2GGMA

Human centrin 2 xeroderma pigmentosum group c protein complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin-2
publication title The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggmA02
1IRJA 2AMIA 1G8IA 3HX4A 2F3ZA 2F8PA 1A2XA 1PRWA 2KI4C 2BCXA 1V1GA 2MRDA 4YI9A 2KQ6A 2LLSA 5AERA 1TNPA 1CNPA 1E8AA 5AANA 1FI5A 3K21A 1TCOB 2I7AA 5F6TA 1OMVA 3I5IB 1K9PA 2BKIB 1BR1B 2A4JA 2HQ8A 3BUWB 3OP0A 1QVIZ 4MRYA 4PE4A 4GGFA 1ZFSA 1BODA 3VRQA 2JXLA 4D1EA 1B8CA 2NXQA 1J1EA 1YR5A 2F3YA 2KYCA 1K94A 2PASA 3SIAA 1K96A 3CR5X 4GGNA 3JVTB 2HPSA 3OHMB 2PMYA 3RM1A 2F33A 4DUQA 2JTTA 2BE4A 2ZRSA 2MLFC 1YVHA 4XJKA 5JOLA 2JQ6A 2ZRTA 4NDBA 4HRGA 1CB1A 1SKTA 1MWNA 2LUCA 1SCMC 3GOFA 2M97A 2JNFA 2L2EA 1XYDA 1JWDA 1F8HA 4OR9B 2FCEA 4MN0A 3AKBA 3SG2A 1M63B 1EXRA 1UWOA 1M46A 1CLMA 1YUSA 3DVJA 5HKYA 4NQGA 1UUSA 1XO5A 3SG3A 1PSRA 2NZ0A 1SYMA 1NX0A 1D1OA 4MLWA 1S6JA 1QXPA 2LANA 3LLEA 1XK4C 3VRPA 2SCPA 1CFDA 2JPTA 2PALA 1CDMA 5CSIA 3KF9A 3TDZA 1CTRA 2CT9A 2H61C 3O2PA 1R2UA 3BYAA 2ZN9A 1WDCC 2BBMA 1EG3A 3FWCA 4MEWA 4ETOA 5HLVA 5CSFA 1JUOA 1QIVA 2M7LA 1IKUA 1AJ5A 3PATA 1MR8A 2LE9B 2SASA 1BLQA 1KQMC 1F70A 2JNXA 1SL9A 1XK4A 4QJ5B 1MHOA 4CPVA 1KSOA 1YTZC 3I5HB 3BOWA 1TNQA 2K7DA 2OS8C 2LMUA 1CFFA 2H61A 1RK9A 2WCBA 3BUXB 4R1EA 3H4SE 4MVFA 2GV5A 1F55A 2F2OA 4N1FA 5KU1A 2M8UA 4YGDB 1B7TZ 2JTZA 3SIBA 3F45A 1XA5A 2LAPA 3PM8A 4PCWA 3BOWB 2K8MB 2M1KB 4MRXA 1KK7Z 4MBEA 4PHMA 1SCVA 1GGWA 1WDCB 1PSBA 3KO0A 1WY9A 2VRGA 1H4BA 3GK1A 2Q4UA 1A03A 1C7WA 1KSMA 1TIZA 1UHIA 2DOQA 2L51A 2JZIA 1LA0A 3EK4A 2LVJA 1RJVA 2OPOA 1XFXO 3OB2B 1YRTB 3CR2A 1FI6A 1OZSA 3EKHA 4DRWA 4A4CA 1S3PA 2ZFDA 1BR4B 2M1UA 1IGVA 3FS7A 1OE9B 4PE0A 2ZNEA 2OS8B 2R2IA 1S6IA 1NP8A 2JT0A 2K7BA 1YVLA 3EKJA 3O78A 1WLMA 2PSRA 4GBAA 1B4CA 1SY9A 5AEQA 3TDIA 3TZ1A 3PN7C 3JTDC 1JBAA 4GNKB 1M31A 2NCPA 4DCKA 1F71A 2G2BA 2O60A 1Y6WA 1QTXA 1DJYA 1SNLA 1EG4A 1WRKA 1IJ5A 1KK7Y 2K0JA 2LHIA 1NCYA 1UHJA 3AKAA 1XFYO 1YRUB 2LHLA 2HETA 3CTNA 1B47A 1QIWA 1DJXA 1TOPA 4YGEB 1Y1XA 1C07A 1B9AA 2K2FA 4M2QA 1G33A 1SW8A 4U8DA 1FBVA 1Y1AA 2JU0A 3BUMB 3OX5A 2L50A 1JF2A 2FCDA 4PHNA 4ORCB 5DKRA 1GQMA 2WOSA 1QLSA 2G9BA 1TNWA 3PSRA 4GPLB 5D7FA 2KAYA 1MXLC 3LK0A 3SG5A 1AK8A 1ZMZA 3JTDB 2CTNA 1UHHA 2JT3A 1K95A 1S36A 1FW4A 1RFJA 2QACA 4YRUA 2IS9A 1OMRA 2K61A 1F4OA 4JPZB 1EH2A 3EVRA 3CZTX 4ICBA 3ZWHA 3CS1A 4GUKA 3LK1A 3CWGA 2CCMA 2OTGB 2L4HA 1S6CA 1CKKA 1S26D 2ZN8A 1IWQA 1XFVO 1DJHA 1TRFA 2LVKA 1DT7B 1FF1A 1YX7A 2LM5A 2KI4B 2KGBC 2KBIA 3KHEA 1QX5B 4HRHA 2K2AA 3FWBA 1CFCA 1AHRA 1PVBA 3DVKA 2I94A 1Y0VH 1HQVA 1MXEA 1OZOA 1TN4A 1KK8C 1K90D 3BQ3A 3CLNA 4UPGA 4XJKB 4YGBB 3LL8B 3HCMA 3IQOA 2E6WA 1CDLA 2K7OA 2ZKMX 2BL0C 2MJWB 2O5GA 1AVSA 3SG7A 5KTYA 3LCPC 1WRZA 4L9MA 2KGRA 1LINA 4CLNA 5HLOA 1DF0A 1BOCA 1CM1A 1RROA 1JFJA 1QS7A 2WORA 4PALA 1NYAA 1OMDA 2KFFA 1NCZA 3ZNIA 1CFPA 1MF8B 2EHBA 3D0YA 1S1EA 1FPWA 1QLKA 4N1GA 1DF0B 5KSZA 2F2PA 1SCMB 1KQVA 2Y5IA 1NCXA 1SPYA 1QX7A 5DKNA 2M49B 3OB1B 2BKHB 3DD4A 3NSIA 1KFXS 1ODBA 3D0YB 4C0JA 1W7IB 3KEVA 4FTGA 1NUBA 2JT8A 2TN4A 1QV1A 4YGCB 2LMVA 4ZCUA 1CMGA 1QATA 1SL7A 5CPVA 1UURA 4OVNF 3VRNA 2CNPA 4YGAA 3VROA 2M3WA 1SL8A 1NPQA 1DGVA 5ER4X 2L0PA 2L5XB 1A29A 2JOJA 4MSPA 1EJ3A 3GK4X 4YBHB 1J7RA 1DJWA 1BF5A 1DVIA 1PVAA 2PRUA 3DVEA 1X02A 2JRFA 1ZOTB 1QASA 1J7PA 3EVVA 2K7CA 1YURA 4OKHA 1KQMB 1XFUO 1A4PA 1KCYA 2EGDA 2KI6D 2KBMA 2KOTA 2LVVA 3A4UB 2FJUB 4PHJA 3AAJA 4CFQA 2KI6C 1KFUS 3IF7A 1VRKA 2EC6C 1L2OC 1SBJA 3O6BA 1NX3A 2QPTA 2HQWA 1GGZA 3NSOA 2I18A 2LNKA 1CLLA 1UHNA 1GJYA 2V53A 4C0LA 2KSPA 1NIWA 1PULA 1Q80A 2M29A 1YUUA 3EK8A 1JSAA 4HREE 2KDHA 3VRRA 2KFGA 1DMOA 2KQYA 2PVBA 1J7OA 2BECA 1M45A 5BPJA 5D69A 2NCOA 1NSHA 4I5LB 1NX2A 1CM4A 1QV0A 1V1FA 4XYNA 5FYXA 1WRLA 2L98A 1RECA 1J1DA 4AOMA 2B1UA 3NXAA 4GAOA 1L7ZA 2KYFA 1L2OB 3PN7B 4I5KA 3DF0A 1K93D 3NSKA 1JC2A 4Q04A 2M9GA 1YX8A 4CFRA 5HKZA 1DTLA 1QJTA 3GK2A 2WC8A 1N65A 2JXCA 1IQ3A 5DKQA 2Q91A 1SK6D 3CGAA 1IH0A 2COLB 2WNDA 4QJ3B 1CDNA 1K9UA 1K9KA 3DF0B 2BCAA 4AQIA 3EK7A 5AXIA 5CSNA 1PALA 1ALWA 1R6PA 1F4QA 4WRIA 1AJ4A 1IG5A 3KPXA 2LUXA 1XFWO 3I5GC 1SR6C 4MZKA 5PALA 1ZUZA 1KWOC 2LLTA 1EL4A 2D8NA 2MHHA 1BG1A 4BY4A 2MAZA 3BUOB 1OQPA 2CBLA 5HYDA 1DGUA 2Y4QA 4OV2A 4IL1A 4ORBB 5G08A 1LXFC 2LP3A 4QJ4B 4M2PA 3SJSA 4CIDA 2HF5A 3D10A 2JULA 3OX6A 4WQ3A 1K8UA 1TTXA 1IQ5A 3EVUA 1KFXL 1RTP1 2FOTA 1PK0D 1BMOA 1J7QA 1JFKA 2BBNA 1W7JB 4OCIA 1XVJA 1QX2A 2Y1NA 1ALVA 1BU3A 3I5GB 5CSJA 5GQQC 3I5FC 3PFVA 1NX1A 1SMGA 2MLEC 1SR6B 4M2OA 2MA2A 3M0WA 1N0YA 1S5GZ 2JWWA 2BE6A 2Y1MA 5I2QA 3MSEB 1DJGA 1KWOB 3I5HC 1G4YR 4TNCA 4P2YB 4YI8A 1QVIY 1KK8B 5HKWA 2L4IA 4NDCA 3ICBA 1ZACA 2E30A 1Y1UA 2AUCA 4MZJA 5K89A 2BL0B 5ER5A 3NSLA 4USLA 2ISDA 1CLBA 1UHKA 4PE7A 1H8BA 4PE1A 1N2DA 2WCEA 2KFHA 1AP4A 4A4BA 1BJFA 1F54A 1A75A 2WCFA 1OSAA 3TDUA 3E3RA 2LLUA 3I5FB 1YUTA 2P6BB 2M0RA 2RGIA 2LC5A 1K2HA 2ZNDA 4JWQA 1S5GY 1KFUL 4FQOA 1CDPA 2AAOA 1A75B 1AUIB 3WHTB 5AFPA 3PALA 3TS5C 3BUNB 2LV7A 4WQ2A 1JF0A 4MZLA 1LVCD 4ZCVA 1LKJA 3IQQA 1SRAA 3O4YA 4ORAB 5J3XA 4E68A 3C1VA 2I2RE 3SG6A 1XFZO 2KHNA 4N5XA 1UP5A 4HSZA 3TUYC 3BXKA 4PHKA 1IJ6A 4AQJA 1TCFA 4JQ0D 3VGOA 5I2OA 1MQ1A 1U5IA 3FIAA 1CMFA 5I2LA 1DJIA 3PLFB 2GGZA 4DIRA 2LMTA 4GFTA 2H2KA 1LA3A 1J55A 3SG4A 3QRXA 3TS5B 4C0KA 1B8RA 3WHUB 4BY5A 1U5IB 4I5NB 3RLZA 3DVMA 2LVIA 1B7TY 1TNXA 2NLNA 1BT6A 3I5IC 1HT9A 3WNXB 4PDZA 2CXJA 2LP2A 5JJGA 2BCBA 2EC6B 2JC2A 5IBWA 4I5JA 1C7VA 4P5OE 2MBXA 4NDDA 2KNEA 5I8NA 1M39A 3TUYB 2KAXA 3A8RA 1OOJA 1WLZA 2LCPA 1NWDA 1DJZA 1RWYA 3JVTC 1B8LA 2OTGC 5TNCA 3AAKA 4DS7A 1MUXA 4F0ZB 3WXAA 5B8IB 1B1GA 3CR4X 2M7NA 2KAVA 4GGFC 2GGMA
