1NX3A

Calpain domain vi in complex with the inhibitor pd150606
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx3A00
1IWQA 2ZNDA 4GGFA 1B4CA 2WCFA 3BYAA 1EH2A 1F8HA 3GK2A 3EKHA 1K95A 1QV1A 1CFPA 1BF5A 1KSMA 2K61A 1CFDA 1CNPA 1W7IB 5F6TA 2F8PA 1LA0A 1NPQA 1UP5A 4OV2A 1SR6B 1B8CA 4F0ZB 1WDCB 2K7DA 3NXAA 2BKIB 2L0PA 3CS1A 1C7VA 2QACA 4AQJA 1JUOA 2KI4B 1ZMZA 1J7OA 1GQMA 1TNQA 1EXRA 2HF5A 2PASA 1QV0A 1L7ZA 2CTNA 4MZKA 1LKJA 3O78A 4BY4A 1SCMB 2E30A 1R6PA 2KI6C 4YI8A 4AOMA 5AXIA 1K93D 4ORBB 1A75A 1CMFA 5ER4X 2MA2A 1SL8A 3EKJA 2G2BA 2JNXA 1QX2A 1XFYO 3WHUB 2Y1NA 3SG4A 5J3XA 3BXKA 2KBIA 4JQ0D 1QLSA 5CSNA 2LLUA 4C0LA 1KFXS 2OTGB 3D10A 5KTYA 1BODA 2EGDA 1FW4A 1M46A 1KWOB 3TZ1A 1K9UA 1XK4C 1NX1A 3TDIA 3M0WA 1A75B 2O60A 2JWWA 2TN4A 1DJWA 5JOLA 3K21A 2K0JA 4N5XA 3BUWB 5I2OA 3JTDC 4D1EA 3PSRA 1CLBA 2BCBA 1KK7Z 1ZFSA 2M7NA 1NUBA 2F3YA 3I5IC 4ICBA 4YBHB 2KHNA 1JFKA 4ETOA 3OX5A 1AP4A 1SRAA 1VRKA 4ORAB 5D7FA 2K7OA 2K8MB 1MHOA 1PSRA 1SMGA 5CSFA 1MWNA 1GGZA 2PRUA 2AUCA 2KAVA 1J7RA 1H4BA 1FPWA 2MLEC 1XYDA 1BR1B 1SK6D 3TS5B 1XFXO 1YURA 4N1FA 1BG1A 3LK0A 1G4YR 2L2EA 4OR9B 1DJYA 4M2OA 1CLLA 5HKWA 1BOCA 2WCBA 4MZJA 1SPYA 1F55A 3AKBA 2HETA 3AAKA 1FF1A 4GUKA 1B8LA 3KPXA 1J1DA 1OQPA 4QJ3B 2K7CA 1YX7A 3D0YA 4PHJA 1QIWA 4YGEB 1DTLA 3JVTB 3PN7B 2JRFA 5HLVA 4P2YB 4JPZB 1YRUB 2AMIA 2KAYA 2LVIA 2KQ6A 2JT0A 2OS8C 1SL7A 2WNDA 3DF0B 3KF9A 2P6BB 4NQGA 1AHRA 1F54A 1BLQA 1TNPA 4I5JA 3VRNA 3PALA 1S3PA 5BPJA 1WRLA 2MJWB 3FS7A 5CPVA 1YVLA 2F3ZA 2F2PA 4ZCVA 1B47A 2E6WA 1F4OA 2JT3A 3D0YB 5I2QA 2JC2A 2EC6B 1E8AA 1S5GZ 1PVBA 4NDDA 1LXFC 1NX2A 3BQ3A 5KU1A 2DOQA 2F33A 1J7QA 4MSPA 1NIWA 2H61A 4OVNF 1DF0A 1ODBA 1WDCC 1XFZO 1MXLC 4L9MA 2KDHA 1ZUZA 1TCFA 3EVRA 1KFUL 1JF2A 2L4HA 2IS9A 4GGNA 1JBAA 1KK7Y 5AANA 2PMYA 4WRIA 2JOJA 1B1GA 1SY9A 2M1KB 4PE1A 5I8NA 4WQ3A 1QLKA 2BE4A 1PK0D 1DF0B 3WNXB 4CLNA 2CCMA 4HREE 1RK9A 3I5HB 3C1VA 2L51A 2GGZA 3CGAA 2OTGC 2BL0B 2M9GA 1HQVA 1IG5A 2SASA 4NDBA 1KWOC 3EVVA 4QJ5B 1BJFA 2LUCA 1DVIA 1XFUO 2ZFDA 1WY9A 2A4JA 1Y6WA 2F2OA 2Y4QA 2ZNEA 5KSZA 1DJXA 1A29A 2KQYA 1IGVA 1ZACA 3GK1A 3TDZA 4MRYA 2HQ8A 1CTRA 1K2HA 1CFFA 3RM1A 1GJYA 2M0RA 3CZTX 1S6JA 3BUXB 2M8UA 2M29A 2HPSA 3AAJA 2M3WA 1M45A 1K94A 1OMDA 1M63B 1AJ5A 1MF8B 1V1GA 2JU0A 4USLA 1RWYA 1AJ4A 1QVIZ 1PVAA 1XFVO 1PULA 1WLZA 5GQQC 4C0KA 1DT7B 1NX3A 1NP8A 1SYMA 4HRHA 1FI5A 3BUNB 2JQ6A 5D69A 3BOWA 3OX6A 3WXAA 1QATA 3EK4A 4GAOA 1KCYA 3H4SE 3LK1A 1ALWA 1BT6A 2KBMA 3IQOA 1CDNA 3O6BA 1CLMA 2Q91A 2OPOA 4PHKA 1H8BA 4NDCA 1TTXA 1B7TY 1NX0A 3DVEA 3KEVA 4YGAA 3VRQA 5AEQA 1NCXA 1OMRA 1XFWO 3F45A 4M2PA 3SG6A 2CBLA 1QX5B 3MSEB 1C7WA 1XK4A 5ER5A 2JZIA 3O4YA 3OHMB 3CTNA 2MLFC 2LVKA 3BOWB 1QASA 3DF0A 1KSOA 2NXQA 1EJ3A 2L4IA 3DVKA 1IRJA 1CM4A 3A8RA 4C0JA 1OZSA 1QTXA 2FCDA 2PVBA 4AQIA 3CR4X 4CFQA 3TUYB 1N0YA 3I5GB 1YR5A 1UURA 2PSRA 2LHIA 3IF7A 2L50A 2KSPA 3HX4A 3AKAA 1AK8A 2MBXA 1F4QA 1SBJA 2EC6C 2NLNA 3I5FC 2KGRA 3BUMB 3CR2A 2NCPA 3LCPC 1CKKA 1BR4B 1M39A 2KYFA 1LINA 4PDZA 4WQ2A 1CMGA 3JTDB 2KYCA 1KQMB 2JTTA 2SCPA 1G8IA 3DD4A 1OOJA 4DCKA 1WRKA 1YX8A 2WCEA 3O2PA 3SG5A 3ZWHA 1K9KA 4HRGA 5K89A 5DKNA 3KO0A 4GFTA 3I5IB 4MRXA 4OKHA 1DGVA 1MR8A 1K96A 1KK8B 3SG7A 2HQWA 1MUXA 2JNFA 1NCYA 1DJHA 1U5IA 4DS7A 1W7JB 1J55A 1FBVA 1B9AA 2NZ0A 1KFUS 3QRXA 4DUQA 1KQVA 3OP0A 1PRWA 2KFHA 5HKZA 5G08A 3VGOA 5AFPA 4IL1A 1SR6C 1JSAA 4DIRA 3I5HC 4GPLB 1UHIA 1UWOA 2M49B 1UHHA 2EHBA 2KI4C 3LL8B 3NSOA 2LNKA 3TDUA 2BBNA 1A4PA 4I5NB 3SIBA 1UHKA 2BCXA 1U5IB 3LLEA 1F71A 1QXPA 4Q04A 4YI9A 1SCMC 4GGFC 2LMUA 1J1EA 1Y1AA 5AERA 1N65A 4PE0A 4YGDB 1PSBA 2BECA 3ZNIA 2M1UA 1J7PA 2M7LA 2D8NA 1S1EA 3FIAA 4TNCA 5FYXA 2KFGA 1C07A 2M97A 1HT9A 3NSKA 1R2UA 3DVMA 1V1FA 2VRGA 1QJTA 4UPGA 1QIVA 1SKTA 1XO5A 1JF0A 4A4BA 4CIDA 1YTZC 1EL4A 4PE7A 1YUUA 1CM1A 3DVJA 1DJZA 1Y1UA 2KFFA 1A03A 3EK8A 4XJKA 3SIAA 1RROA 2LM5A 4R1EA 5CSJA 1GGWA 3PLFB 1TIZA 2LVVA 1RTP1 1M31A 3FWBA 4U8DA 2L5XB 5HLOA 1ZOTB 1RJVA 1K8UA 1YUTA 1L2OB 2MAZA 1BU3A 3VRPA 1AUIB 2AAOA 3E3RA 4E68A 5CSIA 2QPTA 3EVUA 4XYNA 1TRFA 3WHTB 1K90D 2KAXA 2WOSA 2ZRSA 4XJKB 2B1UA 1S6CA 1TNWA 3GK4X 5JJGA 2LV7A 3NSIA 2ISDA 3SG3A 2K2FA 2LE9B 4MN0A 5DKQA 1B8RA 3TS5C 2PALA 1DGUA 2K7BA 1IQ3A 3GOFA 2KI6D 2JPTA 1WRZA 2NCOA 1S5GY 1TNXA 3I5GC 3TUYC 3VRRA 5HKYA 3HCMA 1YRTB 2Q4UA 4MEWA 4MBEA 1OZOA 3A4UB 2ZKMX 4DRWA 1AVSA 4QJ4B 1ALVA 4P5OE 3SG2A 2COLB 2LANA 2FCEA 2WC8A 3JVTC 3PN7C 4MZLA 2L98A 5I2LA 1IH0A 4PCWA 1IJ5A 1DJIA 2LCPA 1KQMC 2JULA 1DJGA 5IBWA 1PALA 4PE4A 1YUSA 1NWDA 2LUXA 1KFXL 1X02A 1A2XA 2BE6A 1LVCD 1OSAA 4YGBB 1CDPA 1KK8C 1NCZA 1Y1XA 1LA3A 2G9BA 2H2KA 1CDMA 2ZRTA 4FTGA 4PHMA 4PALA 1S36A 1G33A 2KNEA 1EG3A 1RFJA 2MHHA 2MRDA 2LLTA 1JC2A 1IJ6A 2CXJA 4CFRA 2JXCA 2KGBC 1D1OA 1JWDA 2JT8A 2ZN8A 2LC5A 1UUSA 1DMOA 1UHNA 4GNKB 2RGIA 3RLZA 2ZN9A 3PFVA 2LMVA 3PM8A 1JFJA 3EK7A 2JXLA 2Y5IA 3KHEA 2FJUB 3CR5X 1QX7A 1CFCA 1F70A 1RECA 1IKUA 3CLNA 4N1GA 4GBAA 1NSHA 5PALA 2FOTA 2JTZA 2Y1MA 4I5KA 4BY5A 1OMVA 2CT9A 1XVJA 2I18A 2O5GA 2BCAA 3BUOB 4JWQA 2LP3A 5TNCA 1FI6A 3FWCA 2BKHB 1XA5A 1TOPA 2LVJA 3SJSA 2H61C 2LMTA 1YVHA 4YRUA 1K9PA 1WLMA 3IQQA 5HYDA 3OB1B 4ORCB 5DKRA 4CPVA 3VROA 3CWGA 2LHLA 1CB1A 3ICBA 4I5LB 1QVIY 1OE9B 2BL0C 3PATA 4MLWA 2GV5A 1SNLA 2V53A 2I2RE 4A4CA 1TN4A 1IQ5A 4YGCB 1EG4A 3OB2B 4M2QA 2CNPA 5B8IB 2R2IA 3I5FB 1B7TZ 3NSLA 4MVFA 4PHNA 1SW8A 4FQOA 1QS7A 1SCVA 2K2AA 2KOTA 1N2DA 1UHJA 1MQ1A 2OS8B 2LAPA 4OCIA 2BBMA 2GGMA 1SL9A 1TCOB 1BMOA 4HSZA 1NYAA 2LLSA 4ZCUA 1Q80A 1MXEA 1S6IA 1CDLA 1S26D 2LP2A 1L2OC 2I7AA 2WORA 1Y0VH 2I94A
