2GGMA

Human centrin 2 xeroderma pigmentosum group c protein complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
ELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Centrin-2
publication title The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ggmA02
2K0JA 5HKYA 2B1UA 1B7TY 4U8DA 5AXIA 1SL8A 2H61C 2K2FA 2KAXA 1BLQA 2BE6A 2KAVA 1NIWA 3PN7B 1CLMA 2MBXA 2BL0B 1BR1B 2K7DA 1OMVA 2H2KA 1JBAA 2LVIA 4P5OE 1BOCA 1UURA 2NCPA 3TDUA 1K9PA 1CDNA 1CLBA 2Q91A 5JOLA 1S1EA 2LM5A 1FBVA 3AAKA 3WXAA 1AUIB 2LVVA 2KGBC 1TOPA 3EK4A 3A8RA 3JVTC 5KTYA 1DGVA 3EVVA 1JF0A 2BE4A 4ETOA 2LUCA 4MZLA 1YRTB 1K95A 3AAJA 3I5GC 4JWQA 4M2OA 4PHNA 3OB2B 2BKHB 3SG4A 2L4HA 2M3WA 1U5IB 4FQOA 5CSJA 1BF5A 1WRLA 1G8IA 4YI9A 2E30A 2LANA 4OR9B 1S26D 1ZUZA 1MHOA 3GK1A 1IGVA 1QV0A 4PE7A 5FYXA 1A4PA 1F71A 1F8HA 1GJYA 1CDLA 4P2YB 5J3XA 2AAOA 3WHUB 1F70A 2ZRTA 4ZCUA 1OZSA 3GK4X 4CFRA 1DF0B 2LE9B 3DVJA 1FPWA 3DF0B 1BG1A 1GQMA 2PMYA 1SYMA 3I5HB 3ZWHA 2KYFA 1XA5A 1ZACA 2I18A 4ORCB 1IKUA 3NXAA 2M1UA 4C0JA 2LVJA 4DIRA 1K2HA 1PULA 4N5XA 1ZFSA 1EG4A 1XFWO 2FOTA 3F45A 4ZCVA 1M39A 2M9GA 4M2QA 1L7ZA 2F8PA 1KFUL 4DCKA 1JWDA 1B8CA 4GBAA 5IBWA 1L2OC 3H4SE 2HPSA 2JT0A 3TDZA 1QVIY 2WCEA 2AMIA 1CTRA 2KI4B 2KAYA 1H8BA 4MVFA 1NCZA 2EHBA 2JZIA 3FWCA 1QIVA 1K96A 1V1FA 3AKBA 4DS7A 2KDHA 1KK8B 2KNEA 3KPXA 3C1VA 1YUSA 4YGDB 1SMGA 3DVEA 2Y4QA 5G08A 4L9MA 3I5FC 2ZKMX 2KOTA 1KFXL 4CPVA 3TUYB 2LLUA 2ZN8A 3TDIA 2LAPA 4MRXA 1WDCB 1UP5A 4JQ0D 1QX2A 5HYDA 1WLZA 2AUCA 1G33A 2BCXA 4PE0A 5DKQA 2LHIA 1A75B 4NDCA 1YUTA 1YTZC 1XFZO 1DTLA 1NCYA 3NSKA 1MUXA 2K7CA 4NDDA 2KQYA 4OVNF 4HRHA 4YGEB 4PE4A 1R6PA 2KYCA 1PSRA 1N2DA 2ISDA 4AOMA 3SG3A 4XJKA 3VRNA 1AJ5A 1MXLC 1YRUB 2JT3A 2KQ6A 2LUXA 1DJGA 1LXFC 1XFYO 1H4BA 3CWGA 2CTNA 3OP0A 5HKWA 3JVTB 1ALVA 2BBNA 3D0YA 4WRIA 2MLEC 2ZNEA 5CSIA 3I5GB 2JNFA 1EG3A 1ZOTB 4AQIA 3EK7A 1TCOB 3PSRA 4GAOA 2L51A 3CR4X 4MSPA 1MWNA 1CMGA 1N0YA 4PHMA 1UUSA 2M8UA 4YRUA 1JSAA 1QXPA 1NYAA 1RTP1 4OV2A 3I5IC 1PALA 1NPQA 1CDPA 4IL1A 4MEWA 5DKNA 4GGNA 1SK6D 4F0ZB 4ICBA 2NCOA 2Y5IA 1B4CA 3LL8B 3BXKA 2M7NA 1AK8A 2L5XB 4YGCB 5PALA 1EH2A 5I2OA 4CIDA 1J7QA 4CLNA 1IH0A 1F54A 2O60A 3ICBA 2GV5A 4UPGA 2LMUA 1SL7A 2FJUB 1TIZA 2I94A 2KI6C 4GGFA 1DJXA 1QJTA 2JPTA 2KFFA 1HQVA 1B1GA 4YGBB 2OTGC 1LVCD 1N65A 2LHLA 4OCIA 2V53A 5K89A 1Q80A 2LV7A 1FI5A 2L2EA 2LLSA 2HETA 5F6TA 5KSZA 3VRRA 1MQ1A 5ER4X 1XFUO 2LLTA 2Y1MA 1IJ6A 4BY5A 1CB1A 1OOJA 1XO5A 2L4IA 3O2PA 1BMOA 5CSNA 2JOJA 2KHNA 5CSFA 1F4QA 3RLZA 5GQQC 4QJ4B 1SNLA 3JTDC 3EVUA 5I2QA 1CFFA 1UHIA 3OX6A 1CLLA 1YVHA 1DT7B 1K94A 1TN4A 2CCMA 2HF5A 2FCEA 3KHEA 1SR6B 4GUKA 1VRKA 1KWOC 1CFDA 1KFXS 1JFKA 1YR5A 2EC6C 2M1KB 2SCPA 4MN0A 1J7OA 1DJZA 1SPYA 1CM1A 3DD4A 1XFVO 1KSMA 4NDBA 5BPJA 1KQMC 3NSIA 1SW8A 2A4JA 1B8LA 1M31A 1NP8A 2OS8B 3DVMA 1Y6WA 1S5GZ 4YI8A 4N1GA 2M97A 2NLNA 3ZNIA 4WQ3A 5CPVA 2F2OA 1Y0VH 2JNXA 2F2PA 1LKJA 1M46A 1C7VA 1DJWA 1WY9A 4I5LB 4NQGA 1SCMC 1SRAA 2PVBA 3PN7C 3PM8A 2DOQA 1B47A 1G4YR 5I8NA 2F3YA 5HLVA 2MHHA 1K93D 3OB1B 3SG6A 2WOSA 1M45A 2LMVA 1TNWA 2CNPA 2L98A 4YGAA 1K9UA 5ER5A 1A29A 1AVSA 1C7WA 2ZNDA 3LK0A 1QVIZ 1EJ3A 1C07A 2LMTA 3IF7A 2BCAA 1RWYA 2JWWA 4MLWA 3M0WA 2MJWB 2NZ0A 3BOWB 3PATA 3TS5C 4DRWA 1U5IA 3BUXB 1BJFA 3IQQA 1TTXA 4R1EA 2MA2A 4C0KA 1KQVA 2BCBA 2F33A 2JXLA 1SCVA 3WHTB 2M29A 2E6WA 2F3ZA 1J7PA 2BECA 1WRKA 2M0RA 1S36A 3CTNA 2GGZA 1NX2A 4HSZA 1CDMA 4MZJA 2ZFDA 1UHHA 2EGDA 3LCPC 3SG5A 1SBJA 1DF0A 2I2RE 2KFGA 4C0LA 3DF0A 4XYNA 2K7OA 1KK7Z 3CS1A 1YUUA 1TNPA 1BT6A 2CT9A 1XVJA 1OMRA 3VRPA 3IQOA 1IG5A 2JRFA 1ZMZA 5AANA 1K90D 2KSPA 2ZRSA 2L50A 3WNXB 1JUOA 2PALA 2ZN9A 3BQ3A 2KBMA 3O78A 1PSBA 3VGOA 1YX7A 2M7LA 4MRYA 1NX0A 1F4OA 1XK4A 3PALA 2K7BA 3O4YA 1ODBA 1LA3A 4WQ2A 3EVRA 1PVBA 1OQPA 1E8AA 1J7RA 2Y1NA 1FF1A 5D69A 1QLKA 1QIWA 1YURA 3D10A 1D1OA 2TN4A 4GPLB 2SASA 1W7IB 2QPTA 1A2XA 4MBEA 1DVIA 2GGMA 1ALWA 1HT9A 4GNKB 5DKRA 1CNPA 1KWOB 2WC8A 2JULA 1EXRA 2EC6B 2JQ6A 3CZTX 3HX4A 3CLNA 3EKJA 4MZKA 5AERA 2D8NA 3LK1A 2G2BA 1QX5B 3TZ1A 3SG7A 4OKHA 2IS9A 2PRUA 4PHKA 4FTGA 1S6JA 4D1EA 1DJHA 1CMFA 1B7TZ 1TRFA 1XFXO 2Q4UA 2QACA 1L2OB 1IQ5A 1A75A 4GGFC 4YBHB 1Y1UA 1KFUS 4M2PA 1SKTA 1B9AA 1XYDA 3CR2A 1LA0A 2M49B 3DVKA 4PCWA 1IRJA 1FW4A 2LP2A 4HREE 4CFQA 3EKHA 1JFJA 3HCMA 1SCMB 1JC2A 1BODA 1BU3A 3BYAA 1OE9B 1RROA 1V1GA 1AJ4A 1MXEA 5B8IB 1NSHA 1QLSA 1DJIA 1AHRA 1B8RA 1OMDA 1PK0D 1K9KA 2MAZA 3I5FB 3KEVA 3LLEA 3MSEB 1F55A 3SIBA 5TNCA 2P6BB 1IWQA 1RK9A 3E3RA 1UHNA 3CGAA 2L0PA 3K21A 3TS5B 3EK8A 2JU0A 2LP3A 5JJGA 1CFPA 1CKKA 4E68A 1NX1A 1J55A 3BUWB 3OHMB 3BUOB 1S3PA 1GGWA 2K61A 1NCXA 4I5NB 1FI6A 1QATA 1J1EA 1QS7A 1KSOA 2CBLA 4JPZB 1J1DA 2HQWA 4Q04A 1AP4A 3KF9A 1MR8A 1DGUA 3FIAA 2MRDA 1DJYA 1TNQA 2JTZA 1S5GY 3PLFB 1LINA 4XJKB 2MLFC 1BR4B 1QASA 3CR5X 2LNKA 5AFPA 1S6CA 2BBMA 3NSOA 2R2IA 2BL0C 3RM1A 1IJ5A 1Y1AA 2I7AA 1OSAA 3D0YB 1R2UA 2KFHA 4PALA 1EL4A 1NWDA 4DUQA 2O5GA 2LVKA 1TCFA 2COLB 1QTXA 3KO0A 3I5IB 2LCPA 1GGZA 3PFVA 3VROA 1RFJA 1RECA 4I5KA 3FS7A 2NXQA 5D7FA 1RJVA 1MF8B 2PSRA 2WORA 2G9BA 3FWBA 2CXJA 2VRGA 2FCDA 1PVAA 1NX3A 3O6BA 1W7JB 2KBIA 1QV1A 1SR6C 2BKIB 3AKAA 4PE1A 2OTGB 1X02A 4TNCA 4I5JA 2HQ8A 1KCYA 3I5HC 1UWOA 1K8UA 2JT8A 2K8MB 1KK7Y 2PASA 3VRQA 2KI6D 2OPOA 1M63B 4N1FA 4QJ5B 4A4CA 4PDZA 2JC2A 1PRWA 3BUNB 2OS8C 1Y1XA 1UHKA 3A4UB 1OZOA 1A03A 1XK4C 4HRGA 1WLMA 4ORBB 3SJSA 1UHJA 2JTTA 1IQ3A 1SY9A 4BY4A 5I2LA 2WCFA 3QRXA 4QJ3B 3JTDB 2K2AA 2RGIA 2KI4C 1NUBA 1DMOA 2LC5A 2JXCA 1S6IA 2WCBA 1YX8A 1SL9A 3SG2A 4AQJA 3OX5A 5AEQA 1CFCA 1KK8C 4ORAB 5KU1A 1TNXA 4A4BA 5HKZA 1WRZA 1KQMB 3BUMB 4GFTA 3GOFA 2KGRA 3SIAA 3BOWA 1JF2A 3GK2A 4USLA 4PHJA 3TUYC 1QX7A 5HLOA 1CM4A 1WDCC 2WNDA 1YVLA 3NSLA 2H61A