chains in the Genus database with same CATH superfamily
1IRJA 2K60A 2AMIA 1G8IA 3HX4A 2F3ZA 2F8PA 1A2XA 1PRWA 2KI4C 2BCXA 1V1GA 2MRDA 4YI9A 2KQ6A 2LLSA 5AERA 1TNPA 1CNPA 1E8AA 5AANA 3BFAA 1FI5A 3K21A 1TCOB 2I7AA 5F6TA 1OMVA 3I5IB 1K9PA 2BKIB 1BR1B 2A4JA 2HQ8A 3BUWB 3OP0A 1TUZA 1QVIZ 4MRYA 4PE4A 4GGFA 1ZFSA 5FI7A 1BODA 3VRQA 2JXLA 4D1EA 1B8CA 2NXQA 1J1EA 1YR5A 2F3YA 2KYCA 1K94A 2PASA 3SIAA 1K96A 3CR5X 4GGNA 3JVTB 2HPSA 3OHMB 2PMYA 3D77A 3NGVA 3RM1A 2F33A 4DUQA 2JTTA 2BE4A 5I94A 2ZRSA 2MLFC 1YVHA 4XJKA 5JOLA 2JQ6A 2ZRTA 4NDBA 4HRGA 1CB1A 1SKTA 1MWNA 2LUCA 1SCMC 3GOFA 2M97A 2JNFA 2L2EA 1XYDA 1TUJA 1JWDA 1F8HA 4OR9B 2FCEA 4MN0A 3AKBA 3SG2A 1M63B 1EXRA 1UWOA 4FQTA 1M46A 1CLMA 2BNXA 1YUSA 3DVJA 1DQEA 5HKYA 4NQGA 3S0GA 1UUSA 1XO5A 3SG3A 1PSRA 2GTEA 2NZ0A 1SYMA 1NX0A 1D1OA 4MLWA 1S6JA 1QXPA 2LANA 3LLEA 1XK4C 3S0DA 3VRPA 2SCPA 1CFDA 2JPTA 2PALA 1CDMA 5CSIA 3KF9A 3TDZA 1IIOA 1CTRA 2CT9A 2H61C 3O2PA 1R2UA 3BYAA 2ZN9A 1WDCC 2BBMA 1EG3A 3FWCA 4MEWA 1GM0A 4ETOA 5HLVA 1ORGA 5CSFA 1JUOA 1QIVA 1OOIX 5DICA 2M7LA 1IKUA 1AJ5A 3PATA 1MR8A 2LE9B 2SASA 1BLQA 1KQMC 1F70A 2JNXA 1SL9A 1XK4A 4QJ5B 1MHOA 4CPVA 1KSOA 1YTZC 5EL2A 3I5HB 3D75A 3S0EA 3BOWA 1TNQA 2K7DA 2OS8C 2LMUA 1CFFA 2H61A 1RK9A 2WCBA 3BUXB 4R1EA 3H4SE 4MVFA 2GV5A 1F55A 2F2OA 4N1FA 5KU1A 2M8UA 2H8VA 4YGDB 3BFBA 1B7TZ 2JTZA 3SIBA 3F45A 1XA5A 2LAPA 3PM8A 4PCWA 3BOWB 2K8MB 2M1KB 3D76A 3DY9A 1KK7Z 4MRXA 4MBEA 4PHMA 1SCVA 1GGWA 1WDCB 1PSBA 3KO0A 1WY9A 2VRGA 1H4BA 3GK1A 2Q4UA 1A03A 1C7WA 1KSMA 1TIZA 1UHIA 2DOQA 2L51A 2JZIA 1LA0A 3EK4A 2LVJA 1RJVA 2OPOA 1XFXO 3OB2B 1YRTB 3CR2A 1FI6A 1OZSA 3EKHA 4DRWA 2L5YA 4A4CA 1S3PA 2ZFDA 1QWVA 1BR4B 2M1UA 3CZ2A 1IGVA 3FS7A 3VB1A 1OE9B 4PE0A 2ZNEA 2OS8B 2R2IA 1S6IA 1W9ZA 3BJHA 1NP8A 2JT0A 2K7BA 1YVLA 3EKJA 3O78A 1WLMA 2PSRA 3B7AA 4GBAA 1SY9A 5AEQA 3TDIA 1B4CA 3TZ1A 3PN7C 3JTDC 1JBAA 1P28A 4GNKB 1M31A 2NCPA 4DCKA 1F71A 2G2BA 2O60A 1Y6WA 1QTXA 1DJYA 1SNLA 1EG4A 1WRKA 1IJ5A 1KK7Y 2K0JA 2LHIA 1NCYA 1UHJA 3AKAA 1XFYO 1YRUB 2LHLA 2HETA 3CTNA 1B47A 1QIWA 1DJXA 1TOPA 3R72A 4YGEB 1Y1XA 3O4XA 1C07A 1B9AA 2K2FA 4M2QA 1G33A 1SW8A 4U8DA 1FBVA 1Y1AA 2JU0A 3BUMB 3OX5A 2L50A 1OW4A 1JF2A 2FCDA 4PHNA 4ORCB 5DKRA 1GQMA 2WOSA 1QLSA 2G9BA 1TNWA 3PSRA 4GPLB 5D7FA 2KAYA 3B87A 1MXLC 3LK0A 3SG5A 1AK8A 1ZMZA 2PQLA 3DYEA 3JTDB 5D3OA 2WCMA 2CTNA 1UHHA 2JT3A 1K95A 1S36A 1FW4A 1RFJA 2QACA 4YRUA 2IS9A 3S0BA 1OMRA 2K61A 1F4OA 2QEHA 4JPZB 1EH2A 3EVRA 3CZTX 4ICBA 2QEOA 3ZWHA 3CS1A 4GUKA 3LK1A 3CWGA 2CCMA 2OTGB 2L4HA 1S6CA 3SS5A 1CKKA 1S26D 2ZN8A 3L4LA 1IWQA 1XFVO 1DJHA 1TRFA 2LVKA 1DT7B 1FF1A 1YX7A 2LM5A 2KI4B 2KGBC 2KBIA 3KHEA 1QX5B 4HRHA 2K2AA 3FWBA 1CFCA 2WC6A 1AHRA 1PVBA 3DVKA 2I94A 1Y0VH 1HQVA 1MXEA 1OZOA 1TN4A 1KK8C 1K90D 3BQ3A 3CLNA 4UPGA 4XJKB 4YGBB 3LL8B 2BAPA 3HCMA 3IQOA 2E6WA 1CDLA 2K7OA 3SS4A 2ZKMX 2BL0C 2MJWB 2O5GA 1AVSA 3SG7A 5KTYA 3LCPC 1WRZA 3D74A 4L9MA 2KGRA 1LINA 4CLNA 5HLOA 1DF0A 1BOCA 1CM1A 1RROA 3D78A 1JFJA 2WCLA 1QS7A 2WORA 4PALA 4OZDA 1NYAA 1OMDA 2KFFA 1NCZA 3ZNIA 1CFPA 1MF8B 2EHBA 3D0YA 5FI6A 1S1EA 2WCJA 1FPWA 1QLKA 4N1GA 1DF0B 5KSZA 2F2PA 2FJYA 1SCMB 1KQVA 2Y5IA 3CYZA 1NCXA 1SPYA 1QX7A 5DKNA 1OOGA 2M49B 3OB1B 2BKHB 3DD4A 3NSIA 1KFXS 1ODBA 3D0YB 4C0JA 1W7IB 3KEVA 4IJ7A 4FTGA 1NUBA 2JPOA 2JT8A 1QV1A 2TN4A 2LMVA 4YGCB 4ZCUA 1CMGA 1QATA 1SL7A 4JKTA 2PYQA 5CPVA 1UURA 4OVNF 4PT1A 3VRNA 2CNPA 4YGAA 3S0FA 3VROA 2M3WA 1SL8A 1NPQA 1DGVA 5ER4X 2L0PA 2L5XB 1A29A 3FE9A 2JOJA 4MSPA 3N7HA 1EJ3A 3GK4X 4YBHB 1J7RA 1DJWA 3L4AA 1BF5A 1DVIA 1PVAA 2PRUA 3DVEA 3S0AA 3V2LA 1X02A 2JRFA 1ZOTB 1QASA 1C3ZA 1J7PA 3EVVA 2K7CA 1YURA 4OKHA 1KQMB 1XFUO 3R1OA 2YGUA 1A4PA 1KCYA 2EGDA 2KI6D 3CABA 2KBMA 2KOTA 2LVVA 3A4UB 2FJUB 3R1PA 4PHJA 3AAJA 4CFQA 2KI6C 1KFUS 3IF7A 4KYNA 1VRKA 3PJIA 2EC6C 1L2OC 1SBJA 3O6BA 1NX3A 2QPTA 2HQWA 1GGZA 1XFRA 3NSOA 2I18A 2LNKA 3CZ1A 5FI2A 1CLLA 1UHNA 1GJYA 2V53A 4C0LA 2KSPA 1NIWA 1PULA 1Q80A 2M29A 1YUUA 3EK8A 1TWOA 1JSAA 3BFHA 1T14A 2KDHA 4HREE 3VRRA 2KFGA 3QMEA 3R1VA 1DMOA 2KQYA 2PVBA 2WC5A 2BECA 1M45A 5BPJA 5D69A 1J7OA 2NCOA 1NSHA 4I5LB 1OOFA 1NX2A 1CM4A 1QV0A 1V1FA 3SS3A 4XYNA 5FYXA 1WRLA 2L98A 3IVTA 1RECA 1J1DA 4AOMA 2B1UA 3NXAA 4GAOA 1L7ZA 2KYFA 1L2OB 3PN7B 4I5KA 3DF0A 1K93D 3NSKA 1JC2A 4Q04A 2M9GA 1YX8A 4CFRA 5HKZA 1DTLA 1QJTA 2P70A 2WC8A 1N65A 2JXCA 2ERBA 2QEVA 3GK2A 1IQ3A 5DKQA 2Q91A 1SK6D 3CGAA 1IH0A 2COLB 2WNDA 4QJ3B 1CDNA 1K9UA 1K9KA 3DF0B 2BCAA 4AQIA 3EK7A 3D73A 2P71A 5AXIA 5CSNA 1PALA 1ALWA 1R6PA 1F4QA 4WRIA 1AJ4A 1IG5A 3KPXA 2LUXA 1XFWO 3I5GC 1SR6C 4MZKA 5PALA 1ZUZA 1KWOC 2LLTA 1EL4A 2D8NA 2MHHA 1BG1A 4INXA 4BY4A 2MAZA 3BUOB 1OQPA 2CBLA 3CZ0A 5HYDA 1DGUA 2Y4QA 4OV2A 4IL1A 4ORBB 5G08A 1LXFC 2LP3A 4QJ4B 4M2PA 3SJSA 3UNWA 1DEKA 4CIDA 2HF5A 3D10A 3L47A 2JULA 2L2CA 3NHTA 3OX6A 1K8UA 1TTXA 1IQ5A 3EVUA 4WQ3A 1KFXL 1RTP1 2FOTA 1PK0D 1BMOA 3OGNA 1J7QA 1JFKA 2BBNA 1W7JB 3FE8A 4OCIA 1XVJA 1QX2A 2WCHA 2Y1NA 1ALVA 1BU3A 1DELA 1DC1A 3I5GB 5CSJA 5GQQC 3I5FC 3PFVA 1NX1A 1SMGA 2KLDA 2MLEC 4F7FA 1SR6B 4M2OA 2MA2A 3M0WA 1N0YA 1S5GZ 2JWWA 2BE6A 2QEBA 2Y1MA 3MSEB 4JD9A 5I2QA 1SSEB 1DJGA 1KWOB 3I5HC 1G4YR 3RZSA 4TNCA 4P2YB 4YI8A 1QVIY 1KK8B 5HKWA 2L4IA 4NDCA 3ICBA 1ZACA 2E30A 1Y1UA 2AUCA 4MZJA 5K89A 2BL0B 5ER5A 3NSLA 4USLA 2ISDA 1CLBA 1UHKA 4PE7A 1H8BA 4PE1A 1N2DA 2WCEA 2WCKA 2KFHA 3B6XA 1AP4A 4A4BA 1BJFA 1F54A 1A75A 2WCFA 1OSAA 3TDUA 3E3RA 2LLUA 3B88A 3I5FB 1YUTA 2P6BB 2M0RA 2RGIA 2LC5A 1K2HA 2ZNDA 4JWQA 1S5GY 1KFUL 4FQOA 1CDPA 2AAOA 3B86A 1A75B 1AUIB 3OBVA 1LS8A 3WHTB 5AFPA 3PALA 3TS5C 1C3YA 3BUNB 2LV7A 4WQ2A 3DXLA 1JF0A 2KLEA 4MZLA 1LVCD 1Z4HA 4ZCVA 1LKJA 3IQQA 1SRAA 3O4YA 4ORAB 5J3XA 4E68A 3C1VA 2I2RE 3SG6A 1XFZO 2KHNA 4N5XA 3CDNA 1UP5A 4HSZA 3TUYC 3BXKA 3EG5B 4PHKA 1IJ6A 4AQJA 1TCFA 4JQ0D 3VGOA 5I2OA 1OOHA 1MQ1A 1U5IA 3FIAA 1CMFA 5I2LA 1DJIA 3PLFB 2GGZA 4DIRA 2LMTA 3DZTA 4GFTA 2H2KA 1LA3A 1J55A 3SG4A 3QRXA 3TS5B 3K1EA 4C0KA 1B8RA 3WHUB 4BY5A 1U5IB 3NHIA 4I5NB 3RLZA 1Z2CB 2QDIA 3DVMA 2LVIA 1B7TY 3FE6A 5HL1A 1TNXA 2NLNA 1BT6A 3I5IC 1HT9A 3WNXB 4PDZA 3UO9A 2CXJA 2LP2A 3PM2A 5JJGA 2BCBA 2EC6B 2JC2A 2KPHA 4I5JA 5IBWA 4P5OE 2MBXA 1C7VA 4NDDA 2KNEA 5I8NA 1M39A 3TUYB 2KAXA 3A8RA 1OOJA 1WLZA 2LCPA 4INWA 1NWDA 1DJZA 1RWYA 3JVTC 1B8LA 2OTGC 5TNCA 3AAKA 3Q8IA 1MUXA 4DS7A 3WXAA 4F0ZB 5B8IB 1B1GA 3CR4X 2M7NA 2KAVA 4GGFC 2GGMA
chains in the Genus database with same CATH topology
1IRJA 2AMIA 1G8IA 3HX4A 2F3ZA 2F8PA 1A2XA 1PRWA 2KI4C 2BCXA 1V1GA 2MRDA 4YI9A 2KQ6A 2LLSA 5AERA 1TNPA 1CNPA 1E8AA 5AANA 1FI5A 3K21A 1TCOB 2I7AA 5F6TA 1OMVA 3I5IB 1K9PA 2BKIB 1BR1B 2A4JA 2HQ8A 3BUWB 3OP0A 1QVIZ 4MRYA 4PE4A 4GGFA 1ZFSA 1BODA 3VRQA 2JXLA 4D1EA 1B8CA 2NXQA 1J1EA 1YR5A 2F3YA 2KYCA 1K94A 2PASA 3SIAA 1K96A 3CR5X 4GGNA 3JVTB 2HPSA 3OHMB 2PMYA 3RM1A 2F33A 4DUQA 2JTTA 2BE4A 2ZRSA 2MLFC 1YVHA 4XJKA 5JOLA 2JQ6A 2ZRTA 4NDBA 4HRGA 1CB1A 1SKTA 1MWNA 2LUCA 1SCMC 3GOFA 2M97A 2JNFA 2L2EA 1XYDA 1JWDA 1F8HA 4OR9B 2FCEA 4MN0A 3AKBA 3SG2A 1M63B 1EXRA 1UWOA 1M46A 1CLMA 1YUSA 3DVJA 5HKYA 4NQGA 1UUSA 1XO5A 3SG3A 1PSRA 2NZ0A 1SYMA 1NX0A 1D1OA 4MLWA 1S6JA 1QXPA 2LANA 3LLEA 1XK4C 3VRPA 2SCPA 1CFDA 2JPTA 2PALA 1CDMA 5CSIA 3KF9A 3TDZA 1CTRA 2CT9A 2H61C 3O2PA 1R2UA 3BYAA 2ZN9A 1WDCC 2BBMA 1EG3A 3FWCA 4MEWA 4ETOA 5HLVA 5CSFA 1JUOA 1QIVA 2M7LA 1IKUA 1AJ5A 3PATA 1MR8A 2LE9B 2SASA 1BLQA 1KQMC 1F70A 2JNXA 1SL9A 1XK4A 4QJ5B 1MHOA 4CPVA 1KSOA 1YTZC 3I5HB 3BOWA 1TNQA 2K7DA 2OS8C 2LMUA 1CFFA 2H61A 1RK9A 2WCBA 3BUXB 4R1EA 3H4SE 4MVFA 2GV5A 1F55A 2F2OA 4N1FA 5KU1A 2M8UA 4YGDB 1B7TZ 2JTZA 3SIBA 3F45A 1XA5A 2LAPA 3PM8A 4PCWA 3BOWB 2K8MB 2M1KB 4MRXA 1KK7Z 4MBEA 4PHMA 1SCVA 1GGWA 1WDCB 1PSBA 3KO0A 1WY9A 2VRGA 1H4BA 3GK1A 2Q4UA 1A03A 1C7WA 1KSMA 1TIZA 1UHIA 2DOQA 2L51A 2JZIA 1LA0A 3EK4A 2LVJA 1RJVA 2OPOA 1XFXO 3OB2B 1YRTB 3CR2A 1FI6A 1OZSA 3EKHA 4DRWA 4A4CA 1S3PA 2ZFDA 1BR4B 2M1UA 1IGVA 3FS7A 1OE9B 4PE0A 2ZNEA 2OS8B 2R2IA 1S6IA 1NP8A 2JT0A 2K7BA 1YVLA 3EKJA 3O78A 1WLMA 2PSRA 4GBAA 1B4CA 1SY9A 5AEQA 3TDIA 3TZ1A 3PN7C 3JTDC 1JBAA 4GNKB 1M31A 2NCPA 4DCKA 1F71A 2G2BA 2O60A 1Y6WA 1QTXA 1DJYA 1SNLA 1EG4A 1WRKA 1IJ5A 1KK7Y 2K0JA 2LHIA 1NCYA 1UHJA 3AKAA 1XFYO 1YRUB 2LHLA 2HETA 3CTNA 1B47A 1QIWA 1DJXA 1TOPA 4YGEB 1Y1XA 1C07A 1B9AA 2K2FA 4M2QA 1G33A 1SW8A 4U8DA 1FBVA 1Y1AA 2JU0A 3BUMB 3OX5A 2L50A 1JF2A 2FCDA 4PHNA 4ORCB 5DKRA 1GQMA 2WOSA 1QLSA 2G9BA 1TNWA 3PSRA 4GPLB 5D7FA 2KAYA 1MXLC 3LK0A 3SG5A 1AK8A 1ZMZA 3JTDB 2CTNA 1UHHA 2JT3A 1K95A 1S36A 1FW4A 1RFJA 2QACA 4YRUA 2IS9A 1OMRA 2K61A 1F4OA 4JPZB 1EH2A 3EVRA 3CZTX 4ICBA 3ZWHA 3CS1A 4GUKA 3LK1A 3CWGA 2CCMA 2OTGB 2L4HA 1S6CA 1CKKA 1S26D 2ZN8A 1IWQA 1XFVO 1DJHA 1TRFA 2LVKA 1DT7B 1FF1A 1YX7A 2LM5A 2KI4B 2KGBC 2KBIA 3KHEA 1QX5B 4HRHA 2K2AA 3FWBA 1CFCA 1AHRA 1PVBA 3DVKA 2I94A 1Y0VH 1HQVA 1MXEA 1OZOA 1TN4A 1KK8C 1K90D 3BQ3A 3CLNA 4UPGA 4XJKB 4YGBB 3LL8B 3HCMA 3IQOA 2E6WA 1CDLA 2K7OA 2ZKMX 2BL0C 2MJWB 2O5GA 1AVSA 3SG7A 5KTYA 3LCPC 1WRZA 4L9MA 2KGRA 1LINA 4CLNA 5HLOA 1DF0A 1BOCA 1CM1A 1RROA 1JFJA 1QS7A 2WORA 4PALA 1NYAA 1OMDA 2KFFA 1NCZA 3ZNIA 1CFPA 1MF8B 2EHBA 3D0YA 1S1EA 1FPWA 1QLKA 4N1GA 1DF0B 5KSZA 2F2PA 1SCMB 1KQVA 2Y5IA 1NCXA 1SPYA 1QX7A 5DKNA 2M49B 3OB1B 2BKHB 3DD4A 3NSIA 1KFXS 1ODBA 3D0YB 4C0JA 1W7IB 3KEVA 4FTGA 1NUBA 2JT8A 2TN4A 1QV1A 4YGCB 2LMVA 4ZCUA 1CMGA 1QATA 1SL7A 5CPVA 1UURA 4OVNF 3VRNA 2CNPA 4YGAA 3VROA 2M3WA 1SL8A 1NPQA 1DGVA 5ER4X 2L0PA 2L5XB 1A29A 2JOJA 4MSPA 1EJ3A 3GK4X 4YBHB 1J7RA 1DJWA 1BF5A 1DVIA 1PVAA 2PRUA 3DVEA 1X02A 2JRFA 1ZOTB 1QASA 1J7PA 3EVVA 2K7CA 1YURA 4OKHA 1KQMB 1XFUO 1A4PA 1KCYA 2EGDA 2KI6D 2KBMA 2KOTA 2LVVA 3A4UB 2FJUB 4PHJA 3AAJA 4CFQA 2KI6C 1KFUS 3IF7A 1VRKA 2EC6C 1L2OC 1SBJA 3O6BA 1NX3A 2QPTA 2HQWA 1GGZA 3NSOA 2I18A 2LNKA 1CLLA 1UHNA 1GJYA 2V53A 4C0LA 2KSPA 1NIWA 1PULA 1Q80A 2M29A 1YUUA 3EK8A 1JSAA 4HREE 2KDHA 3VRRA 2KFGA 1DMOA 2KQYA 2PVBA 1J7OA 2BECA 1M45A 5BPJA 5D69A 2NCOA 1NSHA 4I5LB 1NX2A 1CM4A 1QV0A 1V1FA 4XYNA 5FYXA 1WRLA 2L98A 1RECA 1J1DA 4AOMA 2B1UA 3NXAA 4GAOA 1L7ZA 2KYFA 1L2OB 3PN7B 4I5KA 3DF0A 1K93D 3NSKA 1JC2A 4Q04A 2M9GA 1YX8A 4CFRA 5HKZA 1DTLA 1QJTA 3GK2A 2WC8A 1N65A 2JXCA 1IQ3A 5DKQA 2Q91A 1SK6D 3CGAA 1IH0A 2COLB 2WNDA 4QJ3B 1CDNA 1K9UA 1K9KA 3DF0B 2BCAA 4AQIA 3EK7A 5AXIA 5CSNA 1PALA 1ALWA 1R6PA 1F4QA 4WRIA 1AJ4A 1IG5A 3KPXA 2LUXA 1XFWO 3I5GC 1SR6C 4MZKA 5PALA 1ZUZA 1KWOC 2LLTA 1EL4A 2D8NA 2MHHA 1BG1A 4BY4A 2MAZA 3BUOB 1OQPA 2CBLA 5HYDA 1DGUA 2Y4QA 4OV2A 4IL1A 4ORBB 5G08A 1LXFC 2LP3A 4QJ4B 4M2PA 3SJSA 4CIDA 2HF5A 3D10A 2JULA 3OX6A 4WQ3A 1K8UA 1TTXA 1IQ5A 3EVUA 1KFXL 1RTP1 2FOTA 1PK0D 1BMOA 1J7QA 1JFKA 2BBNA 1W7JB 4OCIA 1XVJA 1QX2A 2Y1NA 1ALVA 