 1XO5A 1X02A 4AOMA 2ZKMX 1OMVA 1K96A 1SR6C 2M97A 2SASA 2WOSA 1YRUB 4GGFA 1TOPA 4I5LB 1CKKA 4HRGA 1F8HA 2CNPA 1PVAA 4M2OA 4MEWA 2JXLA 4JQ0D 2KAYA 2QPTA 1ZOTB 3WHTB 1H8BA 1B7TZ 1JFKA 4NQGA 4MZKA 1BMOA 2JXCA 1SRAA 3BOWB 1JUOA 3VRRA 2LCPA 3CZTX 4C0JA 1SKTA 2EHBA 1LINA 1RTP1 1Y1AA 1K94A 1K9UA 1WRKA 5D7FA 4C0KA 1QX2A 5HYDA 2KNEA 1AK8A 5PALA 4GAOA 1B9AA 1M63B 1S6IA 2MHHA 3AKAA 1H4BA 3H4SE 1DTLA 1VRKA 2RGIA 4GBAA 1F54A 1S3PA 2TN4A 1OZSA 1JSAA 1B1GA 4PCWA 1LKJA 2Y4QA 2JRFA 1F71A 3KF9A 4MLWA 1AVSA 1SCMC 2LUXA 1BOCA 1FPWA 4Q04A 1RJVA 2FOTA 3OB1B 1LA3A 3VROA 2MA2A 3LL8B 1CDLA 1NX1A 3CWGA 1MF8B 4GPLB 1S26D 2I2RE 1FI6A 3BQ3A 1TRFA 3M0WA 2AUCA 1ALVA 1EXRA 2HETA 3OX6A 3C1VA 2AAOA 2M7LA 4OV2A 4PHMA 2M1KB 3FS7A 2MLEC 1A75B 1QTXA 5HKWA 1KFUS 3CR4X 1G33A 3WXAA 3SJSA 1UHHA 1SPYA 2F2OA 3A8RA 1DGUA 2QACA 2H2KA 2JWWA 3SG7A 4CLNA 1F4OA 4ZCUA 1R6PA 2CCMA 3TUYC 3BUWB 1NPQA 4XJKB 1ZACA 2Q4UA 1KFXS 3PATA 4D1EA 4XYNA 1DJYA 1IG5A 2JZIA 3CR5X 1OSAA 3EVUA 2PMYA 1QATA 3HX4A 4YGAA 1CFCA 4N5XA 1S6JA 4F0ZB 2KHNA 4YGCB 2G2BA 2M8UA 1IQ3A 1XFVO 1TNWA 2WCEA 1PVBA 2JC2A 1CLBA 1F4QA 1YVLA 4OVNF 3PALA 2L98A 1B8RA 2M29A 3TZ1A 4WQ2A 1HQVA 1RK9A 2V53A 3DD4A 2L4IA 1PK0D 3MSEB 3OP0A 1ZMZA 2JPTA 5ER5A 5G08A 1M46A 1L2OB 4DUQA 4YBHB 2M0RA 2NCPA 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT7 B;  3EVV A;  2CBL A;  2CTN A;  2MBX A;  3OB2 B;  2KYF A;  1DJI A;  1XFX O;  1GGZ A;  1DF0 B;  1MUX A;  3BUN B;  1SNL A;  2LP3 A;  1M39 A;  3DF0 A;  1WLZ A;  4YGD B;  1TCO B;  1K95 A;  1A2X A;  1V1F A;  1FF1 A;  1QVI Y;  3I5G C;  2NLN A;  1ODB A;  1MXL C;  4CFR A;  1XA5 A;  2FCD A;  1BR1 B;  1B8L A;  1OOJ A;  2KBI A;  2BCX A;  1D1O A;  1Y1X A;  2DOQ A;  2HPS A;  1CDN A;  1QS7 A;  5I8N A;  3I5H B;  2F3Y A;  1TNQ A;  2KDH A;  4PE7 A;  1BOD A;  1N65 A;  4PHJ A;  1S5G Z;  3SIA A;  2LUC A;  5JJG A;  1MXE A;  5AXI A;  5HLO A;  2EC6 C;  4A4B A;  3IF7 A;  2NCO A;  5J3X A;  1J55 A;  3GK2 A;  1MHO A;  3NXA A;  2WC8 A;  1SYM A;  1QLK A;  4AQJ A;  1TIZ A;  1QX7 A;  1RRO A;  3TUY B;  1CNP A;  1YVH A;  5DKN A;  4R1E A;  3NSO A;  1R2U A;  2H61 A;  1U5I A;  1C07 A;  2KFF A;  2VRG A;  3O78 A;  5F6T A;  3JTD C;  1NCZ A;  1NSH A;  2JT0 A;  4QJ5 B;  1S5G Y;  1V1G A;  1W7I B;  2B1U A;  2LMT A;  2KOT A;  2KFG A;  2F8P A;  2JNF A;  1EL4 A;  3BXK A;  2HQW A;  2F33 A;  3IQQ A;  2LMU A;  1L2O C;  4HRH A;  3I5I C;  2LLU A;  2F3Z A;  2M49 B;  2OS8 C;  1NP8 A;  2LAP A;  4N1F A;  3D0Y A;  4DS7 A;  1YUU A;  1CLL A;  3PM8 A;  1B7T Y;  4GFT A;  5CSI A;  3DVM A;  1SCV A;  1KK7 Z;  4MBE A;  1EH2 A;  1Y0V H;  1N2D A;  2FCE A;  1CFF A;  4DRW A;  5BPJ A;  1KSM A;  1LXF C;  1K8U A;  2Y5I A;  2KFH A;  1CTR A;  4C0L A;  3LLE A;  5DKR A;  1SW8 A;  2BBM A;  2L5X B;  1XFW O;  1YUT A;  1AJ5 A;  1RWY A;  4CPV A;  3ZNI A;  2ISD A;  2OTG B;  1CLM A;  2HQ8 A;  3I5H C;  1IQ5 A;  5TNC A;  3I5G B;  2WCF A;  3KPX A;  3SG6 A;  4BY4 A;  1KQV A;  1JWD A;  1FBV A;  2WCB A;  1UP5 A;  4PHN A;  1M45 A;  2NXQ A;  5HLV A;  2GGM A;  3GOF A;  1OZO A;  1QXP A;  4PE4 A;  1IWQ A;  4PHK A;  1JC2 A;  1CM4 A;  2KAV A;  2MRD A;  3SG5 A;  1CFP A;  2NZ0 A;  2K7C A;  2R2I A;  1J1E A;  2ZN8 A;  5IBW A;  4MZJ A;  3RLZ A;  1JFJ A;  5AFP A;  1SY9 A;  1UHK A;  2PAS A;  1QJT A;  4JWQ A;  2E30 A;  3WHU B;  1GJY A;  2EC6 B;  2LLS A;  1XK4 C;  2KI6 D;  2M3W A;  4PAL A;  5GQQ C;  1SL8 A;  1NX3 A;  5I2O A;  1XFY O;  1CFD A;  1DGV A;  1MQ1 A;  3VRP A;  2KAX A;  1AHR A;  4OCI A;  1YTZ C;  1PUL A;  2I18 A;  3LK0 A;  1NUB A;  1QV0 A;  3EKJ A;  3TDZ A;  4ORC B;  3D10 A;  4MN0 A;  2ZN9 A;  3SG2 A;  4FTG A;  1YR5 A;  5DKQ A;  1KK8 C;  2WND A;  3I5F C;  3JTD B;  1FI5 A;  3TS5 B;  1SMG A;  3DVK A;  1J1D A;  1OMD A;  1Y1U A;  1RFJ A;  3O2P A;  1IKU A;  2ZNE A;  5CSN A;  1XVJ A;  5K89 A;  3AAK A;  2ZRT A;  4WRI A;  4E68 A;  1CDP A;  3I5I B;  2F2P A;  2OS8 B;  2I94 A;  1KCY A;  1BLQ A;  4GNK B;  5KU1 A;  4QJ3 B;  1QX5 B;  1K9K A;  4MSP A;  4MRY A;  3E3R A;  1B47 A;  5AER A;  2O60 A;  5CSF A;  4YI9 A;  3DVJ A;  1WDC C;  1F70 A;  4CFQ A;  1S1E A;  1AJ4 A;  2OTG C;  2JTZ A;  2E6W A;  2BKH B;  2BE4 A;  3O6B A;  2L2E A;  3PFV A;  4P2Y B;  2PVB A;  2CT9 A;  2LLT A;  1MWN A;  3FWB A;  1PSR A;  5AAN A;  4A4C A;  2JT3 A;  3NSK A;  4GGN A;  2KBM A;  5HKY A;  4OKH A;  3AKB A;  2BCB A;  2M9G A;  3VRQ A;  1LVC D;  4I5N B;  2ZFD A;  1CMG A;  3HCM A;  2LVJ A;  1J7O A;  2BKI B;  1CDM A;  4BY5 A;  1DMO A;  1UUR A;  1UUS A;  2K2A A;  3CR2 A;  5CPV A;  1S6C A;  1TNX A;  1K2H A;  3EK8 A;  2K0J A;  2L50 A;  4MRX A;  1YUS A;  4ORA B;  1B8C A;  2K7B A;  3BYA A;  2MLF C;  3PSR A;  1JF0 A;  1NWD A;  2ZRS A;  2JT8 A;  1BF5 A;  4GGF C;  2KI4 B;  2O5G A;  2P6B B;  4WQ3 A;  3GK1 A;  3EVR A;  1A75 A;  1EG4 A;  3EK4 A;  1CM1 A;  1GQM A;  1MR8 A;  4YGE B;  1J7P A;  1OMR A;  1DVI A;  1PAL A;  2COL B;  1AUI B;  4DIR A;  4USL A;  1OQP A;  4ORB B;  2JOJ A;  1BT6 A;  4L9M A;  5KTY A;  2PSR A;  1LA0 A;  3O4Y A;  5ER4 X;  1KFX L;  1NIW A;  2PRU A;  3TS5 C;  2KQ6 A;  4CID A;  1K93 D;  1WY9 A;  2LHI A;  5I2Q A;  2BCA A;  1DJZ A;  1JF2 A;  2JTT A;  4XJK A;  1W7J B;  1L7Z A;  1KWO C;  1NX0 A;  2LM5 A;  3EKH A;  3OX5 A;  1EJ3 A;  4PDZ A;  2HF5 A;  1WRL A;  4ZCV A;  1DJG A;  2KQY A;  3FIA A;  1KK8 B;  3I5F B;  1IH0 A;  1ALW A;  1JBA A;  1KQM C;  2EGD A;  1ZFS A;  1OE9 B;  1K9P A;  5D69 A;  1IJ6 A;  1GGW A;  4M2P A;  2KGR A;  2IS9 A;  1UHI A;  1B4C A;  4M2Q A;  1SL7 A;  2K8M B;  4YGB B;  1M31 A;  1J7Q A;  3QRX A;  3LK1 A;  3DF0 B;  1NCY A;  1WDC B;  1XFZ O;  2D8N A;  1NCX A;  2LVK A;  2ZND A;  3NSI A;  1REC A;  2OPO A;  1KK7 Y;  1YUR A;  2M7N A;  1A29 A;  3BUM B;  1UWO A;  3JVT C;  3RM1 A;  4ETO A;  1C7V A;  1DF0 A;  4N1G A;  1BU3 A;  4PE1 A;  2G9B A;  2KI4 C;  1UHJ A;  1A4P A;  4HSZ A;  3EK7 A;  2FJU B;  1KSO A;  1QAS A;  4MVF A;  2I7A A;  1DJX A;  3NSL A;  4TNC A;  4AQI A;  1S36 A;  2LVI A;  5AEQ A;  2JNX A;  3BUX B;  4MZL A;  2JQ6 A;  3VGO A;  2Y1M A;  2JUL A;  2AMI A;  1TN4 A;  4PE0 A;  3SIB A;  2LVV A;  2LE9 B;  2KGB C;  3KO0 A;  3KHE A;  1IJ5 A;  1XFU O;  1G8I A;  1U5I B;  2BEC A;  1BG1 A;  2L0P A;  2L4H A;  3PN7 B;  4YRU A;  1A03 A;  1TTX A;  1DJW A;  2KYC A;  1ZUZ A;  2KSP A;  2BL0 B;  5FYX A;  2K2F A;  2LC5 A;  3BUO B;  3KEV A;  3WNX B;  1IGV A;  1UHN A;  1NX2 A;  1PSB A;  2MAZ A;  1C7W A;  1TCF A;  1KWO B;  3CGA A;  3TDU A;  4YI8 A;  3AAJ A;  1Q80 A;  1XK4 A;  2LV7 A;  1Y6W A;  1SR6 B;  3D0Y B;  2LMV A;  2SCP A;  4NDD A;  4OR9 B;  1DJH A;  1N0Y A;  4DCK A;  3VRN A;  1F55 A;  1KQM B;  4NDC A;  3CTN A;  1WLM A;  5B8I B;  5KSZ A;  2Q91 A;  4QJ4 B;  1EG3 A;  4FQO A;  1AP4 A;  1FW4 A;  1SK6 D;  1YX7 A;  3CS1 A;  1G4Y R;  3IQO A;  5HKZ A;  4P5O E;  1QVI Z;  5I2L A;  