chains in the Genus database with same CATH superfamily
2K0JA 5HKYA 4INXA 2B1UA 1B7TY 4U8DA 5AXIA 1SL8A 2H61C 2K2FA 2KAXA 1BLQA 2BE6A 2KAVA 1NIWA 3PN7B 1CLMA 2MBXA 2BL0B 3B87A 1BR1B 2K7DA 1OMVA 2H2KA 1JBAA 2LVIA 4P5OE 1BOCA 1UURA 1IIOA 2NCPA 3TDUA 1K9PA 2KLDA 1CDNA 1CLBA 2Q91A 5JOLA 1S1EA 2LM5A 1FBVA 3AAKA 3WXAA 1AUIB 2LVVA 2KGBC 1TOPA 3EK4A 3A8RA 3JVTC 5KTYA 1DGVA 3EVVA 1JF0A 2BE4A 4OZDA 4ETOA 2LUCA 4MZLA 1YRTB 1K95A 3AAJA 3I5GC 4JWQA 4M2OA 4PHNA 3OB2B 2BKHB 3SG4A 1OOFA 2L4HA 2M3WA 1U5IB 4FQOA 5CSJA 1BF5A 1WRLA 1G8IA 4YI9A 2E30A 2LANA 2H8VA 4OR9B 1S26D 1OOIX 1ZUZA 1MHOA 3GK1A 1IGVA 1QV0A 4PE7A 5FYXA 1A4PA 1F71A 1F8HA 1GJYA 1CDLA 4P2YB 5J3XA 2AAOA 2WCJA 3NHIA 3WHUB 2PYQA 1F70A 2ZRTA 4ZCUA 1OZSA 3GK4X 4CFRA 3S0FA 1DF0B 2LE9B 3DVJA 1FPWA 3DF0B 1BG1A 1GQMA 2PMYA 1SYMA 3I5HB 3ZWHA 2KYFA 1XA5A 1ZACA 2I18A 4ORCB 1IKUA 2KLEA 2M1UA 3NXAA 2WCHA 4C0JA 2LVJA 4DIRA 1K2HA 1PULA 4N5XA 1ZFSA 1EG4A 1XFWO 2L2CA 2FOTA 3F45A 4ZCVA 2P70A 1M39A 2M9GA 2QEOA 1L7ZA 4M2QA 2F8PA 1KFUL 4DCKA 1JWDA 3SS5A 1B8CA 4GBAA 5IBWA 1L2OC 3H4SE 2WC5A 2HPSA 3S0GA 2JT0A 3TDZA 3BFHA 1QVIY 2WCEA 2AMIA 1CTRA 1QWVA 2KI4B 2KAYA 1H8BA 3OBVA 4MVFA 1NCZA 2EHBA 2JZIA 3FWCA 1QIVA 1K96A 1V1FA 3AKBA 4DS7A 2KDHA 1KK8B 2KNEA 3CZ1A 3C1VA 3KPXA 1YUSA 4YGDB 1SMGA 3DVEA 2Y4QA 5G08A 4L9MA 3I5FC 2WCMA 2ZKMX 2KOTA 1KFXL 4CPVA 4IJ7A 2LLUA 3TUYB 2ZN8A 3TDIA 2LAPA 4MRXA 1WDCB 1UP5A 4JQ0D 3N7HA 3IVTA 1QX2A 5HYDA 1WLZA 2AUCA 1G33A 2BCXA 3FE9A 4PE0A 5DKQA 2LHIA 1W9ZA 3L4AA 1A75B 1ORGA 2QEHA 4NDCA 1YUTA 2QEBA 5EL2A 1YTZC 1XFZO 3L4LA 1DTLA 1NCYA 3NSKA 1MUXA 2K7CA 4NDDA 2KQYA 3D75A 4HRHA 4OVNF 4PE4A 1R6PA 2KYCA 4YGEB 3SS3A 3Q8IA 1PSRA 1N2DA 2ISDA 4AOMA 3SG3A 4XJKA 3VRNA 1AJ5A 1MXLC 1YRUB 2JT3A 2KQ6A 5FI2A 2LUXA 1DJGA 1LXFC 1XFYO 1H4BA 3CWGA 2CTNA 3OP0A 5HKWA 3JVTB 1ALVA 2BBNA 3D0YA 4WRIA 3PM2A 2MLEC 2ZNEA 5CSIA 3I5GB 2JNFA 1EG3A 1ZOTB 4AQIA 3EK7A 3PJIA 1TCOB 3PSRA 4GAOA 2L51A 3CR4X 4MSPA 1MWNA 1CMGA 1N0YA 4PHMA 1UUSA 2M8UA 4YRUA 3FE8A 1JSAA 1QXPA 1NYAA 1RTP1 4OV2A 3I5IC 1PALA 1NPQA 1CDPA 4IL1A 4MEWA 5DKNA 4GGNA 1SK6D 4F0ZB 4ICBA 2NCOA 2Y5IA 3D76A 3LL8B 1B4CA 3BXKA 2M7NA 1AK8A 2L5XB 4YGCB 5PALA 1EH2A 3OGNA 5I2OA 4CIDA 1J7QA 3K1EA 4CLNA 1IH0A 1Z2CB 1F54A 4KYNA 2O60A 3D74A 2GV5A 3ICBA 4UPGA 2LMUA 2YGUA 3L47A 1SL7A 2FJUB 1TIZA 2I94A 2KI6C 4GGFA 1DJXA 1QJTA 2JPTA 2KFFA 1HQVA 1B1GA 4YGBB 4JD9A 2OTGC 1LVCD 1N65A 2LHLA 2L5YA 4OCIA 1OOGA 2V53A 5K89A 1Q80A 2LV7A 1FI5A 2L2EA 2LLSA 2HETA 5F6TA 5KSZA 3VRRA 1MQ1A 5ER4X 1XFUO 3SS4A 3R1PA 2LLTA 2Y1MA 1IJ6A 4BY5A 1CB1A 1OOJA 1XO5A 2L4IA 3O2PA 1BMOA 3CYZA 5CSNA 2KPHA 2JOJA 2KHNA 1P28A 5CSFA 1OW4A 2WCLA 1F4QA 3RLZA 5GQQC 4QJ4B 1SNLA 2K60A 2JPOA 3JTDC 3EVUA 5I2QA 1CFFA 1UHIA 3OX6A 1CLLA 1YVHA 1DT7B 1K94A 1TN4A 2CCMA 2HF5A 2FCEA 3CABA 3KHEA 1SR6B 4GUKA 1VRKA 1KWOC 1CFDA 1KFXS 1JFKA 1YR5A 1GM0A 2EC6C 2M1KB 2SCPA 4MN0A 1J7OA 1DJZA 1SPYA 1CM1A 3DD4A 1XFVO 1KSMA 4NDBA 5BPJA 3D78A 1KQMC 3NSIA 1SW8A 2A4JA 1B8LA 1M31A 1NP8A 2OS8B 3DVMA 1Y6WA 1S5GZ 4YI8A 4N1GA 2M97A 2NLNA 3ZNIA 4WQ3A 5CPVA 2F2OA 1Y0VH 3CZ2A 2JNXA 3UO9A 2F2PA 5DICA 1LKJA 1M46A 3DY9A 1DJWA 1C7VA 1WY9A 3R1OA 4I5LB 4NQGA 1Z4HA 1SCMC 1SRAA 2PVBA 3PN7C 4INWA 1DC1A 3PM8A 2DOQA 1B47A 1G4YR 5I8NA 2F3YA 5FI6A 3DXLA 5HLVA 2MHHA 1K93D 3OB1B 3SG6A 2WOSA 1M45A 2LMVA 1LS8A 1TNWA 2CNPA 2L98A 4YGAA 1K9UA 5ER5A 1A29A 1AVSA 3DZTA 1C7WA 2ZNDA 3LK0A 1QVIZ 1EJ3A 1C07A 2LMTA 3IF7A 3NGVA 2BCAA 1RWYA 2JWWA 2WCKA 4MLWA 3M0WA 2MJWB 2NZ0A 3BOWB 3PATA 3TS5C 4DRWA 5HL1A 1U5IA 4F7FA 3BUXB 1BJFA 3IQQA 1TTXA 4R1EA 2MA2A 4C0KA 1KQVA 2BCBA 2F33A 2JXLA 1SCVA 3BJHA 3WHTB 2ERBA 2M29A 2E6WA 2F3ZA 3O4XA 1J7PA 2BECA 1WRKA 2M0RA 1S36A 3CTNA 2GGZA 1NX2A 4HSZA 1CDMA 4MZJA 2ZFDA 1UHHA 2EGDA 3LCPC 3SG5A 1SBJA 1DF0A 2I2RE 2KFGA 4C0LA 3DF0A 4XYNA 2K7OA 1KK7Z 3CS1A 1YUUA 1TNPA 1BT6A 2CT9A 1XVJA 1OMRA 3VRPA 3IQOA 1IG5A 2JRFA 1ZMZA 5AANA 1K90D 2KSPA 2ZRSA 2L50A 3WNXB 1JUOA 2PALA 2ZN9A 3BQ3A 1TUZA 2KBMA 3O78A 1PSBA 3VGOA 1YX7A 2M7LA 4MRYA 1NX0A 1F4OA 1TWOA 1XK4A 2K7BA 2WC6A 3O4YA 3PALA 1ODBA 1LA3A 1OOHA 4WQ2A 3R72A 3EVRA 1PVBA 1OQPA 1E8AA 3D77A 1J7RA 2Y1NA 1FF1A 5D69A 3BFAA 1QLKA 1QIWA 1YURA 3D10A 1D1OA 2BAPA 2TN4A 4GPLB 3S0DA 2SASA 1TUJA 1W7IB 2QPTA 1A2XA 4MBEA 1DVIA 2GGMA 3B7AA 1ALWA 1HT9A 4GNKB 5DKRA 1CNPA 1KWOB 2WC8A 2JULA 1EXRA 2EC6B 2JQ6A 3CZTX 3BFBA 3HX4A 3CLNA 3EKJA 4MZKA 5AERA 2D8NA 3LK1A 2G2BA 1QX5B 3TZ1A 3SG7A 4OKHA 2IS9A 2PRUA 4FQTA 4PHKA 4FTGA 1S6JA 4D1EA 1DJHA 1CMFA 1B7TZ 1TRFA 3CDNA 1DEKA 1XFXO 2Q4UA 2QACA 3B88A 5D3OA 1L2OB 1IQ5A 1A75A 2FJYA 4GGFC 4YBHB 3S0AA 1Y1UA 1KFUS 3V2LA 4M2PA 1SKTA 1B9AA 1XYDA 3CR2A 1LA0A 2M49B 3DVKA 4PCWA 1IRJA 1FW4A 2LP2A 4HREE 4CFQA 3EKHA 1JFJA 3HCMA 1SCMB 1JC2A 1BODA 3EG5B 1BU3A 3BYAA 1OE9B 1RROA 1V1GA 1AJ4A 1MXEA 5B8IB 1NSHA 1QLSA 1DJIA 1AHRA 1B8RA 1OMDA 3B86A 1PK0D 1K9KA 2MAZA 3I5FB 1DQEA 3KEVA 3LLEA 3MSEB 3S0EA 1F55A 3SIBA 5TNCA 2P6BB 1IWQA 1RK9A 3E3RA 1UHNA 3CGAA 2L0PA 3K21A 3TS5B 3EK8A 2JU0A 2LP3A 5JJGA 1CFPA 1CKKA 4E68A 1NX1A 1J55A 3D73A 3BUWB 3OHMB 3BUOB 3S0BA 1S3PA 1GGWA 3QMEA 2K61A 1NCXA 4I5NB 1FI6A 1QATA 1J1EA 1QS7A 1KSOA 2CBLA 1DELA 4JPZB 