1NX3A

Calpain domain vi in complex with the inhibitor pd150606
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx3A00
1GJYA 3F45A 1TTXA 2M0RA 1BR1B 1F54A 2MA2A 3OX5A 4YGEB 1L2OB 5PALA 4CFQA 2M1KB 2PSRA 4MRXA 5CSJA 1SL7A 2JXLA 1XO5A 2KHNA 2M8UA 1CKKA 4GBAA 1A4PA 3SIBA 2MBXA 3VGOA 1UUSA 2ZN9A 5IBWA 3DF0A 1SPYA 4FTGA 1OMDA 3WHUB 1GGWA 1LA3A 3BQ3A 2QPTA 2ZFDA 1OQPA 5CSNA 1WY9A 2JOJA 3PALA 1F70A 3PATA 5HLOA 1S6IA 2K7CA 1DF0A 3NSOA 1Q80A 2LVKA 3LL8B 2LAPA 4ORAB 1NX3A 2R2IA 3TZ1A 1QIVA 1TNQA 1KFUS 4ETOA 1S3PA 1H8BA 1PULA 1YR5A 1YUUA 3D0YB 1TNWA 2HETA 1KSMA 1Y1XA 1PVAA 2KGRA 1Y1AA 2JT3A 2CCMA 1B8LA 2K8MB 3ICBA 1NPQA 2CT9A 3CZTX 1SYMA 4JWQA 4OKHA 2HPSA 3AAJA 1KWOC 3LCPC 2BBMA 3NSIA 2MHHA 2LP3A 1IWQA 1K96A 3DF0B 2L4IA 3OB1B 2K7DA 1DMOA 1QJTA 1LINA 3WHTB 4HSZA 3GOFA 2L5XB 3GK2A 1RJVA 1CLLA 1QV1A 1EXRA 2LLSA 2NXQA 1IG5A 1AJ5A 1DF0B 1PRWA 1S6JA 1G33A 1QTXA 1ZFSA 3CR4X 4PALA 4Q04A 2JTTA 1Y1UA 3VRNA 2O60A 2I7AA 1KQMB 1YURA 1TNXA 1DGVA 2LP2A 2KGBC 2HQ8A 1MR8A 3K21A 1QATA 1CMFA 5I2OA 1NP8A 2LLUA 1S5GY 1CLBA 1SMGA 1OMVA 1L2OC 1CDMA 4DCKA 4USLA 1EG4A 1BT6A 1SCMB 1F4OA 1NSHA 1SK6D 1G8IA 1UHKA 2JNXA 2ZN8A 5B8IB 2KBMA 1GGZA 4MRYA 1B7TY 3I5FB 2WCFA 1KFUL 1PK0D 3SG6A 1C7WA 2L51A 4YGCB 2ISDA 4MN0A 1DGUA 2LVIA 1X02A 1WRLA 4ORCB 2JC2A 1S36A 1UURA 1A29A 2BE6A 1WRKA 2F2PA 4A4BA 5KSZA 2WNDA 1G4YR 3SIAA 1BJFA 4C0KA 1RFJA 4MZJA 2PRUA 2E30A 2QACA 2K0JA 1CM1A 1MHOA 1QS7A 3BXKA 1N0YA 1FPWA 2M7NA 4GAOA 2KAYA 3SG2A 1A75A 2CNPA 2KI6D 2L4HA 1S26D 4PCWA 3CGAA 1KCYA 1M46A 5HYDA 3CR5X 2LMUA 1CMGA 1XFYO 2AMIA 2NZ0A 1AJ4A 1OE9B 5KTYA 1V1FA 1JFKA 3EVUA 5ER4X 1F4QA 1MXLC 1YTZC 3BUNB 4OVNF 1BOCA 1BLQA 1ALWA 3CTNA 1KK7Z 2ZRSA 1XYDA 2JRFA 2ZKMX 2F33A 2L0PA 2LANA 1JC2A 2PMYA 1CDNA 4HRGA 2EHBA 1CFFA 3ZNIA 1YUSA 1K95A 3PLFB 1RWYA 1YX7A 2JQ6A 3A4UB 3BYAA 3EKJA 4N1FA 4DS7A 2GGMA 4WQ2A 2M29A 3SG4A 1M39A 1J7RA 1KQMC 4AQIA 3PM8A 5HKZA 4AOMA 2LNKA 4ORBB 2JT8A 5GQQC 4QJ4B 2M9GA 1RK9A 1CFPA 1A75B 2F8PA 3EVRA 3FWCA 1B8CA 1NWDA 1AUIB 2LLTA 5ER5A 1K8UA 5FYXA 2CXJA 3TDZA 3PFVA 1EL4A 2Y4QA 1IJ6A 4MZLA 1Y0VH 1SKTA 4C0JA 2K7OA 3KF9A 3TS5B 1SCMC 3TUYB 3WNXB 1NX0A 3CR2A 2BECA 3CWGA 1KK7Y 2WORA 3I5FC 2ZNDA 4P5OE 4PE1A 5JOLA 1KQVA 4ZCUA 2JPTA 2CBLA 1C07A 3I5IC 2HF5A 5DKQA 3JVTB 1SY9A 1EJ3A 2OTGB 4MBEA 4YRUA 1DJGA 4D1EA 3CLNA 1LXFC 4WRIA 4I5LB 2VRGA 3BUOB 3HX4A 5CSFA 1QX2A 2KDHA 1AK8A 4XJKA 3KEVA 3IQQA 1SNLA 4MSPA 1IH0A 3AKAA 1K90D 1B9AA 2E6WA 4PHJA 3SG7A 5JJGA 1UP5A 3KPXA 4YBHB 3O6BA 3EK7A 1TNPA 1XFXO 2PVBA 2KYFA 3BOWA 1S1EA 1YVLA 2MJWB 1QVIZ 4YI9A 1JF2A 1N65A 5D7FA 1OSAA 5BPJA 1J55A 1M31A 4AQJA 2JNFA 1V1GA 4PHMA 1FI6A 2G9BA 1B1GA 2LVVA 2WCEA 3CS1A 5CSIA 2LMTA 3JTDB 4GGFC 1JF0A 1TCFA 5G08A 4PE0A 4I5NB 2I18A 2MRDA 4XYNA 1IQ5A 1J7OA 2BE4A 1PSBA 1DTLA 1NCYA 3LK0A 3OX6A 2F3YA 2BCBA 3VRQA 5I8NA 1H4BA 4OR9B 4I5KA 2EC6B 4JQ0D 1CFCA 1F71A 1NX2A 1QLKA 3DVEA 3EVVA 4MZKA 1EH2A 2KQ6A 1XK4A 3O78A 3FWBA 1FW4A 4XJKB 4GGNA 4TNCA 1SR6B 2H2KA 1XFZO 3C1VA 3DVMA 4BY5A 5AERA 2OPOA 1QLSA 2H61A 2O5GA 1QX7A 3AAKA 2Y1MA 1A03A 1J7QA 5I2LA 3BOWB 5KU1A 4GNKB 2LC5A 1DJYA 5D69A 1IQ3A 1WRZA 1UWOA 1SW8A 1WDCB 2AUCA 2BCAA 3TS5C 2LE9B 1XA5A 4CFRA 3TUYC 2LVJA 2K61A 1PSRA 3VROA 3DVJA 2NLNA 4N5XA 4R1EA 3PSRA 5CPVA 1CNPA 1MUXA 2LMVA 3GK1A 3PN7B 1XFWO 1SBJA 2M7LA 3ZWHA 2Y5IA 1FI5A 2LHLA 5DKNA 3JVTC 2GV5A 4QJ5B 1ALVA 2OTGC 2F3ZA 3SG5A 4PDZA 1K9PA 4C0LA 1F8HA 3SG3A 1UHHA 1YX8A 3SJSA 3RLZA 3BUXB 2KAXA 1R6PA 1C7VA 1MF8B 3NSLA 1BR4B 3OP0A 2KI6C 2L98A 4YGDB 2M97A 4P2YB 1CTRA 4I5JA 3E3RA 3FS7A 3M0WA 1NIWA 2TN4A 4FQOA 4CIDA 2FCDA 1KWOB 2HQWA 2KI4B 4DRWA 3EKHA 2A4JA 2V53A 2MLFC 1E8AA 2IS9A 2M49B 4JPZB 3JTDC 2Y1NA 1CDPA 2JTZA 2FJUB 2G2BA 4DUQA 1TCOB 1CB1A 1L7ZA 1K9KA 3KHEA 5AANA 1NYAA 1TRFA 1B8RA 4PE7A 2AAOA 2KOTA 2KNEA 3O4YA 1JBAA 1J1EA 1NCXA 2DOQA 1ODBA 4HRHA 1MQ1A 1CFDA 4PHKA 5HKYA 2OS8B 1SR6C 3DVKA 2K2AA 1ZMZA 2NCOA 1U5IA 1OZSA 2M1UA 2KFFA 2LUCA 1OZOA 2KFGA 3BUWB 1YUTA 4YGBB 1PVBA 4NDBA 4CPVA 1IKUA 3HCMA 1FF1A 1NCZA 2BBNA 1XFUO 1SRAA 2KAVA 1WDCC 2Q4UA 4PHNA 1AHRA 1KFXS 1LVCD 4NDCA 1JWDA 1UHNA 2PALA 1F55A 1W7IB 2RGIA 1TN4A 1BG1A 5HLVA 1SL9A 1TOPA 5AFPA 4M2QA 3PN7C 1HT9A 4GPLB 1CLMA 5I2QA 3QRXA 4UPGA 3I5HB 1DT7B 2LV7A 2I94A 1A2XA 1SCVA 4NDDA 2WOSA 4E68A 4MVFA 4GUKA 1XK4C 1WLMA 1LA0A 2B1UA 3NXAA 4F0ZB 4M2PA 2SCPA 2KYCA 1JSAA 1SL8A 1K2HA 1NUBA 1U5IB 2H61C 1AP4A 1S5GZ 3DD4A 4GFTA 4HREE 2KBIA 4ICBA 5F6TA 4OV2A 1ZOTB 4NQGA 1IJ5A 5J3XA 1M63B 2ZNEA 2KI4C 1JUOA 4CLNA 1NX1A 1IGVA 3VRRA 5K89A 2JZIA 1ZUZA 4M2OA 1B7TZ 2FOTA 3LLEA 3RM1A 3H4SE 1W7JB 4MLWA 1FBVA 1S6CA 4PE4A 4IL1A 3NSKA 3EK4A 1CDLA 3MSEB 1KK8B 3I5GB 1MWNA 3IF7A 5HKWA 3A8RA 1XFVO 1Y6WA 2NCPA 2BL0B 3VRPA 1QIWA 1VRKA 1M45A 2D8NA 2GGZA 1BODA 3FIAA 2PASA 5AXIA 2M3WA 1J7PA 2L2EA 2MAZA 1QVIY 2WC8A 2JXCA 1QXPA 4OCIA 2FCEA 1CM4A 2OS8C 2LM5A 2JU0A 1KFXL 4A4CA 1DJHA 1MXEA 2I2RE 2ZRTA 4DIRA 1TIZA 1D1OA 1K9UA 1ZACA 2BKIB 1YRTB 3LK1A 1KSOA 1UHIA 1DJIA 3IQOA 4MEWA 1AVSA 3WXAA 1RTP1 4BY4A 4GGFA 1QX5B 4WQ3A 3OB2B 1J1DA 2LCPA 1YVHA 2K2FA 1DJZA 1RROA 2MLEC 3O2PA 1DJXA 1PALA 3OHMB 1WLZA 1DJWA 2KQYA 3I5IB 4L9MA 2Q91A 4YGAA 2COLB 2BKHB 1B47A 1B4CA 1DVIA 3GK4X 3KO0A 2BCXA 2LUXA 2CTNA 3I5HC 2L50A 2P6BB 2JT0A 1LKJA 1UHJA 1QASA 4U8DA 2LHIA 5DKRA 1BMOA 1N2DA 1RECA 3TDUA 5AEQA 1BF5A 1GQMA 1HQVA 3AKBA 1OOJA 2EGDA 2K7BA 1YRUB 2JULA 2KSPA 1K94A 4QJ3B 2EC6C 2JWWA 3D10A 1QV0A 1BU3A 2WCBA 1IRJA 1XVJA 2F2OA 1JFJA 4N1GA 2SASA 5TNCA 1K93D 1KK8C 3I5GC 2KFHA 1R2UA 3BUMB 3EK8A 1OMRA 3D0YA 4YI8A 2BL0C 4ZCVA 3TDIA 1EG3A