1J7R A;  2CXJ A;  2PAL A;  1BJF A;  3SG3 A;  5JOL A;  1BR4 B;  1QIV A;  2M1U A;  1XYD A;  2BE6 A;  4GUK A;  2MJW B;  2L51 A;  3K21 A;  1NYA A;  4HRE E;  1TNP A;  4IL1 A;  2LAN A;  2A4J A;  3DVE A;  3SG4 A;  2JU0 A;  3GK4 X;  4NDB A;  3JVT B;  1QLS A;  1YX8 A;  4I5J A;  1E8A A;  4ICB A;  3ICB A;  4U8D A;  3TDI A;  3LCP C;  1IRJ A;  1SBJ A;  3OHM B;  1SCM B;  2GGZ A;  1KFU L;  2KI6 C;  1CB1 A;  2K7D A;  1HT9 A;  1QIW A;  4JPZ B;  2K61 A;  1SL9 A;  2LHL A;  3PLF B;  2BBN A;  2Y1N A;  3FWC A;  1WRZ A;  2GV5 A;  2H61 C;  3A4U B;  3ZWH A;  1YRT B;  3PN7 C;  2K7O A;  1K90 D;  4UPG A;  1CMF A;  2BL0 C;  3CLN A;  1PRW A;  2LP2 A;  3F45 A;  2WOR A;  4I5K A;  5CSJ A;  2LNK A;  1QV1 A;  1XO5 A;  1X02 A;  4AOM A;  2ZKM X;  1OMV A;  1K96 A;  1SR6 C;  2M97 A;  2SAS A;  2WOS A;  1YRU B;  4GGF A;  1TOP A;  4I5L B;  1CKK A;  4HRG A;  1F8H A;  2CNP A;  1PVA A;  4M2O A;  4MEW A;  2JXL A;  4JQ0 D;  2KAY A;  2QPT A;  1ZOT B;  3WHT B;  1H8B A;  1B7T Z;  1JFK A;  4NQG A;  4MZK A;  1BMO A;  2JXC A;  1SRA A;  3BOW B;  1JUO A;  3VRR A;  2LCP A;  3CZT X;  4C0J A;  1SKT A;  2EHB A;  1LIN A;  1RTP 1;  1Y1A A;  1K94 A;  1K9U A;  1WRK A;  5D7F A;  4C0K A;  1QX2 A;  5HYD A;  2KNE A;  1AK8 A;  5PAL A;  4GAO A;  1B9A A;  1M63 B;  1S6I A;  2MHH A;  3AKA A;  1H4B A;  3H4S E;  1DTL A;  1VRK A;  2RGI A;  4GBA A;  1F54 A;  1S3P A;  2TN4 A;  1OZS A;  1JSA A;  1B1G A;  4PCW A;  1LKJ A;  2Y4Q A;  2JRF A;  1F71 A;  3KF9 A;  4MLW A;  1AVS A;  1SCM C;  2LUX A;  1BOC A;  1FPW A;  4Q04 A;  1RJV A;  2FOT A;  3OB1 B;  1LA3 A;  3VRO A;  2MA2 A;  3LL8 B;  1CDL A;  1NX1 A;  3CWG A;  1MF8 B;  4GPL B;  1S26 D;  2I2R E;  1FI6 A;  3BQ3 A;  1TRF A;  3M0W A;  2AUC A;  1ALV A;  1EXR A;  2HET A;  3OX6 A;  3C1V A;  2AAO A;  2M7L A;  4OV2 A;  4PHM A;  2M1K B;  3FS7 A;  2MLE C;  1A75 B;  1QTX A;  5HKW A;  1KFU S;  3CR4 X;  1G33 A;  3WXA A;  3SJS A;  1UHH A;  1SPY A;  2F2O A;  3A8R A;  1DGU A;  2QAC A;  2H2K A;  2JWW A;  3SG7 A;  4CLN A;  1F4O A;  4ZCU A;  1R6P A;  2CCM A;  3TUY C;  3BUW B;  1NPQ A;  4XJK B;  1ZAC A;  2Q4U A;  1KFX S;  3PAT A;  4D1E A;  4XYN A;  1DJY A;  1IG5 A;  2JZI A;  3CR5 X;  1OSA A;  3EVU A;  2PMY A;  1QAT A;  3HX4 A;  4YGA A;  1CFC A;  4N5X A;  1S6J A;  4F0Z B;  2KHN A;  4YGC B;  2G2B A;  2M8U A;  1IQ3 A;  1XFV O;  1TNW A;  2WCE A;  1PVB A;  2JC2 A;  1CLB A;  1F4Q A;  1YVL A;  4OVN F;  3PAL A;  2L98 A;  1B8R A;  2M29 A;  3TZ1 A;  4WQ2 A;  1HQV A;  1RK9 A;  2V53 A;  3DD4 A;  2L4I A;  1PK0 D;  3MSE B;  3OP0 A;  1ZMZ A;  2JPT A;  5ER5 A;  5G08 A;  1M46 A;  1L2O B;  4DUQ A;  4YBH B;  2M0R A;  2NCP A;  3BOW A; 
#chains in the Genus database with same CATH topology
 2GTE A;  1DT7 B;  3CDN A;  3EVV A;  4IJ7 A;  2CBL A;  2CTN A;  2MBX A;  3OB2 B;  2KYF A;  1DJI A;  1XFX O;  1GGZ A;  1DF0 B;  1MUX A;  3BUN B;  1SNL A;  2LP3 A;  1DC1 A;  1M39 A;  3DF0 A;  5EL2 A;  1WLZ A;  4YGD B;  1TCO B;  1K95 A;  1A2X A;  1V1F A;  1FF1 A;  1QVI Y;  3I5G C;  2NLN A;  1ODB A;  1MXL C;  4CFR A;  1XA5 A;  2FCD A;  1OW4 A;  1BR1 B;  1B8L A;  3DXL A;  1OOJ A;  2WCK A;  2KBI A;  2BCX A;  1D1O A;  1Y1X A;  2DOQ A;  2HPS A;  1CDN A;  1QS7 A;  5I8N A;  3I5H B;  3CZ1 A;  2F3Y A;  1TNQ A;  2KDH A;  4PE7 A;  3CZ2 A;  1N65 A;  4PHJ A;  1BOD A;  1S5G Z;  3SIA A;  2LUC A;  5JJG A;  1MXE A;  2KLE A;  2WC6 A;  5AXI A;  