1J1DA 2HQWA 4Q04A 1AP4A 3KF9A 1MR8A 1DGUA 3FIAA 2MRDA 1DJYA 1TNQA 2JTZA 1S5GY 3PLFB 1LINA 2PQLA 4XJKB 2MLFC 1BR4B 1QASA 3CR5X 2LNKA 5AFPA 1S6CA 2BBMA 3NSOA 4PT1A 2R2IA 2BL0C 3RM1A 1IJ5A 1Y1AA 5I94A 2I7AA 1OSAA 3D0YB 3VB1A 2P71A 1R2UA 2KFHA 4PALA 1T14A 1EL4A 1NWDA 4DUQA 1SSEB 2O5GA 3FE6A 2LVKA 1TCFA 2COLB 1QTXA 3DYEA 3KO0A 3I5IB 2LCPA 1GGZA 3PFVA 3RZSA 3VROA 2GTEA 1RFJA 1RECA 4I5KA 3FS7A 2NXQA 5D7FA 3UNWA 1RJVA 1MF8B 3R1VA 2PSRA 2WORA 2G9BA 3FWBA 1XFRA 2CXJA 2VRGA 2FCDA 1PVAA 1NX3A 3O6BA 1W7JB 2KBIA 1QV1A 1SR6C 2BKIB 3AKAA 4PE1A 2QDIA 2OTGB 1X02A 4TNCA 4I5JA 2HQ8A 1KCYA 3I5HC 1UWOA 1K8UA 2JT8A 2K8MB 1KK7Y 2PASA 3VRQA 2KI6D 2OPOA 1M63B 4N1FA 4QJ5B 1C3YA 4A4CA 4PDZA 2JC2A 1PRWA 3BUNB 2OS8C 1Y1XA 1UHKA 3A4UB 1OZOA 1A03A 1XK4C 4HRGA 1WLMA 4ORBB 3SJSA 2QEVA 1UHJA 2JTTA 3NHTA 1IQ3A 1SY9A 4BY4A 5I2LA 2WCFA 3QRXA 4QJ3B 3JTDB 2K2AA 2RGIA 2KI4C 5FI7A 1NUBA 3CZ0A 1DMOA 2LC5A 2JXCA 1S6IA 2WCBA 4JKTA 1C3ZA 1YX8A 1SL9A 2BNXA 3SG2A 4AQJA 3OX5A 3B6XA 5AEQA 1CFCA 1KK8C 4ORAB 5KU1A 1TNXA 4A4BA 5HKZA 1WRZA 1KQMB 3BUMB 4GFTA 3GOFA 2KGRA 3SIAA 3BOWA 1JF2A 3GK2A 4USLA 4PHJA 3TUYC 1QX7A 5HLOA 1CM4A 1WDCC 2WNDA 1YVLA 3NSLA 2H61A
chains in the Genus database with same CATH topology
2K0JA 5HKYA 2B1UA 1B7TY 4U8DA 5AXIA 1SL8A 2H61C 2K2FA 2KAXA 1BLQA 2BE6A 2KAVA 1NIWA 3PN7B 1CLMA 2MBXA 2BL0B 1BR1B 2K7DA 1OMVA 2H2KA 1JBAA 2LVIA 4P5OE 1BOCA 1UURA 2NCPA 3TDUA 1K9PA 1CDNA 1CLBA 2Q91A 5JOLA 1S1EA 2LM5A 1FBVA 3AAKA 3WXAA 1AUIB 2LVVA 2KGBC 1TOPA 3EK4A 3A8RA 3JVTC 5KTYA 1DGVA 3EVVA 1JF0A 2BE4A 4ETOA 2LUCA 4MZLA 1YRTB 1K95A 3AAJA 3I5GC 4JWQA 4M2OA 4PHNA 3OB2B 2BKHB 3SG4A 2L4HA 2M3WA 1U5IB 4FQOA 5CSJA 1BF5A 1WRLA 1G8IA 4YI9A 2E30A 2LANA 4OR9B 1S26D 1ZUZA 1MHOA 3GK1A 1IGVA 1QV0A 4PE7A 5FYXA 1A4PA 1F71A 1F8HA 1GJYA 1CDLA 4P2YB 5J3XA 2AAOA 3WHUB 1F70A 2ZRTA 4ZCUA 1OZSA 3GK4X 4CFRA 1DF0B 2LE9B 3DVJA 1FPWA 3DF0B 1BG1A 1GQMA 2PMYA 1SYMA 3I5HB 3ZWHA 2KYFA 1XA5A 1ZACA 2I18A 4ORCB 1IKUA 3NXAA 2M1UA 4C0JA 2LVJA 4DIRA 1K2HA 1PULA 4N5XA 1ZFSA 1EG4A 1XFWO 2FOTA 3F45A 4ZCVA 1M39A 2M9GA 4M2QA 1L7ZA 2F8PA 1KFUL 4DCKA 1JWDA 1B8CA 4GBAA 5IBWA 1L2OC 3H4SE 2HPSA 2JT0A 3TDZA 1QVIY 2WCEA 2AMIA 1CTRA 2KI4B 2KAYA 1H8BA 4MVFA 1NCZA 2EHBA 2JZIA 3FWCA 1QIVA 1K96A 1V1FA 3AKBA 4DS7A 2KDHA 1KK8B 2KNEA 3KPXA 3C1VA 1YUSA 4YGDB 1SMGA 3DVEA 2Y4QA 5G08A 4L9MA 3I5FC 2ZKMX 2KOTA 1KFXL 4CPVA 3TUYB 2LLUA 2ZN8A 3TDIA 2LAPA 4MRXA 1WDCB 1UP5A 4JQ0D 1QX2A 5HYDA 1WLZA 2AUCA 1G33A 2BCXA 4PE0A 5DKQA 2LHIA 1A75B 4NDCA 1YUTA 1YTZC 1XFZO 1DTLA 1NCYA 3NSKA 1MUXA 2K7CA 4NDDA 2KQYA 4OVNF 4HRHA 4YGEB 4PE4A 1R6PA 2KYCA 1PSRA 1N2DA 2ISDA 4AOMA 3SG3A 4XJKA 3VRNA 1AJ5A 1MXLC 1YRUB 2JT3A 2KQ6A 2LUXA 1DJGA 1LXFC 1XFYO 1H4BA 3CWGA 2CTNA 3OP0A 5HKWA 3JVTB 1ALVA 2BBNA 3D0YA 4WRIA 2MLEC 2ZNEA 5CSIA 3I5GB 2JNFA 1EG3A 1ZOTB 4AQIA 3EK7A 1TCOB 3PSRA 4GAOA 2L51A 3CR4X 4MSPA 1MWNA 1CMGA 1N0YA 4PHMA 1UUSA 2M8UA 4YRUA 1JSAA 1QXPA 1NYAA 1RTP1 4OV2A 3I5IC 1PALA 1NPQA 1CDPA 4IL1A 4MEWA 5DKNA 4GGNA 1SK6D 4F0ZB 4ICBA 2NCOA 2Y5IA 1B4CA 3LL8B 3BXKA 2M7NA 1AK8A 2L5XB 4YGCB 5PALA 1EH2A 5I2OA 4CIDA 1J7QA 4CLNA 1IH0A 1F54A 2O60A 3ICBA 2GV5A 4UPGA 2LMUA 1SL7A 2FJUB 1TIZA 2I94A 2KI6C 4GGFA 1DJXA 1QJTA 2JPTA 2KFFA 1HQVA 1B1GA 4YGBB 2OTGC 1LVCD 1N65A 2LHLA 4OCIA 2V53A 5K89A 1Q80A 2LV7A 1FI5A 2L2EA 2LLSA 2HETA 5F6TA 5KSZA 3VRRA 1MQ1A 5ER4X 1XFUO 2LLTA 2Y1MA 1IJ6A 4BY5A 1CB1A 1OOJA 1XO5A 2L4IA 3O2PA 1BMOA 5CSNA 2JOJA 2KHNA 5CSFA 1F4QA 3RLZA 5GQQC 4QJ4B 1SNLA 3JTDC 3EVUA 5I2QA 1CFFA 1UHIA 3OX6A 1CLLA 1YVHA 1DT7B 1K94A 1TN4A 2CCMA 2HF5A 2FCEA 3KHEA 1SR6B 4GUKA 1VRKA 1KWOC 1CFDA 1KFXS 1JFKA 1YR5A 2EC6C 2M1KB 2SCPA 4MN0A 1J7OA 1DJZA 1SPYA 1CM1A 3DD4A 1XFVO 1KSMA 4NDBA 5BPJA 1KQMC 3NSIA 1SW8A 2A4JA 1B8LA 1M31A 1NP8A 2OS8B 3DVMA 1Y6WA 1S5GZ 4YI8A 4N1GA 2M97A 2NLNA 3ZNIA 4WQ3A 5CPVA 2F2OA 1Y0VH 2JNXA 2F2PA 1LKJA 1M46A 1C7VA 1DJWA 1WY9A 4I5LB 4NQGA 1SCMC 1SRAA 2PVBA 3PN7C 3PM8A 2DOQA 1B47A 1G4YR 5I8NA 2F3YA 5HLVA 2MHHA 1K93D 3OB1B 3SG6A 2WOSA 1M45A 2LMVA 1TNWA 2CNPA 2L98A 4YGAA 1K9UA 5ER5A 1A29A 1AVSA 1C7WA 2ZNDA 3LK0A 1QVIZ 1EJ3A 1C07A 2LMTA 3IF7A 2BCAA 1RWYA 2JWWA 4MLWA 3M0WA 2MJWB 2NZ0A 3BOWB 3PATA 3TS5C 4DRWA 1U5IA 3BUXB 1BJFA 3IQQA 1TTXA 4R1EA 2MA2A 4C0KA 1KQVA 2BCBA 2F33A 2JXLA 1SCVA 3WHTB 2M29A 2E6WA 2F3ZA 1J7PA 2BECA 1WRKA 2M0RA 1S36A 3CTNA 2GGZA 1NX2A 4HSZA 1CDMA 4MZJA 2ZFDA 1UHHA 2EGDA 3LCPC 3SG5A 1SBJA 1DF0A 2I2RE 2KFGA 4C0LA 3DF0A 4XYNA 2K7OA 1KK7Z 3CS1A 1YUUA 1TNPA 1BT6A 2CT9A 1XVJA 1OMRA 3VRPA 3IQOA 1IG5A 2JRFA 1ZMZA 5AANA 1K90D 2KSPA 2ZRSA 2L50A 3WNXB 1JUOA 2PALA 2ZN9A 3BQ3A 2KBMA 3O78A 1PSBA 3VGOA 1YX7A 2M7LA 4MRYA 1NX0A 1F4OA 1XK4A 3PALA 2K7BA 3O4YA 1ODBA 1LA3A 4WQ2A 3EVRA 1PVBA 1OQPA 1E8AA 1J7RA 2Y1NA 1FF1A 5D69A 1QLKA 1QIWA 1YURA 3D10A 1D1OA 2TN4A 4GPLB 2SASA 1W7IB 2QPTA 1A2XA 4MBEA 1DVIA 2GGMA 1ALWA 1HT9A 4GNKB 5DKRA 1CNPA 1KWOB 2WC8A 2JULA 1EXRA 2EC6B 2JQ6A 3CZTX 3HX4A 3CLNA 3EKJA 4MZKA 5AERA 2D8NA 3LK1A 2G2BA 1QX5B 3TZ1A 3SG7A 4OKHA 2IS9A 2PRUA 4PHKA 4FTGA 1S6JA 4D1EA 1DJHA 1CMFA 1B7TZ 1TRFA 1XFXO 2Q4UA 2QACA 1L2OB 1IQ5A 1A75A 4GGFC 4YBHB 1Y1UA 1KFUS 4M2PA 1SKTA 1B9AA 1XYDA 3CR2A 1LA0A 2M49B 3DVKA 4PCWA 1IRJA 1FW4A 2LP2A 4HREE 4CFQA 3EKHA 1JFJA 3HCMA 1SCMB 1JC2A 1BODA 1BU3A 3BYAA 1OE9B 1RROA 1V1GA 1AJ4A 1MXEA 5B8IB 1NSHA 1QLSA 1DJIA 1AHRA 1B8RA 1OMDA 1PK0D 1K9KA 2MAZA 3I5FB 3KEVA 3LLEA 3MSEB 1F55A 3SIBA 5TNCA 2P6BB 1IWQA 