1BU3A 3I5GB 5CSJA 5GQQC 3I5FC 3PFVA 1NX1A 1SMGA 2MLEC 1SR6B 4M2OA 2MA2A 3M0WA 1N0YA 1S5GZ 2JWWA 2BE6A 2Y1MA 5I2QA 3MSEB 1DJGA 1KWOB 3I5HC 1G4YR 4TNCA 4P2YB 4YI8A 1QVIY 1KK8B 5HKWA 2L4IA 4NDCA 3ICBA 1ZACA 2E30A 1Y1UA 2AUCA 4MZJA 5K89A 2BL0B 5ER5A 3NSLA 4USLA 2ISDA 1CLBA 1UHKA 4PE7A 1H8BA 4PE1A 1N2DA 2WCEA 2KFHA 1AP4A 4A4BA 1BJFA 1F54A 1A75A 2WCFA 1OSAA 3TDUA 3E3RA 2LLUA 3I5FB 1YUTA 2P6BB 2M0RA 2RGIA 2LC5A 1K2HA 2ZNDA 4JWQA 1S5GY 1KFUL 4FQOA 1CDPA 2AAOA 1A75B 1AUIB 3WHTB 5AFPA 3PALA 3TS5C 3BUNB 2LV7A 4WQ2A 1JF0A 4MZLA 1LVCD 4ZCVA 1LKJA 3IQQA 1SRAA 3O4YA 4ORAB 5J3XA 4E68A 3C1VA 2I2RE 3SG6A 1XFZO 2KHNA 4N5XA 1UP5A 4HSZA 3TUYC 3BXKA 4PHKA 1IJ6A 4AQJA 1TCFA 4JQ0D 3VGOA 5I2OA 1MQ1A 1U5IA 3FIAA 1CMFA 5I2LA 1DJIA 3PLFB 2GGZA 4DIRA 2LMTA 4GFTA 2H2KA 1LA3A 1J55A 3SG4A 3QRXA 3TS5B 4C0KA 1B8RA 3WHUB 4BY5A 1U5IB 4I5NB 3RLZA 3DVMA 2LVIA 1B7TY 1TNXA 2NLNA 1BT6A 3I5IC 1HT9A 3WNXB 4PDZA 2CXJA 2LP2A 5JJGA 2BCBA 2EC6B 2JC2A 5IBWA 4I5JA 1C7VA 4P5OE 2MBXA 4NDDA 2KNEA 5I8NA 1M39A 3TUYB 2KAXA 3A8RA 1OOJA 1WLZA 2LCPA 1NWDA 1DJZA 1RWYA 3JVTC 1B8LA 2OTGC 5TNCA 3AAKA 4DS7A 1MUXA 4F0ZB 3WXAA 5B8IB 1B1GA 3CR4X 2M7NA 2KAVA 4GGFC 2GGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRJ A;  2AMI A;  1G8I A;  3HX4 A;  2F3Z A;  2F8P A;  1A2X A;  1PRW A;  2KI4 C;  2BCX A;  1V1G A;  2MRD A;  4YI9 A;  2KQ6 A;  2LLS A;  5AER A;  1TNP A;  1CNP A;  1E8A A;  5AAN A;  1FI5 A;  3K21 A;  1TCO B;  2I7A A;  5F6T A;  1OMV A;  3I5I B;  1K9P A;  2BKI B;  1BR1 B;  2A4J A;  2HQ8 A;  3BUW B;  3OP0 A;  1QVI Z;  4MRY A;  4PE4 A;  4GGF A;  1ZFS A;  1BOD A;  3VRQ A;  2JXL A;  4D1E A;  1B8C A;  2NXQ A;  1J1E A;  1YR5 A;  2F3Y A;  2KYC A;  1K94 A;  2PAS A;  3SIA A;  1K96 A;  3CR5 X;  4GGN A;  3JVT B;  2HPS A;  3OHM B;  2PMY A;  3RM1 A;  2F33 A;  4DUQ A;  2JTT A;  2BE4 A;  2ZRS A;  2MLF C;  1YVH A;  4XJK A;  5JOL A;  2JQ6 A;  2ZRT A;  4NDB A;  4HRG A;  1CB1 A;  1SKT A;  1MWN A;  2LUC A;  1SCM C;  3GOF A;  2M97 A;  2JNF A;  2L2E A;  1XYD A;  1JWD A;  1F8H A;  4OR9 B;  2FCE A;  4MN0 A;  3AKB A;  3SG2 A;  1M63 B;  1EXR A;  1UWO A;  1M46 A;  1CLM A;  1YUS A;  3DVJ A;  5HKY A;  4NQG A;  1UUS A;  1XO5 A;  3SG3 A;  1PSR A;  2NZ0 A;  1SYM A;  1NX0 A;  1D1O A;  4MLW A;  1S6J A;  1QXP A;  2LAN A;  3LLE A;  1XK4 C;  3VRP A;  2SCP A;  1CFD A;  2JPT A;  2PAL A;  1CDM A;  5CSI A;  3KF9 A;  3TDZ A;  1CTR A;  2CT9 A;  2H61 C;  3O2P A;  1R2U A;  3BYA A;  2ZN9 A;  1WDC C;  2BBM A;  1EG3 A;  3FWC A;  4MEW A;  4ETO A;  5HLV A;  5CSF A;  1JUO A;  1QIV A;  2M7L A;  1IKU A;  1AJ5 A;  3PAT A;  1MR8 A;  2LE9 B;  2SAS A;  1BLQ A;  1KQM C;  1F70 A;  2JNX A;  1SL9 A;  1XK4 A;  4QJ5 B;  1MHO A;  4CPV A;  1KSO A;  1YTZ C;  3I5H B;  3BOW A;  1TNQ A;  2K7D A;  2OS8 C;  2LMU A;  1CFF A;  2H61 A;  1RK9 A;  2WCB A;  3BUX B;  4R1E A;  3H4S E;  4MVF A;  2GV5 A;  1F55 A;  2F2O A;  4N1F A;  5KU1 A;  2M8U A;  4YGD B;  1B7T Z;  2JTZ A;  3SIB A;  3F45 A;  1XA5 A;  2LAP A;  3PM8 A;  4PCW A;  3BOW B;  2K8M B;  2M1K B;  4MRX A;  1KK7 Z;  4MBE A;  4PHM A;  1SCV A;  1GGW A;  1WDC B;  1PSB A;  3KO0 A;  1WY9 A;  2VRG A;  1H4B A;  3GK1 A;  2Q4U A;  1A03 A;  1C7W A;  1KSM A;  1TIZ A;  1UHI A;  2DOQ A;  2L51 A;  2JZI A;  1LA0 A;  3EK4 A;  2LVJ A;  1RJV A;  2OPO A;  1XFX O;  3OB2 B;  1YRT B;  3CR2 A;  1FI6 A;  1OZS A;  3EKH A;  4DRW A;  4A4C A;  1S3P A;  2ZFD A;  1BR4 B;  2M1U A;  1IGV A;  3FS7 A;  1OE9 B;  4PE0 A;  2ZNE A;  2OS8 B;  2R2I A;  1S6I A;  1NP8 A;  2JT0 A;  2K7B A;  1YVL A;  3EKJ A;  3O78 A;  1WLM A;  2PSR A;  4GBA A;  1B4C A;  1SY9 A;  5AEQ A;  3TDI A;  3TZ1 A;  3PN7 C;  3JTD C;  1JBA A;  4GNK B;  1M31 A;  2NCP A;  4DCK A;  1F71 A;  2G2B A;  2O60 A;  1Y6W A;  1QTX A;  1DJY A;  1SNL A;  1EG4 A;  1WRK A;  1IJ5 A;  1KK7 Y;  2K0J A;  2LHI A;  1NCY A;  1UHJ A;  3AKA A;  1XFY O;  1YRU B;  2LHL A;  2HET A;  3CTN A;  1B47 A;  1QIW A;  1DJX A;  1TOP A;  4YGE B;  1Y1X A;  1C07 A;  1B9A A;  2K2F A;  4M2Q A;  1G33 A;  1SW8 A;  4U8D A;  1FBV A;  1Y1A A;  2JU0 A;  3BUM B;  3OX5 A;  2L50 A;  1JF2 A;  2FCD A;  4PHN A;  4ORC B;  5DKR A;  1GQM A;  2WOS A;  1QLS A;  2G9B A;  1TNW A;  3PSR A;  4GPL B;  5D7F A;  2KAY A;  1MXL C;  3LK0 A;  3SG5 A;  1AK8 A;  1ZMZ A;  3JTD B;  2CTN A;  1UHH A;  2JT3 A;  1K95 A;  1S36 A;  1FW4 A;  1RFJ A;  2QAC A;  4YRU A;  2IS9 A;  1OMR A;  2K61 A;  1F4O A;  4JPZ B;  1EH2 A;  3EVR A;  3CZT X;  4ICB A;  3ZWH A;  3CS1 A;  4GUK A;  3LK1 A;  3CWG A;  2CCM A;  2OTG B;  2L4H A;  1S6C A;  1CKK A;  1S26 D;  2ZN8 A;  1IWQ A;  1XFV O;  1DJH A;  1TRF A;  2LVK A;  1DT7 B;  1FF1 A;  1YX7 A;  2LM5 A;  2KI4 B;  2KGB C;  2KBI A;  3KHE A;  1QX5 B;  4HRH A;  2K2A A;  3FWB A;  1CFC A;  1AHR A;  1PVB A;  3DVK A;  2I94 A;  1Y0V H;  1HQV A;  1MXE A;  1OZO A;  1TN4 A;  1KK8 C;  1K90 D;  3BQ3 A;  3CLN A;  4UPG A;  4XJK B;  4YGB B;  3LL8 B;  3HCM A;  3IQO A;  2E6W A;  1CDL A;  2K7O A;  2ZKM X;  2BL0 C;  2MJW B;  2O5G A;  1AVS A;  3SG7 A;  5KTY A;  3LCP C;  1WRZ A;  4L9M A;  2KGR A;  1LIN A;  4CLN A;  5HLO A;  1DF0 A;  1BOC A;  1CM1 A;  1RRO A;  1JFJ A;  1QS7 A;  2WOR A;  4PAL A;  1NYA A;  1OMD A;  2KFF A;  1NCZ A;  3ZNI A;  1CFP A;  1MF8 B;  2EHB A;  3D0Y A;  1S1E A;  1FPW A;  1QLK A;  4N1G A;  1DF0 B;  5KSZ A;  2F2P A;  1SCM B;  1KQV A;  2Y5I A;  1NCX A;  1SPY A;  1QX7 A;  5DKN A;  2M49 B;  3OB1 B;  2BKH B;  