chains in the Genus database with same CATH superfamily
1OOHA 3L4LA 1IWQA 2ZNDA 4GGFA 1B4CA 2WCFA 3BYAA 1EH2A 1F8HA 3GK2A 3EKHA 1K95A 1QV1A 1CFPA 1BF5A 1KSMA 3FE6A 2K61A 1CFDA 1CNPA 1W7IB 5I94A 5F6TA 2F8PA 1LA0A 1NPQA 1UP5A 4OV2A 1SR6B 1B8CA 4F0ZB 1WDCB 2K7DA 3D78A 2BKIB 2L0PA 3CS1A 3NXAA 2QACA 4AQJA 3NHIA 1C7VA 1JUOA 2KI4B 1ZMZA 1J7OA 1GQMA 1TNQA 1EXRA 2HF5A 2PASA 1QV0A 1L7ZA 2CTNA 4MZKA 1LKJA 3O78A 4BY4A 1SCMB 2E30A 1R6PA 2KI6C 4YI8A 4AOMA 5AXIA 1K93D 4IJ7A 4ORBB 1A75A 1CMFA 5ER4X 2P70A 2MA2A 1SL8A 3EKJA 3D76A 2G2BA 2JNXA 1LS8A 1QX2A 1XFYO 3WHUB 2Y1NA 3L4AA 3SG4A 5J3XA 3BXKA 2KBIA 4JQ0D 1QLSA 5CSNA 2LLUA 4C0LA 1KFXS 2OTGB 3D10A 2ERBA 5KTYA 1BODA 2EGDA 1FW4A 1M46A 1KWOB 3TZ1A 1K9UA 1XK4C 1NX1A 3TDIA 3M0WA 1A75B 2O60A 2JWWA 2TN4A 1DJWA 5JOLA 3K21A 2K0JA 3B7AA 4N5XA 3BUWB 2QEVA 3JTDC 5I2OA 4D1EA 3PSRA 1CLBA 2BCBA 1KK7Z 1ZFSA 2M7NA 1NUBA 2F3YA 3I5IC 4ICBA 4YBHB 3VB1A 2KHNA 1JFKA 4ETOA 3OX5A 1AP4A 1SRAA 1VRKA 2QEHA 3RZSA 4ORAB 5D7FA 2K7OA 2K8MB 1MHOA 1PSRA 1SMGA 3CABA 5CSFA 1MWNA 1GGZA 2PRUA 3DY9A 2AUCA 2KAVA 1J7RA 1H4BA 1FPWA 2MLEC 1XYDA 1BR1B 1SK6D 3L47A 1XFXO 3TS5B 1YURA 4N1FA 1SSEB 1BG1A 3LK0A 2KLEA 1G4YR 2L2EA 4OR9B 1DJYA 1DC1A 2WC5A 4M2OA 1CLLA 5HKWA 1BOCA 2WCBA 4MZJA 1SPYA 4F7FA 1F55A 1OOGA 3AKBA 2HETA 3AAKA 1FF1A 4GUKA 1B8LA 3KPXA 1J1DA 1OQPA 4QJ3B 2K7CA 1YX7A 3D0YA 4PHJA 1QIWA 4YGEB 1DTLA 3JVTB 3PN7B 2JRFA 5HLVA 4P2YB 3S0AA 4JPZB 1YRUB 2AMIA 2KAYA 2LVIA 2KQ6A 2JT0A 2OS8C 1SL7A 2WNDA 3DF0B 3KF9A 2P6BB 4NQGA 1AHRA 3S0DA 1BLQA 1TNPA 4I5JA 3VRNA 3PALA 1S3PA 5FI2A 5BPJA 1WRLA 2MJWB 3FS7A 5CPVA 3PM2A 1YVLA 2F3ZA 3QMEA 2F2PA 3K1EA 1B47A 2E6WA 4ZCVA 1F4OA 3R1PA 2JT3A 3D0YB 3R72A 5I2QA 2JC2A 2EC6B 5D3OA 1E8AA 1S5GZ 1PVBA 4NDDA 1LXFC 1NX2A 2L2CA 3BQ3A 3D75A 5KU1A 3CZ2A 2DOQA 2F33A 1J7QA 2L5YA 4MSPA 1NIWA 2H61A 4OVNF 1DF0A 1ODBA 1WDCC 1XFZO 1MXLC 3OBVA 4JD9A 4L9MA 2KDHA 3DYEA 2PYQA 1Z2CB 1ZUZA 3R1VA 1C3YA 1TCFA 3EVRA 1KFUL 1JF2A 2L4HA 2IS9A 4GGNA 1JBAA 1KK7Y 5AANA 2PMYA 4WRIA 2JOJA 1B1GA 1SY9A 2QEBA 1C3ZA 1DELA 2M1KB 4PE1A 4WQ3A 5I8NA 1QLKA 2BE4A 1PK0D 1DF0B 3N7HA 3WNXB 4CLNA 2CCMA 4HREE 1RK9A 3I5HB 3C1VA 2L51A 2GGZA 3CGAA 2OTGC 2BL0B 3B86A 1F54A 2M9GA 1HQVA 1IG5A 2SASA 4NDBA 1KWOC 3EVVA 4QJ5B 1BJFA 2LUCA 1DVIA 1XFUO 2ZFDA 3S0EA 1WY9A 2A4JA 1Y6WA 2F2OA 2Y4QA 2ZNEA 4FQTA 1DJXA 3V2LA 1A29A 5KSZA 2KQYA 1IGVA 1ZACA 2KPHA 3GK1A 2JPOA 3TDZA 4MRYA 2HQ8A 1CTRA 1K2HA 1CFFA 3RM1A 3BFHA 1GJYA 2M0RA 3CZTX 2YGUA 1S6JA 3BUXB 2M8UA 2M29A 5FI6A 2HPSA 3AAJA 2M3WA 1M45A 1K94A 1OMDA 3BFAA 1M63B 1AJ5A 1MF8B 1V1GA 2JU0A 4USLA 3Q8IA 1RWYA 1AJ4A 3S0GA 1QVIZ 1PVAA 2QEOA 1XFVO 1PULA 1WLZA 5GQQC 4C0KA 1DT7B 1NX3A 1NP8A 1SYMA 4HRHA 3R1OA 1FI5A 3BUNB 2JQ6A 5D69A 3BOWA 3D73A 3OX6A 3WXAA 1QATA 3EK4A 5DICA 4GAOA 1KCYA 3H4SE 3LK1A 1ALWA 1BT6A 2KBMA 3IQOA 1CDNA 3O6BA 1CLMA 2Q91A 2OPOA 4PHKA 1H8BA 4NDCA 1TTXA 1B7TY 1NX0A 3DVEA 3KEVA 3OGNA 4YGAA 5AEQA 3VRQA 1NCXA 1OMRA 1XFWO 3F45A 4M2PA 3SG6A 2CBLA 1QX5B 3MSEB 1C7WA 1XK4A 1ORGA 5ER5A 1OOIX 2JZIA 3O4YA 3FE9A 3CTNA 2MLFC 3OHMB 2LVKA 3BOWB 3SS3A 1QASA 3DF0A 3CZ0A 1KSOA 2NXQA 1DQEA 1EJ3A 2L4IA 3DVKA 1IRJA 1CM4A 3A8RA 3CYZA 4C0JA 1OZSA 1QTXA 2FCDA 2PVBA 4AQIA 3CR4X 4CFQA 3TUYB 1N0YA 3I5GB 1YR5A 1UURA 2PSRA 2LHIA 3IF7A 2L50A 2KSPA 3HX4A 3AKAA 1AK8A 2MBXA 1F4QA 1SBJA 2EC6C 2NLNA 3I5FC 2KGRA 3BUMB 3CR2A 2NCPA 3LCPC 1CKKA 1BR4B 1M39A 2KYFA 1LINA 3CZ1A 4PDZA 4WQ2A 1CMGA 3JTDB 1XFRA 1KQMB 2KYCA 2JTTA 2SCPA 1G8IA 3DXLA 3DD4A 1OOJA 4DCKA 3BFBA 1WRKA 1YX8A 2WCEA 3O2PA 3SG5A 3ZWHA 1K9KA 4HRGA 5K89A 5DKNA 3EG5B 3KO0A 3I5IB 3NHTA 3IVTA 4GFTA 4MRXA 4OKHA 1DGVA 2WCKA 1MR8A 1K96A 1KK8B 3SG7A 2HQWA 1MUXA 2JNFA 1NCYA 1DJHA 1Z4HA 1U5IA 4DS7A 5FI7A 1W7JB 1J55A 1TUZA 1FBVA 3PJIA 1B9AA 2NZ0A 1KFUS 3QRXA 2P71A 4DUQA 1KQVA 3OP0A 1PRWA 2KFHA 1IIOA 5HKZA 5G08A 3VGOA 5AFPA 4IL1A 1SR6C 1JSAA 4DIRA 3I5HC 4GPLB 1TUJA 1UHIA 1UWOA 2M49B 1UHHA 2EHBA 2KI4C 3LL8B 3NSOA 4INXA 2LNKA 3TDUA 2BBNA 1A4PA 4I5NB 3SIBA 1UHKA 2BCXA 1U5IB 3LLEA 1F71A 1QXPA 4Q04A 4YI9A 1SCMC 4GGFC 2LMUA 1J1EA 1Y1AA 5AERA 1N65A 4PE0A 4YGDB 1PSBA 2BECA 3ZNIA 2M1UA 1J7PA 2M7LA 2D8NA 1S1EA 3FIAA 4TNCA 5FYXA 2FJYA 2KFGA 1C07A 2M97A 1HT9A 3NSKA 1R2UA 3DVMA 1V1FA 2VRGA 1QJTA 3UNWA 4UPGA 1QIVA 1SKTA 1OW4A 1XO5A 1JF0A 4A4BA 5HL1A 4CIDA 1YTZC 1EL4A 4PE7A 1YUUA 3UO9A 1CM1A 3DVJA 1DJZA 1Y1UA 3CDNA 2KFFA 1A03A 1TWOA 4KYNA 3EK8A 4XJKA 3SIAA 2PQLA 1RROA 2LM5A 4R1EA 5CSJA 1GGWA 3PLFB 1TIZA 2LVVA 1RTP1 1M31A 3FWBA 4U8DA 2BNXA 2L5XB 5HLOA 1ZOTB 1RJVA 1K8UA 1YUTA 2WCLA 1GM0A 4PT1A 2BAPA 1L2OB 2MAZA 1BU3A 3BJHA 1AUIB 2AAOA 3VRPA 3D77A 3E3RA 4E68A 5CSIA 1P28A 2QPTA 3EVUA 1TRFA 4XYNA 1K90D 3WHTB 2KAXA 2WOSA 2ZRSA 4XJKB 2B1UA 1S6CA 1W9ZA 1TNWA 3GK4X 5JJGA 2LV7A 3NSIA 2ISDA 3SG3A 2K2FA 2LE9B 4MN0A 5DKQA 1B8RA 3DZTA 3TS5C 2PALA 1DGUA 2K7BA 1IQ3A 3GOFA 2WCHA 2KI6D 2GTEA 3SS4A 2JPTA 1WRZA 2NCOA 1S5GY 1TNXA 3I5GC 3TUYC 3VRRA 5HKYA 3HCMA 1YRTB 2Q4UA 4MEWA 4JKTA 4MBEA 1OZOA 3A4UB 2ZKMX 4DRWA 1AVSA 4QJ4B 1QWVA 1ALVA 4P5OE 3SG2A 2COLB 2LANA 2FCEA 2WC8A 3JVTC 3PN7C 4MZLA 2L98A 5I2LA 1IH0A 4INWA 4PCWA 1IJ5A 1DJIA 2LCPA 1T14A 1KQMC 2KLDA 2JULA 1DJGA 5IBWA 1PALA 2QDIA 4PE4A 1YUSA 1NWDA 2LUXA 1KFXL 1X02A 1A2XA 2WC6A 2BE6A 1LVCD 1OSAA 4YGBB 1CDPA 1KK8C 3B6XA 