1RK9A 3E3RA 1UHNA 3CGAA 2L0PA 3K21A 3TS5B 3EK8A 2JU0A 2LP3A 5JJGA 1CFPA 1CKKA 4E68A 1NX1A 1J55A 3BUWB 3OHMB 3BUOB 1S3PA 1GGWA 2K61A 1NCXA 4I5NB 1FI6A 1QATA 1J1EA 1QS7A 1KSOA 2CBLA 4JPZB 1J1DA 2HQWA 4Q04A 1AP4A 3KF9A 1MR8A 1DGUA 3FIAA 2MRDA 1DJYA 1TNQA 2JTZA 1S5GY 3PLFB 1LINA 4XJKB 2MLFC 1BR4B 1QASA 3CR5X 2LNKA 5AFPA 1S6CA 2BBMA 3NSOA 2R2IA 2BL0C 3RM1A 1IJ5A 1Y1AA 2I7AA 1OSAA 3D0YB 1R2UA 2KFHA 4PALA 1EL4A 1NWDA 4DUQA 2O5GA 2LVKA 1TCFA 2COLB 1QTXA 3KO0A 3I5IB 2LCPA 1GGZA 3PFVA 3VROA 1RFJA 1RECA 4I5KA 3FS7A 2NXQA 5D7FA 1RJVA 1MF8B 2PSRA 2WORA 2G9BA 3FWBA 2CXJA 2VRGA 2FCDA 1PVAA 1NX3A 3O6BA 1W7JB 2KBIA 1QV1A 1SR6C 2BKIB 3AKAA 4PE1A 2OTGB 1X02A 4TNCA 4I5JA 2HQ8A 1KCYA 3I5HC 1UWOA 1K8UA 2JT8A 2K8MB 1KK7Y 2PASA 3VRQA 2KI6D 2OPOA 1M63B 4N1FA 4QJ5B 4A4CA 4PDZA 2JC2A 1PRWA 3BUNB 2OS8C 1Y1XA 1UHKA 3A4UB 1OZOA 1A03A 1XK4C 4HRGA 1WLMA 4ORBB 3SJSA 1UHJA 2JTTA 1IQ3A 1SY9A 4BY4A 5I2LA 2WCFA 3QRXA 4QJ3B 3JTDB 2K2AA 2RGIA 2KI4C 1NUBA 1DMOA 2LC5A 2JXCA 1S6IA 2WCBA 1YX8A 1SL9A 3SG2A 4AQJA 3OX5A 5AEQA 1CFCA 1KK8C 4ORAB 5KU1A 1TNXA 4A4BA 5HKZA 1WRZA 1KQMB 3BUMB 4GFTA 3GOFA 2KGRA 3SIAA 3BOWA 1JF2A 3GK2A 4USLA 4PHJA 3TUYC 1QX7A 5HLOA 1CM4A 1WDCC 2WNDA 1YVLA 3NSLA 2H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0J A;  5HKY A;  2B1U A;  1B7T Y;  4U8D A;  5AXI A;  1SL8 A;  2H61 C;  2K2F A;  2KAX A;  1BLQ A;  2BE6 A;  2KAV A;  1NIW A;  3PN7 B;  1CLM A;  2MBX A;  2BL0 B;  1BR1 B;  2K7D A;  1OMV A;  2H2K A;  1JBA A;  2LVI A;  4P5O E;  1BOC A;  1UUR A;  2NCP A;  3TDU A;  1K9P A;  1CDN A;  1CLB A;  2Q91 A;  5JOL A;  1S1E A;  2LM5 A;  1FBV A;  3AAK A;  3WXA A;  1AUI B;  2LVV A;  2KGB C;  1TOP A;  3EK4 A;  3A8R A;  3JVT C;  5KTY A;  1DGV A;  3EVV A;  1JF0 A;  2BE4 A;  4ETO A;  2LUC A;  4MZL A;  1YRT B;  1K95 A;  3AAJ A;  3I5G C;  4JWQ A;  4M2O A;  4PHN A;  3OB2 B;  2BKH B;  3SG4 A;  2L4H A;  2M3W A;  1U5I B;  4FQO A;  5CSJ A;  1BF5 A;  1WRL A;  1G8I A;  4YI9 A;  2E30 A;  2LAN A;  4OR9 B;  1S26 D;  1ZUZ A;  1MHO A;  3GK1 A;  1IGV A;  1QV0 A;  4PE7 A;  5FYX A;  1A4P A;  1F71 A;  1F8H A;  1GJY A;  1CDL A;  4P2Y B;  5J3X A;  2AAO A;  3WHU B;  1F70 A;  2ZRT A;  4ZCU A;  1OZS A;  3GK4 X;  4CFR A;  1DF0 B;  2LE9 B;  3DVJ A;  1FPW A;  3DF0 B;  1BG1 A;  1GQM A;  2PMY A;  1SYM A;  3I5H B;  3ZWH A;  2KYF A;  1XA5 A;  1ZAC A;  2I18 A;  4ORC B;  1IKU A;  3NXA A;  2M1U A;  4C0J A;  2LVJ A;  4DIR A;  1K2H A;  1PUL A;  4N5X A;  1ZFS A;  1EG4 A;  1XFW O;  2FOT A;  3F45 A;  4ZCV A;  1M39 A;  2M9G A;  4M2Q A;  1L7Z A;  2F8P A;  1KFU L;  4DCK A;  1JWD A;  1B8C A;  4GBA A;  5IBW A;  1L2O C;  3H4S E;  2HPS A;  2JT0 A;  3TDZ A;  1QVI Y;  2WCE A;  2AMI A;  1CTR A;  2KI4 B;  2KAY A;  1H8B A;  4MVF A;  1NCZ A;  2EHB A;  2JZI A;  3FWC A;  1QIV A;  1K96 A;  1V1F A;  3AKB A;  4DS7 A;  2KDH A;  1KK8 B;  2KNE A;  3KPX A;  3C1V A;  1YUS A;  4YGD B;  1SMG A;  3DVE A;  2Y4Q A;  5G08 A;  4L9M A;  3I5F C;  2ZKM X;  2KOT A;  1KFX L;  4CPV A;  3TUY B;  2LLU A;  2ZN8 A;  3TDI A;  2LAP A;  4MRX A;  1WDC B;  1UP5 A;  4JQ0 D;  1QX2 A;  5HYD A;  1WLZ A;  2AUC A;  1G33 A;  2BCX A;  4PE0 A;  5DKQ A;  2LHI A;  1A75 B;  4NDC A;  1YUT A;  1YTZ C;  1XFZ O;  1DTL A;  1NCY A;  3NSK A;  1MUX A;  2K7C A;  4NDD A;  2KQY A;  4OVN F;  4HRH A;  4YGE B;  4PE4 A;  1R6P A;  2KYC A;  1PSR A;  1N2D A;  2ISD A;  4AOM A;  3SG3 A;  4XJK A;  3VRN A;  1AJ5 A;  1MXL C;  1YRU B;  2JT3 A;  2KQ6 A;  2LUX A;  1DJG A;  1LXF C;  1XFY O;  1H4B A;  3CWG A;  2CTN A;  3OP0 A;  5HKW A;  3JVT B;  1ALV A;  2BBN A;  3D0Y A;  4WRI A;  2MLE C;  2ZNE A;  5CSI A;  3I5G B;  2JNF A;  1EG3 A;  1ZOT B;  4AQI A;  3EK7 A;  1TCO B;  3PSR A;  4GAO A;  2L51 A;  3CR4 X;  4MSP A;  1MWN A;  1CMG A;  1N0Y A;  4PHM A;  1UUS A;  2M8U A;  4YRU A;  1JSA A;  1QXP A;  1NYA A;  1RTP 1;  4OV2 A;  3I5I C;  1PAL A;  1NPQ A;  1CDP A;  4IL1 A;  4MEW A;  5DKN A;  4GGN A;  1SK6 D;  4F0Z B;  4ICB A;  2NCO A;  2Y5I A;  1B4C A;  3LL8 B;  3BXK A;  2M7N A;  1AK8 A;  2L5X B;  4YGC B;  5PAL A;  1EH2 A;  5I2O A;  4CID A;  1J7Q A;  4CLN A;  1IH0 A;  1F54 A;  2O60 A;  3ICB A;  2GV5 A;  4UPG A;  2LMU A;  1SL7 A;  2FJU B;  1TIZ A;  2I94 A;  2KI6 C;  4GGF A;  1DJX A;  1QJT A;  2JPT A;  2KFF A;  1HQV A;  1B1G A;  4YGB B;  2OTG C;  1LVC D;  1N65 A;  2LHL A;  4OCI A;  2V53 A;  5K89 A;  1Q80 A;  2LV7 A;  1FI5 A;  2L2E A;  2LLS A;  2HET A;  5F6T A;  5KSZ A;  3VRR A;  1MQ1 A;  5ER4 X;  1XFU O;  2LLT A;  2Y1M A;  1IJ6 A;  4BY5 A;  1CB1 A;  1OOJ A;  1XO5 A;  2L4I A;  3O2P A;  1BMO A;  5CSN A;  2JOJ A;  2KHN A;  5CSF A;  1F4Q A;  3RLZ A;  5GQQ C;  4QJ4 B;  1SNL A;  3JTD C;  3EVU A;  5I2Q A;  1CFF A;  1UHI A;  3OX6 A;  1CLL A;  1YVH A;  1DT7 B;  1K94 A;  1TN4 A;  2CCM A;  2HF5 A;  2FCE A;  3KHE A;  1SR6 B;  4GUK A;  1VRK A;  1KWO C;  1CFD A;  1KFX S;  1JFK A;  1YR5 A;  2EC6 C;  2M1K B;  2SCP A;  4MN0 A;  1J7O A;  1DJZ A;  1SPY A;  1CM1 A;  3DD4 A;  1XFV O;  1KSM A;  4NDB A;  5BPJ A;  1KQM C;  3NSI A;  1SW8 A;  2A4J A;  1B8L A;  1M31 A;  1NP8 A;  2OS8 B;  3DVM A;  1Y6W A;  1S5G Z;  4YI8 A;  4N1G A;  2M97 A;  2NLN A;  3ZNI A;  4WQ3 A;  5CPV A;  2F2O A;  1Y0V H;  2JNX A;  2F2P A;  1LKJ A;  1M46 A;  1C7V A;  1DJW A;  1WY9 A;  4I5L B;  4NQG A;  1SCM C;  1SRA A;  2PVB A;  3PN7 C;  3PM8 A;  2DOQ A;  1B47 A;  1G4Y R;  5I8N A;  2F3Y A;  5HLV A;  2MHH A;  1K93 D;  3OB1 B;  3SG6 