chains in the Genus database with same CATH superfamily
1GJYA 3F45A 1TTXA 2M0RA 1BR1B 1F54A 2MA2A 3OX5A 3L47A 1L2OB 2KLEA 4YGEB 5PALA 2M1KB 2PSRA 4MRXA 5CSJA 1SL7A 4CFQA 3OGNA 2JXLA 3R72A 1XO5A 2KHNA 2M8UA 1CKKA 4GBAA 1A4PA 3SIBA 2MBXA 3VGOA 1UUSA 2ZN9A 5IBWA 3DF0A 1SPYA 4FTGA 1OMDA 2QEHA 3WHUB 1GGWA 1LA3A 3BQ3A 2QPTA 2ZFDA 1OQPA 5CSNA 1WY9A 3UO9A 2JOJA 3PALA 1F70A 3PATA 5HLOA 1S6IA 2K7CA 3IVTA 1DF0A 3NSOA 1Q80A 2LVKA 3LL8B 2LAPA 4ORAB 1TUJA 1NX3A 2R2IA 3TZ1A 1QIVA 1TNQA 1KFUS 4ETOA 3BFHA 1S3PA 1H8BA 1PULA 1YR5A 1YUUA 3BFBA 3D0YB 1TNWA 2HETA 1KSMA 1Y1XA 1PVAA 2KGRA 1Y1AA 2JT3A 2CCMA 1B8LA 2K8MB 2YGUA 3ICBA 1NPQA 2CT9A 3CZTX 1SYMA 4JWQA 3N7HA 4OKHA 2HPSA 3AAJA 3L4AA 1KWOC 3LCPC 2BBMA 3NSIA 2MHHA 2LP3A 1IWQA 1K96A 4KYNA 3DF0B 2L4IA 3OB1B 2K7DA 1DMOA 1QJTA 1LINA 3WHTB 4HSZA 3GOFA 2L5XB 3GK2A 1RJVA 1CLLA 1QV1A 1EXRA 2LLSA 2NXQA 1IG5A 1AJ5A 1DF0B 1PRWA 1S6JA 1G33A 1QTXA 1ZFSA 3CABA 3CR4X 1OW4A 2JTTA 1Y1UA 3PM2A 3K1EA 4PALA 2O60A 2I7AA 1KQMB 1YURA 2FJYA 4PT1A 1TNXA 1DGVA 2LP2A 2KGBC 1C3YA 2HQ8A 1MR8A 3K21A 1QATA 1CMFA 5I2OA 1NP8A 2LLUA 1S5GY 1CLBA 1SMGA 1OMVA 1L2OC 1OOIX 1CDMA 4DCKA 4USLA 1EG4A 1BT6A 1SCMB 1F4OA 1NSHA 1SK6D 2QEOA 3SS4A 1G8IA 1UHKA 2JNXA 2ZN8A 3SS3A 2KBMA 1GGZA 4MRYA 1B7TY 3I5FB 2WCFA 5B8IB 1KFUL 1PK0D 3SG6A 1C7WA 2L51A 1P28A 4YGCB 2ISDA 4F7FA 4MN0A 1DGUA 2LVIA 1X02A 1WRLA 4ORCB 2JC2A 1S36A 2PYQA 1UURA 1A29A 2BE6A 1WRKA 2F2PA 4A4BA 5KSZA 2WNDA 1G4YR 3B6XA 1BJFA 3SIAA 1ORGA 1RFJA 2WC6A 4MZJA 3UNWA 2PRUA 2E30A 2QACA 2K0JA 1CM1A 1MHOA 1QS7A 3BXKA 1N0YA 1FPWA 2M7NA 4GAOA 2KAYA 3SG2A 1A75A 2CNPA 2KI6D 2L4HA 1S26D 4PCWA 3CGAA 1KCYA 1M46A 5HYDA 2QEBA 3CR5X 2LMUA 1CMGA 1XFYO 2AMIA 2NZ0A 1AJ4A 1OE9B 5KTYA 1V1FA 1JFKA 2PQLA 3EVUA 5ER4X 1F4QA 1MXLC 1YTZC 3BUNB 4C0KA 4OVNF 1BOCA 1BLQA 1ALWA 1W9ZA 3CTNA 1KK7Z 2ZRSA 1XYDA 2JRFA 2ZKMX 2F33A 2L0PA 2LANA 1JC2A 2PMYA 1CDNA 4HRGA 2EHBA 1CFFA 3ZNIA 1Z2CB 1YUSA 1K95A 3PLFB 3S0EA 3RZSA 1RWYA 1YX7A 1TWOA 2JQ6A 3A4UB 3BYAA 3EKJA 4N1FA 4DS7A 2GGMA 4WQ2A 2M29A 3SG4A 1M39A 1J7RA 1KQMC 4AQIA 3PM8A 5HKZA 4AOMA 2LNKA 3NGVA 4ORBB 2JT8A 5GQQC 4QJ4B 2M9GA 1RK9A 3D77A 3FE8A 1A75B 2F8PA 3EVRA 3S0DA 1CFPA 3FWCA 3SS5A 1B8CA 1NWDA 1AUIB 2LLTA 3FE6A 1K8UA 5ER5A 2CXJA 5FYXA 3TDZA 3PFVA 1EL4A 2Y4QA 1IJ6A 5FI6A 1QWVA 4MZLA 1Y0VH 1SKTA 4C0JA 1XFRA 2K7OA 3KF9A 1SCMC 3TS5B 3TUYB 3WNXB 1NX0A 3CR2A 3VRNA 3B87A 2WCLA 2BECA 3CWGA 1KK7Y 2WORA 3I5FC 2ZNDA 4P5OE 4PE1A 5FI7A 5JOLA 1KQVA 4ZCUA 2JPTA 2CBLA 1C07A 3I5IC 2HF5A 5DKQA 3JVTB 1SY9A 1EJ3A 2OTGB 2BAPA 4MBEA 4YRUA 1DJGA 4D1EA 3CLNA 1LXFC 3B7AA 4WRIA 4I5LB 2VRGA 3BUOB 3HX4A 5CSFA 1QX2A 2KDHA 2WCJA 4XJKA 5D3OA 3KEVA 3IQQA 1AK8A 1SNLA 4MSPA 1IH0A 3AKAA 1K90D 2P71A 3CYZA 1B9AA 2E6WA 4PHJA 3SG7A 5JJGA 1UP5A 3KPXA 1LS8A 4YBHB 3O6BA 3EK7A 1XFXO 1TNPA 2PVBA 2KYFA 3BOWA 1S1EA 1YVLA 2MJWB 1QVIZ 4YI9A 1JF2A 1N65A 5D7FA 1OSAA 5BPJA 1J55A 1M31A 4AQJA 2JNFA 1V1GA 4PHMA 1FI6A 2G9BA 1B1GA 2LVVA 2WCEA 3CS1A 5CSIA 2LMTA 3JTDB 4GGFC 1JF0A 1TCFA 3CZ2A 5G08A 3D74A 4PE0A 4I5NB 2I18A 2MRDA 4XYNA 1IQ5A 1J7OA 2BE4A 1PSBA 1DTLA 1NCYA 3LK0A 3OX6A 2F3YA 2BCBA 3VRQA 5I8NA 1H4BA 3BJHA 4OR9B 4I5KA 2EC6B 4JQ0D 1CFCA 3S0AA 1F71A 1NX2A 1QLKA 3DVEA 3EVVA 4MZKA 1EH2A 2KQ6A 1XK4A 3DY9A 3O78A 3FWBA 1FW4A 4XJKB 3Q8IA 4GGNA 4TNCA 1SR6B 2H2KA 1XFZO 3C1VA 3DVMA 4BY5A 5AERA 2OPOA 3PJIA 1QLSA 2H61A 2O5GA 1QX7A 3AAKA 2Y1MA 1A03A 1J7QA 5I2LA 3BOWB 5KU1A 4GNKB 2LC5A 1DJYA 5D69A 1IQ3A 3OBVA 1WRZA 3NHIA 1UWOA 2H8VA 1SW8A 1WDCB 2AUCA 2BCAA 3TS5C 2LE9B 1XA5A 4CFRA 3TUYC 2LVJA 2K61A 1PSRA 3VROA 3DVJA 2NLNA 4N5XA 4R1EA 3PSRA 5CPVA 1CNPA 1MUXA 2LMVA 3GK1A 3CZ0A 3PN7B 1XFWO 1SBJA 2M7LA 3ZWHA 4Q04A 2Y5IA 1FI5A 2LHLA 3FE9A 5DKNA 3JVTC 1DC1A 2GV5A 4QJ5B 1ALVA 2OTGC 1IIOA 2F3ZA 3SG5A 4PDZA 1K9PA 4C0LA 5I94A 1F8HA 3SG3A 1UHHA 5EL2A 1YX8A 3SJSA 3RLZA 3BUXB 2KAXA 2KLDA 1R6PA 1C7VA 1MF8B 3NSLA 3S0FA 1BR4B 3OP0A 2KI6C 2L98A 4YGDB 2M97A 4P2YB 1CTRA 4I5JA 3E3RA 3FS7A 3M0WA 1NIWA 2TN4A 4FQOA 4CIDA 2FCDA 1KWOB 2HQWA 2KI4B 4DRWA 3EKHA 2A4JA 2V53A 2MLFC 1E8AA 2IS9A 2M49B 4JPZB 3JTDC 2Y1NA 1CDPA 2JTZA 2FJUB 2G2BA 3R1OA 1TCOB 4DUQA 1L7ZA 1K9KA 1CB1A 3KHEA 5AANA 1NYAA 1TRFA 3CZ1A 1B8RA 4PE7A 2AAOA 2KOTA 2KNEA 3O4YA 1JBAA 1J1EA 1NCXA 2DOQA 3D75A 1ODBA 4HRHA 1MQ1A 5FI2A 1CFDA 4PHKA 3R1VA 5HKYA 2OS8B 1SR6C 2ERBA 3DVKA 2K2AA 1ZMZA 2NCOA 1U5IA 3D78A 5HL1A 1OZSA 2M1UA 2KFFA 3L4LA 2LUCA 1OZOA 2KFGA 2KPHA 3BUWB 1YUTA 4YGBB 1PVBA 3VB1A 2JPOA 4NDBA 4CPVA 1IKUA 3HCMA 1DQEA 1FF1A 1NCZA 2BBNA 1XFUO 1SRAA 2KAVA 1WDCC 2Q4UA 2K60A 4PHNA 1AHRA 1KFXS 1LVCD 4NDCA 1JWDA 1UHNA 2PALA 1F55A 1W7IB 2RGIA 1TN4A 1BG1A 5HLVA 1SL9A 1TOPA 5AFPA 4INWA 3PN7C 1HT9A 2QDIA 4GPLB 1CLMA 4M2QA 2L5YA 5I2QA 3QRXA 4UPGA 3I5HB 1DT7B 2LV7A 3QMEA 2I94A 1A2XA 1SCVA 3CDNA 2WOSA 3D76A 4NDDA 4MVFA 4E68A 4GUKA 1XK4C 1WLMA 1LA0A 2B1UA 3NXAA 4F0ZB 3V2LA 4M2PA 2SCPA 2KYCA 1JSAA 1SL8A 1K2HA 1T14A 1NUBA 1U5IB 2H61C 1AP4A 3S0GA 1S5GZ 3DD4A 1TUZA 4GFTA 4HREE 2KBIA 4ICBA 3BFAA 5F6TA 4OV2A 1ZOTB 4NQGA 1IJ5A 5J3XA 1M63B 2ZNEA 2KI4C 1JUOA 4CLNA 2QEVA 1NX1A 1IGVA 3VRRA 3B86A 5K89A 2JZIA 1ZUZA 4M2OA 1B7TZ 2FOTA 3LLEA 3RM1A 3H4SE 1W7JB 4MLWA 1FBVA 1S6CA 4PE4A 4IL1A 3NSKA 3EK4A 1CDLA 3DYEA 1KK8B 3I5GB 1MWNA 3IF7A 3MSEB 5HKWA 3A8RA 1XFVO 