3DD4 A;  3NSI A;  1KFX S;  1ODB A;  3D0Y B;  4C0J A;  1W7I B;  3KEV A;  4FTG A;  1NUB A;  2JT8 A;  2TN4 A;  1QV1 A;  4YGC B;  2LMV A;  4ZCU A;  1CMG A;  1QAT A;  1SL7 A;  5CPV A;  1UUR A;  4OVN F;  3VRN A;  2CNP A;  4YGA A;  3VRO A;  2M3W A;  1SL8 A;  1NPQ A;  1DGV A;  5ER4 X;  2L0P A;  2L5X B;  1A29 A;  2JOJ A;  4MSP A;  1EJ3 A;  3GK4 X;  4YBH B;  1J7R A;  1DJW A;  1BF5 A;  1DVI A;  1PVA A;  2PRU A;  3DVE A;  1X02 A;  2JRF A;  1ZOT B;  1QAS A;  1J7P A;  3EVV A;  2K7C A;  1YUR A;  4OKH A;  1KQM B;  1XFU O;  1A4P A;  1KCY A;  2EGD A;  2KI6 D;  2KBM A;  2KOT A;  2LVV A;  3A4U B;  2FJU B;  4PHJ A;  3AAJ A;  4CFQ A;  2KI6 C;  1KFU S;  3IF7 A;  1VRK A;  2EC6 C;  1L2O C;  1SBJ A;  3O6B A;  1NX3 A;  2QPT A;  2HQW A;  1GGZ A;  3NSO A;  2I18 A;  2LNK A;  1CLL A;  1UHN A;  1GJY A;  2V53 A;  4C0L A;  2KSP A;  1NIW A;  1PUL A;  1Q80 A;  2M29 A;  1YUU A;  3EK8 A;  1JSA A;  4HRE E;  2KDH A;  3VRR A;  2KFG A;  1DMO A;  2KQY A;  2PVB A;  1J7O A;  2BEC A;  1M45 A;  5BPJ A;  5D69 A;  2NCO A;  1NSH A;  4I5L B;  1NX2 A;  1CM4 A;  1QV0 A;  1V1F A;  4XYN A;  5FYX A;  1WRL A;  2L98 A;  1REC A;  1J1D A;  4AOM A;  2B1U A;  3NXA A;  4GAO A;  1L7Z A;  2KYF A;  1L2O B;  3PN7 B;  4I5K A;  3DF0 A;  1K93 D;  3NSK A;  1JC2 A;  4Q04 A;  2M9G A;  1YX8 A;  4CFR A;  5HKZ A;  1DTL A;  1QJT A;  3GK2 A;  2WC8 A;  1N65 A;  2JXC A;  1IQ3 A;  5DKQ A;  2Q91 A;  1SK6 D;  3CGA A;  1IH0 A;  2COL B;  2WND A;  4QJ3 B;  1CDN A;  1K9U A;  1K9K A;  3DF0 B;  2BCA A;  4AQI A;  3EK7 A;  5AXI A;  5CSN A;  1PAL A;  1ALW A;  1R6P A;  1F4Q A;  4WRI A;  1AJ4 A;  1IG5 A;  3KPX A;  2LUX A;  1XFW O;  3I5G C;  1SR6 C;  4MZK A;  5PAL A;  1ZUZ A;  1KWO C;  2LLT A;  1EL4 A;  2D8N A;  2MHH A;  1BG1 A;  4BY4 A;  2MAZ A;  3BUO B;  1OQP A;  2CBL A;  5HYD A;  1DGU A;  2Y4Q A;  4OV2 A;  4IL1 A;  4ORB B;  5G08 A;  1LXF C;  2LP3 A;  4QJ4 B;  4M2P A;  3SJS A;  4CID A;  2HF5 A;  3D10 A;  2JUL A;  3OX6 A;  4WQ3 A;  1K8U A;  1TTX A;  1IQ5 A;  3EVU A;  1KFX L;  1RTP 1;  2FOT A;  1PK0 D;  1BMO A;  1J7Q A;  1JFK A;  2BBN A;  1W7J B;  4OCI A;  1XVJ A;  1QX2 A;  2Y1N A;  1ALV A;  1BU3 A;  3I5G B;  5CSJ A;  5GQQ C;  3I5F C;  3PFV A;  1NX1 A;  1SMG A;  2MLE C;  1SR6 B;  4M2O A;  2MA2 A;  3M0W A;  1N0Y A;  1S5G Z;  2JWW A;  2BE6 A;  2Y1M A;  5I2Q A;  3MSE B;  1DJG A;  1KWO B;  3I5H C;  1G4Y R;  4TNC A;  4P2Y B;  4YI8 A;  1QVI Y;  1KK8 B;  5HKW A;  2L4I A;  4NDC A;  3ICB A;  1ZAC A;  2E30 A;  1Y1U A;  2AUC A;  4MZJ A;  5K89 A;  2BL0 B;  5ER5 A;  3NSL A;  4USL A;  2ISD A;  1CLB A;  1UHK A;  4PE7 A;  1H8B A;  4PE1 A;  1N2D A;  2WCE A;  2KFH A;  1AP4 A;  4A4B A;  1BJF A;  1F54 A;  1A75 A;  2WCF A;  1OSA A;  3TDU A;  3E3R A;  2LLU A;  3I5F B;  1YUT A;  2P6B B;  2M0R A;  2RGI A;  2LC5 A;  1K2H A;  2ZND A;  4JWQ A;  1S5G Y;  1KFU L;  4FQO A;  1CDP A;  2AAO A;  1A75 B;  1AUI B;  3WHT B;  5AFP A;  3PAL A;  3TS5 C;  3BUN B;  2LV7 A;  4WQ2 A;  1JF0 A;  4MZL A;  1LVC D;  4ZCV A;  1LKJ A;  3IQQ A;  1SRA A;  3O4Y A;  4ORA B;  5J3X A;  4E68 A;  3C1V A;  2I2R E;  3SG6 A;  1XFZ O;  2KHN A;  4N5X A;  1UP5 A;  4HSZ A;  3TUY C;  3BXK A;  4PHK A;  1IJ6 A;  4AQJ A;  1TCF A;  4JQ0 D;  3VGO A;  5I2O A;  1MQ1 A;  1U5I A;  3FIA A;  1CMF A;  5I2L A;  1DJI A;  3PLF B;  2GGZ A;  4DIR A;  2LMT A;  4GFT A;  2H2K A;  1LA3 A;  1J55 A;  3SG4 A;  3QRX A;  3TS5 B;  4C0K A;  1B8R A;  3WHU B;  4BY5 A;  1U5I B;  4I5N B;  3RLZ A;  3DVM A;  2LVI A;  1B7T Y;  1TNX A;  2NLN A;  1BT6 A;  3I5I C;  1HT9 A;  3WNX B;  4PDZ A;  2CXJ A;  2LP2 A;  5JJG A;  2BCB A;  2EC6 B;  2JC2 A;  5IBW A;  4I5J A;  1C7V A;  4P5O E;  2MBX A;  4NDD A;  2KNE A;  5I8N A;  1M39 A;  3TUY B;  2KAX A;  3A8R A;  1OOJ A;  1WLZ A;  2LCP A;  1NWD A;  1DJZ A;  1RWY A;  3JVT C;  1B8L A;  2OTG C;  5TNC A;  3AAK A;  4DS7 A;  1MUX A;  4F0Z B;  3WXA A;  5B8I B;  1B1G A;  3CR4 X;  2M7N A;  2KAV A;  4GGF C;  2GGM A; 
#chains in the Genus database with same CATH topology
 1IRJ A;  2K60 A;  2AMI A;  1G8I A;  3HX4 A;  2F3Z A;  2F8P A;  1A2X A;  1PRW A;  2KI4 C;  2BCX A;  1V1G A;  2MRD A;  4YI9 A;  2KQ6 A;  2LLS A;  5AER A;  1TNP A;  1CNP A;  1E8A A;  5AAN A;  3BFA A;  1FI5 A;  3K21 A;  1TCO B;  2I7A A;  5F6T A;  1OMV A;  3I5I B;  1K9P A;  2BKI B;  1BR1 B;  2A4J A;  2HQ8 A;  3BUW B;  3OP0 A;  1TUZ A;  1QVI Z;  4MRY A;  4PE4 A;  4GGF A;  1ZFS A;  5FI7 A;  1BOD A;  3VRQ A;  2JXL A;  4D1E A;  1B8C A;  2NXQ A;  1J1E A;  1YR5 A;  2F3Y A;  2KYC A;  1K94 A;  2PAS A;  3SIA A;  1K96 A;  3CR5 X;  4GGN A;  3JVT B;  2HPS A;  3OHM B;  2PMY A;  3D77 A;  3NGV A;  3RM1 A;  2F33 A;  4DUQ A;  2JTT A;  2BE4 A;  5I94 A;  2ZRS A;  2MLF C;  1YVH A;  4XJK A;  5JOL A;  2JQ6 A;  2ZRT A;  4NDB A;  4HRG A;  1CB1 A;  1SKT A;  1MWN A;  2LUC A;  1SCM C;  3GOF A;  2M97 A;  2JNF A;  2L2E A;  1XYD A;  1TUJ A;  1JWD A;  1F8H A;  4OR9 B;  2FCE A;  4MN0 A;  3AKB A;  3SG2 A;  1M63 B;  1EXR A;  1UWO A;  4FQT A;  1M46 A;  1CLM A;  2BNX A;  1YUS A;  3DVJ A;  1DQE A;  5HKY A;  4NQG A;  3S0G A;  1UUS A;  1XO5 A;  3SG3 A;  1PSR A;  2GTE A;  2NZ0 A;  1SYM A;  1NX0 A;  1D1O A;  4MLW A;  1S6J A;  1QXP A;  2LAN A;  3LLE A;  1XK4 C;  3S0D A;  3VRP A;  2SCP A;  1CFD A;  2JPT A;  2PAL A;  1CDM A;  5CSI A;  3KF9 A;  3TDZ A;  1IIO A;  1CTR A;  2CT9 A;  2H61 C;  3O2P A;  1R2U A;  3BYA A;  2ZN9 A;  1WDC C;  2BBM A;  1EG3 A;  3FWC