A;  2WOS A;  1M45 A;  2LMV A;  1TNW A;  2CNP A;  2L98 A;  4YGA A;  1K9U A;  5ER5 A;  1A29 A;  1AVS A;  1C7W A;  2ZND A;  3LK0 A;  1QVI Z;  1EJ3 A;  1C07 A;  2LMT A;  3IF7 A;  2BCA A;  1RWY A;  2JWW A;  4MLW A;  3M0W A;  2MJW B;  2NZ0 A;  3BOW B;  3PAT A;  3TS5 C;  4DRW A;  1U5I A;  3BUX B;  1BJF A;  3IQQ A;  1TTX A;  4R1E A;  2MA2 A;  4C0K A;  1KQV A;  2BCB A;  2F33 A;  2JXL A;  1SCV A;  3WHT B;  2M29 A;  2E6W A;  2F3Z A;  1J7P A;  2BEC A;  1WRK A;  2M0R A;  1S36 A;  3CTN A;  2GGZ A;  1NX2 A;  4HSZ A;  1CDM A;  4MZJ A;  2ZFD A;  1UHH A;  2EGD A;  3LCP C;  3SG5 A;  1SBJ A;  1DF0 A;  2I2R E;  2KFG A;  4C0L A;  3DF0 A;  4XYN A;  2K7O A;  1KK7 Z;  3CS1 A;  1YUU A;  1TNP A;  1BT6 A;  2CT9 A;  1XVJ A;  1OMR A;  3VRP A;  3IQO A;  1IG5 A;  2JRF A;  1ZMZ A;  5AAN A;  1K90 D;  2KSP A;  2ZRS A;  2L50 A;  3WNX B;  1JUO A;  2PAL A;  2ZN9 A;  3BQ3 A;  2KBM A;  3O78 A;  1PSB A;  3VGO A;  1YX7 A;  2M7L A;  4MRY A;  1NX0 A;  1F4O A;  1XK4 A;  3PAL A;  2K7B A;  3O4Y A;  1ODB A;  1LA3 A;  4WQ2 A;  3EVR A;  1PVB A;  1OQP A;  1E8A A;  1J7R A;  2Y1N A;  1FF1 A;  5D69 A;  1QLK A;  1QIW A;  1YUR A;  3D10 A;  1D1O A;  2TN4 A;  4GPL B;  2SAS A;  1W7I B;  2QPT A;  1A2X A;  4MBE A;  1DVI A;  2GGM A;  1ALW A;  1HT9 A;  4GNK B;  5DKR A;  1CNP A;  1KWO B;  2WC8 A;  2JUL A;  1EXR A;  2EC6 B;  2JQ6 A;  3CZT X;  3HX4 A;  3CLN A;  3EKJ A;  4MZK A;  5AER A;  2D8N A;  3LK1 A;  2G2B A;  1QX5 B;  3TZ1 A;  3SG7 A;  4OKH A;  2IS9 A;  2PRU A;  4PHK A;  4FTG A;  1S6J A;  4D1E A;  1DJH A;  1CMF A;  1B7T Z;  1TRF A;  1XFX O;  2Q4U A;  2QAC A;  1L2O B;  1IQ5 A;  1A75 A;  4GGF C;  4YBH B;  1Y1U A;  1KFU S;  4M2P A;  1SKT A;  1B9A A;  1XYD A;  3CR2 A;  1LA0 A;  2M49 B;  3DVK A;  4PCW A;  1IRJ A;  1FW4 A;  2LP2 A;  4HRE E;  4CFQ A;  3EKH A;  1JFJ A;  3HCM A;  1SCM B;  1JC2 A;  1BOD A;  1BU3 A;  3BYA A;  1OE9 B;  1RRO A;  1V1G A;  1AJ4 A;  1MXE A;  5B8I B;  1NSH A;  1QLS A;  1DJI A;  1AHR A;  1B8R A;  1OMD A;  1PK0 D;  1K9K A;  2MAZ A;  3I5F B;  3KEV A;  3LLE A;  3MSE B;  1F55 A;  3SIB A;  5TNC A;  2P6B B;  1IWQ A;  1RK9 A;  3E3R A;  1UHN A;  3CGA A;  2L0P A;  3K21 A;  3TS5 B;  3EK8 A;  2JU0 A;  2LP3 A;  5JJG A;  1CFP A;  1CKK A;  4E68 A;  1NX1 A;  1J55 A;  3BUW B;  3OHM B;  3BUO B;  1S3P A;  1GGW A;  2K61 A;  1NCX A;  4I5N B;  1FI6 A;  1QAT A;  1J1E A;  1QS7 A;  1KSO A;  2CBL A;  4JPZ B;  1J1D A;  2HQW A;  4Q04 A;  1AP4 A;  3KF9 A;  1MR8 A;  1DGU A;  3FIA A;  2MRD A;  1DJY A;  1TNQ A;  2JTZ A;  1S5G Y;  3PLF B;  1LIN A;  4XJK B;  2MLF C;  1BR4 B;  1QAS A;  3CR5 X;  2LNK A;  5AFP A;  1S6C A;  2BBM A;  3NSO A;  2R2I A;  2BL0 C;  3RM1 A;  1IJ5 A;  1Y1A A;  2I7A A;  1OSA A;  3D0Y B;  1R2U A;  2KFH A;  4PAL A;  1EL4 A;  1NWD A;  4DUQ A;  2O5G A;  2LVK A;  1TCF A;  2COL B;  1QTX A;  3KO0 A;  3I5I B;  2LCP A;  1GGZ A;  3PFV A;  3VRO A;  1RFJ A;  1REC A;  4I5K A;  3FS7 A;  2NXQ A;  5D7F A;  1RJV A;  1MF8 B;  2PSR A;  2WOR A;  2G9B A;  3FWB A;  2CXJ A;  2VRG A;  2FCD A;  1PVA A;  1NX3 A;  3O6B A;  1W7J B;  2KBI A;  1QV1 A;  1SR6 C;  2BKI B;  3AKA A;  4PE1 A;  2OTG B;  1X02 A;  4TNC A;  4I5J A;  2HQ8 A;  1KCY A;  3I5H C;  1UWO A;  1K8U A;  2JT8 A;  2K8M B;  1KK7 Y;  2PAS A;  3VRQ A;  2KI6 D;  2OPO A;  1M63 B;  4N1F A;  4QJ5 B;  4A4C A;  4PDZ A;  2JC2 A;  1PRW A;  3BUN B;  2OS8 C;  1Y1X A;  1UHK A;  3A4U B;  1OZO A;  1A03 A;  1XK4 C;  4HRG A;  1WLM A;  4ORB B;  3SJS A;  1UHJ A;  2JTT A;  1IQ3 A;  1SY9 A;  4BY4 A;  5I2L A;  2WCF A;  3QRX A;  4QJ3 B;  3JTD B;  2K2A A;  2RGI A;  2KI4 C;  1NUB A;  1DMO A;  2LC5 A;  2JXC A;  1S6I A;  2WCB A;  1YX8 A;  1SL9 A;  3SG2 A;  4AQJ A;  3OX5 A;  5AEQ A;  1CFC A;  1KK8 C;  4ORA B;  5KU1 A;  1TNX A;  4A4B A;  5HKZ A;  1WRZ A;  1KQM B;  3BUM B;  4GFT A;  3GOF A;  2KGR A;  3SIA A;  3BOW A;  1JF2 A;  3GK2 A;  4USL A;  4PHJ A;  3TUY C;  1QX7 A;  5HLO A;  1CM4 A;  1WDC C;  2WND A;  1YVL A;  3NSL A;  2H61 A; 
#chains in the Genus database with same CATH topology
 2K0J A;  5HKY A;  4INX A;  2B1U A;  1B7T Y;  4U8D A;  5AXI A;  1SL8 A;  2H61 C;  2K2F A;  2KAX A;  1BLQ A;  2BE6 A;  2KAV A;  1NIW A;  3PN7 B;  1CLM A;  2MBX A;  2BL0 B;  3B87 A;  1BR1 B;  2K7D A;  1OMV A;  2H2K A;  1JBA A;  2LVI A;  4P5O E;  1BOC A;  1UUR A;  1IIO A;  2NCP A;  3TDU A;  1K9P A;  2KLD A;  1CDN A;  1CLB A;  2Q91 A;  5JOL A;  1S1E A;  2LM5 A;  1FBV A;  3AAK A;  3WXA A;  1AUI B;  2LVV A;  2KGB C;  1TOP A;  3EK4 A;  3A8R A;  3JVT C;  5KTY A;  1DGV A;  3EVV A;  1JF0 A;  2BE4 A;  4OZD A;  4ETO A;  2LUC A;  4MZL A;  1YRT B;  1K95 A;  3AAJ A;  3I5G C;  4JWQ A;  4M2O A;  4PHN A;  3OB2 B;  2BKH B;  3SG4 A;  1OOF A;  2L4H A;  2M3W A;  1U5I B;  4FQO A;  5CSJ A;  1BF5 A;  1WRL A;  1G8I A;  4YI9 A;  2E30 A;  2LAN A;  2H8V A;  4OR9 B;  1S26 D;  1OOI X;  1ZUZ A;  1MHO A;  3GK1 A;  1IGV A;  1QV0 A;  4PE7 A;  5FYX A;  1A4P A;  1F71 A;  1F8H A;  1GJY A;  1CDL A;  4P2Y B;  5J3X A;  2AAO A;  2WCJ A;  3NHI A;  3WHU B;  2PYQ A;  1F70 A;  2ZRT A;  4ZCU A;  1OZS A;  3GK4 X;  4CFR A;  3S0F A;  1DF0 B;  2LE9 B;  3DVJ A;  1FPW A;  3DF0 B;  1BG1 A;  1GQM A;  2PMY A;  1SYM A;  3I5H B;  3ZWH A;  2KYF A;  1XA5 A;  1ZAC A;  2I18 A;  4ORC B;  1IKU A;  2KLE A;  2M1U A;  3NXA A;  2WCH A;  4C0J A;  2LVJ A;  4DIR A;  1K2H A;  1PUL A;  4N5X A;  1ZFS A;  1EG4 A;  1XFW O;  2L2C A;  2FOT A;  3F45 A;  4ZCV A;  