3B88A 1Y6WA 2NCPA 1Z4HA 2BL0B 3VRPA 1QIWA 1VRKA 3R1PA 1M45A 2D8NA 2GGZA 1BODA 3FIAA 2PASA 5AXIA 2M3WA 1J7PA 2L2EA 2MAZA 2P70A 1QVIY 2WC8A 2JXCA 1QXPA 4OCIA 2FCEA 1DELA 1CM4A 2OS8C 2LM5A 2JU0A 1KFXL 4A4CA 1DJHA 1MXEA 2I2RE 2ZRTA 4DIRA 1TIZA 1D1OA 1K9UA 1ZACA 2BKIB 1YRTB 1DEKA 3LK1A 2WCMA 1KSOA 1UHIA 1DJIA 3IQOA 4MEWA 1AVSA 3WXAA 2L2CA 1RTP1 4BY4A 4GGFA 1QX5B 4WQ3A 3OB2B 1J1DA 2LCPA 2WC5A 1YVHA 2K2FA 1DJZA 1OOGA 1RROA 2MLEC 3O2PA 1DJXA 1PALA 3OHMB 1WLZA 1DJWA 2KQYA 3I5IB 5DICA 4L9MA 1C3ZA 2Q91A 3NHTA 4YGAA 2COLB 2BKHB 1B47A 3DZTA 1B4CA 1DVIA 3GK4X 3KO0A 2BCXA 2LUXA 2CTNA 3I5HC 2L50A 2WCHA 2P6BB 2JT0A 1LKJA 4JKTA 3D73A 1UHJA 3O4XA 1SSEB 1OOFA 2GTEA 1OOHA 3EG5B 1QASA 4U8DA 2LHIA 5DKRA 1BMOA 2WCKA 1GM0A 1N2DA 1RECA 3TDUA 4INXA 5AEQA 1BF5A 1GQMA 1HQVA 3AKBA 1OOJA 2EGDA 2K7BA 1YRUB 2BNXA 2JULA 3DXLA 2KSPA 1K94A 4QJ3B 2EC6C 2JWWA 3S0BA 3D10A 1QV0A 1BU3A 2WCBA 1IRJA 1XVJA 2F2OA 4FQTA 4N1GA 1JFJA 2SASA 5TNCA 1K93D 1KK8C 3I5GC 2KFHA 4IJ7A 1R2UA 3BUMB 3EK8A 1OMRA 4OZDA 3D0YA 4YI8A 2BL0C 4ZCVA 3TDIA 1EG3A 4JD9A
chains in the Genus database with same CATH topology
1GJYA 3F45A 1TTXA 2M0RA 1BR1B 1F54A 2MA2A 3OX5A 4YGEB 1L2OB 5PALA 4CFQA 2M1KB 2PSRA 4MRXA 5CSJA 1SL7A 2JXLA 1XO5A 2KHNA 2M8UA 1CKKA 4GBAA 1A4PA 3SIBA 2MBXA 3VGOA 1UUSA 2ZN9A 5IBWA 3DF0A 1SPYA 4FTGA 1OMDA 3WHUB 1GGWA 1LA3A 3BQ3A 2QPTA 2ZFDA 1OQPA 5CSNA 1WY9A 2JOJA 3PALA 1F70A 3PATA 5HLOA 1S6IA 2K7CA 1DF0A 3NSOA 1Q80A 2LVKA 3LL8B 2LAPA 4ORAB 1NX3A 2R2IA 3TZ1A 1QIVA 1TNQA 1KFUS 4ETOA 1S3PA 1H8BA 1PULA 1YR5A 1YUUA 3D0YB 1TNWA 2HETA 1KSMA 1Y1XA 1PVAA 2KGRA 1Y1AA 2JT3A 2CCMA 1B8LA 2K8MB 3ICBA 1NPQA 2CT9A 3CZTX 1SYMA 4JWQA 4OKHA 2HPSA 3AAJA 1KWOC 3LCPC 2BBMA 3NSIA 2MHHA 2LP3A 1IWQA 1K96A 3DF0B 2L4IA 3OB1B 2K7DA 1DMOA 1QJTA 1LINA 3WHTB 4HSZA 3GOFA 2L5XB 3GK2A 1RJVA 1CLLA 1QV1A 1EXRA 2LLSA 2NXQA 1IG5A 1AJ5A 1DF0B 1PRWA 1S6JA 1G33A 1QTXA 1ZFSA 3CR4X 4PALA 4Q04A 2JTTA 1Y1UA 3VRNA 2O60A 2I7AA 1KQMB 1YURA 1TNXA 1DGVA 2LP2A 2KGBC 2HQ8A 1MR8A 3K21A 1QATA 1CMFA 5I2OA 1NP8A 2LLUA 1S5GY 1CLBA 1SMGA 1OMVA 1L2OC 1CDMA 4DCKA 4USLA 1EG4A 1BT6A 1SCMB 1F4OA 1NSHA 1SK6D 1G8IA 1UHKA 2JNXA 2ZN8A 5B8IB 2KBMA 1GGZA 4MRYA 1B7TY 3I5FB 2WCFA 1KFUL 1PK0D 3SG6A 1C7WA 2L51A 4YGCB 2ISDA 4MN0A 1DGUA 2LVIA 1X02A 1WRLA 4ORCB 2JC2A 1S36A 1UURA 1A29A 2BE6A 1WRKA 2F2PA 4A4BA 5KSZA 2WNDA 1G4YR 3SIAA 1BJFA 4C0KA 1RFJA 4MZJA 2PRUA 2E30A 2QACA 2K0JA 1CM1A 1MHOA 1QS7A 3BXKA 1N0YA 1FPWA 2M7NA 4GAOA 2KAYA 3SG2A 1A75A 2CNPA 2KI6D 2L4HA 1S26D 4PCWA 3CGAA 1KCYA 1M46A 5HYDA 3CR5X 2LMUA 1CMGA 1XFYO 2AMIA 2NZ0A 1AJ4A 1OE9B 5KTYA 1V1FA 1JFKA 3EVUA 5ER4X 1F4QA 1MXLC 1YTZC 3BUNB 4OVNF 1BOCA 1BLQA 1ALWA 3CTNA 1KK7Z 2ZRSA 1XYDA 2JRFA 2ZKMX 2F33A 2L0PA 2LANA 1JC2A 2PMYA 1CDNA 4HRGA 2EHBA 1CFFA 3ZNIA 1YUSA 1K95A 3PLFB 1RWYA 1YX7A 2JQ6A 3A4UB 3BYAA 3EKJA 4N1FA 4DS7A 2GGMA 4WQ2A 2M29A 3SG4A 1M39A 1J7RA 1KQMC 4AQIA 3PM8A 5HKZA 4AOMA 2LNKA 4ORBB 2JT8A 5GQQC 4QJ4B 2M9GA 1RK9A 1CFPA 1A75B 2F8PA 3EVRA 3FWCA 1B8CA 1NWDA 1AUIB 2LLTA 5ER5A 1K8UA 5FYXA 2CXJA 3TDZA 3PFVA 1EL4A 2Y4QA 1IJ6A 4MZLA 1Y0VH 1SKTA 4C0JA 2K7OA 3KF9A 3TS5B 1SCMC 3TUYB 3WNXB 1NX0A 3CR2A 2BECA 3CWGA 1KK7Y 2WORA 3I5FC 2ZNDA 4P5OE 4PE1A 5JOLA 1KQVA 4ZCUA 2JPTA 2CBLA 1C07A 3I5IC 2HF5A 5DKQA 3JVTB 1SY9A 1EJ3A 2OTGB 4MBEA 4YRUA 1DJGA 4D1EA 3CLNA 1LXFC 4WRIA 4I5LB 2VRGA 3BUOB 3HX4A 5CSFA 1QX2A 2KDHA 1AK8A 4XJKA 3KEVA 3IQQA 1SNLA 4MSPA 1IH0A 3AKAA 1K90D 1B9AA 2E6WA 4PHJA 3SG7A 5JJGA 1UP5A 3KPXA 4YBHB 3O6BA 3EK7A 1TNPA 1XFXO 2PVBA 2KYFA 3BOWA 1S1EA 1YVLA 2MJWB 1QVIZ 4YI9A 1JF2A 1N65A 5D7FA 1OSAA 5BPJA 1J55A 1M31A 4AQJA 2JNFA 1V1GA 4PHMA 1FI6A 2G9BA 1B1GA 2LVVA 2WCEA 3CS1A 5CSIA 2LMTA 3JTDB 4GGFC 1JF0A 1TCFA 5G08A 4PE0A 4I5NB 2I18A 2MRDA 4XYNA 1IQ5A 1J7OA 2BE4A 1PSBA 1DTLA 1NCYA 3LK0A 3OX6A 2F3YA 2BCBA 3VRQA 5I8NA 1H4BA 4OR9B 4I5KA 2EC6B 4JQ0D 1CFCA 1F71A 1NX2A 1QLKA 3DVEA 3EVVA 4MZKA 1EH2A 2KQ6A 1XK4A 3O78A 3FWBA 1FW4A 4XJKB 4GGNA 4TNCA 1SR6B 2H2KA 1XFZO 3C1VA 3DVMA 4BY5A 5AERA 2OPOA 1QLSA 2H61A 2O5GA 1QX7A 3AAKA 2Y1MA 1A03A 1J7QA 5I2LA 3BOWB 5KU1A 4GNKB 2LC5A 1DJYA 5D69A 1IQ3A 1WRZA 1UWOA 1SW8A 1WDCB 2AUCA 2BCAA 3TS5C 2LE9B 1XA5A 4CFRA 3TUYC 2LVJA 2K61A 1PSRA 3VROA 3DVJA 2NLNA 4N5XA 4R1EA 3PSRA 5CPVA 1CNPA 1MUXA 2LMVA 3GK1A 3PN7B 1XFWO 1SBJA 2M7LA 3ZWHA 2Y5IA 1FI5A 2LHLA 5DKNA 3JVTC 2GV5A 4QJ5B 1ALVA 2OTGC 2F3ZA 3SG5A 4PDZA 1K9PA 4C0LA 1F8HA 3SG3A 1UHHA 1YX8A 3SJSA 3RLZA 3BUXB 2KAXA 1R6PA 1C7VA 1MF8B 3NSLA 1BR4B 3OP0A 2KI6C 2L98A 4YGDB 2M97A 4P2YB 1CTRA 4I5JA 3E3RA 3FS7A 3M0WA 1NIWA 2TN4A 4FQOA 4CIDA 2FCDA 1KWOB 2HQWA 2KI4B 4DRWA 3EKHA 2A4JA 2V53A 2MLFC 1E8AA 2IS9A 2M49B 4JPZB 3JTDC 2Y1NA 1CDPA 2JTZA 2FJUB 2G2BA 4DUQA 1TCOB 1CB1A 1L7ZA 1K9KA 3KHEA 5AANA 1NYAA 1TRFA 1B8RA 4PE7A 2AAOA 2KOTA 2KNEA 3O4YA 1JBAA 1J1EA 1NCXA 2DOQA 1ODBA 4HRHA 1MQ1A 1CFDA 4PHKA 5HKYA 2OS8B 1SR6C 3DVKA 2K2AA 1ZMZA 2NCOA 1U5IA 1OZSA 2M1UA 2KFFA 2LUCA 1OZOA 2KFGA 3BUWB 1YUTA 4YGBB 1PVBA 4NDBA 4CPVA 1IKUA 3HCMA 1FF1A 1NCZA 2BBNA 1XFUO 1SRAA 2KAVA 1WDCC 2Q4UA 4PHNA 1AHRA 1KFXS 1LVCD 4NDCA 1JWDA 1UHNA 2PALA 1F55A 1W7IB 2RGIA 1TN4A 1BG1A 5HLVA 1SL9A 1TOPA 5AFPA 4M2QA 3PN7C 1HT9A 4GPLB 1CLMA 5I2QA 3QRXA 4UPGA 3I5HB 1DT7B 2LV7A 2I94A 1A2XA 1SCVA 4NDDA 2WOSA 4E68A 4MVFA 4GUKA 1XK4C 1WLMA 1LA0A 2B1UA 3NXAA 4F0ZB 4M2PA 2SCPA 2KYCA 1JSAA 1SL8A 1K2HA 1NUBA 1U5IB 2H61C 1AP4A 1S5GZ 3DD4A 4GFTA 