5HLO A;  2EC6 C;  4A4B A;  3IF7 A;  2NCO A;  5J3X A;  3D75 A;  1J55 A;  3GK2 A;  1MHO A;  3NXA A;  2WC8 A;  1SYM A;  1QLK A;  4AQJ A;  1TIZ A;  1QX7 A;  1RRO A;  4INW A;  3TUY B;  1YVH A;  1CNP A;  5DKN A;  4R1E A;  3NSO A;  1R2U A;  2H61 A;  1U5I A;  1C07 A;  2KFF A;  2VRG A;  3O78 A;  2QDI A;  5DIC A;  3JTD C;  5F6T A;  1NCZ A;  1NSH A;  2ERB A;  2JT0 A;  4QJ5 B;  1S5G Y;  1V1G A;  3UO9 A;  1W7I B;  1DEK A;  2B1U A;  2LMT A;  2KOT A;  2KFG A;  2F8P A;  3BFH A;  2JNF A;  1EL4 A;  3BXK A;  2HQW A;  2F33 A;  3IQQ A;  2LMU A;  1L2O C;  3NHI A;  4HRH A;  3I5I C;  2LLU A;  2F3Z A;  2M49 B;  2OS8 C;  1NP8 A;  2LAP A;  4N1F A;  3D0Y A;  4DS7 A;  1YUU A;  1CLL A;  3PM8 A;  1B7T Y;  4GFT A;  5CSI A;  3DVM A;  1SCV A;  1KK7 Z;  2FJY A;  4JD9 A;  4MBE A;  1EH2 A;  1Y0V H;  1N2D A;  2FCE A;  3N7H A;  1CFF A;  4DRW A;  5BPJ A;  1KSM A;  1LXF C;  1K8U A;  2Y5I A;  2KFH A;  1CTR A;  4C0L A;  3LLE A;  5DKR A;  1SW8 A;  2BBM A;  2L5X B;  1XFW O;  1YUT A;  1TUZ A;  1XFR A;  5I94 A;  1AJ5 A;  1RWY A;  4CPV A;  3ZNI A;  2ISD A;  2OTG B;  1CLM A;  3UNW A;  3O4X A;  2HQ8 A;  3I5H C;  1IQ5 A;  5TNC A;  3I5G B;  2WCF A;  3KPX A;  3SG6 A;  4BY4 A;  1KQV A;  1JWD A;  1FBV A;  3SS3 A;  2WCB A;  2QEH A;  1UP5 A;  4PHN A;  1M45 A;  2NXQ A;  5HLV A;  2GGM A;  3CAB A;  1OZO A;  1QXP A;  3GOF A;  4PE4 A;  1GM0 A;  1IWQ A;  4PHK A;  1JC2 A;  1CM4 A;  2KAV A;  2MRD A;  2WCH A;  3SG5 A;  1CFP A;  2NZ0 A;  2K7C A;  2R2I A;  1J1E A;  2ZN8 A;  5IBW A;  4MZJ A;  3RLZ A;  1JFJ A;  5AFP A;  1SY9 A;  1OOF A;  1UHK A;  3L47 A;  2PAS A;  1QJT A;  4JWQ A;  2E30 A;  3WHU B;  1GJY A;  2EC6 B;  2LLS A;  1XK4 C;  2KI6 D;  2M3W A;  4PAL A;  1W9Z A;  5GQQ C;  1SL8 A;  1NX3 A;  5I2O A;  1XFY O;  1CFD A;  1DGV A;  1MQ1 A;  3K1E A;  3VRP A;  2KAX A;  1AHR A;  4OCI A;  1YTZ C;  1PUL A;  2I18 A;  2WCJ A;  1NUB A;  3LK0 A;  1QV0 A;  3EKJ A;  3TDZ A;  4ORC B;  3D10 A;  4MN0 A;  3BFA A;  2ZN9 A;  3IVT A;  3SG2 A;  4FTG A;  1YR5 A;  1OOH A;  5DKQ A;  1KK8 C;  2WND A;  3I5F C;  3JTD B;  1FI5 A;  3TS5 B;  1SMG A;  3DVK A;  1J1D A;  1OMD A;  1Y1U A;  1RFJ A;  3O2P A;  1IKU A;  2ZNE A;  5CSN A;  1XVJ A;  5K89 A;  2L5Y A;  2ZRT A;  3AAK A;  3FE9 A;  3OGN A;  4WRI A;  4E68 A;  1CDP A;  3I5I B;  3R1V A;  2F2P A;  2OS8 B;  2I94 A;  1KCY A;  1BLQ A;  3L4A A;  4GNK B;  4QJ3 B;  5KU1 A;  3S0F A;  1QX5 B;  1K9K A;  4MSP A;  2L2C A;  4MRY A;  3E3R A;  1B47 A;  5AER A;  2O60 A;  3S0G A;  5CSF A;  4YI9 A;  3DVJ A;  1WDC C;  1F70 A;  4CFQ A;  1S1E A;  1AJ4 A;  2OTG C;  2JTZ A;  2E6W A;  2BKH B;  2BE4 A;  3O6B A;  2L2E A;  3PFV A;  4P2Y B;  2PVB A;  2CT9 A;  2LLT A;  1MWN A;  3FWB A;  1PSR A;  3OBV A;  5AAN A;  4A4C A;  2JT3 A;  3NSK A;  4GGN A;  3B86 A;  2KBM A;  5HKY A;  3FE6 A;  2P71 A;  3AKB A;  2BCB A;  2M9G A;  4OKH A;  3VRQ A;  1LVC D;  4I5N B;  2ZFD A;  1CMG A;  3HCM A;  2LVJ A;  2WCM A;  1J7O A;  2BKI B;  1CDM A;  4BY5 A;  1DMO A;  1UUR A;  1UUS A;  2K2A A;  3CR2 A;  5CPV A;  1S6C A;  1TNX A;  1K2H A;  3EK8 A;  2K0J A;  2L50 A;  4MRX A;  1YUS A;  4ORA B;  1B8C A;  2K7B A;  3BYA A;  2MLF C;  3PSR A;  1DQE A;  1JF0 A;  1NWD A;  2ZRS A;  2JT8 A;  3S0A A;  3D76 A;  1BF5 A;  4GGF C;  2KI4 B;  2O5G A;  2P6B B;  2PQL A;  4WQ3 A;  3GK1 A;  3EVR A;  1A75 A;  1EG4 A;  3RZS A;  3EK4 A;  1CM1 A;  1GQM A;  1MR8 A;  