2P70 A;  1M39 A;  2M9G A;  2QEO A;  1L7Z A;  4M2Q A;  2F8P A;  1KFU L;  4DCK A;  1JWD A;  3SS5 A;  1B8C A;  4GBA A;  5IBW A;  1L2O C;  3H4S E;  2WC5 A;  2HPS A;  3S0G A;  2JT0 A;  3TDZ A;  3BFH A;  1QVI Y;  2WCE A;  2AMI A;  1CTR A;  1QWV A;  2KI4 B;  2KAY A;  1H8B A;  3OBV A;  4MVF A;  1NCZ A;  2EHB A;  2JZI A;  3FWC A;  1QIV A;  1K96 A;  1V1F A;  3AKB A;  4DS7 A;  2KDH A;  1KK8 B;  2KNE A;  3CZ1 A;  3C1V A;  3KPX A;  1YUS A;  4YGD B;  1SMG A;  3DVE A;  2Y4Q A;  5G08 A;  4L9M A;  3I5F C;  2WCM A;  2ZKM X;  2KOT A;  1KFX L;  4CPV A;  4IJ7 A;  2LLU A;  3TUY B;  2ZN8 A;  3TDI A;  2LAP A;  4MRX A;  1WDC B;  1UP5 A;  4JQ0 D;  3N7H A;  3IVT A;  1QX2 A;  5HYD A;  1WLZ A;  2AUC A;  1G33 A;  2BCX A;  3FE9 A;  4PE0 A;  5DKQ A;  2LHI A;  1W9Z A;  3L4A A;  1A75 B;  1ORG A;  2QEH A;  4NDC A;  1YUT A;  2QEB A;  5EL2 A;  1YTZ C;  1XFZ O;  3L4L A;  1DTL A;  1NCY A;  3NSK A;  1MUX A;  2K7C A;  4NDD A;  2KQY A;  3D75 A;  4HRH A;  4OVN F;  4PE4 A;  1R6P A;  2KYC A;  4YGE B;  3SS3 A;  3Q8I A;  1PSR A;  1N2D A;  2ISD A;  4AOM A;  3SG3 A;  4XJK A;  3VRN A;  1AJ5 A;  1MXL C;  1YRU B;  2JT3 A;  2KQ6 A;  5FI2 A;  2LUX A;  1DJG A;  1LXF C;  1XFY O;  1H4B A;  3CWG A;  2CTN A;  3OP0 A;  5HKW A;  3JVT B;  1ALV A;  2BBN A;  3D0Y A;  4WRI A;  3PM2 A;  2MLE C;  2ZNE A;  5CSI A;  3I5G B;  2JNF A;  1EG3 A;  1ZOT B;  4AQI A;  3EK7 A;  3PJI A;  1TCO B;  3PSR A;  4GAO A;  2L51 A;  3CR4 X;  4MSP A;  1MWN A;  1CMG A;  1N0Y A;  4PHM A;  1UUS A;  2M8U A;  4YRU A;  3FE8 A;  1JSA A;  1QXP A;  1NYA A;  1RTP 1;  4OV2 A;  3I5I C;  1PAL A;  1NPQ A;  1CDP A;  4IL1 A;  4MEW A;  5DKN A;  4GGN A;  1SK6 D;  4F0Z B;  4ICB A;  2NCO A;  2Y5I A;  3D76 A;  3LL8 B;  1B4C A;  3BXK A;  2M7N A;  1AK8 A;  2L5X B;  4YGC B;  5PAL A;  1EH2 A;  3OGN A;  5I2O A;  4CID A;  1J7Q A;  3K1E A;  4CLN A;  1IH0 A;  1Z2C B;  1F54 A;  4KYN A;  2O60 A;  3D74 A;  2GV5 A;  3ICB A;  4UPG A;  2LMU A;  2YGU A;  3L47 A;  1SL7 A;  2FJU B;  1TIZ A;  2I94 A;  2KI6 C;  4GGF A;  1DJX A;  1QJT A;  2JPT A;  2KFF A;  1HQV A;  1B1G A;  4YGB B;  4JD9 A;  2OTG C;  1LVC D;  1N65 A;  2LHL A;  2L5Y A;  4OCI A;  1OOG A;  2V53 A;  5K89 A;  1Q80 A;  2LV7 A;  1FI5 A;  2L2E A;  2LLS A;  2HET A;  5F6T A;  5KSZ A;  3VRR A;  1MQ1 A;  5ER4 X;  1XFU O;  3SS4 A;  3R1P A;  2LLT A;  2Y1M A;  1IJ6 A;  4BY5 A;  1CB1 A;  1OOJ A;  1XO5 A;  2L4I A;  3O2P A;  1BMO A;  3CYZ A;  5CSN A;  2KPH A;  2JOJ A;  2KHN A;  1P28 A;  5CSF A;  1OW4 A;  2WCL A;  1F4Q A;  3RLZ A;  5GQQ C;  4QJ4 B;  1SNL A;  2K60 A;  2JPO A;  3JTD C;  3EVU A;  5I2Q A;  1CFF A;  1UHI A;  3OX6 A;  1CLL A;  1YVH A;  1DT7 B;  1K94 A;  1TN4 A;  2CCM A;  2HF5 A;  2FCE A;  3CAB A;  3KHE A;  1SR6 B;  4GUK A;  1VRK A;  1KWO C;  1CFD A;  1KFX S;  1JFK A;  1YR5 A;  1GM0 A;  2EC6 C;  2M1K B;  2SCP A;  4MN0 A;  1J7O A;  1DJZ A;  1SPY A;  1CM1 A;  3DD4 A;  1XFV O;  1KSM A;  4NDB A;  5BPJ A;  3D78 A;  1KQM C;  3NSI A;  1SW8 A;  2A4J A;  1B8L A;  1M31 A;  1NP8 A;  2OS8 B;  3DVM A;  1Y6W A;  1S5G Z;  4YI8 A;  4N1G A;  2M97 A;  2NLN A;  3ZNI A;  4WQ3 A;  5CPV A;  2F2O A;  1Y0V H;  3CZ2 A;  2JNX A;  3UO9 A;  2F2P A;  5DIC A;  1LKJ A;  1M46 A;  3DY9 A;  1DJW A;  1C7V A;  1WY9 A;  3R1O A;  4I5L B;  4NQG A;  1Z4H A;  1SCM C;  1SRA A;  2PVB A;  3PN7 C;  4INW A;  1DC1 A;  3PM8 A;  2DOQ A;  1B47 A;  1G4Y R;  5I8N A;  2F3Y A;  5FI6 A;  3DXL A;  5HLV A;  2MHH A;  1K93 D;  3OB1 B;  3SG6 A;  2WOS A;  1M45 A;  2LMV A;  1LS8 A;  1TNW A;  2CNP A;  2L98 A;  4YGA A;  1K9U A;  5ER5 A;  1A29 A;  1AVS A;  3DZT A;  1C7W A;  2ZND A;  3LK0 A;  1QVI Z;  1EJ3 A;  1C07 A;  2LMT A;  3IF7 A;  3NGV A;  2BCA A;  1RWY A;  2JWW A;  2WCK A;  4MLW A;  3M0W A;  2MJW B;  2NZ0 A;  3BOW B;  3PAT A;  3TS5 C;  4DRW A;  5HL1 A;  1U5I A;  4F7F A;  3BUX B;  1BJF A;  3IQQ A;  1TTX A;  4R1E A;  2MA2 A;  4C0K A;  1KQV A;  2BCB A;  2F33 A;  2JXL A;  1SCV A;  3BJH A;  3WHT B;  2ERB A;  2M29 A;  2E6W A;  2F3Z A;  3O4X A;  1J7P A;  2BEC A;  1WRK A;  2M0R A;  1S36 A;  3CTN A;  2GGZ A;  1NX2 A;  4HSZ A;  1CDM A;  4MZJ A;  2ZFD A;  1UHH A;  2EGD A;  3LCP C;  3SG5 A;  1SBJ A;  1DF0 A;  2I2R E;  2KFG A;  4C0L A;  3DF0 A;  4XYN A;  2K7O A;  1KK7 Z;  3CS1 A;  1YUU A;  1TNP A;  1BT6 A;  2CT9 A;  1XVJ A;  1OMR A;  3VRP A;  3IQO A;  1IG5 A;  2JRF A;  1ZMZ A;  5AAN A;  1K90 D;  2KSP A;  2ZRS A;  2L50 A;  3WNX B;  1JUO A;  2PAL A;  2ZN9 A;  3BQ3 A;  1TUZ A;  2KBM A;  3O78 A;  1PSB A;  3VGO A;  1YX7 A;  2M7L A;  4MRY A;  1NX0 A;  1F4O A;  1TWO A;  1XK4 A;  2K7B A;  2WC6 A;  3O4Y A;  3PAL A;  1ODB A;  1LA3 A;  1OOH A;  4WQ2 A;  3R72 A;  3EVR A;  1PVB A;  1OQP A;  1E8A A;  3D77 A;  1J7R A;  2Y1N A;  1FF1 A;  5D69 A;  3BFA A;  1QLK A;  1QIW A;  1YUR A;  3D10 A;  1D1O A;  2BAP A;  2TN4 A;  4GPL B;  3S0D A;  2SAS A;  1TUJ A;  1W7I B;  2QPT A;  1A2X A;  4MBE A;  1DVI A;  2GGM A;  3B7A A;  1ALW A;  1HT9 A;  4GNK B;  5DKR A;  1CNP A;  1KWO B;  2WC8 A;  2JUL A;  1EXR A;  2EC6 B;  2JQ6 A;  3CZT X;  3BFB A;  3HX4 A;  3CLN A;  3EKJ A;  4MZK A;  5AER A;  2D8N A;  3LK1 A;  2G2B A;  1QX5 B;  3TZ1 A;  3SG7 A;  4OKH A;  2IS9 A;  2PRU A;  4FQT A;  4PHK A;  4FTG A;  1S6J A;  4D1E A;  1DJH A;  1CMF A;  1B7T Z;  1TRF A;  3CDN A;  1DEK A;  1XFX O;  2Q4U A;  2QAC A;  3B88 A;  5D3O A;  1L2O B;  1IQ5 A;  1A75 A;  2FJY A;  4GGF C;  4YBH B;  3S0A A;  1Y1U A;  