4HREE 2KBIA 4ICBA 5F6TA 4OV2A 1ZOTB 4NQGA 1IJ5A 5J3XA 1M63B 2ZNEA 2KI4C 1JUOA 4CLNA 1NX1A 1IGVA 3VRRA 5K89A 2JZIA 1ZUZA 4M2OA 1B7TZ 2FOTA 3LLEA 3RM1A 3H4SE 1W7JB 4MLWA 1FBVA 1S6CA 4PE4A 4IL1A 3NSKA 3EK4A 1CDLA 3MSEB 1KK8B 3I5GB 1MWNA 3IF7A 5HKWA 3A8RA 1XFVO 1Y6WA 2NCPA 2BL0B 3VRPA 1QIWA 1VRKA 1M45A 2D8NA 2GGZA 1BODA 3FIAA 2PASA 5AXIA 2M3WA 1J7PA 2L2EA 2MAZA 1QVIY 2WC8A 2JXCA 1QXPA 4OCIA 2FCEA 1CM4A 2OS8C 2LM5A 2JU0A 1KFXL 4A4CA 1DJHA 1MXEA 2I2RE 2ZRTA 4DIRA 1TIZA 1D1OA 1K9UA 1ZACA 2BKIB 1YRTB 3LK1A 1KSOA 1UHIA 1DJIA 3IQOA 4MEWA 1AVSA 3WXAA 1RTP1 4BY4A 4GGFA 1QX5B 4WQ3A 3OB2B 1J1DA 2LCPA 1YVHA 2K2FA 1DJZA 1RROA 2MLEC 3O2PA 1DJXA 1PALA 3OHMB 1WLZA 1DJWA 2KQYA 3I5IB 4L9MA 2Q91A 4YGAA 2COLB 2BKHB 1B47A 1B4CA 1DVIA 3GK4X 3KO0A 2BCXA 2LUXA 2CTNA 3I5HC 2L50A 2P6BB 2JT0A 1LKJA 1UHJA 1QASA 4U8DA 2LHIA 5DKRA 1BMOA 1N2DA 1RECA 3TDUA 5AEQA 1BF5A 1GQMA 1HQVA 3AKBA 1OOJA 2EGDA 2K7BA 1YRUB 2JULA 2KSPA 1K94A 4QJ3B 2EC6C 2JWWA 3D10A 1QV0A 1BU3A 2WCBA 1IRJA 1XVJA 2F2OA 1JFJA 4N1GA 2SASA 5TNCA 1K93D 1KK8C 3I5GC 2KFHA 1R2UA 3BUMB 3EK8A 1OMRA 3D0YA 4YI8A 2BL0C 4ZCVA 3TDIA 1EG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJY A;  3F45 A;  1TTX A;  2M0R A;  1BR1 B;  1F54 A;  2MA2 A;  3OX5 A;  4YGE B;  1L2O B;  5PAL A;  4CFQ A;  2M1K B;  2PSR A;  4MRX A;  5CSJ A;  1SL7 A;  2JXL A;  1XO5 A;  2KHN A;  2M8U A;  1CKK A;  4GBA A;  1A4P A;  3SIB A;  2MBX A;  3VGO A;  1UUS A;  2ZN9 A;  5IBW A;  3DF0 A;  1SPY A;  4FTG A;  1OMD A;  3WHU B;  1GGW A;  1LA3 A;  3BQ3 A;  2QPT A;  2ZFD A;  1OQP A;  5CSN A;  1WY9 A;  2JOJ A;  3PAL A;  1F70 A;  3PAT A;  5HLO A;  1S6I A;  2K7C A;  1DF0 A;  3NSO A;  1Q80 A;  2LVK A;  3LL8 B;  2LAP A;  4ORA B;  1NX3 A;  2R2I A;  3TZ1 A;  1QIV A;  1TNQ A;  1KFU S;  4ETO A;  1S3P A;  1H8B A;  1PUL A;  1YR5 A;  1YUU A;  3D0Y B;  1TNW A;  2HET A;  1KSM A;  1Y1X A;  1PVA A;  2KGR A;  1Y1A A;  2JT3 A;  2CCM A;  1B8L A;  2K8M B;  3ICB A;  1NPQ A;  2CT9 A;  3CZT X;  1SYM A;  4JWQ A;  4OKH A;  2HPS A;  3AAJ A;  1KWO C;  3LCP C;  2BBM A;  3NSI A;  2MHH A;  2LP3 A;  1IWQ A;  1K96 A;  3DF0 B;  2L4I A;  3OB1 B;  2K7D A;  1DMO A;  1QJT A;  1LIN A;  3WHT B;  4HSZ A;  3GOF A;  2L5X B;  3GK2 A;  1RJV A;  1CLL A;  1QV1 A;  1EXR A;  2LLS A;  2NXQ A;  1IG5 A;  1AJ5 A;  1DF0 B;  1PRW A;  1S6J A;  1G33 A;  1QTX A;  1ZFS A;  3CR4 X;  4PAL A;  4Q04 A;  2JTT A;  1Y1U A;  3VRN A;  2O60 A;  2I7A A;  1KQM B;  1YUR A;  1TNX A;  1DGV A;  2LP2 A;  2KGB C;  2HQ8 A;  1MR8 A;  3K21 A;  1QAT A;  1CMF A;  5I2O A;  1NP8 A;  2LLU A;  1S5G Y;  1CLB A;  1SMG A;  1OMV A;  1L2O C;  1CDM A;  4DCK A;  4USL A;  1EG4 A;  1BT6 A;  1SCM B;  1F4O A;  1NSH A;  1SK6 D;  1G8I A;  1UHK A;  2JNX A;  2ZN8 A;  5B8I B;  2KBM A;  1GGZ A;  4MRY A;  1B7T Y;  3I5F B;  2WCF A;  1KFU L;  1PK0 D;  3SG6 A;  1C7W A;  2L51 A;  4YGC B;  2ISD A;  4MN0 A;  1DGU A;  2LVI A;  1X02 A;  1WRL A;  4ORC B;  2JC2 A;  1S36 A;  1UUR A;  1A29 A;  2BE6 A;  1WRK A;  2F2P A;  4A4B A;  5KSZ A;  2WND A;  1G4Y R;  3SIA A;  1BJF A;  4C0K A;  1RFJ A;  4MZJ A;  2PRU A;  2E30 A;  2QAC A;  2K0J A;  1CM1 A;  1MHO A;  1QS7 A;  3BXK A;  1N0Y A;  1FPW A;  2M7N A;  4GAO A;  2KAY A;  3SG2 A;  1A75 A;  2CNP A;  2KI6 D;  2L4H A;  1S26 D;  4PCW A;  3CGA A;  1KCY A;  1M46 A;  5HYD A;  3CR5 X;  2LMU A;  1CMG A;  1XFY O;  2AMI A;  2NZ0 A;  1AJ4 A;  1OE9 B;  5KTY A;  1V1F A;  1JFK A;  3EVU A;  5ER4 X;  1F4Q A;  1MXL C;  1YTZ C;  3BUN B;  4OVN F;  1BOC A;  1BLQ A;  1ALW A;  3CTN A;  1KK7 Z;  2ZRS A;  1XYD A;  2JRF A;  2ZKM X;  2F33 A;  2L0P A;  2LAN A;  1JC2 A;  2PMY A;  1CDN A;  4HRG A;  2EHB A;  1CFF A;  3ZNI A;  1YUS A;  1K95 A;  3PLF B;  1RWY A;  1YX7 A;  2JQ6 A;  3A4U B;  3BYA A;  3EKJ A;  4N1F A;  4DS7 A;  2GGM A;  4WQ2 A;  2M29 A;  3SG4 A;  1M39 A;  1J7R A;  1KQM C;  4AQI A;  3PM8 A;  5HKZ A;  4AOM A;  2LNK A;  4ORB B;  2JT8 A;  5GQQ C;  4QJ4 B;  2M9G A;  1RK9 A;  1CFP A;  1A75 B;  2F8P A;  3EVR A;  3FWC A;  1B8C A;  1NWD A;  1AUI B;  2LLT A;  5ER5 A;  1K8U A;  5FYX A;  2CXJ A;  3TDZ A;  3PFV A;  1EL4 A;  2Y4Q A;  1IJ6 A;  4MZL A;  1Y0V H;  1SKT A;  4C0J A;  2K7O A;  3KF9 A;  3TS5 B;  1SCM C;  3TUY B;  3WNX B;  1NX0 A;  3CR2 A;  2BEC A;  3CWG A;  1KK7 Y;  2WOR A;  3I5F C;  2ZND A;  4P5O E;  4PE1 A;  5JOL A;  1KQV A;  4ZCU A;  2JPT A;  2CBL A;  1C07 A;  3I5I C;  2HF5 A;  5DKQ A;  3JVT B;  1SY9 A;  1EJ3 A;  2OTG B;  4MBE A;  4YRU A;  1DJG A;  4D1E A;  3CLN A;  1LXF C;  4WRI A;  4I5L B;  2VRG A;  3BUO B;  3HX4 A;  5CSF A;  1QX2 A;  2KDH A;  1AK8 A;  4XJK A;  3KEV A;  3IQQ A;  1SNL A;  4MSP A;  1IH0 A;  3AKA A;  1K90 D;  1B9A A;  2E6W A;  4PHJ A;  3SG7 A;  5JJG A;  1UP5 A;  3KPX A;  4YBH B;  3O6B A;  3EK7 A;  1TNP A;  1XFX O;  2PVB A;  2KYF A;  3BOW A;  1S1E A;  1YVL A;  2MJW B;  1QVI Z;  4YI9 A;  1JF2 A;  1N65 A;  5D7F A;  1OSA A;  5BPJ A;  1J55 A;  1M31 A;  4AQJ A;  2JNF A;  1V1G A;  4PHM A;  1FI6 A;  2G9B A;  1B1G A;  2LVV A;  2WCE A;  3CS1 A;  5CSI A;  2LMT A;  3JTD B;  4GGF C;  1JF0 A;  1TCF A;  5G08 A;  4PE0 A;  4I5N B;  2I18 A;  2MRD A;  4XYN A;  1IQ5 A;  1J7O A;  2BE4 A;  1PSB A;  1DTL A;  1NCY A;  3LK0 A;  3OX6 A;  2F3Y A;  2BCB A;  3VRQ A;  5I8N A;  1H4B A;  4OR9 B;  4I5K A;  2EC6 B;  4JQ0 D;  1CFC A;  1F71 A;  1NX2 A;  1QLK A;  3DVE A;  3EVV A;  4MZK A;  1EH2 A;  2KQ6 A;  1XK4 A;  3O78 