1NCZA 1Y1XA 1LA3A 2G9BA 2H2KA 1CDMA 2ZRTA 4FTGA 4PHMA 4PALA 3FE8A 1S36A 1G33A 2KNEA 1EG3A 1RFJA 2MHHA 2MRDA 2LLTA 1JC2A 1IJ6A 2CXJA 4CFRA 2JXCA 2KGBC 1D1OA 1JWDA 2JT8A 2ZN8A 2LC5A 1UUSA 1DEKA 1DMOA 1UHNA 4GNKB 2RGIA 3RLZA 2ZN9A 3PFVA 2LMVA 3PM8A 1JFJA 3EK7A 2JXLA 2Y5IA 3B87A 3KHEA 2FJUB 3CR5X 1QX7A 1CFCA 1F70A 1RECA 2K60A 1IKUA 3O4XA 3CLNA 4N1GA 4GBAA 1NSHA 5PALA 2FOTA 2JTZA 2Y1MA 4I5KA 4BY5A 1OMVA 2CT9A 1XVJA 2I18A 2O5GA 2BCAA 3BUOB 4JWQA 4OZDA 2LP3A 3SS5A 5TNCA 1FI6A 3FWCA 2BKHB 1XA5A 1TOPA 2H8VA 2LVJA 3SJSA 2H61C 2LMTA 1YVHA 4YRUA 1K9PA 1WLMA 3IQQA 5HYDA 3OB1B 3B88A 4ORCB 5DKRA 4CPVA 3VROA 3CWGA 2LHLA 1CB1A 3ICBA 4I5LB 1QVIY 1OE9B 2BL0C 3PATA 4MLWA 2GV5A 1SNLA 2V53A 2I2RE 4A4CA 2WCJA 1TN4A 1IQ5A 4YGCB 1EG4A 3OB2B 4M2QA 2CNPA 5B8IB 1OOFA 2R2IA 3I5FB 3S0FA 1B7TZ 3NSLA 4MVFA 4PHNA 1SW8A 4FQOA 1QS7A 1SCVA 2K2AA 2KOTA 1N2DA 3D74A 1UHJA 1MQ1A 2OS8B 2LAPA 4OCIA 2BBMA 2GGMA 1SL9A 1TCOB 1BMOA 3S0BA 4HSZA 2WCMA 1NYAA 2LLSA 4ZCUA 1Q80A 1MXEA 1S6IA 1CDLA 1S26D 5EL2A 3NGVA 2LP2A 1L2OC 2I7AA 2WORA 1Y0VH 2I94A
chains in the Genus database with same CATH topology
1IWQA 2ZNDA 4GGFA 1B4CA 2WCFA 3BYAA 1EH2A 1F8HA 3GK2A 3EKHA 1K95A 1QV1A 1CFPA 1BF5A 1KSMA 2K61A 1CFDA 1CNPA 1W7IB 5F6TA 2F8PA 1LA0A 1NPQA 1UP5A 4OV2A 1SR6B 1B8CA 4F0ZB 1WDCB 2K7DA 3NXAA 2BKIB 2L0PA 3CS1A 1C7VA 2QACA 4AQJA 1JUOA 2KI4B 1ZMZA 1J7OA 1GQMA 1TNQA 1EXRA 2HF5A 2PASA 1QV0A 1L7ZA 2CTNA 4MZKA 1LKJA 3O78A 4BY4A 1SCMB 2E30A 1R6PA 2KI6C 4YI8A 4AOMA 5AXIA 1K93D 4ORBB 1A75A 1CMFA 5ER4X 2MA2A 1SL8A 3EKJA 2G2BA 2JNXA 1QX2A 1XFYO 3WHUB 2Y1NA 3SG4A 5J3XA 3BXKA 2KBIA 4JQ0D 1QLSA 5CSNA 2LLUA 4C0LA 1KFXS 2OTGB 3D10A 5KTYA 1BODA 2EGDA 1FW4A 1M46A 1KWOB 3TZ1A 1K9UA 1XK4C 1NX1A 3TDIA 3M0WA 1A75B 2O60A 2JWWA 2TN4A 1DJWA 5JOLA 3K21A 2K0JA 4N5XA 3BUWB 5I2OA 3JTDC 4D1EA 3PSRA 1CLBA 2BCBA 1KK7Z 1ZFSA 2M7NA 1NUBA 2F3YA 3I5IC 4ICBA 4YBHB 2KHNA 1JFKA 4ETOA 3OX5A 1AP4A 1SRAA 1VRKA 4ORAB 5D7FA 2K7OA 2K8MB 1MHOA 1PSRA 1SMGA 5CSFA 1MWNA 1GGZA 2PRUA 2AUCA 2KAVA 1J7RA 1H4BA 1FPWA 2MLEC 1XYDA 1BR1B 1SK6D 3TS5B 1XFXO 1YURA 4N1FA 1BG1A 3LK0A 1G4YR 2L2EA 4OR9B 1DJYA 4M2OA 1CLLA 5HKWA 1BOCA 2WCBA 4MZJA 1SPYA 1F55A 3AKBA 2HETA 3AAKA 1FF1A 4GUKA 1B8LA 3KPXA 1J1DA 1OQPA 4QJ3B 2K7CA 1YX7A 3D0YA 4PHJA 1QIWA 4YGEB 1DTLA 3JVTB 3PN7B 2JRFA 5HLVA 4P2YB 4JPZB 1YRUB 2AMIA 2KAYA 2LVIA 2KQ6A 2JT0A 2OS8C 1SL7A 2WNDA 3DF0B 3KF9A 2P6BB 4NQGA 1AHRA 1F54A 1BLQA 1TNPA 4I5JA 3VRNA 3PALA 1S3PA 5BPJA 1WRLA 2MJWB 3FS7A 5CPVA 1YVLA 2F3ZA 2F2PA 4ZCVA 1B47A 2E6WA 1F4OA 2JT3A 3D0YB 5I2QA 2JC2A 2EC6B 1E8AA 1S5GZ 1PVBA 4NDDA 1LXFC 1NX2A 3BQ3A 5KU1A 2DOQA 2F33A 1J7QA 4MSPA 1NIWA 2H61A 4OVNF 1DF0A 1ODBA 1WDCC 1XFZO 1MXLC 4L9MA 2KDHA 1ZUZA 1TCFA 3EVRA 1KFUL 1JF2A 2L4HA 2IS9A 4GGNA 1JBAA 1KK7Y 5AANA 2PMYA 4WRIA 2JOJA 1B1GA 1SY9A 2M1KB 4PE1A 5I8NA 4WQ3A 1QLKA 2BE4A 1PK0D 1DF0B 3WNXB 4CLNA 2CCMA 4HREE 1RK9A 3I5HB 3C1VA 2L51A 2GGZA 3CGAA 2OTGC 2BL0B 2M9GA 1HQVA 1IG5A 2SASA 4NDBA 1KWOC 3EVVA 4QJ5B 1BJFA 2LUCA 1DVIA 1XFUO 2ZFDA 1WY9A 2A4JA 1Y6WA 2F2OA 2Y4QA 2ZNEA 5KSZA 1DJXA 1A29A 2KQYA 1IGVA 1ZACA 3GK1A 3TDZA 4MRYA 2HQ8A 1CTRA 1K2HA 1CFFA 3RM1A 1GJYA 2M0RA 3CZTX 1S6JA 3BUXB 2M8UA 2M29A 2HPSA 3AAJA 2M3WA 1M45A 1K94A 1OMDA 1M63B 1AJ5A 1MF8B 1V1GA 2JU0A 4USLA 1RWYA 1AJ4A 1QVIZ 1PVAA 1XFVO 1PULA 1WLZA 5GQQC 4C0KA 1DT7B 1NX3A 1NP8A 1SYMA 4HRHA 1FI5A 3BUNB 2JQ6A 5D69A 3BOWA 3OX6A 3WXAA 1QATA 3EK4A 4GAOA 1KCYA 3H4SE 3LK1A 1ALWA 1BT6A 2KBMA 3IQOA 1CDNA 3O6BA 1CLMA 2Q91A 2OPOA 4PHKA 1H8BA 4NDCA 1TTXA 1B7TY 1NX0A 3DVEA 3KEVA 4YGAA 3VRQA 5AEQA 1NCXA 1OMRA 1XFWO 3F45A 4M2PA 3SG6A 2CBLA 1QX5B 3MSEB 1C7WA 1XK4A 5ER5A 2JZIA 3O4YA 3OHMB 3CTNA 2MLFC 2LVKA 3BOWB 1QASA 3DF0A 1KSOA 2NXQA 1EJ3A 2L4IA 3DVKA 1IRJA 1CM4A 3A8RA 4C0JA 1OZSA 1QTXA 2FCDA 2PVBA 4AQIA 3CR4X 4CFQA 3TUYB 1N0YA 3I5GB 1YR5A 1UURA 2PSRA 2LHIA 3IF7A 2L50A 2KSPA 3HX4A 3AKAA 1AK8A 2MBXA 1F4QA 1SBJA 2EC6C 2NLNA 3I5FC 2KGRA 3BUMB 3CR2A 2NCPA 3LCPC 1CKKA 1BR4B 1M39A 2KYFA 1LINA 4PDZA 4WQ2A 1CMGA 3JTDB 2KYCA 1KQMB 2JTTA 2SCPA 1G8IA 3DD4A 1OOJA 4DCKA 1WRKA 1YX8A 2WCEA 3O2PA 3SG5A 3ZWHA 1K9KA 4HRGA 5K89A 5DKNA 3KO0A 4GFTA 3I5IB 4MRXA 4OKHA 1DGVA 1MR8A 1K96A 1KK8B 3SG7A 2HQWA 1MUXA 2JNFA 1NCYA 1DJHA 1U5IA 4DS7A 1W7JB 1J55A 1FBVA 1B9AA 2NZ0A 1KFUS 3QRXA 4DUQA 1KQVA 3OP0A 1PRWA 2KFHA 5HKZA 5G08A 3VGOA 5AFPA 4IL1A 1SR6C 1JSAA 4DIRA 3I5HC 4GPLB 1UHIA 1UWOA 2M49B 1UHHA 2EHBA 2KI4C 3LL8B 3NSOA 2LNKA 3TDUA 2BBNA 1A4PA 4I5NB 3SIBA 1UHKA 2BCXA 1U5IB 3LLEA 1F71A 1QXPA 4Q04A 4YI9A 1SCMC 4GGFC 2LMUA 1J1EA 1Y1AA 5AERA 1N65A 4PE0A 4YGDB 1PSBA 2BECA 3ZNIA 2M1UA 1J7PA 2M7LA 2D8NA 1S1EA 3FIAA 4TNCA 5FYXA 2KFGA 1C07A 2M97A 1HT9A 3NSKA 1R2UA 3DVMA 1V1FA 2VRGA 1QJTA 4UPGA 1QIVA 1SKTA 1XO5A 1JF0A 4A4BA 4CIDA 1YTZC 1EL4A 4PE7A 1YUUA 1CM1A 3DVJA 1DJZA 1Y1UA 2KFFA 1A03A 3EK8A 4XJKA 3SIAA 1RROA 2LM5A 4R1EA 5CSJA 1GGWA 3PLFB 1TIZA 2LVVA 1RTP1 1M31A 3FWBA 4U8DA 2L5XB 5HLOA 1ZOTB 1RJVA 1K8UA 1YUTA 1L2OB 2MAZA 1BU3A 3VRPA 1AUIB 2AAOA 3E3RA 4E68A 5CSIA 2QPTA 3EVUA 4XYNA 1TRFA 3WHTB 1K90D 2KAXA 2WOSA 2ZRSA 4XJKB 2B1UA 1S6CA 1TNWA 3GK4X 5JJGA 2LV7A 3NSIA 2ISDA 3SG3A 2K2FA 2LE9B 4MN0A 5DKQA 1B8RA 3TS5C 2PALA 1DGUA 2K7BA 1IQ3A 3GOFA 2KI6D 2JPTA 1WRZA 2NCOA 1S5GY 1TNXA 3I5GC 3TUYC 3VRRA 5HKYA 3HCMA 1YRTB 2Q4UA 4MEWA 4MBEA 1OZOA 3A4UB 2ZKMX 4DRWA 1AVSA 4QJ4B 1ALVA 4P5OE 3SG2A 2COLB 2LANA 2FCEA 2WC8A 3JVTC 