4YGE B;  1J7P A;  1OMR A;  1DVI A;  1PAL A;  2COL B;  1AUI B;  4KYN A;  4DIR A;  4USL A;  1OQP A;  4ORB B;  2JOJ A;  1BT6 A;  4L9M A;  3D77 A;  5KTY A;  2PSR A;  1LA0 A;  3O4Y A;  5ER4 X;  1KFX L;  1NIW A;  2PRU A;  3TS5 C;  2KQ6 A;  4CID A;  1K93 D;  1WY9 A;  2LHI A;  1TWO A;  2BCA A;  5I2Q A;  1DJZ A;  1JF2 A;  2JTT A;  4XJK A;  1W7J B;  1L7Z A;  1KWO C;  1NX0 A;  2LM5 A;  3EKH A;  3OX5 A;  2YGU A;  1EJ3 A;  4PDZ A;  2HF5 A;  1WRL A;  3S0D A;  4ZCV A;  1DJG A;  1QWV A;  2KQY A;  3FIA A;  1KK8 B;  1LS8 A;  3I5F B;  1IH0 A;  1ALW A;  1JBA A;  1KQM C;  2EGD A;  1ZFS A;  1OE9 B;  2JPO A;  1K9P A;  5D69 A;  1IJ6 A;  1GGW A;  4M2P A;  2KGR A;  2IS9 A;  1UHI A;  1B4C A;  4M2Q A;  1SL7 A;  2K8M B;  4YGB B;  1M31 A;  1J7Q A;  3QRX A;  3LK1 A;  3DF0 B;  1NCY A;  1WDC B;  1XFZ O;  3L4L A;  2D8N A;  1NCX A;  2LVK A;  2ZND A;  3NSI A;  1REC A;  2OPO A;  1KK7 Y;  1YUR A;  2M7N A;  1A29 A;  3BUM B;  3V2L A;  3BJH A;  3R1P A;  1UWO A;  3JVT C;  3RM1 A;  1IIO A;  4ETO A;  1C7V A;  1DF0 A;  4N1G A;  1BU3 A;  4PE1 A;  2G9B A;  2KI4 C;  3R1O A;  1UHJ A;  1A4P A;  4HSZ A;  3EK7 A;  2FJU B;  1KSO A;  1QAS A;  4MVF A;  2I7A A;  1DJX A;  3DZT A;  3NSL A;  4TNC A;  1S36 A;  2LVI A;  5AEQ A;  4AQI A;  4JKT A;  2JNX A;  3BUX B;  4MZL A;  2JQ6 A;  3VGO A;  2Y1M A;  2JUL A;  2AMI A;  3D78 A;  1TN4 A;  4PE0 A;  3SIB A;  2LVV A;  2LE9 B;  2KGB C;  3KO0 A;  3KHE A;  4INX A;  1IJ5 A;  1XFU O;  1G8I A;  1U5I B;  2BEC A;  1BG1 A;  2L0P A;  2L4H A;  3PN7 B;  4YRU A;  1A03 A;  1TTX A;  1DJW A;  2KYC A;  2H8V A;  1ZUZ A;  4FQT A;  2KSP A;  2BL0 B;  5FYX A;  4OZD A;  2K2F A;  2LC5 A;  3BUO B;  3KEV A;  3B88 A;  3WNX B;  1IGV A;  1UHN A;  1NX2 A;  1PSB A;  2MAZ A;  1C7W A;  1TCF A;  1KWO B;  3CGA A;  3TDU A;  4YI8 A;  3AAJ A;  1Q80 A;  1XK4 A;  2LV7 A;  1Y6W A;  2QEV A;  1SR6 B;  3D0Y B;  4F7F A;  2LMV A;  2SCP A;  4NDD A;  4OR9 B;  1DJH A;  1N0Y A;  4DCK A;  3VRN A;  1F55 A;  1KQM B;  4NDC A;  3CTN A;  1WLM A;  5B8I B;  5KSZ A;  2Q91 A;  4QJ4 B;  1EG3 A;  1SSE B;  4FQO A;  1AP4 A;  1FW4 A;  1SK6 D;  1YX7 A;  3CS1 A;  1G4Y R;  3IQO A;  5HKZ A;  4P5O E;  1QVI Z;  5I2L A;  1J7R A;  2CXJ A;  2PAL A;  3VB1 A;  1BJF A;  3SG3 A;  5JOL A;  1BR4 B;  1ORG A;  1QIV A;  2M1U A;  1XYD A;  3CZ0 A;  2BE6 A;  4GUK A;  2MJW B;  2L51 A;  3K21 A;  1NYA A;  4HRE E;  1TNP A;  1P28 A;  2LAN A;  4IL1 A;  2A4J A;  3DVE A;  3SG4 A;  2JU0 A;  3GK4 X;  4NDB A;  3JVT B;  1QLS A;  1YX8 A;  3R72 A;  1E8A A;  4I5J A;  3ICB A;  4ICB A;  4U8D A;  3TDI A;  3LCP C;  1IRJ A;  1SBJ A;  3OHM B;  1SCM B;  2GGZ A;  1KFU L;  2K60 A;  2KI6 C;  3PJI A;  1CB1 A;  2K7D A;  1HT9 A;  1QIW A;  4JPZ B;  2K61 A;  1Z2C B;  1SL9 A;  2LHL A;  3PLF B;  2BBN A;  1TUJ A;  2Y1N A;  3FWC A;  1WRZ A;  2GV5 A;  2H61 C;  3A4U B;  3ZWH A;  1YRT B;  3DYE A;  3PN7 C;  2K7O A;  1K90 D;  4UPG A;  1CMF A;  2BL0 C;  3CLN A;  1PRW A;  2LP2 A;  1OOG A;  2PYQ A;  3F45 A;  2WOR A;  3CYZ A;  4I5K A;  5CSJ A;  2LNK A;  1C3Y A;  3B87 A;  1QV1 A;  1XO5 A;  1X02 A;  3SS4 A;  4AOM A;  2ZKM X;  1OMV A;  1K96 A;  1SR6 C;  2M97 A;  2SAS A;  2WOS A;  3D74 A;  1YRU B;  4GGF A;  1TOP A;  4I5L B;  1CKK A;  4HRG A;  1F8H A;  2CNP A;  1PVA A;  4M2O A;  4MEW A;  2JXL A;  4JQ0 D;  2KAY A;  2QPT A;  1ZOT B;  3WHT B;  1H8B A;  3B6X A;  2WCL A;  1B7T Z;  1JFK A;  4NQG