A;  4MEW A;  1GM0 A;  4ETO A;  5HLV A;  1ORG A;  5CSF A;  1JUO A;  1QIV A;  1OOI X;  5DIC A;  2M7L A;  1IKU A;  1AJ5 A;  3PAT A;  1MR8 A;  2LE9 B;  2SAS A;  1BLQ A;  1KQM C;  1F70 A;  2JNX A;  1SL9 A;  1XK4 A;  4QJ5 B;  1MHO A;  4CPV A;  1KSO A;  1YTZ C;  5EL2 A;  3I5H B;  3D75 A;  3S0E A;  3BOW A;  1TNQ A;  2K7D A;  2OS8 C;  2LMU A;  1CFF A;  2H61 A;  1RK9 A;  2WCB A;  3BUX B;  4R1E A;  3H4S E;  4MVF A;  2GV5 A;  1F55 A;  2F2O A;  4N1F A;  5KU1 A;  2M8U A;  2H8V A;  4YGD B;  3BFB A;  1B7T Z;  2JTZ A;  3SIB A;  3F45 A;  1XA5 A;  2LAP A;  3PM8 A;  4PCW A;  3BOW B;  2K8M B;  2M1K B;  3D76 A;  3DY9 A;  1KK7 Z;  4MRX A;  4MBE A;  4PHM A;  1SCV A;  1GGW A;  1WDC B;  1PSB A;  3KO0 A;  1WY9 A;  2VRG A;  1H4B A;  3GK1 A;  2Q4U A;  1A03 A;  1C7W A;  1KSM A;  1TIZ A;  1UHI A;  2DOQ A;  2L51 A;  2JZI A;  1LA0 A;  3EK4 A;  2LVJ A;  1RJV A;  2OPO A;  1XFX O;  3OB2 B;  1YRT B;  3CR2 A;  1FI6 A;  1OZS A;  3EKH A;  4DRW A;  2L5Y A;  4A4C A;  1S3P A;  2ZFD A;  1QWV A;  1BR4 B;  2M1U A;  3CZ2 A;  1IGV A;  3FS7 A;  3VB1 A;  1OE9 B;  4PE0 A;  2ZNE A;  2OS8 B;  2R2I A;  1S6I A;  1W9Z A;  3BJH A;  1NP8 A;  2JT0 A;  2K7B A;  1YVL A;  3EKJ A;  3O78 A;  1WLM A;  2PSR A;  3B7A A;  4GBA A;  1SY9 A;  5AEQ A;  3TDI A;  1B4C A;  3TZ1 A;  3PN7 C;  3JTD C;  1JBA A;  1P28 A;  4GNK B;  1M31 A;  2NCP A;  4DCK A;  1F71 A;  2G2B A;  2O60 A;  1Y6W A;  1QTX A;  1DJY A;  1SNL A;  1EG4 A;  1WRK A;  1IJ5 A;  1KK7 Y;  2K0J A;  2LHI A;  1NCY A;  1UHJ A;  3AKA A;  1XFY O;  1YRU B;  2LHL A;  2HET A;  3CTN A;  1B47 A;  1QIW A;  1DJX A;  1TOP A;  3R72 A;  4YGE B;  1Y1X A;  3O4X A;  1C07 A;  1B9A A;  2K2F A;  4M2Q A;  1G33 A;  1SW8 A;  4U8D A;  1FBV A;  1Y1A A;  2JU0 A;  3BUM B;  3OX5 A;  2L50 A;  1OW4 A;  1JF2 A;  2FCD A;  4PHN A;  4ORC B;  5DKR A;  1GQM A;  2WOS A;  1QLS A;  2G9B A;  1TNW A;  3PSR A;  4GPL B;  5D7F A;  2KAY A;  3B87 A;  1MXL C;  3LK0 A;  3SG5 A;  1AK8 A;  1ZMZ A;  2PQL A;  3DYE A;  3JTD B;  5D3O A;  2WCM A;  2CTN A;  1UHH A;  2JT3 A;  1K95 A;  1S36 A;  1FW4 A;  1RFJ A;  2QAC A;  4YRU A;  2IS9 A;  3S0B A;  1OMR A;  2K61 A;  1F4O A;  2QEH A;  4JPZ B;  1EH2 A;  3EVR A;  3CZT X;  4ICB A;  2QEO A;  3ZWH A;  3CS1 A;  4GUK A;  3LK1 A;  3CWG A;  2CCM A;  2OTG B;  2L4H A;  1S6C A;  3SS5 A;  1CKK A;  1S26 D;  2ZN8 A;  3L4L A;  1IWQ A;  1XFV O;  1DJH A;  1TRF A;  2LVK A;  1DT7 B;  1FF1 A;  1YX7 A;  2LM5 A;  2KI4 B;  2KGB C;  2KBI A;  3KHE A;  1QX5 B;  4HRH A;  2K2A A;  3FWB A;  1CFC A;  2WC6 A;  1AHR A;  1PVB A;  3DVK A;  2I94 A;  1Y0V H;  1HQV A;  1MXE A;  1OZO A;  1TN4 A;  1KK8 C;  1K90 D;  3BQ3 A;  3CLN A;  4UPG A;  4XJK B;  4YGB B;  3LL8 B;  2BAP A;  3HCM A;  3IQO A;  2E6W A;  1CDL A;  2K7O A;  3SS4 A;  2ZKM X;  2BL0 C;  2MJW B;  2O5G A;  1AVS A;  3SG7 A;  5KTY A;  3LCP C;  1WRZ A;  3D74 A;  4L9M A;  2KGR A;  1LIN A;  4CLN A;  5HLO A;  1DF0 A;  1BOC A;  1CM1 A;  1RRO A;  3D78 A;  1JFJ A;  2WCL A;  1QS7 A;  2WOR A;  4PAL A;  4OZD A;  1NYA A;  1OMD A;  2KFF A;  1NCZ A;  3ZNI A;  1CFP A;  1MF8 B;  2EHB A;  3D0Y A;  5FI6 A;  1S1E A;  2WCJ A;  1FPW A;  1QLK A;  4N1G A;  1DF0 B;  5KSZ A;  2F2P A;  2FJY A;  1SCM B;  1KQV A;  2Y5I A;  3CYZ A;  1NCX A;  1SPY A;  1QX7 A;  5DKN A;  1OOG A;  2M49 B;  3OB1 B;  2BKH B;  3DD4 A;  3NSI A;  1KFX S;  1ODB A;  3D0Y B;  4C0J A;  1W7I B;  3KEV A;  4IJ7 A;  4FTG A;  1NUB A;  2JPO A;  2JT8 A;  1QV1 A;  2TN4 A;  2LMV A;  4YGC B;  4ZCU A;  1CMG A;  1QAT A;  1SL7 A;  4JKT A;  2PYQ A;  5CPV A;  1UUR A;  4OVN F;  4PT1 A;  3VRN A;  2CNP A;  4YGA A;  3S0F A;  3VRO A;  2M3W A;  1SL8 A;  1NPQ A;  1DGV A;  5ER4 X;  2L0P A;  2L5X B;  1A29 A;  3FE9 A;  2JOJ A;  4MSP A;  3N7H A;  1EJ3 A;  3GK4 X;  4YBH B;  1J7R A;  1DJW A;  3L4A A;  1BF5 A;  1DVI A;  1PVA A;  2PRU A;  3DVE A;  3S0A A;  3V2L A;  1X02 A;  2JRF A;  1ZOT B;  1QAS A;  1C3Z A;  1J7P A;  3EVV A;  2K7C A;  1YUR A;  4OKH A;  1KQM B;  1XFU O;  3R1O A;  2YGU A;  1A4P A;  1KCY A;  2EGD A;  2KI6 D;  3CAB A;  2KBM A;  2KOT A;  2LVV A;  3A4U B;  2FJU B;  3R1P A;  4PHJ A;  3AAJ A;  4CFQ A;  2KI6 C;  1KFU S;  3IF7 A;  4KYN A;  1VRK A;  3PJI A;  2EC6 C;  1L2O C;  1SBJ A;  3O6B A;  1NX3 A;  2QPT A;  2HQW A;  1GGZ A;  1XFR A;  3NSO A;  2I18 A;  2LNK A;  3CZ1 A;  5FI2 A;  1CLL A;  1UHN A;  1GJY A;  2V53 A;  4C0L A;  2KSP A;  1NIW A;  1PUL A;  1Q80 A;  2M29 A;  1YUU A;  3EK8 A;  1TWO A;  1JSA A;  3BFH A;  1T14 A;  2KDH A;  4HRE E;  3VRR A;  2KFG A;  3QME A;  3R1V A;  1DMO A;  2KQY A;  2PVB A;  2WC5 A;  2BEC A;  1M45 A;  5BPJ A;  5D69 A;  1J7O A;  2NCO A;  1NSH A;  4I5L B;  1OOF A;  1NX2 A;  1CM4 A;  1QV0 A;  1V1F A;  3SS3 A;  4XYN A;  5FYX A;  1WRL A;  2L98 A;  3IVT A;  1REC A;  1J1D A;  4AOM A;  2B1U A;  3NXA A;  4GAO A;  1L7Z A;  2KYF A;  1L2O B;  3PN7 B;  4I5K A;  3DF0 A;  1K93 D;  3NSK A;  1JC2 A;  4Q04 A;  2M9G A;  1YX8 A;  4CFR A;  5HKZ A;  1DTL A;  1QJT A;  2P70 A;  2WC8 A;  1N65 A;  2JXC A;  2ERB A;  2QEV A;  3GK2 A;  1IQ3 A;  5DKQ A;  2Q91 A;  1SK6 D;  3CGA A;  1IH0 A;  2COL B;  2WND A;  4QJ3 B;  1CDN A;  1K9U A;  1K9K A;  3DF0 B;  2BCA A;  4AQI A;  3EK7 A;  3D73 A;  2P71 A;  5AXI A;  5CSN A;  1PAL A;  1ALW A;  1R6P A;  1F4Q A;  4WRI A;  1AJ4 A;  1IG5 A;  3KPX A;  2LUX A;  1XFW O;  3I5G C;  1SR6 C;  4MZK A;  5PAL A;  1ZUZ A;  1KWO C;  2LLT A;  1EL4 A;  2D8N A;  2MHH A;  