1KFU S;  3V2L A;  4M2P A;  1SKT A;  1B9A A;  1XYD A;  3CR2 A;  1LA0 A;  2M49 B;  3DVK A;  4PCW A;  1IRJ A;  1FW4 A;  2LP2 A;  4HRE E;  4CFQ A;  3EKH A;  1JFJ A;  3HCM A;  1SCM B;  1JC2 A;  1BOD A;  3EG5 B;  1BU3 A;  3BYA A;  1OE9 B;  1RRO A;  1V1G A;  1AJ4 A;  1MXE A;  5B8I B;  1NSH A;  1QLS A;  1DJI A;  1AHR A;  1B8R A;  1OMD A;  3B86 A;  1PK0 D;  1K9K A;  2MAZ A;  3I5F B;  1DQE A;  3KEV A;  3LLE A;  3MSE B;  3S0E A;  1F55 A;  3SIB A;  5TNC A;  2P6B B;  1IWQ A;  1RK9 A;  3E3R A;  1UHN A;  3CGA A;  2L0P A;  3K21 A;  3TS5 B;  3EK8 A;  2JU0 A;  2LP3 A;  5JJG A;  1CFP A;  1CKK A;  4E68 A;  1NX1 A;  1J55 A;  3D73 A;  3BUW B;  3OHM B;  3BUO B;  3S0B A;  1S3P A;  1GGW A;  3QME A;  2K61 A;  1NCX A;  4I5N B;  1FI6 A;  1QAT A;  1J1E A;  1QS7 A;  1KSO A;  2CBL A;  1DEL A;  4JPZ B;  1J1D A;  2HQW A;  4Q04 A;  1AP4 A;  3KF9 A;  1MR8 A;  1DGU A;  3FIA A;  2MRD A;  1DJY A;  1TNQ A;  2JTZ A;  1S5G Y;  3PLF B;  1LIN A;  2PQL A;  4XJK B;  2MLF C;  1BR4 B;  1QAS A;  3CR5 X;  2LNK A;  5AFP A;  1S6C A;  2BBM A;  3NSO A;  4PT1 A;  2R2I A;  2BL0 C;  3RM1 A;  1IJ5 A;  1Y1A A;  5I94 A;  2I7A A;  1OSA A;  3D0Y B;  3VB1 A;  2P71 A;  1R2U A;  2KFH A;  4PAL A;  1T14 A;  1EL4 A;  1NWD A;  4DUQ A;  1SSE B;  2O5G A;  3FE6 A;  2LVK A;  1TCF A;  2COL B;  1QTX A;  3DYE A;  3KO0 A;  3I5I B;  2LCP A;  1GGZ A;  3PFV A;  3RZS A;  3VRO A;  2GTE A;  1RFJ A;  1REC A;  4I5K A;  3FS7 A;  2NXQ A;  5D7F A;  3UNW A;  1RJV A;  1MF8 B;  3R1V A;  2PSR A;  2WOR A;  2G9B A;  3FWB A;  1XFR A;  2CXJ A;  2VRG A;  2FCD A;  1PVA A;  1NX3 A;  3O6B A;  1W7J B;  2KBI A;  1QV1 A;  1SR6 C;  2BKI B;  3AKA A;  4PE1 A;  2QDI A;  2OTG B;  1X02 A;  4TNC A;  4I5J A;  2HQ8 A;  1KCY A;  3I5H C;  1UWO A;  1K8U A;  2JT8 A;  2K8M B;  1KK7 Y;  2PAS A;  3VRQ A;  2KI6 D;  2OPO A;  1M63 B;  4N1F A;  4QJ5 B;  1C3Y A;  4A4C A;  4PDZ A;  2JC2 A;  1PRW A;  3BUN B;  2OS8 C;  1Y1X A;  1UHK A;  3A4U B;  1OZO A;  1A03 A;  1XK4 C;  4HRG A;  1WLM A;  4ORB B;  3SJS A;  2QEV A;  1UHJ A;  2JTT A;  3NHT A;  1IQ3 A;  1SY9 A;  4BY4 A;  5I2L A;  2WCF A;  3QRX A;  4QJ3 B;  3JTD B;  2K2A A;  2RGI A;  2KI4 C;  5FI7 A;  1NUB A;  3CZ0 A;  1DMO A;  2LC5 A;  2JXC A;  1S6I A;  2WCB A;  4JKT A;  1C3Z A;  1YX8 A;  1SL9 A;  2BNX A;  3SG2 A;  4AQJ A;  3OX5 A;  3B6X A;  5AEQ A;  1CFC A;  1KK8 C;  4ORA B;  5KU1 A;  1TNX A;  4A4B A;  5HKZ A;  1WRZ A;  1KQM B;  3BUM B;  4GFT A;  3GOF A;  2KGR A;  3SIA A;  3BOW A;  1JF2 A;  3GK2 A;  4USL A;  4PHJ A;  3TUY C;  1QX7 A;  5HLO A;  1CM4 A;  1WDC C;  2WND A;  1YVL A;  3NSL A;  2H61 A; 
#chains in the Genus database with same CATH homology
 2K0J A;  5HKY A;  2B1U A;  1B7T Y;  4U8D A;  5AXI A;  1SL8 A;  2H61 C;  2K2F A;  2KAX A;  1BLQ A;  2BE6 A;  2KAV A;  1NIW A;  3PN7 B;  1CLM A;  2MBX A;  2BL0 B;  1BR1 B;  2K7D A;  1OMV A;  2H2K A;  1JBA A;  2LVI A;  4P5O E;  1BOC A;  1UUR A;  2NCP A;  3TDU A;  1K9P A;  1CDN A;  1CLB A;  2Q91 A;  5JOL A;  1S1E A;  2LM5 A;  1FBV A;  3AAK A;  3WXA A;  1AUI B;  2LVV A;  2KGB C;  1TOP A;  3EK4 A;  3A8R A;  3JVT C;  5KTY A;  1DGV A;  3EVV A;  1JF0 A;  2BE4 A;  4ETO A;  2LUC A;  4MZL A;  1YRT B;  1K95 A;  3AAJ A;  3I5G C;  4JWQ A;  4M2O A;  4PHN A;  3OB2 B;  2BKH B;  3SG4 A;  2L4H A;  2M3W A;  1U5I B;  4FQO A;  5CSJ A;  1BF5 A;  1WRL A;  1G8I A;  4YI9 A;  2E30 A;  2LAN A;  4OR9 B;  1S26 D;  1ZUZ A;  1MHO A;  3GK1 A;  1IGV A;  1QV0 A;  4PE7 A;  5FYX A;  1A4P A;  1F71 A;  1F8H A;  1GJY A;  1CDL A;  4P2Y B;  5J3X A;  2AAO A;  3WHU B;  1F70 A;  2ZRT A;  4ZCU A;  1OZS A;  3GK4 X;  4CFR A;  1DF0 B;  2LE9 B;  3DVJ A;  1FPW A;  3DF0 B;  1BG1 A;  1GQM A;  2PMY A;  1SYM A;  3I5H B;  3ZWH A;  2KYF A;  1XA5 A;  1ZAC A;  2I18 A;  4ORC B;  1IKU A;  3NXA A;  2M1U A;  4C0J A;  2LVJ A;  4DIR A;  1K2H A;  1PUL A;  4N5X A;  1ZFS A;  1EG4 A;  1XFW O;  2FOT A;  3F45 A;  4ZCV A;  1M39 A;  2M9G A;  4M2Q A;  1L7Z A;  2F8P A;  1KFU L;  4DCK A;  1JWD A;  1B8C A;  4GBA A;  5IBW A;  1L2O C;  3H4S E;  2HPS A;  2JT0 A;  3TDZ A;  1QVI Y;  2WCE A;  2AMI A;  1CTR A;  2KI4 B;  2KAY A;  1H8B A;  4MVF A;  1NCZ A;  2EHB A;  2JZI A;  3FWC A;  1QIV A;  1K96 A;  1V1F A;  3AKB A;  4DS7 A;  2KDH A;  1KK8 B;  2KNE A;  3KPX A;  3C1V A;  1YUS A;  4YGD B;  1SMG A;  3DVE A;  2Y4Q A;  5G08 A;  4L9M A;  3I5F C;  2ZKM X;  2KOT A;  1KFX L;  4CPV A;  3TUY B;  2LLU A;  2ZN8 A;  3TDI A;  2LAP A;  4MRX A;  1WDC B;  1UP5 A;  4JQ0 D;  1QX2 A;  5HYD A;  1WLZ A;  2AUC A;  1G33 A;  2BCX A;  4PE0 A;  5DKQ A;  2LHI A;  1A75 B;  4NDC A;  1YUT A;  1YTZ C;  1XFZ O;  1DTL A;  1NCY A;  3NSK A;  1MUX A;  2K7C A;  4NDD A;  2KQY A;  4OVN F;  4HRH A;  4YGE B;  4PE4 A;  1R6P A;  2KYC A;  1PSR A;  1N2D A;  2ISD A;  4AOM A;  3SG3 A;  4XJK A;  3VRN A;  1AJ5 A;  1MXL C;  1YRU B;  2JT3 A;  2KQ6 A;  2LUX A;  1DJG A;  1LXF C;  1XFY O;  1H4B A;  3CWG A;  2CTN A;  3OP0 A;  5HKW A;  3JVT B;  1ALV A;  2BBN A;  3D0Y A;  4WRI A;  2MLE C;  2ZNE A;  5CSI A;  3I5G B;  2JNF A;  1EG3 A;  1ZOT B;  4AQI A;  3EK7 A;  1TCO B;  3PSR A;  4GAO A;  2L51 A;  3CR4 X;  4MSP A;  1MWN A;  1CMG A;  1N0Y A;  4PHM A;  1UUS A;  2M8U A;  4YRU A;  1JSA A;  1QXP A;  1NYA A;  1RTP 1;  4OV2 A;  3I5I C;  1PAL A;  1NPQ A;  1CDP A;  4IL1 A;  4MEW A;  5DKN A;  4GGN A;  1SK6 D;  4F0Z B;  4ICB A;  2NCO A;  2Y5I A;  1B4C A;  3LL8 B;  3BXK A;  2M7N A;  1AK8 A;  