A;  3FWB A;  1FW4 A;  4XJK B;  4GGN A;  4TNC A;  1SR6 B;  2H2K A;  1XFZ O;  3C1V A;  3DVM A;  4BY5 A;  5AER A;  2OPO A;  1QLS A;  2H61 A;  2O5G A;  1QX7 A;  3AAK A;  2Y1M A;  1A03 A;  1J7Q A;  5I2L A;  3BOW B;  5KU1 A;  4GNK B;  2LC5 A;  1DJY A;  5D69 A;  1IQ3 A;  1WRZ A;  1UWO A;  1SW8 A;  1WDC B;  2AUC A;  2BCA A;  3TS5 C;  2LE9 B;  1XA5 A;  4CFR A;  3TUY C;  2LVJ A;  2K61 A;  1PSR A;  3VRO A;  3DVJ A;  2NLN A;  4N5X A;  4R1E A;  3PSR A;  5CPV A;  1CNP A;  1MUX A;  2LMV A;  3GK1 A;  3PN7 B;  1XFW O;  1SBJ A;  2M7L A;  3ZWH A;  2Y5I A;  1FI5 A;  2LHL A;  5DKN A;  3JVT C;  2GV5 A;  4QJ5 B;  1ALV A;  2OTG C;  2F3Z A;  3SG5 A;  4PDZ A;  1K9P A;  4C0L A;  1F8H A;  3SG3 A;  1UHH A;  1YX8 A;  3SJS A;  3RLZ A;  3BUX B;  2KAX A;  1R6P A;  1C7V A;  1MF8 B;  3NSL A;  1BR4 B;  3OP0 A;  2KI6 C;  2L98 A;  4YGD B;  2M97 A;  4P2Y B;  1CTR A;  4I5J A;  3E3R A;  3FS7 A;  3M0W A;  1NIW A;  2TN4 A;  4FQO A;  4CID A;  2FCD A;  1KWO B;  2HQW A;  2KI4 B;  4DRW A;  3EKH A;  2A4J A;  2V53 A;  2MLF C;  1E8A A;  2IS9 A;  2M49 B;  4JPZ B;  3JTD C;  2Y1N A;  1CDP A;  2JTZ A;  2FJU B;  2G2B A;  4DUQ A;  1TCO B;  1CB1 A;  1L7Z A;  1K9K A;  3KHE A;  5AAN A;  1NYA A;  1TRF A;  1B8R A;  4PE7 A;  2AAO A;  2KOT A;  2KNE A;  3O4Y A;  1JBA A;  1J1E A;  1NCX A;  2DOQ A;  1ODB A;  4HRH A;  1MQ1 A;  1CFD A;  4PHK A;  5HKY A;  2OS8 B;  1SR6 C;  3DVK A;  2K2A A;  1ZMZ A;  2NCO A;  1U5I A;  1OZS A;  2M1U A;  2KFF A;  2LUC A;  1OZO A;  2KFG A;  3BUW B;  1YUT A;  4YGB B;  1PVB A;  4NDB A;  4CPV A;  1IKU A;  3HCM A;  1FF1 A;  1NCZ A;  2BBN A;  1XFU O;  1SRA A;  2KAV A;  1WDC C;  2Q4U A;  4PHN A;  1AHR A;  1KFX S;  1LVC D;  4NDC A;  1JWD A;  1UHN A;  2PAL A;  1F55 A;  1W7I B;  2RGI A;  1TN4 A;  1BG1 A;  5HLV A;  1SL9 A;  1TOP A;  5AFP A;  4M2Q A;  3PN7 C;  1HT9 A;  4GPL B;  1CLM A;  5I2Q A;  3QRX A;  4UPG A;  3I5H B;  1DT7 B;  2LV7 A;  2I94 A;  1A2X A;  1SCV A;  4NDD A;  2WOS A;  4E68 A;  4MVF A;  4GUK A;  1XK4 C;  1WLM A;  1LA0 A;  2B1U A;  3NXA A;  4F0Z B;  4M2P A;  2SCP A;  2KYC A;  1JSA A;  1SL8 A;  1K2H A;  1NUB A;  1U5I B;  2H61 C;  1AP4 A;  1S5G Z;  3DD4 A;  4GFT A;  4HRE E;  2KBI A;  4ICB A;  5F6T A;  4OV2 A;  1ZOT B;  4NQG A;  1IJ5 A;  5J3X A;  1M63 B;  2ZNE A;  2KI4 C;  1JUO A;  4CLN A;  1NX1 A;  1IGV A;  3VRR A;  5K89 A;  2JZI A;  1ZUZ A;  4M2O A;  1B7T Z;  2FOT A;  3LLE A;  3RM1 A;  3H4S E;  1W7J B;  4MLW A;  1FBV A;  1S6C A;  4PE4 A;  4IL1 A;  3NSK A;  3EK4 A;  1CDL A;  3MSE B;  1KK8 B;  3I5G B;  1MWN A;  3IF7 A;  5HKW A;  3A8R A;  1XFV O;  1Y6W A;  2NCP A;  2BL0 B;  3VRP A;  1QIW A;  1VRK A;  1M45 A;  2D8N A;  2GGZ A;  1BOD A;  3FIA A;  2PAS A;  5AXI A;  2M3W A;  1J7P A;  2L2E A;  2MAZ A;  1QVI Y;  2WC8 A;  2JXC A;  1QXP A;  4OCI A;  2FCE A;  1CM4 A;  2OS8 C;  2LM5 A;  2JU0 A;  1KFX L;  4A4C A;  1DJH A;  1MXE A;  2I2R E;  2ZRT A;  4DIR A;  1TIZ A;  1D1O A;  1K9U A;  1ZAC A;  2BKI B;  1YRT B;  3LK1 A;  1KSO A;  1UHI A;  1DJI A;  3IQO A;  4MEW A;  1AVS A;  3WXA A;  1RTP 1;  4BY4 A;  4GGF A;  1QX5 B;  4WQ3 A;  3OB2 B;  1J1D A;  2LCP A;  1YVH A;  2K2F A;  1DJZ A;  1RRO A;  2MLE C;  3O2P A;  1DJX A;  1PAL A;  3OHM B;  1WLZ A;  1DJW A;  2KQY A;  3I5I B;  4L9M A;  2Q91 A;  4YGA A;  2COL B;  2BKH B;  1B47 A;  1B4C A;  1DVI A;  3GK4 X;  3KO0 A;  2BCX A;  2LUX A;  2CTN A;  3I5H C;  2L50 A;  2P6B B;  2JT0 A;  1LKJ A;  1UHJ A;  1QAS A;  4U8D A;  2LHI A;  5DKR A;  1BMO A;  1N2D A;  1REC A;  3TDU A;  5AEQ A;  1BF5 A;  1GQM A;  1HQV A;  3AKB A;  1OOJ A;  2EGD A;  2K7B A;  1YRU B;  2JUL A;  2KSP A;  1K94 A;  4QJ3 B;  2EC6 C;  2JWW A;  3D10 A;  1QV0 A;  1BU3 A;  2WCB A;  1IRJ A;  1XVJ A;  2F2O A;  1JFJ A;  4N1G A;  2SAS A;  5TNC A;  1K93 D;  1KK8 C;  3I5G C;  2KFH A;  1R2U A;  3BUM B;  3EK8 A;  1OMR A;  3D0Y A;  4YI8 A;  2BL0 C;  4ZCV A;  3TDI A;  1EG3 A; 
#chains in the Genus database with same CATH topology
 1GJY A;  3F45 A;  1TTX A;  2M0R A;  1BR1 B;  1F54 A;  2MA2 A;  3OX5 A;  3L47 A;  1L2O B;  2KLE A;  4YGE B;  5PAL A;  2M1K B;  2PSR A;  4MRX A;  5CSJ A;  1SL7 A;  4CFQ A;  3OGN A;  2JXL A;  3R72 A;  1XO5 A;  2KHN A;  2M8U A;  1CKK A;  4GBA A;  1A4P A;  3SIB A;  2MBX A;  3VGO A;  1UUS A;  2ZN9 A;  5IBW A;  3DF0 A;  1SPY A;  4FTG A;  1OMD A;  2QEH A;  3WHU B;  1GGW A;  1LA3 A;  3BQ3 A;  2QPT A;  2ZFD A;  1OQP A;  5CSN A;  1WY9 A;  3UO9 A;  2JOJ A;  3PAL A;  1F70 A;  3PAT A;  5HLO A;  1S6I A;  2K7C A;  3IVT A;  1DF0 A;  3NSO A;  1Q80 A;  2LVK A;  3LL8 B;  2LAP A;  4ORA B;  1TUJ A;  1NX3 A;  2R2I A;  3TZ1 A;  1QIV A;  1TNQ A;  1KFU S;  4ETO A;  3BFH A;  1S3P A;  1H8B A;  1PUL A;  1YR5 A;  1YUU A;  3BFB A;  3D0Y B;  1TNW A;  2HET A;  1KSM A;  1Y1X A;  1PVA A;  2KGR A;  1Y1A A;  2JT3 A;  2CCM A;  1B8L A;  2K8M B;  2YGU A;  3ICB A;  1NPQ A;  2CT9 A;  3CZT X;  1SYM A;  4JWQ A;  3N7H A;  4OKH A;  2HPS A;  3AAJ A;  3L4A A;  1KWO C;  3LCP C;  2BBM A;  3NSI A;  2MHH A;  2LP3 A;  1IWQ A;  1K96 A;  4KYN A;  3DF0 B;  2L4I A;  3OB1 B;  2K7D A;  1DMO A;  1QJT A;  1LIN A;  3WHT B;  4HSZ A;  3GOF A;  2L5X B;  3GK2 A;  1RJV A;  1CLL A;  1QV1 A;  1EXR A;  2LLS A;  2NXQ A;  1IG5 A;  1AJ5 A;  1DF0 B;  1PRW A;  1S6J A;  1G33 A;  1QTX A;  1ZFS A;  3CAB A;  3CR4 X;  1OW4 A;  2JTT A;  1Y1U A;  3PM2 A;  3K1E A;  4PAL A;  2O60 A;  2I7A A;  1KQM B;  1YUR A;  2FJY A;  