A;  4MZK A;  1BMO A;  2JXC A;  1SRA A;  3BOW B;  1JUO A;  3VRR A;  2LCP A;  3CZT X;  4C0J A;  5FI7 A;  1SKT A;  2EHB A;  3SS5 A;  1LIN A;  1RTP 1;  1Y1A A;  1K94 A;  1K9U A;  1WRK A;  5D7F A;  4C0K A;  1QX2 A;  5HYD A;  2KNE A;  3EG5 B;  5PAL A;  1AK8 A;  4GAO A;  4PT1 A;  3S0E A;  1B9A A;  1M63 B;  1OOI X;  1S6I A;  2MHH A;  2WC5 A;  3AKA A;  1H4B A;  3H4S E;  1DTL A;  2QEB A;  1VRK A;  2RGI A;  4GBA A;  1F54 A;  1S3P A;  2TN4 A;  1OZS A;  1JSA A;  1B1G A;  2BNX A;  4PCW A;  1LKJ A;  3NHT A;  2Y4Q A;  2JRF A;  1F71 A;  3KF9 A;  4MLW A;  1AVS A;  1SCM C;  2LUX A;  1BOC A;  1FPW A;  4Q04 A;  1RJV A;  2FOT A;  3FE8 A;  3OB1 B;  1LA3 A;  3VRO A;  2MA2 A;  3LL8 B;  1CDL A;  1NX1 A;  3CWG A;  1MF8 B;  4GPL B;  1DEL A;  1S26 D;  2I2R E;  3QME A;  1FI6 A;  2KLD A;  3BQ3 A;  1TRF A;  3M0W A;  2AUC A;  1ALV A;  1EXR A;  1T14 A;  2HET A;  3OX6 A;  3C1V A;  2AAO A;  2M7L A;  4OV2 A;  4PHM A;  2M1K B;  3FS7 A;  2MLE C;  1A75 B;  1QTX A;  3PM2 A;  5HKW A;  1KFU S;  5HL1 A;  3CR4 X;  1G33 A;  3WXA A;  1C3Z A;  3SJS A;  1UHH A;  1SPY A;  2F2O A;  3A8R A;  1DGU A;  2P70 A;  2QAC A;  2H2K A;  2JWW A;  3SG7 A;  4CLN A;  1F4O A;  4ZCU A;  1R6P A;  2CCM A;  3TUY C;  3S0B A;  3BUW B;  1NPQ A;  4XJK B;  1ZAC A;  2M0R A;  2Q4U A;  1KFX S;  2BAP A;  3PAT A;  4XYN A;  4D1E A;  5FI2 A;  3B7A A;  1DJY A;  1IG5 A;  2JZI A;  3CR5 X;  1OSA A;  3EVU A;  2PMY A;  1QAT A;  3HX4 A;  4YGA A;  1CFC A;  3BFB A;  4N5X A;  1S6J A;  4F0Z B;  2KHN A;  4YGC B;  2G2B A;  5D3O A;  2QEO A;  2M8U A;  1IQ3 A;  1XFV O;  1TNW A;  2WCE A;  5FI6 A;  1PVB A;  2JC2 A;  1CLB A;  1F4Q A;  3NGV A;  1Z4H A;  1YVL A;  4OVN F;  3D73 A;  2L98 A;  3PAL A;  1B8R A;  2M29 A;  3TZ1 A;  4WQ2 A;  1HQV A;  1RK9 A;  2V53 A;  3DD4 A;  2L4I A;  1PK0 D;  3MSE B;  3OP0 A;  3DY9 A;  1ZMZ A;  2JPT A;  5ER5 A;  3Q8I A;  1M46 A;  5G08 A;  1L2O B;  4DUQ A;  4YBH B;  2KPH A;  2NCP A;  3BOW A; 
#chains in the Genus database with same CATH homology
 1DT7 B;  3EVV A;  2CBL A;  2CTN A;  2MBX A;  3OB2 B;  2KYF A;  1DJI A;  1XFX O;  1GGZ A;  1DF0 B;  1MUX A;  3BUN B;  1SNL A;  2LP3 A;  1M39 A;  3DF0 A;  1WLZ A;  4YGD B;  1TCO B;  1K95 A;  1A2X A;  1V1F A;  1FF1 A;  1QVI Y;  3I5G C;  2NLN A;  1ODB A;  1MXL C;  4CFR A;  1XA5 A;  2FCD A;  1BR1 B;  1B8L A;  1OOJ A;  2KBI A;  2BCX A;  1D1O A;  1Y1X A;  2DOQ A;  2HPS A;  1CDN A;  1QS7 A;  5I8N A;  3I5H B;  2F3Y A;  1TNQ A;  2KDH A;  4PE7 A;  1BOD A;  1N65 A;  4PHJ A;  1S5G Z;  3SIA A;  2LUC A;  5JJG A;  1MXE A;  5AXI A;  5HLO A;  2EC6 C;  4A4B A;  3IF7 A;  2NCO A;  5J3X A;  1J55 A;  3GK2 A;  1MHO A;  3NXA A;  2WC8 A;  1SYM A;  1QLK A;  4AQJ A;  1TIZ A;  1QX7 A;  1RRO A;  3TUY B;  1CNP A;  1YVH A;  5DKN A;  4R1E A;  3NSO A;  1R2U A;  2H61 A;  1U5I A;  1C07 A;  2KFF A;  2VRG A;  3O78 A;  5F6T A;  3JTD C;  1NCZ A;  1NSH A;  2JT0 A;  4QJ5 B;  1S5G Y;  1V1G A;  1W7I B;  2B1U A;  2LMT A;  2KOT A;  2KFG A;  2F8P A;  2JNF A;  1EL4 A;  3BXK A;  2HQW A;  2F33 A;  3IQQ A;  2LMU A;  1L2O C;  4HRH A;  3I5I C;  2LLU A;  2F3Z A;  2M49 B;  2OS8 C;  1NP8 A;  2LAP A;  4N1F A;  3D0Y A;  4DS7 A;  1YUU A;  1CLL A;  3PM8 A;  1B7T Y;  4GFT A;  5CSI A;  3DVM A;  1SCV A;  1KK7 Z;  4MBE A;  1EH2 A;  1Y0V H;  1N2D A;  2FCE A;  1CFF A;  4DRW A;  5BPJ A;  1KSM A;  1LXF C;  1K8U A;  2Y5I A;  2KFH A;  1CTR