3PN7C 4MZLA 2L98A 5I2LA 1IH0A 4PCWA 1IJ5A 1DJIA 2LCPA 1KQMC 2JULA 1DJGA 5IBWA 1PALA 4PE4A 1YUSA 1NWDA 2LUXA 1KFXL 1X02A 1A2XA 2BE6A 1LVCD 1OSAA 4YGBB 1CDPA 1KK8C 1NCZA 1Y1XA 1LA3A 2G9BA 2H2KA 1CDMA 2ZRTA 4FTGA 4PHMA 4PALA 1S36A 1G33A 2KNEA 1EG3A 1RFJA 2MHHA 2MRDA 2LLTA 1JC2A 1IJ6A 2CXJA 4CFRA 2JXCA 2KGBC 1D1OA 1JWDA 2JT8A 2ZN8A 2LC5A 1UUSA 1DMOA 1UHNA 4GNKB 2RGIA 3RLZA 2ZN9A 3PFVA 2LMVA 3PM8A 1JFJA 3EK7A 2JXLA 2Y5IA 3KHEA 2FJUB 3CR5X 1QX7A 1CFCA 1F70A 1RECA 1IKUA 3CLNA 4N1GA 4GBAA 1NSHA 5PALA 2FOTA 2JTZA 2Y1MA 4I5KA 4BY5A 1OMVA 2CT9A 1XVJA 2I18A 2O5GA 2BCAA 3BUOB 4JWQA 2LP3A 5TNCA 1FI6A 3FWCA 2BKHB 1XA5A 1TOPA 2LVJA 3SJSA 2H61C 2LMTA 1YVHA 4YRUA 1K9PA 1WLMA 3IQQA 5HYDA 3OB1B 4ORCB 5DKRA 4CPVA 3VROA 3CWGA 2LHLA 1CB1A 3ICBA 4I5LB 1QVIY 1OE9B 2BL0C 3PATA 4MLWA 2GV5A 1SNLA 2V53A 2I2RE 4A4CA 1TN4A 1IQ5A 4YGCB 1EG4A 3OB2B 4M2QA 2CNPA 5B8IB 2R2IA 3I5FB 1B7TZ 3NSLA 4MVFA 4PHNA 1SW8A 4FQOA 1QS7A 1SCVA 2K2AA 2KOTA 1N2DA 1UHJA 1MQ1A 2OS8B 2LAPA 4OCIA 2BBMA 2GGMA 1SL9A 1TCOB 1BMOA 4HSZA 1NYAA 2LLSA 4ZCUA 1Q80A 1MXEA 1S6IA 1CDLA 1S26D 2LP2A 1L2OC 2I7AA 2WORA 1Y0VH 2I94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWQ A;  2ZND A;  4GGF A;  1B4C A;  2WCF A;  3BYA A;  1EH2 A;  1F8H A;  3GK2 A;  3EKH A;  1K95 A;  1QV1 A;  1CFP A;  1BF5 A;  1KSM A;  2K61 A;  1CFD A;  1CNP A;  1W7I B;  5F6T A;  2F8P A;  1LA0 A;  1NPQ A;  1UP5 A;  4OV2 A;  1SR6 B;  1B8C A;  4F0Z B;  1WDC B;  2K7D A;  3NXA A;  2BKI B;  2L0P A;  3CS1 A;  1C7V A;  2QAC A;  4AQJ A;  1JUO A;  2KI4 B;  1ZMZ A;  1J7O A;  1GQM A;  1TNQ A;  1EXR A;  2HF5 A;  2PAS A;  1QV0 A;  1L7Z A;  2CTN A;  4MZK A;  1LKJ A;  3O78 A;  4BY4 A;  1SCM B;  2E30 A;  1R6P A;  2KI6 C;  4YI8 A;  4AOM A;  5AXI A;  1K93 D;  4ORB B;  1A75 A;  1CMF A;  5ER4 X;  2MA2 A;  1SL8 A;  3EKJ A;  2G2B A;  2JNX A;  1QX2 A;  1XFY O;  3WHU B;  2Y1N A;  3SG4 A;  5J3X A;  3BXK A;  2KBI A;  4JQ0 D;  1QLS A;  5CSN A;  2LLU A;  4C0L A;  1KFX S;  2OTG B;  3D10 A;  5KTY A;  1BOD A;  2EGD A;  1FW4 A;  1M46 A;  1KWO B;  3TZ1 A;  1K9U A;  1XK4 C;  1NX1 A;  3TDI A;  3M0W A;  1A75 B;  2O60 A;  2JWW A;  2TN4 A;  1DJW A;  5JOL A;  3K21 A;  2K0J A;  4N5X A;  3BUW B;  5I2O A;  3JTD C;  4D1E A;  3PSR A;  1CLB A;  2BCB A;  1KK7 Z;  1ZFS A;  2M7N A;  1NUB A;  2F3Y A;  3I5I C;  4ICB A;  4YBH B;  2KHN A;  1JFK A;  4ETO A;  3OX5 A;  1AP4 A;  1SRA A;  1VRK A;  4ORA B;  5D7F A;  2K7O A;  2K8M B;  1MHO A;  1PSR A;  1SMG A;  5CSF A;  1MWN A;  1GGZ A;  2PRU A;  2AUC A;  2KAV A;  1J7R A;  1H4B A;  1FPW A;  2MLE C;  1XYD A;  1BR1 B;  1SK6 D;  3TS5 B;  1XFX O;  1YUR A;  4N1F A;  1BG1 A;  3LK0 A;  1G4Y R;  2L2E A;  4OR9 B;  1DJY A;  4M2O A;  1CLL A;  5HKW A;  1BOC A;  2WCB A;  4MZJ A;  1SPY A;  1F55 A;  3AKB A;  2HET A;  3AAK A;  1FF1 A;  4GUK A;  1B8L A;  3KPX A;  1J1D A;  1OQP A;  4QJ3 B;  2K7C A;  1YX7 A;  3D0Y A;  4PHJ A;  1QIW A;  4YGE B;  1DTL A;  3JVT B;  3PN7 B;  2JRF A;  5HLV A;  4P2Y B;  4JPZ B;  1YRU B;  2AMI A;  2KAY A;  2LVI A;  2KQ6 A;  2JT0 A;  2OS8 C;  1SL7 A;  2WND A;  3DF0 B;  3KF9 A;  2P6B B;  4NQG A;  1AHR A;  1F54 A;  1BLQ A;  1TNP A;  4I5J A;  3VRN A;  3PAL A;  1S3P A;  5BPJ A;  1WRL A;  2MJW B;  3FS7 A;  5CPV A;  1YVL A;  2F3Z A;  2F2P A;  4ZCV A;  1B47 A;  2E6W A;  1F4O A;  2JT3 A;  3D0Y B;  5I2Q A;  2JC2 A;  2EC6 B;  1E8A A;  1S5G Z;  1PVB A;  4NDD A;  1LXF C;  1NX2 A;  3BQ3 A;  5KU1 A;  2DOQ A;  2F33 A;  1J7Q A;  4MSP A;  1NIW A;  2H61 A;  4OVN F;  1DF0 A;  1ODB A;  1WDC C;  1XFZ O;  1MXL C;  4L9M A;  2KDH A;  1ZUZ A;  1TCF A;  3EVR A;  1KFU L;  1JF2 A;  2L4H A;  2IS9 A;  4GGN A;  1JBA A;  1KK7 Y;  5AAN A;  2PMY A;  4WRI A;  2JOJ A;  1B1G A;  1SY9 A;  2M1K B;  4PE1 A;  5I8N A;  4WQ3 A;  1QLK A;  2BE4 A;  1PK0 D;  1DF0 B;  3WNX B;  4CLN A;  2CCM A;  4HRE E;  1RK9 A;  3I5H B;  3C1V A;  2L51 A;  2GGZ A;  3CGA A;  2OTG C;  2BL0 B;  2M9G A;  1HQV A;  1IG5 A;  2SAS A;  4NDB A;  1KWO C;  3EVV A;  4QJ5 B;  1BJF A;  2LUC A;  1DVI A;  1XFU O;  2ZFD A;  1WY9 A;  2A4J A;  1Y6W A;  2F2O A;  2Y4Q A;  2ZNE A;  5KSZ A;  1DJX A;  1A29 A;  2KQY A;  1IGV A;  1ZAC A;  3GK1 A;  3TDZ A;  4MRY A;  2HQ8 A;  1CTR A;  1K2H A;  1CFF A;  3RM1 A;  1GJY A;  2M0R A;  3CZT X;  1S6J A;  3BUX B;  2M8U A;  2M29 A;  2HPS A;  3AAJ A;  2M3W A;  1M45 A;  1K94 A;  1OMD A;  1M63 B;  1AJ5 A;  1MF8 B;  1V1G A;  2JU0 A;  4USL A;  1RWY A;  1AJ4 A;  1QVI Z;  1PVA A;  1XFV O;  1PUL A;  1WLZ A;  5GQQ C;  4C0K A;  1DT7 B;  1NX3 A;  1NP8 A;  1SYM A;  4HRH A;  1FI5 A;  3BUN B;  2JQ6 A;  5D69 A;  3BOW A;  3OX6 A;  3WXA A;  1QAT A;  3EK4 A;  4GAO A;  1KCY A;  3H4S E;  3LK1 A;  1ALW A;  1BT6 A;  2KBM A;  3IQO A;  1CDN A;  3O6B A;  1CLM A;  2Q91 A;  2OPO A;  4PHK A;  1H8B A;  4NDC A;  1TTX A;  1B7T Y;  1NX0 A;  3DVE A;  3KEV A;  4YGA A;  3VRQ A;  5AEQ A;  1NCX A;  1OMR A;  1XFW O;  3F45 A;  4M2P A;  3SG6 A;  2CBL A;  1QX5 B;  3MSE B;  1C7W A;  1XK4 A;  5ER5 A;  2JZI A;  3O4Y A;  3OHM B;  3CTN A;  2MLF C;  2LVK A;  3BOW B;  1QAS A;  3DF0 A;  1KSO A;  2NXQ A;  1EJ3 A;  2L4I A;  3DVK A;  1IRJ A;  1CM4 A;  3A8R A;  4C0J A;  1OZS A;  1QTX A;  2FCD A;  2PVB A;  4AQI A;  3CR4 X;  4CFQ A;  3TUY B;  1N0Y A;  3I5G B;  1YR5 A;  1UUR A;  2PSR A;  2LHI A;  3IF7 A;  2L50 A;  2KSP A;  3HX4 A;  3AKA A;  1AK8 A;  2MBX A;  1F4Q A;  1SBJ A;  2EC6 C;  2NLN A;  3I5F