4PT1 A;  1TNX A;  1DGV A;  2LP2 A;  2KGB C;  1C3Y A;  2HQ8 A;  1MR8 A;  3K21 A;  1QAT A;  1CMF A;  5I2O A;  1NP8 A;  2LLU A;  1S5G Y;  1CLB A;  1SMG A;  1OMV A;  1L2O C;  1OOI X;  1CDM A;  4DCK A;  4USL A;  1EG4 A;  1BT6 A;  1SCM B;  1F4O A;  1NSH A;  1SK6 D;  2QEO A;  3SS4 A;  1G8I A;  1UHK A;  2JNX A;  2ZN8 A;  3SS3 A;  2KBM A;  1GGZ A;  4MRY A;  1B7T Y;  3I5F B;  2WCF A;  5B8I B;  1KFU L;  1PK0 D;  3SG6 A;  1C7W A;  2L51 A;  1P28 A;  4YGC B;  2ISD A;  4F7F A;  4MN0 A;  1DGU A;  2LVI A;  1X02 A;  1WRL A;  4ORC B;  2JC2 A;  1S36 A;  2PYQ A;  1UUR A;  1A29 A;  2BE6 A;  1WRK A;  2F2P A;  4A4B A;  5KSZ A;  2WND A;  1G4Y R;  3B6X A;  1BJF A;  3SIA A;  1ORG A;  1RFJ A;  2WC6 A;  4MZJ A;  3UNW A;  2PRU A;  2E30 A;  2QAC A;  2K0J A;  1CM1 A;  1MHO A;  1QS7 A;  3BXK A;  1N0Y A;  1FPW A;  2M7N A;  4GAO A;  2KAY A;  3SG2 A;  1A75 A;  2CNP A;  2KI6 D;  2L4H A;  1S26 D;  4PCW A;  3CGA A;  1KCY A;  1M46 A;  5HYD A;  2QEB A;  3CR5 X;  2LMU A;  1CMG A;  1XFY O;  2AMI A;  2NZ0 A;  1AJ4 A;  1OE9 B;  5KTY A;  1V1F A;  1JFK A;  2PQL A;  3EVU A;  5ER4 X;  1F4Q A;  1MXL C;  1YTZ C;  3BUN B;  4C0K A;  4OVN F;  1BOC A;  1BLQ A;  1ALW A;  1W9Z A;  3CTN A;  1KK7 Z;  2ZRS A;  1XYD A;  2JRF A;  2ZKM X;  2F33 A;  2L0P A;  2LAN A;  1JC2 A;  2PMY A;  1CDN A;  4HRG A;  2EHB A;  1CFF A;  3ZNI A;  1Z2C B;  1YUS A;  1K95 A;  3PLF B;  3S0E A;  3RZS A;  1RWY A;  1YX7 A;  1TWO A;  2JQ6 A;  3A4U B;  3BYA A;  3EKJ A;  4N1F A;  4DS7 A;  2GGM A;  4WQ2 A;  2M29 A;  3SG4 A;  1M39 A;  1J7R A;  1KQM C;  4AQI A;  3PM8 A;  5HKZ A;  4AOM A;  2LNK A;  3NGV A;  4ORB B;  2JT8 A;  5GQQ C;  4QJ4 B;  2M9G A;  1RK9 A;  3D77 A;  3FE8 A;  1A75 B;  2F8P A;  3EVR A;  3S0D A;  1CFP A;  3FWC A;  3SS5 A;  1B8C A;  1NWD A;  1AUI B;  2LLT A;  3FE6 A;  1K8U A;  5ER5 A;  2CXJ A;  5FYX A;  3TDZ A;  3PFV A;  1EL4 A;  2Y4Q A;  1IJ6 A;  5FI6 A;  1QWV A;  4MZL A;  1Y0V H;  1SKT A;  4C0J A;  1XFR A;  2K7O A;  3KF9 A;  1SCM C;  3TS5 B;  3TUY B;  3WNX B;  1NX0 A;  3CR2 A;  3VRN A;  3B87 A;  2WCL A;  2BEC A;  3CWG A;  1KK7 Y;  2WOR A;  3I5F C;  2ZND A;  4P5O E;  4PE1 A;  5FI7 A;  5JOL A;  1KQV A;  4ZCU A;  2JPT A;  2CBL A;  1C07 A;  3I5I C;  2HF5 A;  5DKQ A;  3JVT B;  1SY9 A;  1EJ3 A;  2OTG B;  2BAP A;  4MBE A;  4YRU A;  1DJG A;  4D1E A;  3CLN A;  1LXF C;  3B7A A;  4WRI A;  4I5L B;  2VRG A;  3BUO B;  3HX4 A;  5CSF A;  1QX2 A;  2KDH A;  2WCJ A;  4XJK A;  5D3O A;  3KEV A;  3IQQ A;  1AK8 A;  1SNL A;  4MSP A;  1IH0 A;  3AKA A;  1K90 D;  2P71 A;  3CYZ A;  1B9A A;  2E6W A;  4PHJ A;  3SG7 A;  5JJG A;  1UP5 A;  3KPX A;  1LS8 A;  4YBH B;  3O6B A;  3EK7 A;  1XFX O;  1TNP A;  2PVB A;  2KYF A;  3BOW A;  1S1E A;  1YVL A;  2MJW B;  1QVI Z;  4YI9 A;  1JF2 A;  1N65 A;  5D7F A;  1OSA A;  5BPJ A;  1J55 A;  1M31 A;  4AQJ A;  2JNF A;  1V1G A;  4PHM A;  1FI6 A;  2G9B A;  1B1G A;  2LVV A;  2WCE A;  3CS1 A;  5CSI A;  2LMT A;  3JTD B;  4GGF C;  1JF0 A;  1TCF A;  3CZ2 A;  5G08 A;  3D74 A;  4PE0 A;  4I5N B;  2I18 A;  2MRD A;  4XYN A;  1IQ5 A;  1J7O A;  2BE4 A;  1PSB A;  1DTL A;  1NCY A;  3LK0 A;  3OX6 A;  2F3Y A;  2BCB A;  3VRQ A;  5I8N A;  1H4B A;  3BJH A;  4OR9 B;  4I5K A;  2EC6 B;  4JQ0 D;  1CFC A;  3S0A A;  1F71 A;  1NX2 A;  1QLK A;  3DVE A;  3EVV A;  4MZK A;  1EH2 A;  2KQ6 A;  1XK4 A;  3DY9 A;  3O78 A;  3FWB A;  1FW4 A;  4XJK B;  3Q8I A;  4GGN A;  4TNC A;  1SR6 B;  2H2K A;  1XFZ O;  3C1V A;  3DVM A;  4BY5 A;  5AER A;  2OPO A;  3PJI A;  1QLS A;  2H61 A;  2O5G A;  1QX7 A;  3AAK A;  2Y1M A;  1A03 A;  1J7Q A;  5I2L A;  3BOW B;  5KU1 A;  4GNK B;  2LC5 A;  1DJY A;  5D69 A;  1IQ3 A;  3OBV A;  1WRZ A;  3NHI A;  1UWO A;  2H8V A;  1SW8 A;  1WDC B;  2AUC A;  2BCA A;  3TS5 C;  2LE9 B;  1XA5 A;  4CFR A;  3TUY C;  2LVJ A;  2K61 A;  1PSR A;  3VRO A;  3DVJ A;  2NLN A;  4N5X A;  4R1E A;  3PSR A;  5CPV A;  1CNP A;  1MUX A;  2LMV A;  3GK1 A;  3CZ0 A;  3PN7 B;  1XFW O;  1SBJ A;  2M7L A;  3ZWH A;  4Q04 A;  2Y5I A;  1FI5 A;  2LHL A;  3FE9 A;  5DKN A;  3JVT C;  1DC1 A;  2GV5 A;  4QJ5 B;  1ALV A;  2OTG C;  1IIO A;  2F3Z A;  3SG5 A;  4PDZ A;  1K9P A;  4C0L A;  5I94 A;  1F8H A;  3SG3 A;  1UHH A;  5EL2 A;  1YX8 A;  3SJS A;  3RLZ A;  3BUX B;  2KAX A;  2KLD A;  1R6P A;  1C7V A;  1MF8 B;  3NSL A;  3S0F A;  1BR4 B;  3OP0 A;  2KI6 C;  2L98 A;  4YGD B;  2M97 A;  4P2Y B;  1CTR A;  4I5J A;  3E3R A;  3FS7 A;  3M0W A;  1NIW A;  2TN4 A;  4FQO A;  4CID A;  2FCD A;  1KWO B;  2HQW A;  2KI4 B;  4DRW A;  3EKH A;  2A4J A;  2V53 A;  2MLF C;  1E8A A;  2IS9 A;  2M49 B;  4JPZ B;  3JTD C;  2Y1N A;  1CDP A;  2JTZ A;  2FJU B;  2G2B A;  3R1O A;  1TCO B;  4DUQ A;  1L7Z A;  1K9K A;  1CB1 A;  3KHE A;  5AAN A;  1NYA A;  1TRF A;  3CZ1 A;  1B8R A;  4PE7 A;  2AAO A;  2KOT A;  2KNE A;  3O4Y A;  1JBA A;  1J1E A;  1NCX A;  2DOQ A;  3D75 A;  1ODB A;  4HRH A;  1MQ1 A;  5FI2 A;  1CFD A;  4PHK A;  3R1V A;  5HKY A;  2OS8 B;  1SR6 C;  2ERB A;  3DVK A;  2K2A A;  1ZMZ A;  2NCO A;  1U5I A;  3D78 A;  5HL1 A;  1OZS A;  2M1U A;  2KFF A;  3L4L A;  2LUC A;  1OZO A;  2KFG A;  2KPH A;  3BUW B;  1YUT A;  4YGB B;  1PVB A;  3VB1 A;  2JPO A;  4NDB A;  4CPV A;  1IKU A;  3HCM A;  1DQE A;  1FF1 A;  1NCZ A;  2BBN A;  1XFU O;  1SRA A;  2KAV A;  1WDC C;  2Q4U A;  2K60 A;  4PHN A;  1AHR A;  1KFX S;  1LVC D;  4NDC A;  1JWD A;  1UHN A;  2PAL A;  1F55 A;  1W7I B;  2RGI A;  