A;  4C0L A;  3LLE A;  5DKR A;  1SW8 A;  2BBM A;  2L5X B;  1XFW O;  1YUT A;  1AJ5 A;  1RWY A;  4CPV A;  3ZNI A;  2ISD A;  2OTG B;  1CLM A;  2HQ8 A;  3I5H C;  1IQ5 A;  5TNC A;  3I5G B;  2WCF A;  3KPX A;  3SG6 A;  4BY4 A;  1KQV A;  1JWD A;  1FBV A;  2WCB A;  1UP5 A;  4PHN A;  1M45 A;  2NXQ A;  5HLV A;  2GGM A;  3GOF A;  1OZO A;  1QXP A;  4PE4 A;  1IWQ A;  4PHK A;  1JC2 A;  1CM4 A;  2KAV A;  2MRD A;  3SG5 A;  1CFP A;  2NZ0 A;  2K7C A;  2R2I A;  1J1E A;  2ZN8 A;  5IBW A;  4MZJ A;  3RLZ A;  1JFJ A;  5AFP A;  1SY9 A;  1UHK A;  2PAS A;  1QJT A;  4JWQ A;  2E30 A;  3WHU B;  1GJY A;  2EC6 B;  2LLS A;  1XK4 C;  2KI6 D;  2M3W A;  4PAL A;  5GQQ C;  1SL8 A;  1NX3 A;  5I2O A;  1XFY O;  1CFD A;  1DGV A;  1MQ1 A;  3VRP A;  2KAX A;  1AHR A;  4OCI A;  1YTZ C;  1PUL A;  2I18 A;  3LK0 A;  1NUB A;  1QV0 A;  3EKJ A;  3TDZ A;  4ORC B;  3D10 A;  4MN0 A;  2ZN9 A;  3SG2 A;  4FTG A;  1YR5 A;  5DKQ A;  1KK8 C;  2WND A;  3I5F C;  3JTD B;  1FI5 A;  3TS5 B;  1SMG A;  3DVK A;  1J1D A;  1OMD A;  1Y1U A;  1RFJ A;  3O2P A;  1IKU A;  2ZNE A;  5CSN A;  1XVJ A;  5K89 A;  3AAK A;  2ZRT A;  4WRI A;  4E68 A;  1CDP A;  3I5I B;  2F2P A;  2OS8 B;  2I94 A;  1KCY A;  1BLQ A;  4GNK B;  5KU1 A;  4QJ3 B;  1QX5 B;  1K9K A;  4MSP A;  4MRY A;  3E3R A;  1B47 A;  5AER A;  2O60 A;  5CSF A;  4YI9 A;  3DVJ A;  1WDC C;  1F70 A;  4CFQ A;  1S1E A;  1AJ4 A;  2OTG C;  2JTZ A;  2E6W A;  2BKH B;  2BE4 A;  3O6B A;  2L2E A;  3PFV A;  4P2Y B;  2PVB A;  2CT9 A;  2LLT A;  1MWN A;  3FWB A;  1PSR A;  5AAN A;  4A4C A;  2JT3 A;  3NSK A;  4GGN A;  2KBM A;  5HKY A;  4OKH A;  3AKB A;  2BCB A;  2M9G A;  3VRQ A;  1LVC D;  4I5N B;  2ZFD A;  1CMG A;  3HCM A;  2LVJ A;  1J7O A;  2BKI B;  1CDM A;  4BY5 A;  1DMO A;  1UUR A;  1UUS A;  2K2A A;  3CR2 A;  5CPV A;  1S6C A;  1TNX A;  1K2H A;  3EK8 A;  2K0J A;  2L50 A;  4MRX A;  1YUS A;  4ORA B;  1B8C A;  2K7B A;  3BYA A;  2MLF C;  3PSR A;  1JF0 A;  1NWD A;  2ZRS A;  2JT8 A;  1BF5 A;  4GGF C;  2KI4 B;  2O5G A;  2P6B B;  4WQ3 A;  3GK1 A;  3EVR A;  1A75 A;  1EG4 A;  3EK4 A;  1CM1 A;  1GQM A;  1MR8 A;  4YGE B;  1J7P A;  1OMR A;  1DVI A;  1PAL A;  2COL B;  1AUI B;  4DIR A;  4USL A;  1OQP A;  4ORB B;  2JOJ A;  1BT6 A;  4L9M A;  5KTY A;  2PSR A;  1LA0 A;  3O4Y A;  5ER4 X;  1KFX L;  1NIW A;  2PRU A;  3TS5 C;  2KQ6 A;  4CID A;  1K93 D;  1WY9 A;  2LHI A;  5I2Q A;  2BCA A;  1DJZ A;  1JF2 A;  2JTT A;  4XJK A;  1W7J B;  1L7Z A;  1KWO C;  1NX0 A;  2LM5 A;  3EKH A;  3OX5 A;  1EJ3 A;  4PDZ A;  2HF5 A;  1WRL A;  4ZCV A;  1DJG A;  2KQY A;  3FIA A;  1KK8 B;  3I5F B;  1IH0 A;  1ALW A;  1JBA A;  1KQM C;  2EGD A;  1ZFS A;  1OE9 B;  1K9P A;  5D69 A;  1IJ6 A;  1GGW A;  4M2P A;  2KGR A;  2IS9 A;  1UHI A;  1B4C A;  4M2Q A;  1SL7 A;  2K8M B;  4YGB B;  1M31 A;  1J7Q A;  3QRX A;  3LK1 A;  3DF0 B;  1NCY A;  1WDC B;  1XFZ O;  2D8N A;  1NCX A;  2LVK A;  2ZND A;  3NSI A;  1REC A;  2OPO A;  1KK7 Y;  1YUR A;  2M7N A;  1A29 A;  3BUM B;  1UWO A;  3JVT C;  3RM1 A;  4ETO A;  1C7V A;  1DF0 A;  4N1G A;  1BU3 A;  4PE1 A;  2G9B A;  2KI4 C;  1UHJ A;  1A4P A;  4HSZ A;  3EK7 A;  2FJU B;  1KSO A;  1QAS A;  4MVF A;  2I7A A;  1DJX A;  3NSL A;  4TNC A;  4AQI A;  1S36 A;  2LVI A;  5AEQ A;  2JNX A;  3BUX B;  4MZL A;  2JQ6 A;  3VGO A;  2Y1M A;  2JUL A;  2AMI A;  1TN4 A;  4PE0 A;  3SIB A;  2LVV A;  2LE9 B;  2KGB C;  3KO0 A;  3KHE A;  