C;  2KGR A;  3BUM B;  3CR2 A;  2NCP A;  3LCP C;  1CKK A;  1BR4 B;  1M39 A;  2KYF A;  1LIN A;  4PDZ A;  4WQ2 A;  1CMG A;  3JTD B;  2KYC A;  1KQM B;  2JTT A;  2SCP A;  1G8I A;  3DD4 A;  1OOJ A;  4DCK A;  1WRK A;  1YX8 A;  2WCE A;  3O2P A;  3SG5 A;  3ZWH A;  1K9K A;  4HRG A;  5K89 A;  5DKN A;  3KO0 A;  4GFT A;  3I5I B;  4MRX A;  4OKH A;  1DGV A;  1MR8 A;  1K96 A;  1KK8 B;  3SG7 A;  2HQW A;  1MUX A;  2JNF A;  1NCY A;  1DJH A;  1U5I A;  4DS7 A;  1W7J B;  1J55 A;  1FBV A;  1B9A A;  2NZ0 A;  1KFU S;  3QRX A;  4DUQ A;  1KQV A;  3OP0 A;  1PRW A;  2KFH A;  5HKZ A;  5G08 A;  3VGO A;  5AFP A;  4IL1 A;  1SR6 C;  1JSA A;  4DIR A;  3I5H C;  4GPL B;  1UHI A;  1UWO A;  2M49 B;  1UHH A;  2EHB A;  2KI4 C;  3LL8 B;  3NSO A;  2LNK A;  3TDU A;  2BBN A;  1A4P A;  4I5N B;  3SIB A;  1UHK A;  2BCX A;  1U5I B;  3LLE A;  1F71 A;  1QXP A;  4Q04 A;  4YI9 A;  1SCM C;  4GGF C;  2LMU A;  1J1E A;  1Y1A A;  5AER A;  1N65 A;  4PE0 A;  4YGD B;  1PSB A;  2BEC A;  3ZNI A;  2M1U A;  1J7P A;  2M7L A;  2D8N A;  1S1E A;  3FIA A;  4TNC A;  5FYX A;  2KFG A;  1C07 A;  2M97 A;  1HT9 A;  3NSK A;  1R2U A;  3DVM A;  1V1F A;  2VRG A;  1QJT A;  4UPG A;  1QIV A;  1SKT A;  1XO5 A;  1JF0 A;  4A4B A;  4CID A;  1YTZ C;  1EL4 A;  4PE7 A;  1YUU A;  1CM1 A;  3DVJ A;  1DJZ A;  1Y1U A;  2KFF A;  1A03 A;  3EK8 A;  4XJK A;  3SIA A;  1RRO A;  2LM5 A;  4R1E A;  5CSJ A;  1GGW A;  3PLF B;  1TIZ A;  2LVV A;  1RTP 1;  1M31 A;  3FWB A;  4U8D A;  2L5X B;  5HLO A;  1ZOT B;  1RJV A;  1K8U A;  1YUT A;  1L2O B;  2MAZ A;  1BU3 A;  3VRP A;  1AUI B;  2AAO A;  3E3R A;  4E68 A;  5CSI A;  2QPT A;  3EVU A;  4XYN A;  1TRF A;  3WHT B;  1K90 D;  2KAX A;  2WOS A;  2ZRS A;  4XJK B;  2B1U A;  1S6C A;  1TNW A;  3GK4 X;  5JJG A;  2LV7 A;  3NSI A;  2ISD A;  3SG3 A;  2K2F A;  2LE9 B;  4MN0 A;  5DKQ A;  1B8R A;  3TS5 C;  2PAL A;  1DGU A;  2K7B A;  1IQ3 A;  3GOF A;  2KI6 D;  2JPT A;  1WRZ A;  2NCO A;  1S5G Y;  1TNX A;  3I5G C;  3TUY C;  3VRR A;  5HKY A;  3HCM A;  1YRT B;  2Q4U A;  4MEW A;  4MBE A;  1OZO A;  3A4U B;  2ZKM X;  4DRW A;  1AVS A;  4QJ4 B;  1ALV A;  4P5O E;  3SG2 A;  2COL B;  2LAN A;  2FCE A;  2WC8 A;  3JVT C;  3PN7 C;  4MZL A;  2L98 A;  5I2L A;  1IH0 A;  4PCW A;  1IJ5 A;  1DJI A;  2LCP A;  1KQM C;  2JUL A;  1DJG A;  5IBW A;  1PAL A;  4PE4 A;  1YUS A;  1NWD A;  2LUX A;  1KFX L;  1X02 A;  1A2X A;  2BE6 A;  1LVC D;  1OSA A;  4YGB B;  1CDP A;  1KK8 C;  1NCZ A;  1Y1X A;  1LA3 A;  2G9B A;  2H2K A;  1CDM A;  2ZRT A;  4FTG A;  4PHM A;  4PAL A;  1S36 A;  1G33 A;  2KNE A;  1EG3 A;  1RFJ A;  2MHH A;  2MRD A;  2LLT A;  1JC2 A;  1IJ6 A;  2CXJ A;  4CFR A;  2JXC A;  2KGB C;  1D1O A;  1JWD A;  2JT8 A;  2ZN8 A;  2LC5 A;  1UUS A;  1DMO A;  1UHN A;  4GNK B;  2RGI A;  3RLZ A;  2ZN9 A;  3PFV A;  2LMV A;  3PM8 A;  1JFJ A;  3EK7 A;  2JXL A;  2Y5I A;  3KHE A;  2FJU B;  3CR5 X;  1QX7 A;  1CFC A;  1F70 A;  1REC A;  1IKU A;  3CLN A;  4N1G A;  4GBA A;  1NSH A;  5PAL A;  2FOT A;  2JTZ A;  2Y1M A;  4I5K A;  4BY5 A;  1OMV A;  2CT9 A;  1XVJ A;  2I18 A;  2O5G A;  2BCA A;  3BUO B;  4JWQ A;  2LP3 A;  5TNC A;  1FI6 A;  3FWC A;  2BKH B;  1XA5 A;  1TOP A;  2LVJ A;  3SJS A;  2H61 C;  2LMT A;  1YVH A;  4YRU A;  1K9P A;  1WLM A;  3IQQ A;  5HYD A;  3OB1 B;  4ORC B;  5DKR A;  4CPV A;  3VRO A;  3CWG A;  2LHL A;  1CB1 A;  3ICB A;  4I5L B;  1QVI Y;  1OE9 B;  2BL0 C;  3PAT A;  4MLW A;  2GV5 A;  1SNL A;  2V53 A;  2I2R E;  4A4C A;  1TN4 A;  1IQ5 A;  4YGC B;  1EG4 A;  3OB2 B;  4M2Q A;  2CNP A;  5B8I B;  2R2I A;  3I5F B;  1B7T Z;  3NSL A;  4MVF A;  4PHN A;  1SW8 A;  4FQO A;  1QS7 A;  1SCV A;  2K2A A;  2KOT A;  1N2D A;  1UHJ A;  1MQ1 A;  2OS8 B;  2LAP A;  4OCI A;  2BBM A;  2GGM A;  1SL9 A;  1TCO B;  1BMO A;  4HSZ A;  1NYA A;  2LLS A;  4ZCU A;  1Q80 A;  1MXE A;  1S6I A;  1CDL A;  1S26 D;  2LP2 A;  1L2O C;  2I7A A;  2WOR A;  1Y0V H;  2I94 A; 
#chains in the Genus database with same CATH topology
 1OOH A;  3L4L A;  1IWQ A;  2ZND A;  4GGF A;  1B4C A;  2WCF A;  3BYA A;  1EH2 A;  1F8H A;  3GK2 A;  3EKH A;  1K95 A;  1QV1 A;  1CFP A;  1BF5 A;  1KSM A;  3FE6 A;  2K61 A;  1CFD A;  1CNP A;  1W7I B;  5I94 A;  5F6T A;  2F8P A;  1LA0 A;  1NPQ A;  1UP5 A;  4OV2 A;  1SR6 B;  1B8C A;  4F0Z B;  1WDC B;  2K7D A;  3D78 A;  2BKI B;  2L0P A;  3CS1 A;  3NXA A;  2QAC A;  4AQJ A;  3NHI A;  1C7V A;  1JUO A;  2KI4 B;  1ZMZ A;  1J7O A;  1GQM A;  1TNQ A;  1EXR A;  2HF5 A;  2PAS A;  1QV0 A;  1L7Z A;  2CTN A;  4MZK A;  1LKJ A;  3O78 A;  4BY4 A;  1SCM B;  2E30 A;  1R6P A;  2KI6 C;  4YI8 A;  4AOM A;  5AXI A;  1K93 D;  4IJ7 A;  4ORB B;  1A75 A;  1CMF A;  5ER4 X;  2P70 A;  2MA2 A;  1SL8 A;  3EKJ A;  3D76 A;  2G2B A;  2JNX A;  1LS8 A;  1QX2 A;  1XFY O;  3WHU B;  2Y1N A;  3L4A A;  3SG4 A;  5J3X A;  3BXK A;  2KBI A;  4JQ0 D;  1QLS A;  5CSN A;  2LLU A;  4C0L A;  1KFX S;  2OTG B;  3D10 A;  2ERB A;  5KTY A;  1BOD A;  2EGD A;  1FW4 A;  1M46 A;  1KWO B;  3TZ1 A;  1K9U A;  1XK4 C;  1NX1 A;  3TDI A;  3M0W A;  1A75 B;  2O60 A;  2JWW A;  2TN4 A;  1DJW A;  5JOL A;  3K21 A;  2K0J A;  3B7A A;  4N5X A;  3BUW B;  2QEV A;  3JTD C;  5I2O A;  4D1E A;  3PSR A;  1CLB A;  2BCB A;  1KK7 Z;  1ZFS A;  2M7N A;  1NUB A;  2F3Y A;  3I5I C;  4ICB A;  4YBH B;  3VB1 A;  2KHN A;  1JFK A;  4ETO A;  3OX5 A;  1AP4 A;  1SRA A;  1VRK A;  2QEH A;  3RZS A;  4ORA B;  5D7F A;  2K7O A;  2K8M B;  1MHO A;  