1TN4 A;  1BG1 A;  5HLV A;  1SL9 A;  1TOP A;  5AFP A;  4INW A;  3PN7 C;  1HT9 A;  2QDI A;  4GPL B;  1CLM A;  4M2Q A;  2L5Y A;  5I2Q A;  3QRX A;  4UPG A;  3I5H B;  1DT7 B;  2LV7 A;  3QME A;  2I94 A;  1A2X A;  1SCV A;  3CDN A;  2WOS A;  3D76 A;  4NDD A;  4MVF A;  4E68 A;  4GUK A;  1XK4 C;  1WLM A;  1LA0 A;  2B1U A;  3NXA A;  4F0Z B;  3V2L A;  4M2P A;  2SCP A;  2KYC A;  1JSA A;  1SL8 A;  1K2H A;  1T14 A;  1NUB A;  1U5I B;  2H61 C;  1AP4 A;  3S0G A;  1S5G Z;  3DD4 A;  1TUZ A;  4GFT A;  4HRE E;  2KBI A;  4ICB A;  3BFA A;  5F6T A;  4OV2 A;  1ZOT B;  4NQG A;  1IJ5 A;  5J3X A;  1M63 B;  2ZNE A;  2KI4 C;  1JUO A;  4CLN A;  2QEV A;  1NX1 A;  1IGV A;  3VRR A;  3B86 A;  5K89 A;  2JZI A;  1ZUZ A;  4M2O A;  1B7T Z;  2FOT A;  3LLE A;  3RM1 A;  3H4S E;  1W7J B;  4MLW A;  1FBV A;  1S6C A;  4PE4 A;  4IL1 A;  3NSK A;  3EK4 A;  1CDL A;  3DYE A;  1KK8 B;  3I5G B;  1MWN A;  3IF7 A;  3MSE B;  5HKW A;  3A8R A;  1XFV O;  3B88 A;  1Y6W A;  2NCP A;  1Z4H A;  2BL0 B;  3VRP A;  1QIW A;  1VRK A;  3R1P A;  1M45 A;  2D8N A;  2GGZ A;  1BOD A;  3FIA A;  2PAS A;  5AXI A;  2M3W A;  1J7P A;  2L2E A;  2MAZ A;  2P70 A;  1QVI Y;  2WC8 A;  2JXC A;  1QXP A;  4OCI A;  2FCE A;  1DEL A;  1CM4 A;  2OS8 C;  2LM5 A;  2JU0 A;  1KFX L;  4A4C A;  1DJH A;  1MXE A;  2I2R E;  2ZRT A;  4DIR A;  1TIZ A;  1D1O A;  1K9U A;  1ZAC A;  2BKI B;  1YRT B;  1DEK A;  3LK1 A;  2WCM A;  1KSO A;  1UHI A;  1DJI A;  3IQO A;  4MEW A;  1AVS A;  3WXA A;  2L2C A;  1RTP 1;  4BY4 A;  4GGF A;  1QX5 B;  4WQ3 A;  3OB2 B;  1J1D A;  2LCP A;  2WC5 A;  1YVH A;  2K2F A;  1DJZ A;  1OOG A;  1RRO A;  2MLE C;  3O2P A;  1DJX A;  1PAL A;  3OHM B;  1WLZ A;  1DJW A;  2KQY A;  3I5I B;  5DIC A;  4L9M A;  1C3Z A;  2Q91 A;  3NHT A;  4YGA A;  2COL B;  2BKH B;  1B47 A;  3DZT A;  1B4C A;  1DVI A;  3GK4 X;  3KO0 A;  2BCX A;  2LUX A;  2CTN A;  3I5H C;  2L50 A;  2WCH A;  2P6B B;  2JT0 A;  1LKJ A;  4JKT A;  3D73 A;  1UHJ A;  3O4X A;  1SSE B;  1OOF A;  2GTE A;  1OOH A;  3EG5 B;  1QAS A;  4U8D A;  2LHI A;  5DKR A;  1BMO A;  2WCK A;  1GM0 A;  1N2D A;  1REC A;  3TDU A;  4INX A;  5AEQ A;  1BF5 A;  1GQM A;  1HQV A;  3AKB A;  1OOJ A;  2EGD A;  2K7B A;  1YRU B;  2BNX A;  2JUL A;  3DXL A;  2KSP A;  1K94 A;  4QJ3 B;  2EC6 C;  2JWW A;  3S0B A;  3D10 A;  1QV0 A;  1BU3 A;  2WCB A;  1IRJ A;  1XVJ A;  2F2O A;  4FQT A;  4N1G A;  1JFJ A;  2SAS A;  5TNC A;  1K93 D;  1KK8 C;  3I5G C;  2KFH A;  4IJ7 A;  1R2U A;  3BUM B;  3EK8 A;  1OMR A;  4OZD A;  3D0Y A;  4YI8 A;  2BL0 C;  4ZCV A;  3TDI A;  1EG3 A;  4JD9 A; 
#chains in the Genus database with same CATH homology
 1GJY A;  3F45 A;  1TTX A;  2M0R A;  1BR1 B;  1F54 A;  2MA2 A;  3OX5 A;  4YGE B;  1L2O B;  5PAL A;  4CFQ A;  2M1K B;  2PSR A;  4MRX A;  5CSJ A;  1SL7 A;  2JXL A;  1XO5 A;  2KHN A;  2M8U A;  1CKK A;  4GBA A;  1A4P A;  3SIB A;  2MBX A;  3VGO A;  1UUS A;  2ZN9 A;  5IBW A;  3DF0 A;  1SPY A;  4FTG A;  1OMD A;  3WHU B;  1GGW A;  1LA3 A;  3BQ3 A;  2QPT A;  2ZFD A;  1OQP A;  5CSN A;  1WY9 A;  2JOJ A;  3PAL A;  1F70 A;  3PAT A;  5HLO A;  1S6I A;  2K7C A;  1DF0 A;  3NSO A;  1Q80 A;  2LVK A;  3LL8 B;  2LAP A;  4ORA B;  1NX3 A;  2R2I A;  3TZ1 A;  1QIV A;  1TNQ A;  1KFU S;  4ETO A;  1S3P A;  1H8B A;  1PUL A;  1YR5 A;  1YUU A;  3D0Y B;  1TNW A;  2HET A;  1KSM A;  1Y1X A;  1PVA A;  2KGR A;  1Y1A A;  2JT3 A;  2CCM A;  1B8L A;  2K8M B;  3ICB A;  1NPQ A;  2CT9 A;  3CZT X;  1SYM A;  4JWQ A;  4OKH A;  2HPS A;  3AAJ A;  1KWO C;  3LCP C;  2BBM A;  3NSI A;  2MHH A;  2LP3 A;  1IWQ A;  1K96 A;  3DF0 B;  2L4I A;  3OB1 B;  2K7D A;  1DMO A;  1QJT A;  1LIN A;  3WHT B;  4HSZ A;  3GOF A;  2L5X B;  3GK2 A;  1RJV A;  1CLL A;  1QV1 A;  1EXR A;  2LLS A;  2NXQ A;  1IG5 A;  1AJ5 A;  1DF0 B;  1PRW A;  1S6J A;  1G33 A;  1QTX A;  1ZFS A;  3CR4 X;  4PAL A;  4Q04 A;  2JTT A;  1Y1U A;  3VRN A;  2O60 A;  2I7A A;  1KQM B;  1YUR A;  1TNX A;  1DGV A;  2LP2 A;  2KGB C;  2HQ8 A;  1MR8 A;  3K21 A;  1QAT A;  1CMF A;  5I2O A;  1NP8 A;  2LLU A;  1S5G Y;  1CLB A;  1SMG A;  1OMV A;  1L2O C;  1CDM A;  4DCK A;  4USL A;  1EG4 A;  1BT6 A;  1SCM B;  1F4O A;  1NSH A;  1SK6 D;  1G8I A;  1UHK A;  2JNX A;  2ZN8 A;  5B8I B;  2KBM A;  1GGZ A;  4MRY A;  1B7T Y;  3I5F B;  2WCF A;  1KFU L;  1PK0 D;  3SG6 A;  1C7W A;  2L51 A;  4YGC B;  2ISD A;  4MN0 A;  1DGU A;  2LVI A;  1X02 A;  1WRL A;  4ORC B;  2JC2 A;  1S36 A;  1UUR A;  1A29 A;  2BE6 A;  1WRK A;  2F2P A;  4A4B A;  5KSZ A;  2WND A;  1G4Y R;  3SIA A;  1BJF A;  4C0K A;  1RFJ A;  4MZJ A;  2PRU A;  2E30 A;  2QAC A;  2K0J A;  1CM1 A;  1MHO A;  1QS7 A;  3BXK A;  1N0Y A;  1FPW A;  2M7N A;  4GAO A;  2KAY A;  3SG2 A;  1A75 A;  2CNP A;  2KI6 D;  2L4H A;  1S26 D;  4PCW A;  3CGA A;  1KCY A;  1M46 A;  5HYD A;  3CR5 X;  2LMU A;  1CMG A;  1XFY O;  2AMI A;  2NZ0 A;  1AJ4 A;  1OE9 B;  5KTY A;  1V1F A;  1JFK A;  3EVU A;  5ER4 X;  1F4Q A;  1MXL C;  1YTZ C;  3BUN B;  4OVN F;  1BOC A;  1BLQ A;  1ALW A;  3CTN A;  1KK7 Z;  2ZRS A;  1XYD A;  2JRF A;  2ZKM X;  2F33 A;  2L0P A;  2LAN A;  1JC2 A;  2PMY A;  1CDN A;  4HRG A;  2EHB A;  1CFF A;  3ZNI A;  1YUS A;  1K95 A;  3PLF B;  1RWY A;  1YX7 A;  2JQ6 A;  3A4U B;  3BYA A;  3EKJ A;  4N1F A;  4DS7 A;  2GGM A;  4WQ2 A;  2M29 A;  3SG4 A;  1M39 A;  1J7R A;  1KQM C;  4AQI A;  3PM8 A;  5HKZ A;  4AOM A;  2LNK A;  4ORB B;  2JT8 A;  5GQQ C;  4QJ4 B;  2M9G A;  