1BG1 A;  4INX A;  4BY4 A;  2MAZ A;  3BUO B;  1OQP A;  2CBL A;  3CZ0 A;  5HYD A;  1DGU A;  2Y4Q A;  4OV2 A;  4IL1 A;  4ORB B;  5G08 A;  1LXF C;  2LP3 A;  4QJ4 B;  4M2P A;  3SJS A;  3UNW A;  1DEK A;  4CID A;  2HF5 A;  3D10 A;  3L47 A;  2JUL A;  2L2C A;  3NHT A;  3OX6 A;  1K8U A;  1TTX A;  1IQ5 A;  3EVU A;  4WQ3 A;  1KFX L;  1RTP 1;  2FOT A;  1PK0 D;  1BMO A;  3OGN A;  1J7Q A;  1JFK A;  2BBN A;  1W7J B;  3FE8 A;  4OCI A;  1XVJ A;  1QX2 A;  2WCH A;  2Y1N A;  1ALV A;  1BU3 A;  1DEL A;  1DC1 A;  3I5G B;  5CSJ A;  5GQQ C;  3I5F C;  3PFV A;  1NX1 A;  1SMG A;  2KLD A;  2MLE C;  4F7F A;  1SR6 B;  4M2O A;  2MA2 A;  3M0W A;  1N0Y A;  1S5G Z;  2JWW A;  2BE6 A;  2QEB A;  2Y1M A;  3MSE B;  4JD9 A;  5I2Q A;  1SSE B;  1DJG A;  1KWO B;  3I5H C;  1G4Y R;  3RZS A;  4TNC A;  4P2Y B;  4YI8 A;  1QVI Y;  1KK8 B;  5HKW A;  2L4I A;  4NDC A;  3ICB A;  1ZAC A;  2E30 A;  1Y1U A;  2AUC A;  4MZJ A;  5K89 A;  2BL0 B;  5ER5 A;  3NSL A;  4USL A;  2ISD A;  1CLB A;  1UHK A;  4PE7 A;  1H8B A;  4PE1 A;  1N2D A;  2WCE A;  2WCK A;  2KFH A;  3B6X A;  1AP4 A;  4A4B A;  1BJF A;  1F54 A;  1A75 A;  2WCF A;  1OSA A;  3TDU A;  3E3R A;  2LLU A;  3B88 A;  3I5F B;  1YUT A;  2P6B B;  2M0R A;  2RGI A;  2LC5 A;  1K2H A;  2ZND A;  4JWQ A;  1S5G Y;  1KFU L;  4FQO A;  1CDP A;  2AAO A;  3B86 A;  1A75 B;  1AUI B;  3OBV A;  1LS8 A;  3WHT B;  5AFP A;  3PAL A;  3TS5 C;  1C3Y A;  3BUN B;  2LV7 A;  4WQ2 A;  3DXL A;  1JF0 A;  2KLE A;  4MZL A;  1LVC D;  1Z4H A;  4ZCV A;  1LKJ A;  3IQQ A;  1SRA A;  3O4Y A;  4ORA B;  5J3X A;  4E68 A;  3C1V A;  2I2R E;  3SG6 A;  1XFZ O;  2KHN A;  4N5X A;  3CDN A;  1UP5 A;  4HSZ A;  3TUY C;  3BXK A;  3EG5 B;  4PHK A;  1IJ6 A;  4AQJ A;  1TCF A;  4JQ0 D;  3VGO A;  5I2O A;  1OOH A;  1MQ1 A;  1U5I A;  3FIA A;  1CMF A;  5I2L A;  1DJI A;  3PLF B;  2GGZ A;  4DIR A;  2LMT A;  3DZT A;  4GFT A;  2H2K A;  1LA3 A;  1J55 A;  3SG4 A;  3QRX A;  3TS5 B;  3K1E A;  4C0K A;  1B8R A;  3WHU B;  4BY5 A;  1U5I B;  3NHI A;  4I5N B;  3RLZ A;  1Z2C B;  2QDI A;  3DVM A;  2LVI A;  1B7T Y;  3FE6 A;  5HL1 A;  1TNX A;  2NLN A;  1BT6 A;  3I5I C;  1HT9 A;  3WNX B;  4PDZ A;  3UO9 A;  2CXJ A;  2LP2 A;  3PM2 A;  5JJG A;  2BCB A;  2EC6 B;  2JC2 A;  2KPH A;  4I5J A;  5IBW A;  4P5O E;  2MBX A;  1C7V A;  4NDD A;  2KNE A;  5I8N A;  1M39 A;  3TUY B;  2KAX A;  3A8R A;  1OOJ A;  1WLZ A;  2LCP A;  4INW A;  1NWD A;  1DJZ A;  1RWY A;  3JVT C;  1B8L A;  2OTG C;  5TNC A;  3AAK A;  3Q8I A;  1MUX A;  4DS7 A;  3WXA A;  4F0Z B;  5B8I B;  1B1G A;  3CR4 X;  2M7N A;  2KAV A;  4GGF C;  2GGM A; 
#chains in the Genus database with same CATH homology
 1IRJ A;  2AMI A;  1G8I A;  3HX4 A;  2F3Z A;  2F8P A;  1A2X A;  1PRW A;  2KI4 C;  2BCX A;  1V1G A;  2MRD A;  4YI9 A;  2KQ6 A;  2LLS A;  5AER A;  1TNP A;  1CNP A;  1E8A A;  5AAN A;  1FI5 A;  3K21 A;  1TCO B;  2I7A A;  5F6T A;  1OMV A;  3I5I B;  1K9P A;  2BKI B;  1BR1 B;  2A4J A;  2HQ8 A;  3BUW B;  3OP0 A;  1QVI Z;  4MRY A;  4PE4 A;  4GGF A;  1ZFS A;  1BOD A;  3VRQ A;  2JXL A;  4D1E A;  1B8C A;  2NXQ A;  1J1E A;  1YR5 A;  2F3Y A;  2KYC A;  1K94 A;  2PAS A;  3SIA A;  1K96 A;  3CR5 X;  4GGN A;  3JVT B;  2HPS A;  3OHM B;  2PMY A;  3RM1 A;  2F33 A;  4DUQ A;  2JTT A;  2BE4 A;  2ZRS A;  2MLF C;  1YVH A;  4XJK A;  5JOL A;  2JQ6 A;  2ZRT A;  4NDB A;  4HRG A;  1CB1 A;  1SKT A;  1MWN A;  2LUC A;  1SCM C;  3GOF A;  2M97 A;  2JNF A;  2L2E A;  1XYD A;  1JWD A;  1F8H A;  4OR9 B;  2FCE A;  4MN0 A;  3AKB A;  3SG2 A;  1M63 B;  1EXR A;  1UWO A;  1M46 A;  1CLM A;  1YUS A;  3DVJ A;  5HKY A;  4NQG A;  1UUS A;  1XO5 A;  3SG3 A;  1PSR A;  2NZ0 A;  1SYM A;  1NX0 A;  1D1O A;  4MLW A;  1S6J A;  1QXP A;  2LAN A;  3LLE A;  1XK4 C;  3VRP A;  2SCP A;  1CFD A;  2JPT A;  2PAL A;  1CDM A;  5CSI A;  3KF9 A;  3TDZ A;  1CTR A;  2CT9 A;  2H61 C;  3O2P A;  1R2U A;  3BYA A;  2ZN9 A;  1WDC C;  2BBM A;  1EG3 A;  3FWC A;  4MEW A;  4ETO A;  5HLV A;  5CSF A;  1JUO A;  1QIV A;  2M7L A;  1IKU A;  1AJ5 A;  3PAT A;  1MR8 A;  2LE9 B;  2SAS A;  1BLQ A;  1KQM C;  1F70 A;  2JNX A;  1SL9 A;  1XK4 A;  4QJ5 B;  1MHO A;  4CPV A;  1KSO A;  1YTZ C;  3I5H B;  3BOW A;  1TNQ A;  2K7D A;  2OS8 C;  2LMU A;  1CFF A;  2H61 A;  1RK9 A;  2WCB A;  3BUX B;  4R1E A;  3H4S E;  4MVF A;  2GV5 A;  1F55 A;  2F2O A;  4N1F A;  5KU1 A;  2M8U A;  4YGD B;  1B7T Z;  2JTZ A;  3SIB A;  3F45 A;  1XA5 A;  2LAP A;  3PM8 A;  4PCW A;  3BOW B;  2K8M B;  2M1K B;  4MRX A;  1KK7 Z;  4MBE A;  4PHM A;  1SCV A;  1GGW A;  1WDC B;  1PSB A;  3KO0 A;  1WY9 A;  2VRG A;  1H4B A;  3GK1 A;  2Q4U A;  1A03 A;  1C7W A;  1KSM A;  1TIZ A;  1UHI A;  2DOQ A;  2L51 A;  2JZI A;  1LA0 A;  3EK4 A;  2LVJ A;  1RJV A;  2OPO A;  1XFX O;  3OB2 B;  1YRT B;  3CR2 A;  1FI6 A;  1OZS A;  3EKH A;  4DRW A;  4A4C A;  1S3P A;  2ZFD A;  1BR4 B;  2M1U A;  1IGV A;  3FS7 A;  1OE9 B;  4PE0 A;  2ZNE A;  2OS8 B;  2R2I A;  1S6I A;  1NP8 A;  2JT0 A;  2K7B A;  1YVL A;  3EKJ A;  3O78 A;  1WLM A;  2PSR A;  4GBA A;  1B4C A;  1SY9 A;  5AEQ A;  3TDI A;  3TZ1 A;  3PN7 C;  3JTD C;  1JBA A;  4GNK B;  1M31 A;  2NCP A;  4DCK A;  1F71 A;  2G2B A;  2O60 A;  1Y6W A;  1QTX A;  1DJY A;  1SNL A;  1EG4 A;  1WRK A;  1IJ5 A;  1KK7 Y;  2K0J A;  2LHI A;  1NCY A;  1UHJ A;  3AKA A;  1XFY O;  1YRU B;  2LHL A;  2HET A;  3CTN A;  1B47 A;  1QIW A;  1DJX A;  1TOP A;  4YGE B;  1Y1X A;  1C07 A;  1B9A A;  2K2F A;  