1PSR A;  1SMG A;  3CAB A;  5CSF A;  1MWN A;  1GGZ A;  2PRU A;  3DY9 A;  2AUC A;  2KAV A;  1J7R A;  1H4B A;  1FPW A;  2MLE C;  1XYD A;  1BR1 B;  1SK6 D;  3L47 A;  1XFX O;  3TS5 B;  1YUR A;  4N1F A;  1SSE B;  1BG1 A;  3LK0 A;  2KLE A;  1G4Y R;  2L2E A;  4OR9 B;  1DJY A;  1DC1 A;  2WC5 A;  4M2O A;  1CLL A;  5HKW A;  1BOC A;  2WCB A;  4MZJ A;  1SPY A;  4F7F A;  1F55 A;  1OOG A;  3AKB A;  2HET A;  3AAK A;  1FF1 A;  4GUK A;  1B8L A;  3KPX A;  1J1D A;  1OQP A;  4QJ3 B;  2K7C A;  1YX7 A;  3D0Y A;  4PHJ A;  1QIW A;  4YGE B;  1DTL A;  3JVT B;  3PN7 B;  2JRF A;  5HLV A;  4P2Y B;  3S0A A;  4JPZ B;  1YRU B;  2AMI A;  2KAY A;  2LVI A;  2KQ6 A;  2JT0 A;  2OS8 C;  1SL7 A;  2WND A;  3DF0 B;  3KF9 A;  2P6B B;  4NQG A;  1AHR A;  3S0D A;  1BLQ A;  1TNP A;  4I5J A;  3VRN A;  3PAL A;  1S3P A;  5FI2 A;  5BPJ A;  1WRL A;  2MJW B;  3FS7 A;  5CPV A;  3PM2 A;  1YVL A;  2F3Z A;  3QME A;  2F2P A;  3K1E A;  1B47 A;  2E6W A;  4ZCV A;  1F4O A;  3R1P A;  2JT3 A;  3D0Y B;  3R72 A;  5I2Q A;  2JC2 A;  2EC6 B;  5D3O A;  1E8A A;  1S5G Z;  1PVB A;  4NDD A;  1LXF C;  1NX2 A;  2L2C A;  3BQ3 A;  3D75 A;  5KU1 A;  3CZ2 A;  2DOQ A;  2F33 A;  1J7Q A;  2L5Y A;  4MSP A;  1NIW A;  2H61 A;  4OVN F;  1DF0 A;  1ODB A;  1WDC C;  1XFZ O;  1MXL C;  3OBV A;  4JD9 A;  4L9M A;  2KDH A;  3DYE A;  2PYQ A;  1Z2C B;  1ZUZ A;  3R1V A;  1C3Y A;  1TCF A;  3EVR A;  1KFU L;  1JF2 A;  2L4H A;  2IS9 A;  4GGN A;  1JBA A;  1KK7 Y;  5AAN A;  2PMY A;  4WRI A;  2JOJ A;  1B1G A;  1SY9 A;  2QEB A;  1C3Z A;  1DEL A;  2M1K B;  4PE1 A;  4WQ3 A;  5I8N A;  1QLK A;  2BE4 A;  1PK0 D;  1DF0 B;  3N7H A;  3WNX B;  4CLN A;  2CCM A;  4HRE E;  1RK9 A;  3I5H B;  3C1V A;  2L51 A;  2GGZ A;  3CGA A;  2OTG C;  2BL0 B;  3B86 A;  1F54 A;  2M9G A;  1HQV A;  1IG5 A;  2SAS A;  4NDB A;  1KWO C;  3EVV A;  4QJ5 B;  1BJF A;  2LUC A;  1DVI A;  1XFU O;  2ZFD A;  3S0E A;  1WY9 A;  2A4J A;  1Y6W A;  2F2O A;  2Y4Q A;  2ZNE A;  4FQT A;  1DJX A;  3V2L A;  1A29 A;  5KSZ A;  2KQY A;  1IGV A;  1ZAC A;  2KPH A;  3GK1 A;  2JPO A;  3TDZ A;  4MRY A;  2HQ8 A;  1CTR A;  1K2H A;  1CFF A;  3RM1 A;  3BFH A;  1GJY A;  2M0R A;  3CZT X;  2YGU A;  1S6J A;  3BUX B;  2M8U A;  2M29 A;  5FI6 A;  2HPS A;  3AAJ A;  2M3W A;  1M45 A;  1K94 A;  1OMD A;  3BFA A;  1M63 B;  1AJ5 A;  1MF8 B;  1V1G A;  2JU0 A;  4USL A;  3Q8I A;  1RWY A;  1AJ4 A;  3S0G A;  1QVI Z;  1PVA A;  2QEO A;  1XFV O;  1PUL A;  1WLZ A;  5GQQ C;  4C0K A;  1DT7 B;  1NX3 A;  1NP8 A;  1SYM A;  4HRH A;  3R1O A;  1FI5 A;  3BUN B;  2JQ6 A;  5D69 A;  3BOW A;  3D73 A;  3OX6 A;  3WXA A;  1QAT A;  3EK4 A;  5DIC A;  4GAO A;  1KCY A;  3H4S E;  3LK1 A;  1ALW A;  1BT6 A;  2KBM A;  3IQO A;  1CDN A;  3O6B A;  1CLM A;  2Q91 A;  2OPO A;  4PHK A;  1H8B A;  4NDC A;  1TTX A;  1B7T Y;  1NX0 A;  3DVE A;  3KEV A;  3OGN A;  4YGA A;  5AEQ A;  3VRQ A;  1NCX A;  1OMR A;  1XFW O;  3F45 A;  4M2P A;  3SG6 A;  2CBL A;  1QX5 B;  3MSE B;  1C7W A;  1XK4 A;  1ORG A;  5ER5 A;  1OOI X;  2JZI A;  3O4Y A;  3FE9 A;  3CTN A;  2MLF C;  3OHM B;  2LVK A;  3BOW B;  3SS3 A;  1QAS A;  3DF0 A;  3CZ0 A;  1KSO A;  2NXQ A;  1DQE A;  1EJ3 A;  2L4I A;  3DVK A;  1IRJ A;  1CM4 A;  3A8R A;  3CYZ A;  4C0J A;  1OZS A;  1QTX A;  2FCD A;  2PVB A;  4AQI A;  3CR4 X;  4CFQ A;  3TUY B;  1N0Y A;  3I5G B;  1YR5 A;  1UUR A;  2PSR A;  2LHI A;  3IF7 A;  2L50 A;  2KSP A;  3HX4 A;  3AKA A;  1AK8 A;  2MBX A;  1F4Q A;  1SBJ A;  2EC6 C;  2NLN A;  3I5F C;  2KGR A;  3BUM B;  3CR2 A;  2NCP A;  3LCP C;  1CKK A;  1BR4 B;  1M39 A;  2KYF A;  1LIN A;  3CZ1 A;  4PDZ A;  4WQ2 A;  1CMG A;  3JTD B;  1XFR A;  1KQM B;  2KYC A;  2JTT A;  2SCP A;  1G8I A;  3DXL A;  3DD4 A;  1OOJ A;  4DCK A;  3BFB A;  1WRK A;  1YX8 A;  2WCE A;  3O2P A;  3SG5 A;  3ZWH A;  1K9K A;  4HRG A;  5K89 A;  5DKN A;  3EG5 B;  3KO0 A;  3I5I B;  3NHT A;  3IVT A;  4GFT A;  4MRX A;  4OKH A;  1DGV A;  2WCK A;  1MR8 A;  1K96 A;  1KK8 B;  3SG7 A;  2HQW A;  1MUX A;  2JNF A;  1NCY A;  1DJH A;  1Z4H A;  1U5I A;  4DS7 A;  5FI7 A;  1W7J B;  1J55 A;  1TUZ A;  1FBV A;  3PJI A;  1B9A A;  2NZ0 A;  1KFU S;  3QRX A;  2P71 A;  4DUQ A;  1KQV A;  3OP0 A;  1PRW A;  2KFH A;  1IIO A;  5HKZ A;  5G08 A;  3VGO A;  5AFP A;  4IL1 A;  1SR6 C;  1JSA A;  4DIR A;  3I5H C;  4GPL B;  1TUJ A;  1UHI A;  1UWO A;  2M49 B;  1UHH A;  2EHB A;  2KI4 C;  3LL8 B;  3NSO A;  4INX A;  2LNK A;  3TDU A;  2BBN A;  1A4P A;  4I5N B;  3SIB A;  1UHK A;  2BCX A;  1U5I B;  3LLE A;  1F71 A;  1QXP A;  4Q04 A;  4YI9 A;  1SCM C;  4GGF C;  2LMU A;  1J1E A;  1Y1A A;  5AER A;  1N65 A;  4PE0 A;  4YGD B;  1PSB A;  2BEC A;  3ZNI A;  2M1U A;  1J7P A;  2M7L A;  2D8N A;  1S1E A;  3FIA A;  4TNC A;  5FYX A;  2FJY A;  2KFG A;  1C07 A;  2M97 A;  1HT9 A;  3NSK A;  1R2U A;  3DVM A;  1V1F A;  2VRG A;  1QJT A;  3UNW A;  4UPG A;  1QIV A;  1SKT A;  1OW4 A;  1XO5 A;  1JF0 A;  4A4B A;  5HL1 A;  4CID A;  1YTZ C;  1EL4 A;  4PE7 A;  1YUU A;  3UO9 A;  1CM1 A;  3DVJ A;  1DJZ A;  1Y1U A;  3CDN A;  2KFF A;  1A03 A;  1TWO A;  4KYN A;  3EK8 A;  4XJK A;  3SIA A;  2PQL A;  1RRO A;  2LM5 A;  4R1E A;  5CSJ A;  1GGW A;  3PLF B;  1TIZ A;  2LVV A;  1RTP 1;  1M31 A;  3FWB A;  4U8D A;  2BNX A;  2L5X B;  5HLO A;  1ZOT B;  1RJV A;  1K8U A;  1YUT A;  2WCL A;  1GM0 A;  4PT1 A;  2BAP A;  1L2O B;  2MAZ A;  1BU3 A;  3BJH A;  1AUI B;  2AAO A;  3VRP A;  3D77 A;  3E3R A;  4E68 A;  