1RK9 A;  1CFP A;  1A75 B;  2F8P A;  3EVR A;  3FWC A;  1B8C A;  1NWD A;  1AUI B;  2LLT A;  5ER5 A;  1K8U A;  5FYX A;  2CXJ A;  3TDZ A;  3PFV A;  1EL4 A;  2Y4Q A;  1IJ6 A;  4MZL A;  1Y0V H;  1SKT A;  4C0J A;  2K7O A;  3KF9 A;  3TS5 B;  1SCM C;  3TUY B;  3WNX B;  1NX0 A;  3CR2 A;  2BEC A;  3CWG A;  1KK7 Y;  2WOR A;  3I5F C;  2ZND A;  4P5O E;  4PE1 A;  5JOL A;  1KQV A;  4ZCU A;  2JPT A;  2CBL A;  1C07 A;  3I5I C;  2HF5 A;  5DKQ A;  3JVT B;  1SY9 A;  1EJ3 A;  2OTG B;  4MBE A;  4YRU A;  1DJG A;  4D1E A;  3CLN A;  1LXF C;  4WRI A;  4I5L B;  2VRG A;  3BUO B;  3HX4 A;  5CSF A;  1QX2 A;  2KDH A;  1AK8 A;  4XJK A;  3KEV A;  3IQQ A;  1SNL A;  4MSP A;  1IH0 A;  3AKA A;  1K90 D;  1B9A A;  2E6W A;  4PHJ A;  3SG7 A;  5JJG A;  1UP5 A;  3KPX A;  4YBH B;  3O6B A;  3EK7 A;  1TNP A;  1XFX O;  2PVB A;  2KYF A;  3BOW A;  1S1E A;  1YVL A;  2MJW B;  1QVI Z;  4YI9 A;  1JF2 A;  1N65 A;  5D7F A;  1OSA A;  5BPJ A;  1J55 A;  1M31 A;  4AQJ A;  2JNF A;  1V1G A;  4PHM A;  1FI6 A;  2G9B A;  1B1G A;  2LVV A;  2WCE A;  3CS1 A;  5CSI A;  2LMT A;  3JTD B;  4GGF C;  1JF0 A;  1TCF A;  5G08 A;  4PE0 A;  4I5N B;  2I18 A;  2MRD A;  4XYN A;  1IQ5 A;  1J7O A;  2BE4 A;  1PSB A;  1DTL A;  1NCY A;  3LK0 A;  3OX6 A;  2F3Y A;  2BCB A;  3VRQ A;  5I8N A;  1H4B A;  4OR9 B;  4I5K A;  2EC6 B;  4JQ0 D;  1CFC A;  1F71 A;  1NX2 A;  1QLK A;  3DVE A;  3EVV A;  4MZK A;  1EH2 A;  2KQ6 A;  1XK4 A;  3O78 A;  3FWB A;  1FW4 A;  4XJK B;  4GGN A;  4TNC A;  1SR6 B;  2H2K A;  1XFZ O;  3C1V A;  3DVM A;  4BY5 A;  5AER A;  2OPO A;  1QLS A;  2H61 A;  2O5G A;  1QX7 A;  3AAK A;  2Y1M A;  1A03 A;  1J7Q A;  5I2L A;  3BOW B;  5KU1 A;  4GNK B;  2LC5 A;  1DJY A;  5D69 A;  1IQ3 A;  1WRZ A;  1UWO A;  1SW8 A;  1WDC B;  2AUC A;  2BCA A;  3TS5 C;  2LE9 B;  1XA5 A;  4CFR A;  3TUY C;  2LVJ A;  2K61 A;  1PSR A;  3VRO A;  3DVJ A;  2NLN A;  4N5X A;  4R1E A;  3PSR A;  5CPV A;  1CNP A;  1MUX A;  2LMV A;  3GK1 A;  3PN7 B;  1XFW O;  1SBJ A;  2M7L A;  3ZWH A;  2Y5I A;  1FI5 A;  2LHL A;  5DKN A;  3JVT C;  2GV5 A;  4QJ5 B;  1ALV A;  2OTG C;  2F3Z A;  3SG5 A;  4PDZ A;  1K9P A;  4C0L A;  1F8H A;  3SG3 A;  1UHH A;  1YX8 A;  3SJS A;  3RLZ A;  3BUX B;  2KAX A;  1R6P A;  1C7V A;  1MF8 B;  3NSL A;  1BR4 B;  3OP0 A;  2KI6 C;  2L98 A;  4YGD B;  2M97 A;  4P2Y B;  1CTR A;  4I5J A;  3E3R A;  3FS7 A;  3M0W A;  1NIW A;  2TN4 A;  4FQO A;  4CID A;  2FCD A;  1KWO B;  2HQW A;  2KI4 B;  4DRW A;  3EKH A;  2A4J A;  2V53 A;  2MLF C;  1E8A A;  2IS9 A;  2M49 B;  4JPZ B;  3JTD C;  2Y1N A;  1CDP A;  2JTZ A;  2FJU B;  2G2B A;  4DUQ A;  1TCO B;  1CB1 A;  1L7Z A;  1K9K A;  3KHE A;  5AAN A;  1NYA A;  1TRF A;  1B8R A;  4PE7 A;  2AAO A;  2KOT A;  2KNE A;  3O4Y A;  1JBA A;  1J1E A;  1NCX A;  2DOQ A;  1ODB A;  4HRH A;  1MQ1 A;  1CFD A;  4PHK A;  5HKY A;  2OS8 B;  1SR6 C;  3DVK A;  2K2A A;  1ZMZ A;  2NCO A;  1U5I A;  1OZS A;  2M1U A;  2KFF A;  2LUC A;  1OZO A;  2KFG A;  3BUW B;  1YUT A;  4YGB B;  1PVB A;  4NDB A;  4CPV A;  1IKU A;  3HCM A;  1FF1 A;  1NCZ A;  2BBN A;  1XFU O;  1SRA A;  2KAV A;  1WDC C;  2Q4U A;  4PHN A;  1AHR A;  1KFX S;  1LVC D;  4NDC A;  1JWD A;  1UHN A;  2PAL A;  1F55 A;  1W7I B;  2RGI A;  1TN4 A;  1BG1 A;  5HLV A;  1SL9 A;  1TOP A;  5AFP A;  4M2Q A;  3PN7 C;  1HT9 A;  4GPL B;  1CLM A;  5I2Q A;  3QRX A;  4UPG A;  3I5H B;  1DT7 B;  2LV7 A;  2I94 A;  1A2X A;  1SCV A;  4NDD A;  2WOS A;  4E68 A;  4MVF A;  4GUK A;  1XK4 C;  1WLM A;  1LA0 A;  2B1U A;  3NXA A;  4F0Z B;  4M2P A;  2SCP A;  2KYC A;  1JSA A;  1SL8 A;  1K2H A;  1NUB A;  1U5I B;  2H61 C;  1AP4 A;  1S5G Z;  3DD4 A;  4GFT A;  4HRE E;  2KBI A;  4ICB A;  5F6T A;  4OV2 A;  1ZOT B;  4NQG A;  1IJ5 A;  5J3X A;  1M63 B;  2ZNE A;  2KI4 C;  1JUO A;  4CLN A;  1NX1 A;  1IGV A;  3VRR A;  5K89 A;  2JZI A;  1ZUZ A;  4M2O A;  1B7T Z;  2FOT A;  3LLE A;  3RM1 A;  3H4S E;  1W7J B;  4MLW A;  1FBV A;  1S6C A;  4PE4 A;  4IL1 A;  3NSK A;  3EK4 A;  1CDL A;  3MSE B;  1KK8 B;  3I5G B;  1MWN A;  3IF7 A;  5HKW A;  3A8R A;  1XFV O;  1Y6W A;  2NCP A;  2BL0 B;  3VRP A;  1QIW A;  1VRK A;  1M45 A;  2D8N A;  2GGZ A;  1BOD A;  3FIA A;  2PAS A;  5AXI A;  2M3W A;  1J7P A;  2L2E A;  2MAZ A;  1QVI Y;  2WC8 A;  2JXC A;  1QXP A;  4OCI A;  2FCE A;  1CM4 A;  2OS8 C;  2LM5 A;  2JU0 A;  1KFX L;  4A4C A;  1DJH A;  1MXE A;  2I2R E;  2ZRT A;  4DIR A;  1TIZ A;  1D1O A;  1K9U A;  1ZAC A;  2BKI B;  1YRT B;  3LK1 A;  1KSO A;  1UHI A;  1DJI A;  3IQO A;  4MEW A;  1AVS A;  3WXA A;  1RTP 1;  4BY4 A;  4GGF A;  1QX5 B;  4WQ3 A;  3OB2 B;  1J1D A;  2LCP A;  1YVH A;  2K2F A;  1DJZ A;  1RRO A;  2MLE C;  3O2P A;  1DJX A;  1PAL A;  3OHM B;  1WLZ A;  1DJW A;  2KQY A;  3I5I B;  4L9M A;  2Q91 A;  4YGA A;  2COL B;  2BKH B;  1B47 A;  1B4C A;  1DVI A;  3GK4 X;  3KO0 A;  2BCX A;  2LUX A;  2CTN A;  3I5H C;  2L50 A;  2P6B B;  2JT0 A;  1LKJ A;  1UHJ A;  1QAS A;  4U8D A;  2LHI A;  5DKR A;  1BMO A;  1N2D A;  1REC A;  3TDU A;  5AEQ A;  1BF5 A;  1GQM A;  1HQV A;  3AKB A;  1OOJ A;  2EGD A;  2K7B A;  1YRU B;  2JUL A;  2KSP A;  1K94 A;  4QJ3 B;  2EC6 C;  2JWW A;  3D10 A;  1QV0 A;  1BU3 A;  2WCB A;  1IRJ A;  1XVJ A;  2F2O A;  1JFJ A;  4N1G A;  2SAS A;  5TNC A;  1K93 D;  1KK8 C;  3I5G C;  2KFH A;  1R2U A;  3BUM B;  3EK8 A;  1OMR A;  3D0Y A;  4YI8 A;  2BL0 C;  4ZCV A;  3TDI A;  1EG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...