4M2Q A;  1G33 A;  1SW8 A;  4U8D A;  1FBV A;  1Y1A A;  2JU0 A;  3BUM B;  3OX5 A;  2L50 A;  1JF2 A;  2FCD A;  4PHN A;  4ORC B;  5DKR A;  1GQM A;  2WOS A;  1QLS A;  2G9B A;  1TNW A;  3PSR A;  4GPL B;  5D7F A;  2KAY A;  1MXL C;  3LK0 A;  3SG5 A;  1AK8 A;  1ZMZ A;  3JTD B;  2CTN A;  1UHH A;  2JT3 A;  1K95 A;  1S36 A;  1FW4 A;  1RFJ A;  2QAC A;  4YRU A;  2IS9 A;  1OMR A;  2K61 A;  1F4O A;  4JPZ B;  1EH2 A;  3EVR A;  3CZT X;  4ICB A;  3ZWH A;  3CS1 A;  4GUK A;  3LK1 A;  3CWG A;  2CCM A;  2OTG B;  2L4H A;  1S6C A;  1CKK A;  1S26 D;  2ZN8 A;  1IWQ A;  1XFV O;  1DJH A;  1TRF A;  2LVK A;  1DT7 B;  1FF1 A;  1YX7 A;  2LM5 A;  2KI4 B;  2KGB C;  2KBI A;  3KHE A;  1QX5 B;  4HRH A;  2K2A A;  3FWB A;  1CFC A;  1AHR A;  1PVB A;  3DVK A;  2I94 A;  1Y0V H;  1HQV A;  1MXE A;  1OZO A;  1TN4 A;  1KK8 C;  1K90 D;  3BQ3 A;  3CLN A;  4UPG A;  4XJK B;  4YGB B;  3LL8 B;  3HCM A;  3IQO A;  2E6W A;  1CDL A;  2K7O A;  2ZKM X;  2BL0 C;  2MJW B;  2O5G A;  1AVS A;  3SG7 A;  5KTY A;  3LCP C;  1WRZ A;  4L9M A;  2KGR A;  1LIN A;  4CLN A;  5HLO A;  1DF0 A;  1BOC A;  1CM1 A;  1RRO A;  1JFJ A;  1QS7 A;  2WOR A;  4PAL A;  1NYA A;  1OMD A;  2KFF A;  1NCZ A;  3ZNI A;  1CFP A;  1MF8 B;  2EHB A;  3D0Y A;  1S1E A;  1FPW A;  1QLK A;  4N1G A;  1DF0 B;  5KSZ A;  2F2P A;  1SCM B;  1KQV A;  2Y5I A;  1NCX A;  1SPY A;  1QX7 A;  5DKN A;  2M49 B;  3OB1 B;  2BKH B;  3DD4 A;  3NSI A;  1KFX S;  1ODB A;  3D0Y B;  4C0J A;  1W7I B;  3KEV A;  4FTG A;  1NUB A;  2JT8 A;  2TN4 A;  1QV1 A;  4YGC B;  2LMV A;  4ZCU A;  1CMG A;  1QAT A;  1SL7 A;  5CPV A;  1UUR A;  4OVN F;  3VRN A;  2CNP A;  4YGA A;  3VRO A;  2M3W A;  1SL8 A;  1NPQ A;  1DGV A;  5ER4 X;  2L0P A;  2L5X B;  1A29 A;  2JOJ A;  4MSP A;  1EJ3 A;  3GK4 X;  4YBH B;  1J7R A;  1DJW A;  1BF5 A;  1DVI A;  1PVA A;  2PRU A;  3DVE A;  1X02 A;  2JRF A;  1ZOT B;  1QAS A;  1J7P A;  3EVV A;  2K7C A;  1YUR A;  4OKH A;  1KQM B;  1XFU O;  1A4P A;  1KCY A;  2EGD A;  2KI6 D;  2KBM A;  2KOT A;  2LVV A;  3A4U B;  2FJU B;  4PHJ A;  3AAJ A;  4CFQ A;  2KI6 C;  1KFU S;  3IF7 A;  1VRK A;  2EC6 C;  1L2O C;  1SBJ A;  3O6B A;  1NX3 A;  2QPT A;  2HQW A;  1GGZ A;  3NSO A;  2I18 A;  2LNK A;  1CLL A;  1UHN A;  1GJY A;  2V53 A;  4C0L A;  2KSP A;  1NIW A;  1PUL A;  1Q80 A;  2M29 A;  1YUU A;  3EK8 A;  1JSA A;  4HRE E;  2KDH A;  3VRR A;  2KFG A;  1DMO A;  2KQY A;  2PVB A;  1J7O A;  2BEC A;  1M45 A;  5BPJ A;  5D69 A;  2NCO A;  1NSH A;  4I5L B;  1NX2 A;  1CM4 A;  1QV0 A;  1V1F A;  4XYN A;  5FYX A;  1WRL A;  2L98 A;  1REC A;  1J1D A;  4AOM A;  2B1U A;  3NXA A;  4GAO A;  1L7Z A;  2KYF A;  1L2O B;  3PN7 B;  4I5K A;  3DF0 A;  1K93 D;  3NSK A;  1JC2 A;  4Q04 A;  2M9G A;  1YX8 A;  4CFR A;  5HKZ A;  1DTL A;  1QJT A;  3GK2 A;  2WC8 A;  1N65 A;  2JXC A;  1IQ3 A;  5DKQ A;  2Q91 A;  1SK6 D;  3CGA A;  1IH0 A;  2COL B;  2WND A;  4QJ3 B;  1CDN A;  1K9U A;  1K9K A;  3DF0 B;  2BCA A;  4AQI A;  3EK7 A;  5AXI A;  5CSN A;  1PAL A;  1ALW A;  1R6P A;  1F4Q A;  4WRI A;  1AJ4 A;  1IG5 A;  3KPX A;  2LUX A;  1XFW O;  3I5G C;  1SR6 C;  4MZK A;  5PAL A;  1ZUZ A;  1KWO C;  2LLT A;  1EL4 A;  2D8N A;  2MHH A;  1BG1 A;  4BY4 A;  2MAZ A;  3BUO B;  1OQP A;  2CBL A;  5HYD A;  1DGU A;  2Y4Q A;  4OV2 A;  4IL1 A;  4ORB B;  5G08 A;  1LXF C;  2LP3 A;  4QJ4 B;  4M2P A;  3SJS A;  4CID A;  2HF5 A;  3D10 A;  2JUL A;  3OX6 A;  4WQ3 A;  1K8U A;  1TTX A;  1IQ5 A;  3EVU A;  1KFX L;  1RTP 1;  2FOT A;  1PK0 D;  1BMO A;  1J7Q A;  1JFK A;  2BBN A;  1W7J B;  4OCI A;  1XVJ A;  1QX2 A;  2Y1N A;  1ALV A;  1BU3 A;  3I5G B;  5CSJ A;  5GQQ C;  3I5F C;  3PFV A;  1NX1 A;  1SMG A;  2MLE C;  1SR6 B;  4M2O A;  2MA2 A;  3M0W A;  1N0Y A;  1S5G Z;  2JWW A;  2BE6 A;  2Y1M A;  5I2Q A;  3MSE B;  1DJG A;  1KWO B;  3I5H C;  1G4Y R;  4TNC A;  4P2Y B;  4YI8 A;  1QVI Y;  1KK8 B;  5HKW A;  2L4I A;  4NDC A;  3ICB A;  1ZAC A;  2E30 A;  1Y1U A;  2AUC A;  4MZJ A;  5K89 A;  2BL0 B;  5ER5 A;  3NSL A;  4USL A;  2ISD A;  1CLB A;  1UHK A;  4PE7 A;  1H8B A;  4PE1 A;  1N2D A;  2WCE A;  2KFH A;  1AP4 A;  4A4B A;  1BJF A;  1F54 A;  1A75 A;  2WCF A;  1OSA A;  3TDU A;  3E3R A;  2LLU A;  3I5F B;  1YUT A;  2P6B B;  2M0R A;  2RGI A;  2LC5 A;  1K2H A;  2ZND A;  4JWQ A;  1S5G Y;  1KFU L;  4FQO A;  1CDP A;  2AAO A;  1A75 B;  1AUI B;  3WHT B;  5AFP A;  3PAL A;  3TS5 C;  3BUN B;  2LV7 A;  4WQ2 A;  1JF0 A;  4MZL A;  1LVC D;  4ZCV A;  1LKJ A;  3IQQ A;  1SRA A;  3O4Y A;  4ORA B;  5J3X A;  4E68 A;  3C1V A;  2I2R E;  3SG6 A;  1XFZ O;  2KHN A;  4N5X A;  1UP5 A;  4HSZ A;  3TUY C;  3BXK A;  4PHK A;  1IJ6 A;  4AQJ A;  1TCF A;  4JQ0 D;  3VGO A;  5I2O A;  1MQ1 A;  1U5I A;  3FIA A;  1CMF A;  5I2L A;  1DJI A;  3PLF B;  2GGZ A;  4DIR A;  2LMT A;  4GFT A;  2H2K A;  1LA3 A;  1J55 A;  3SG4 A;  3QRX A;  3TS5 B;  4C0K A;  1B8R A;  3WHU B;  4BY5 A;  1U5I B;  4I5N B;  3RLZ A;  3DVM A;  2LVI A;  1B7T Y;  1TNX A;  2NLN A;  1BT6 A;  3I5I C;  1HT9 A;  3WNX B;  4PDZ A;  2CXJ A;  2LP2 A;  5JJG A;  2BCB A;  2EC6 B;  2JC2 A;  5IBW A;  4I5J A;  1C7V A;  4P5O E;  2MBX A;  4NDD A;  2KNE A;  5I8N A;  1M39 A;  3TUY B;  2KAX A;  3A8R A;  1OOJ A;  1WLZ A;  2LCP A;  1NWD A;  1DJZ A;  1RWY A;  3JVT C;  1B8L A;  2OTG C;  5TNC A;  3AAK A;  4DS7 A;  1MUX A;  4F0Z B;  3WXA A;  5B8I B;  1B1G A;  3CR4 X;  2M7N A;  2KAV A;  4GGF C;  2GGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...