5CSI A;  1P28 A;  2QPT A;  3EVU A;  1TRF A;  4XYN A;  1K90 D;  3WHT B;  2KAX A;  2WOS A;  2ZRS A;  4XJK B;  2B1U A;  1S6C A;  1W9Z A;  1TNW A;  3GK4 X;  5JJG A;  2LV7 A;  3NSI A;  2ISD A;  3SG3 A;  2K2F A;  2LE9 B;  4MN0 A;  5DKQ A;  1B8R A;  3DZT A;  3TS5 C;  2PAL A;  1DGU A;  2K7B A;  1IQ3 A;  3GOF A;  2WCH A;  2KI6 D;  2GTE A;  3SS4 A;  2JPT A;  1WRZ A;  2NCO A;  1S5G Y;  1TNX A;  3I5G C;  3TUY C;  3VRR A;  5HKY A;  3HCM A;  1YRT B;  2Q4U A;  4MEW A;  4JKT A;  4MBE A;  1OZO A;  3A4U B;  2ZKM X;  4DRW A;  1AVS A;  4QJ4 B;  1QWV A;  1ALV A;  4P5O E;  3SG2 A;  2COL B;  2LAN A;  2FCE A;  2WC8 A;  3JVT C;  3PN7 C;  4MZL A;  2L98 A;  5I2L A;  1IH0 A;  4INW A;  4PCW A;  1IJ5 A;  1DJI A;  2LCP A;  1T14 A;  1KQM C;  2KLD A;  2JUL A;  1DJG A;  5IBW A;  1PAL A;  2QDI A;  4PE4 A;  1YUS A;  1NWD A;  2LUX A;  1KFX L;  1X02 A;  1A2X A;  2WC6 A;  2BE6 A;  1LVC D;  1OSA A;  4YGB B;  1CDP A;  1KK8 C;  3B6X A;  1NCZ A;  1Y1X A;  1LA3 A;  2G9B A;  2H2K A;  1CDM A;  2ZRT A;  4FTG A;  4PHM A;  4PAL A;  3FE8 A;  1S36 A;  1G33 A;  2KNE A;  1EG3 A;  1RFJ A;  2MHH A;  2MRD A;  2LLT A;  1JC2 A;  1IJ6 A;  2CXJ A;  4CFR A;  2JXC A;  2KGB C;  1D1O A;  1JWD A;  2JT8 A;  2ZN8 A;  2LC5 A;  1UUS A;  1DEK A;  1DMO A;  1UHN A;  4GNK B;  2RGI A;  3RLZ A;  2ZN9 A;  3PFV A;  2LMV A;  3PM8 A;  1JFJ A;  3EK7 A;  2JXL A;  2Y5I A;  3B87 A;  3KHE A;  2FJU B;  3CR5 X;  1QX7 A;  1CFC A;  1F70 A;  1REC A;  2K60 A;  1IKU A;  3O4X A;  3CLN A;  4N1G A;  4GBA A;  1NSH A;  5PAL A;  2FOT A;  2JTZ A;  2Y1M A;  4I5K A;  4BY5 A;  1OMV A;  2CT9 A;  1XVJ A;  2I18 A;  2O5G A;  2BCA A;  3BUO B;  4JWQ A;  4OZD A;  2LP3 A;  3SS5 A;  5TNC A;  1FI6 A;  3FWC A;  2BKH B;  1XA5 A;  1TOP A;  2H8V A;  2LVJ A;  3SJS A;  2H61 C;  2LMT A;  1YVH A;  4YRU A;  1K9P A;  1WLM A;  3IQQ A;  5HYD A;  3OB1 B;  3B88 A;  4ORC B;  5DKR A;  4CPV A;  3VRO A;  3CWG A;  2LHL A;  1CB1 A;  3ICB A;  4I5L B;  1QVI Y;  1OE9 B;  2BL0 C;  3PAT A;  4MLW A;  2GV5 A;  1SNL A;  2V53 A;  2I2R E;  4A4C A;  2WCJ A;  1TN4 A;  1IQ5 A;  4YGC B;  1EG4 A;  3OB2 B;  4M2Q A;  2CNP A;  5B8I B;  1OOF A;  2R2I A;  3I5F B;  3S0F A;  1B7T Z;  3NSL A;  4MVF A;  4PHN A;  1SW8 A;  4FQO A;  1QS7 A;  1SCV A;  2K2A A;  2KOT A;  1N2D A;  3D74 A;  1UHJ A;  1MQ1 A;  2OS8 B;  2LAP A;  4OCI A;  2BBM A;  2GGM A;  1SL9 A;  1TCO B;  1BMO A;  3S0B A;  4HSZ A;  2WCM A;  1NYA A;  2LLS A;  4ZCU A;  1Q80 A;  1MXE A;  1S6I A;  1CDL A;  1S26 D;  5EL2 A;  3NGV A;  2LP2 A;  1L2O C;  2I7A A;  2WOR A;  1Y0V H;  2I94 A; 
#chains in the Genus database with same CATH homology
 1IWQ A;  2ZND A;  4GGF A;  1B4C A;  2WCF A;  3BYA A;  1EH2 A;  1F8H A;  3GK2 A;  3EKH A;  1K95 A;  1QV1 A;  1CFP A;  1BF5 A;  1KSM A;  2K61 A;  1CFD A;  1CNP A;  1W7I B;  5F6T A;  2F8P A;  1LA0 A;  1NPQ A;  1UP5 A;  4OV2 A;  1SR6 B;  1B8C A;  4F0Z B;  1WDC B;  2K7D A;  3NXA A;  2BKI B;  2L0P A;  3CS1 A;  1C7V A;  2QAC A;  4AQJ A;  1JUO A;  2KI4 B;  1ZMZ A;  1J7O A;  1GQM A;  1TNQ A;  1EXR A;  2HF5 A;  2PAS A;  1QV0 A;  1L7Z A;  2CTN A;  4MZK A;  1LKJ A;  3O78 A;  4BY4 A;  1SCM B;  2E30 A;  1R6P A;  2KI6 C;  4YI8 A;  4AOM A;  5AXI A;  1K93 D;  4ORB B;  1A75 A;  1CMF A;  5ER4 X;  2MA2 A;  1SL8 A;  3EKJ A;  2G2B A;  2JNX A;  1QX2 A;  1XFY O;  3WHU B;  2Y1N A;  3SG4 A;  5J3X A;  3BXK A;  2KBI A;  4JQ0 D;  1QLS A;  5CSN A;  2LLU A;  4C0L A;  1KFX S;  2OTG B;  3D10 A;  5KTY A;  1BOD A;  2EGD A;  1FW4 A;  1M46 A;  1KWO B;  3TZ1 A;  1K9U A;  1XK4 C;  1NX1 A;  3TDI A;  3M0W A;  1A75 B;  2O60 A;  2JWW A;  2TN4 A;  1DJW A;  5JOL A;  3K21 A;  2K0J A;  4N5X A;  3BUW B;  5I2O A;  3JTD C;  4D1E A;  3PSR A;  1CLB A;  2BCB A;  1KK7 Z;  1ZFS A;  2M7N A;  1NUB A;  2F3Y A;  3I5I C;  4ICB A;  4YBH B;  2KHN A;  1JFK A;  4ETO A;  3OX5 A;  1AP4 A;  1SRA A;  1VRK A;  4ORA B;  5D7F A;  2K7O A;  2K8M B;  1MHO A;  1PSR A;  1SMG A;  5CSF A;  1MWN A;  1GGZ A;  2PRU A;  2AUC A;  2KAV A;  1J7R A;  1H4B A;  1FPW A;  2MLE C;  1XYD A;  1BR1 B;  1SK6 D;  3TS5 B;  1XFX O;  1YUR A;  4N1F A;  1BG1 A;  3LK0 A;  1G4Y R;  2L2E A;  4OR9 B;  1DJY A;  4M2O A;  1CLL A;  5HKW A;  1BOC A;  2WCB A;  4MZJ A;  1SPY A;  1F55 A;  3AKB A;  2HET A;  3AAK A;  1FF1 A;  4GUK A;  1B8L A;  3KPX A;  1J1D A;  1OQP A;  4QJ3 B;  2K7C A;  1YX7 A;  3D0Y A;  4PHJ A;  1QIW A;  4YGE B;  1DTL A;  3JVT B;  3PN7 B;  2JRF A;  5HLV A;  4P2Y B;  4JPZ B;  1YRU B;  2AMI A;  2KAY A;  2LVI A;  2KQ6 A;  2JT0 A;  2OS8 C;  1SL7 A;  2WND A;  3DF0 B;  3KF9 A;  2P6B B;  4NQG A;  1AHR A;  1F54 A;  1BLQ A;  1TNP A;  4I5J A;  3VRN A;  3PAL A;  1S3P A;  5BPJ A;  1WRL A;  2MJW B;  3FS7 A;  5CPV A;  1YVL A;  2F3Z A;  2F2P A;  4ZCV A;  1B47 A;  2E6W A;  1F4O A;  2JT3 A;  3D0Y B;  5I2Q A;  2JC2 A;  2EC6 B;  1E8A A;  1S5G Z;  1PVB A;  4NDD A;  1LXF C;  1NX2 A;  3BQ3 A;  5KU1 A;  2DOQ A;  2F33 A;  1J7Q A;  4MSP A;  1NIW A;  2H61 A;  4OVN F;  1DF0 A;  1ODB A;  1WDC C;  1XFZ O;  1MXL C;  4L9M A;  2KDH A;  1ZUZ A;  1TCF A;  3EVR A;  1KFU L;  1JF2 A;  2L4H A;  2IS9 A;  4GGN A;  1JBA A;  1KK7 Y;  5AAN A;  2PMY A;  4WRI A;  2JOJ A;  1B1G A;  1SY9 A;  2M1K B;  4PE1 A;  5I8N A;  4WQ3 A;  1QLK A;  2BE4 A;  1PK0 D;  1DF0 B;  3WNX B;  4CLN A;  2CCM A;  4HRE E;  1RK9 A;  3I5H B;  3C1V A;  2L51 A;  2GGZ A;  3CGA A;  2OTG C;  2BL0 B;  2M9G A;  1HQV A;  1IG5 A;  2SAS