2L5X B;  4YGC B;  5PAL A;  1EH2 A;  5I2O A;  4CID A;  1J7Q A;  4CLN A;  1IH0 A;  1F54 A;  2O60 A;  3ICB A;  2GV5 A;  4UPG A;  2LMU A;  1SL7 A;  2FJU B;  1TIZ A;  2I94 A;  2KI6 C;  4GGF A;  1DJX A;  1QJT A;  2JPT A;  2KFF A;  1HQV A;  1B1G A;  4YGB B;  2OTG C;  1LVC D;  1N65 A;  2LHL A;  4OCI A;  2V53 A;  5K89 A;  1Q80 A;  2LV7 A;  1FI5 A;  2L2E A;  2LLS A;  2HET A;  5F6T A;  5KSZ A;  3VRR A;  1MQ1 A;  5ER4 X;  1XFU O;  2LLT A;  2Y1M A;  1IJ6 A;  4BY5 A;  1CB1 A;  1OOJ A;  1XO5 A;  2L4I A;  3O2P A;  1BMO A;  5CSN A;  2JOJ A;  2KHN A;  5CSF A;  1F4Q A;  3RLZ A;  5GQQ C;  4QJ4 B;  1SNL A;  3JTD C;  3EVU A;  5I2Q A;  1CFF A;  1UHI A;  3OX6 A;  1CLL A;  1YVH A;  1DT7 B;  1K94 A;  1TN4 A;  2CCM A;  2HF5 A;  2FCE A;  3KHE A;  1SR6 B;  4GUK A;  1VRK A;  1KWO C;  1CFD A;  1KFX S;  1JFK A;  1YR5 A;  2EC6 C;  2M1K B;  2SCP A;  4MN0 A;  1J7O A;  1DJZ A;  1SPY A;  1CM1 A;  3DD4 A;  1XFV O;  1KSM A;  4NDB A;  5BPJ A;  1KQM C;  3NSI A;  1SW8 A;  2A4J A;  1B8L A;  1M31 A;  1NP8 A;  2OS8 B;  3DVM A;  1Y6W A;  1S5G Z;  4YI8 A;  4N1G A;  2M97 A;  2NLN A;  3ZNI A;  4WQ3 A;  5CPV A;  2F2O A;  1Y0V H;  2JNX A;  2F2P A;  1LKJ A;  1M46 A;  1C7V A;  1DJW A;  1WY9 A;  4I5L B;  4NQG A;  1SCM C;  1SRA A;  2PVB A;  3PN7 C;  3PM8 A;  2DOQ A;  1B47 A;  1G4Y R;  5I8N A;  2F3Y A;  5HLV A;  2MHH A;  1K93 D;  3OB1 B;  3SG6 A;  2WOS A;  1M45 A;  2LMV A;  1TNW A;  2CNP A;  2L98 A;  4YGA A;  1K9U A;  5ER5 A;  1A29 A;  1AVS A;  1C7W A;  2ZND A;  3LK0 A;  1QVI Z;  1EJ3 A;  1C07 A;  2LMT A;  3IF7 A;  2BCA A;  1RWY A;  2JWW A;  4MLW A;  3M0W A;  2MJW B;  2NZ0 A;  3BOW B;  3PAT A;  3TS5 C;  4DRW A;  1U5I A;  3BUX B;  1BJF A;  3IQQ A;  1TTX A;  4R1E A;  2MA2 A;  4C0K A;  1KQV A;  2BCB A;  2F33 A;  2JXL A;  1SCV A;  3WHT B;  2M29 A;  2E6W A;  2F3Z A;  1J7P A;  2BEC A;  1WRK A;  2M0R A;  1S36 A;  3CTN A;  2GGZ A;  1NX2 A;  4HSZ A;  1CDM A;  4MZJ A;  2ZFD A;  1UHH A;  2EGD A;  3LCP C;  3SG5 A;  1SBJ A;  1DF0 A;  2I2R E;  2KFG A;  4C0L A;  3DF0 A;  4XYN A;  2K7O A;  1KK7 Z;  3CS1 A;  1YUU A;  1TNP A;  1BT6 A;  2CT9 A;  1XVJ A;  1OMR A;  3VRP A;  3IQO A;  1IG5 A;  2JRF A;  1ZMZ A;  5AAN A;  1K90 D;  2KSP A;  2ZRS A;  2L50 A;  3WNX B;  1JUO A;  2PAL A;  2ZN9 A;  3BQ3 A;  2KBM A;  3O78 A;  1PSB A;  3VGO A;  1YX7 A;  2M7L A;  4MRY A;  1NX0 A;  1F4O A;  1XK4 A;  3PAL A;  2K7B A;  3O4Y A;  1ODB A;  1LA3 A;  4WQ2 A;  3EVR A;  1PVB A;  1OQP A;  1E8A A;  1J7R A;  2Y1N A;  1FF1 A;  5D69 A;  1QLK A;  1QIW A;  1YUR A;  3D10 A;  1D1O A;  2TN4 A;  4GPL B;  2SAS A;  1W7I B;  2QPT A;  1A2X A;  4MBE A;  1DVI A;  2GGM A;  1ALW A;  1HT9 A;  4GNK B;  5DKR A;  1CNP A;  1KWO B;  2WC8 A;  2JUL A;  1EXR A;  2EC6 B;  2JQ6 A;  3CZT X;  3HX4 A;  3CLN A;  3EKJ A;  4MZK A;  5AER A;  2D8N A;  3LK1 A;  2G2B A;  1QX5 B;  3TZ1 A;  3SG7 A;  4OKH A;  2IS9 A;  2PRU A;  4PHK A;  4FTG A;  1S6J A;  4D1E A;  1DJH A;  1CMF A;  1B7T Z;  1TRF A;  1XFX O;  2Q4U A;  2QAC A;  1L2O B;  1IQ5 A;  1A75 A;  4GGF C;  4YBH B;  1Y1U A;  1KFU S;  4M2P A;  1SKT A;  1B9A A;  1XYD A;  3CR2 A;  1LA0 A;  2M49 B;  3DVK A;  4PCW A;  1IRJ A;  1FW4 A;  2LP2 A;  4HRE E;  4CFQ A;  3EKH A;  1JFJ A;  3HCM A;  1SCM B;  1JC2 A;  1BOD A;  1BU3 A;  3BYA A;  1OE9 B;  1RRO A;  1V1G A;  1AJ4 A;  1MXE A;  5B8I B;  1NSH A;  1QLS A;  1DJI A;  1AHR A;  1B8R A;  1OMD A;  1PK0 D;  1K9K A;  2MAZ A;  3I5F B;  3KEV A;  3LLE A;  3MSE B;  1F55 A;  3SIB A;  5TNC A;  2P6B B;  1IWQ A;  1RK9 A;  3E3R A;  1UHN A;  3CGA A;  2L0P A;  3K21 A;  3TS5 B;  3EK8 A;  2JU0 A;  2LP3 A;  5JJG A;  1CFP A;  1CKK A;  4E68 A;  1NX1 A;  1J55 A;  3BUW B;  3OHM B;  3BUO B;  1S3P A;  1GGW A;  2K61 A;  1NCX A;  4I5N B;  1FI6 A;  1QAT A;  1J1E A;  1QS7 A;  1KSO A;  2CBL A;  4JPZ B;  1J1D A;  2HQW A;  4Q04 A;  1AP4 A;  3KF9 A;  1MR8 A;  1DGU A;  3FIA A;  2MRD A;  1DJY A;  1TNQ A;  2JTZ A;  1S5G Y;  3PLF B;  1LIN A;  4XJK B;  2MLF C;  1BR4 B;  1QAS A;  3CR5 X;  2LNK A;  5AFP A;  1S6C A;  2BBM A;  3NSO A;  2R2I A;  2BL0 C;  3RM1 A;  1IJ5 A;  1Y1A A;  2I7A A;  1OSA A;  3D0Y B;  1R2U A;  2KFH A;  4PAL A;  1EL4 A;  1NWD A;  4DUQ A;  2O5G A;  2LVK A;  1TCF A;  2COL B;  1QTX A;  3KO0 A;  3I5I B;  2LCP A;  1GGZ A;  3PFV A;  3VRO A;  1RFJ A;  1REC A;  4I5K A;  3FS7 A;  2NXQ A;  5D7F A;  1RJV A;  1MF8 B;  2PSR A;  2WOR A;  2G9B A;  3FWB A;  2CXJ A;  2VRG A;  2FCD A;  1PVA A;  1NX3 A;  3O6B A;  1W7J B;  2KBI A;  1QV1 A;  1SR6 C;  2BKI B;  3AKA A;  4PE1 A;  2OTG B;  1X02 A;  4TNC A;  4I5J A;  2HQ8 A;  1KCY A;  3I5H C;  1UWO A;  1K8U A;  2JT8 A;  2K8M B;  1KK7 Y;  2PAS A;  3VRQ A;  2KI6 D;  2OPO A;  1M63 B;  4N1F A;  4QJ5 B;  4A4C A;  4PDZ A;  2JC2 A;  1PRW A;  3BUN B;  2OS8 C;  1Y1X A;  1UHK A;  3A4U B;  1OZO A;  1A03 A;  1XK4 C;  4HRG A;  1WLM A;  4ORB B;  3SJS A;  1UHJ A;  2JTT A;  1IQ3 A;  1SY9 A;  4BY4 A;  5I2L A;  2WCF A;  3QRX A;  4QJ3 B;  3JTD B;  2K2A A;  2RGI A;  2KI4 C;  1NUB A;  1DMO A;  2LC5 A;  2JXC A;  1S6I A;  2WCB A;  1YX8 A;  1SL9 A;  3SG2 A;  4AQJ A;  3OX5 A;  5AEQ A;  1CFC A;  1KK8 C;  4ORA B;  5KU1 A;  1TNX A;  4A4B A;  5HKZ A;  1WRZ A;  1KQM B;  3BUM B;  4GFT A;  3GOF A;  2KGR A;  3SIA A;  3BOW A;  1JF2 A;  3GK2 A;  4USL A;  4PHJ A;  3TUY C;  1QX7 A;  5HLO A;  1CM4 A;  1WDC C;  2WND A;  1YVL A;  3NSL A;  2H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...