1IJ5 A;  1XFU O;  1G8I A;  1U5I B;  2BEC A;  1BG1 A;  2L0P A;  2L4H A;  3PN7 B;  4YRU A;  1A03 A;  1TTX A;  1DJW A;  2KYC A;  1ZUZ A;  2KSP A;  2BL0 B;  5FYX A;  2K2F A;  2LC5 A;  3BUO B;  3KEV A;  3WNX B;  1IGV A;  1UHN A;  1NX2 A;  1PSB A;  2MAZ A;  1C7W A;  1TCF A;  1KWO B;  3CGA A;  3TDU A;  4YI8 A;  3AAJ A;  1Q80 A;  1XK4 A;  2LV7 A;  1Y6W A;  1SR6 B;  3D0Y B;  2LMV A;  2SCP A;  4NDD A;  4OR9 B;  1DJH A;  1N0Y A;  4DCK A;  3VRN A;  1F55 A;  1KQM B;  4NDC A;  3CTN A;  1WLM A;  5B8I B;  5KSZ A;  2Q91 A;  4QJ4 B;  1EG3 A;  4FQO A;  1AP4 A;  1FW4 A;  1SK6 D;  1YX7 A;  3CS1 A;  1G4Y R;  3IQO A;  5HKZ A;  4P5O E;  1QVI Z;  5I2L A;  1J7R A;  2CXJ A;  2PAL A;  1BJF A;  3SG3 A;  5JOL A;  1BR4 B;  1QIV A;  2M1U A;  1XYD A;  2BE6 A;  4GUK A;  2MJW B;  2L51 A;  3K21 A;  1NYA A;  4HRE E;  1TNP A;  4IL1 A;  2LAN A;  2A4J A;  3DVE A;  3SG4 A;  2JU0 A;  3GK4 X;  4NDB A;  3JVT B;  1QLS A;  1YX8 A;  4I5J A;  1E8A A;  4ICB A;  3ICB A;  4U8D A;  3TDI A;  3LCP C;  1IRJ A;  1SBJ A;  3OHM B;  1SCM B;  2GGZ A;  1KFU L;  2KI6 C;  1CB1 A;  2K7D A;  1HT9 A;  1QIW A;  4JPZ B;  2K61 A;  1SL9 A;  2LHL A;  3PLF B;  2BBN A;  2Y1N A;  3FWC A;  1WRZ A;  2GV5 A;  2H61 C;  3A4U B;  3ZWH A;  1YRT B;  3PN7 C;  2K7O A;  1K90 D;  4UPG A;  1CMF A;  2BL0 C;  3CLN A;  1PRW A;  2LP2 A;  3F45 A;  2WOR A;  4I5K A;  5CSJ A;  2LNK A;  1QV1 A;  1XO5 A;  1X02 A;  4AOM A;  2ZKM X;  1OMV A;  1K96 A;  1SR6 C;  2M97 A;  2SAS A;  2WOS A;  1YRU B;  4GGF A;  1TOP A;  4I5L B;  1CKK A;  4HRG A;  1F8H A;  2CNP A;  1PVA A;  4M2O A;  4MEW A;  2JXL A;  4JQ0 D;  2KAY A;  2QPT A;  1ZOT B;  3WHT B;  1H8B A;  1B7T Z;  1JFK A;  4NQG A;  4MZK A;  1BMO A;  2JXC A;  1SRA A;  3BOW B;  1JUO A;  3VRR A;  2LCP A;  3CZT X;  4C0J A;  1SKT A;  2EHB A;  1LIN A;  1RTP 1;  1Y1A A;  1K94 A;  1K9U A;  1WRK A;  5D7F A;  4C0K A;  1QX2 A;  5HYD A;  2KNE A;  1AK8 A;  5PAL A;  4GAO A;  1B9A A;  1M63 B;  1S6I A;  2MHH A;  3AKA A;  1H4B A;  3H4S E;  1DTL A;  1VRK A;  2RGI A;  4GBA A;  1F54 A;  1S3P A;  2TN4 A;  1OZS A;  1JSA A;  1B1G A;  4PCW A;  1LKJ A;  2Y4Q A;  2JRF A;  1F71 A;  3KF9 A;  4MLW A;  1AVS A;  1SCM C;  2LUX A;  1BOC A;  1FPW A;  4Q04 A;  1RJV A;  2FOT A;  3OB1 B;  1LA3 A;  3VRO A;  2MA2 A;  3LL8 B;  1CDL A;  1NX1 A;  3CWG A;  1MF8 B;  4GPL B;  1S26 D;  2I2R E;  1FI6 A;  3BQ3 A;  1TRF A;  3M0W A;  2AUC A;  1ALV A;  1EXR A;  2HET A;  3OX6 A;  3C1V A;  2AAO A;  2M7L A;  4OV2 A;  4PHM A;  2M1K B;  3FS7 A;  2MLE C;  1A75 B;  1QTX A;  5HKW A;  1KFU S;  3CR4 X;  1G33 A;  3WXA A;  3SJS A;  1UHH A;  1SPY A;  2F2O A;  3A8R A;  1DGU A;  2QAC A;  2H2K A;  2JWW A;  3SG7 A;  4CLN A;  1F4O A;  4ZCU A;  1R6P A;  2CCM A;  3TUY C;  3BUW B;  1NPQ A;  4XJK B;  1ZAC A;  2Q4U A;  1KFX S;  3PAT A;  4D1E A;  4XYN A;  1DJY A;  1IG5 A;  2JZI A;  3CR5 X;  1OSA A;  3EVU A;  2PMY A;  1QAT A;  3HX4 A;  4YGA A;  1CFC A;  4N5X A;  1S6J A;  4F0Z B;  2KHN A;  4YGC B;  2G2B A;  2M8U A;  1IQ3 A;  1XFV O;  1TNW A;  2WCE A;  1PVB A;  2JC2 A;  1CLB A;  1F4Q A;  1YVL A;  4OVN F;  3PAL A;  2L98 A;  1B8R A;  2M29 A;  3TZ1 A;  4WQ2 A;  1HQV A;  1RK9 A;  2V53 A;  3DD4 A;  2L4I A;  1PK0 D;  3MSE B;  3OP0 A;  1ZMZ A;  2JPT A;  5ER5 A;  5G08 A;  1M46 A;  1L2O B;  4DUQ A;  4YBH B;  2M0R A;  2NCP A;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...