A;  4NDB A;  1KWO C;  3EVV A;  4QJ5 B;  1BJF A;  2LUC A;  1DVI A;  1XFU O;  2ZFD A;  1WY9 A;  2A4J A;  1Y6W A;  2F2O A;  2Y4Q A;  2ZNE A;  5KSZ A;  1DJX A;  1A29 A;  2KQY A;  1IGV A;  1ZAC A;  3GK1 A;  3TDZ A;  4MRY A;  2HQ8 A;  1CTR A;  1K2H A;  1CFF A;  3RM1 A;  1GJY A;  2M0R A;  3CZT X;  1S6J A;  3BUX B;  2M8U A;  2M29 A;  2HPS A;  3AAJ A;  2M3W A;  1M45 A;  1K94 A;  1OMD A;  1M63 B;  1AJ5 A;  1MF8 B;  1V1G A;  2JU0 A;  4USL A;  1RWY A;  1AJ4 A;  1QVI Z;  1PVA A;  1XFV O;  1PUL A;  1WLZ A;  5GQQ C;  4C0K A;  1DT7 B;  1NX3 A;  1NP8 A;  1SYM A;  4HRH A;  1FI5 A;  3BUN B;  2JQ6 A;  5D69 A;  3BOW A;  3OX6 A;  3WXA A;  1QAT A;  3EK4 A;  4GAO A;  1KCY A;  3H4S E;  3LK1 A;  1ALW A;  1BT6 A;  2KBM A;  3IQO A;  1CDN A;  3O6B A;  1CLM A;  2Q91 A;  2OPO A;  4PHK A;  1H8B A;  4NDC A;  1TTX A;  1B7T Y;  1NX0 A;  3DVE A;  3KEV A;  4YGA A;  3VRQ A;  5AEQ A;  1NCX A;  1OMR A;  1XFW O;  3F45 A;  4M2P A;  3SG6 A;  2CBL A;  1QX5 B;  3MSE B;  1C7W A;  1XK4 A;  5ER5 A;  2JZI A;  3O4Y A;  3OHM B;  3CTN A;  2MLF C;  2LVK A;  3BOW B;  1QAS A;  3DF0 A;  1KSO A;  2NXQ A;  1EJ3 A;  2L4I A;  3DVK A;  1IRJ A;  1CM4 A;  3A8R A;  4C0J A;  1OZS A;  1QTX A;  2FCD A;  2PVB A;  4AQI A;  3CR4 X;  4CFQ A;  3TUY B;  1N0Y A;  3I5G B;  1YR5 A;  1UUR A;  2PSR A;  2LHI A;  3IF7 A;  2L50 A;  2KSP A;  3HX4 A;  3AKA A;  1AK8 A;  2MBX A;  1F4Q A;  1SBJ A;  2EC6 C;  2NLN A;  3I5F C;  2KGR A;  3BUM B;  3CR2 A;  2NCP A;  3LCP C;  1CKK A;  1BR4 B;  1M39 A;  2KYF A;  1LIN A;  4PDZ A;  4WQ2 A;  1CMG A;  3JTD B;  2KYC A;  1KQM B;  2JTT A;  2SCP A;  1G8I A;  3DD4 A;  1OOJ A;  4DCK A;  1WRK A;  1YX8 A;  2WCE A;  3O2P A;  3SG5 A;  3ZWH A;  1K9K A;  4HRG A;  5K89 A;  5DKN A;  3KO0 A;  4GFT A;  3I5I B;  4MRX A;  4OKH A;  1DGV A;  1MR8 A;  1K96 A;  1KK8 B;  3SG7 A;  2HQW A;  1MUX A;  2JNF A;  1NCY A;  1DJH A;  1U5I A;  4DS7 A;  1W7J B;  1J55 A;  1FBV A;  1B9A A;  2NZ0 A;  1KFU S;  3QRX A;  4DUQ A;  1KQV A;  3OP0 A;  1PRW A;  2KFH A;  5HKZ A;  5G08 A;  3VGO A;  5AFP A;  4IL1 A;  1SR6 C;  1JSA A;  4DIR A;  3I5H C;  4GPL B;  1UHI A;  1UWO A;  2M49 B;  1UHH A;  2EHB A;  2KI4 C;  3LL8 B;  3NSO A;  2LNK A;  3TDU A;  2BBN A;  1A4P A;  4I5N B;  3SIB A;  1UHK A;  2BCX A;  1U5I B;  3LLE A;  1F71 A;  1QXP A;  4Q04 A;  4YI9 A;  1SCM C;  4GGF C;  2LMU A;  1J1E A;  1Y1A A;  5AER A;  1N65 A;  4PE0 A;  4YGD B;  1PSB A;  2BEC A;  3ZNI A;  2M1U A;  1J7P A;  2M7L A;  2D8N A;  1S1E A;  3FIA A;  4TNC A;  5FYX A;  2KFG A;  1C07 A;  2M97 A;  1HT9 A;  3NSK A;  1R2U A;  3DVM A;  1V1F A;  2VRG A;  1QJT A;  4UPG A;  1QIV A;  1SKT A;  1XO5 A;  1JF0 A;  4A4B A;  4CID A;  1YTZ C;  1EL4 A;  4PE7 A;  1YUU A;  1CM1 A;  3DVJ A;  1DJZ A;  1Y1U A;  2KFF A;  1A03 A;  3EK8 A;  4XJK A;  3SIA A;  1RRO A;  2LM5 A;  4R1E A;  5CSJ A;  1GGW A;  3PLF B;  1TIZ A;  2LVV A;  1RTP 1;  1M31 A;  3FWB A;  4U8D A;  2L5X B;  5HLO A;  1ZOT B;  1RJV A;  1K8U A;  1YUT A;  1L2O B;  2MAZ A;  1BU3 A;  3VRP A;  1AUI B;  2AAO A;  3E3R A;  4E68 A;  5CSI A;  2QPT A;  3EVU A;  4XYN A;  1TRF A;  3WHT B;  1K90 D;  2KAX A;  2WOS A;  2ZRS A;  4XJK B;  2B1U A;  1S6C A;  1TNW A;  3GK4 X;  5JJG A;  2LV7 A;  3NSI A;  2ISD A;  3SG3 A;  2K2F A;  2LE9 B;  4MN0 A;  5DKQ A;  1B8R A;  3TS5 C;  2PAL A;  1DGU A;  2K7B A;  1IQ3 A;  3GOF A;  2KI6 D;  2JPT A;  1WRZ A;  2NCO A;  1S5G Y;  1TNX A;  3I5G C;  3TUY C;  3VRR A;  5HKY A;  3HCM A;  1YRT B;  2Q4U A;  4MEW A;  4MBE A;  1OZO A;  3A4U B;  2ZKM X;  4DRW A;  1AVS A;  4QJ4 B;  1ALV A;  4P5O E;  3SG2 A;  2COL B;  2LAN A;  2FCE A;  2WC8 A;  3JVT C;  3PN7 C;  4MZL A;  2L98 A;  5I2L A;  1IH0 A;  4PCW A;  1IJ5 A;  1DJI A;  2LCP A;  1KQM C;  2JUL A;  1DJG A;  5IBW A;  1PAL A;  4PE4 A;  1YUS A;  1NWD A;  2LUX A;  1KFX L;  1X02 A;  1A2X A;  2BE6 A;  1LVC D;  1OSA A;  4YGB B;  1CDP A;  1KK8 C;  1NCZ A;  1Y1X A;  1LA3 A;  2G9B A;  2H2K A;  1CDM A;  2ZRT A;  4FTG A;  4PHM A;  4PAL A;  1S36 A;  1G33 A;  2KNE A;  1EG3 A;  1RFJ A;  2MHH A;  2MRD A;  2LLT A;  1JC2 A;  1IJ6 A;  2CXJ A;  4CFR A;  2JXC A;  2KGB C;  1D1O A;  1JWD A;  2JT8 A;  2ZN8 A;  2LC5 A;  1UUS A;  1DMO A;  1UHN A;  4GNK B;  2RGI A;  3RLZ A;  2ZN9 A;  3PFV A;  2LMV A;  3PM8 A;  1JFJ A;  3EK7 A;  2JXL A;  2Y5I A;  3KHE A;  2FJU B;  3CR5 X;  1QX7 A;  1CFC A;  1F70 A;  1REC A;  1IKU A;  3CLN A;  4N1G A;  4GBA A;  1NSH A;  5PAL A;  2FOT A;  2JTZ A;  2Y1M A;  4I5K A;  4BY5 A;  1OMV A;  2CT9 A;  1XVJ A;  2I18 A;  2O5G A;  2BCA A;  3BUO B;  4JWQ A;  2LP3 A;  5TNC A;  1FI6 A;  3FWC A;  2BKH B;  1XA5 A;  1TOP A;  2LVJ A;  3SJS A;  2H61 C;  2LMT A;  1YVH A;  4YRU A;  1K9P A;  1WLM A;  3IQQ A;  5HYD A;  3OB1 B;  4ORC B;  5DKR A;  4CPV A;  3VRO A;  3CWG A;  2LHL A;  1CB1 A;  3ICB A;  4I5L B;  1QVI Y;  1OE9 B;  2BL0 C;  3PAT A;  4MLW A;  2GV5 A;  1SNL A;  2V53 A;  2I2R E;  4A4C A;  1TN4 A;  1IQ5 A;  4YGC B;  1EG4 A;  3OB2 B;  4M2Q A;  2CNP A;  5B8I B;  2R2I A;  3I5F B;  1B7T Z;  3NSL A;  4MVF A;  4PHN A;  1SW8 A;  4FQO A;  1QS7 A;  1SCV A;  2K2A A;  2KOT A;  1N2D A;  1UHJ A;  1MQ1 A;  2OS8 B;  2LAP A;  4OCI A;  2BBM A;  2GGM A;  1SL9 A;  1TCO B;  1BMO A;  4HSZ A;  1NYA A;  2LLS A;  4ZCU A;  1Q80 A;  1MXE A;  1S6I A;  1CDL A;  1S26 D;  2LP2 A;  1L2O C;  2I7A A;  2WOR A;  1Y0V H;  2I94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...