1NX3A

Calpain domain vi in complex with the inhibitor pd150606
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx3A00
1G4YR 1BLQA 4GGFA 2HPSA 1XFUO 2EC6C 2PSRA 1K2HA 1XFXO 2MLFC 3PALA 1U5IA 2WCFA 4F0ZB 1XK4A 1WRKA 2JZIA 2R2IA 1NP8A 2H2KA 1YRUB 5ER5A 2LE9B 3TDUA 5AERA 2LLTA 1YVHA 2OTGC 4BY4A 1EJ3A 3GK2A 1J1DA 1KFUL 2AAOA 1OE9B 2L5XB 4MRXA 2BCXA 1B7TY 1QX2A 1KWOC 2L0PA 4I5KA 1JF2A 2BKIB 1BJFA 1UHKA 2AUCA 2PRUA 1CKKA 1J7PA 1FI5A 1N0YA 2KFGA 3JTDB 1KK8C 2JXCA 1CLMA 4NDDA 1CFCA 1IGVA 1H4BA 1DGUA 1NSHA 3BUWB 3BOWB 5I2LA 3OX5A 3CTNA 2O60A 1F4QA 3PLFB 1UHHA 1SY9A 1OMVA 2CBLA 3QRXA 4M2PA 4ZCUA 1Y6WA 2LMVA 1SCMC 1AVSA 2LVIA 1B8CA 1XYDA 3FWBA 1PULA 1QS7A 3I5FC 2D8NA 1NCZA 1BF5A 1TCFA 3D10A 3LK0A 3WHUB 1OZSA 1IH0A 1SK6D 1TCOB 3LLEA 5KSZA 1SCVA 3CR5X 3EKHA 2KSPA 3PN7C 3CZTX 4PHJA 5HLOA 1DJYA 1UHIA 4YRUA 4E68A 3NXAA 5HKZA 2LHLA 3KHEA 1OOJA 2LLSA 3I5GC 3RLZA 4OV2A 2KI4B 3TDZA 4AQIA 3PM8A 1IJ5A 1LA3A 2M97A 1DF0B 3EVVA 1KK7Z 1UHJA 1DVIA 1GGWA 4MVFA 5KTYA 3KPXA 2KGRA 4YI9A 3BUXB 1ZOTB 1FI6A 2SCPA 1CM1A 3KEVA 2LLUA 2JNXA 1E8AA 1RWYA 1W7IB 1MXLC 1OQPA 1L2OB 1TTXA 2LVJA 1XA5A 3FIAA 4L9MA 1K96A 4JPZB 5CSFA 1UWOA 2K2AA 2G2BA 4MEWA 1Y1AA 3KF9A 1X02A 3I5HB 1ZACA 1MXEA 1F55A 4HSZA 3TUYC 2JQ6A 4I5LB 4N1GA 3VRQA 2Y1MA 5DKQA 1KFXS 1VRKA 2M8UA 1QVIY 4GGFC 2BECA 1CNPA 1G8IA 1WLZA 3NSIA 3SG2A 4BY5A 3VRPA 1FPWA 1YUTA 4YGCB 2LHIA 2E6WA 4DRWA 1NIWA 2WC8A 4PALA 1LVCD 1XVJA 3DVJA 4FQOA 2PMYA 2K2FA 2OPOA 3OB2B 1FW4A 2JULA 2G9BA 3AAKA 4R1EA 1SL9A 3NSLA 2K7OA 5I2QA 1A75A 1NCXA 1LINA 1TOPA 2BL0C 3D0YB 1UURA 3EVRA 2KGBC 3TZ1A 1SRAA 2I18A 5CSJA 3C1VA 4PE4A 4DIRA 2HF5A 2ZRTA 1S1EA 3O2PA 4DCKA 2ZFDA 1KSOA 1UHNA 1SR6B 2GV5A 4HRHA 1QASA 1F71A 1NX2A 1S5GY 1Q80A 1OMDA 1LKJA 1YX8A 2K7DA 3CR2A 3WHTB 4UPGA 1DMOA 1GQMA 4P5OE 3JVTB 3SG3A 3D0YA 1S6IA 3AKBA 3LCPC 3WXAA 3JTDC 2FOTA 1B4CA 1MUXA 2QACA 1LXFC 1TNXA 4NDBA 1BODA 1CFFA 1OSAA 1QV1A 1MQ1A 2JTTA 2I94A 2LMUA 4QJ4B 1CDMA 3CS1A 3CWGA 5JOLA 2BBNA 2HETA 4FTGA 5JJGA 2LUXA 2MHHA 2KAVA 1V1FA 1QLKA 1RECA 3WNXB 2HQ8A 4XYNA 2FCEA 1JSAA 1QATA 1TN4A 1MHOA 2M7NA 1WDCC 1EG3A 4NDCA 1NCYA 2MAZA 1CLLA 3K21A 4MRYA 2IS9A 2DOQA 1QXPA 3BUMB 5G08A 1F54A 2P6BB 3O78A 4N1FA 2LUCA 1Y1UA 5I2OA 1N2DA 3EK7A 4DUQA 3CGAA 1SPYA 5HKYA 1R6PA 1ALVA 2CXJA 3PSRA 1PK0D 1A03A 1A2XA 1DJGA 4MSPA 3TS5B 2OTGB 4TNCA 3DVEA 3SJSA 4CIDA 2ZNEA 2ZRSA 2GGMA 2CTNA 3CR4X 3EKJA 4N5XA 5HKWA 2M3WA 4QJ5B 3IF7A 2GGZA 1NX3A 2E30A 2MLEC 2COLB 2LVKA 1UP5A 3SG4A 1KQVA 2M29A 3SIBA 1B9AA 1L2OC 4OKHA 2F33A 1SNLA 1B1GA 2F8PA 3DF0B 1KK8B 1RFJA 2L51A 1LA0A 1XFYO 1PVBA 3DVKA 2L50A 3I5HC 1S3PA 3BUOB 1IG5A 2KHNA 5AXIA 4A4BA 2AMIA 2JXLA 2BCBA 1FBVA 4M2QA 5HLVA 3ZNIA 4DS7A 2A4JA 2PVBA 1H8BA 1YRTB 3DVMA 5IBWA 3IQOA 4PE0A 5D69A 4ORCB 4PE7A 1TNWA 4CLNA 2F2OA 1IQ3A 1FF1A 1TRFA 1IJ6A 1C7WA 1NX0A 2L4HA 3BUNB 3PATA 1GJYA 1WY9A 3H4SE 1QIVA 2H61A 1RROA 1MF8B 5AANA 1EL4A 3DF0A 3PN7B 1QIWA 2Y5IA 1A75B 1J7OA 2MJWB 1PRWA 1BU3A 2K7CA 1DTLA 4XJKB 4MN0A 1D1OA 1XK4C 1M63B 1KK7Y 1RJVA 2PALA 3A8RA 4HRGA 2ZN8A 1JC2A 1CMFA 1TIZA 1GGZA 1IQ5A 3PFVA 1NUBA 1DGVA 1C07A 1IKUA 2JT3A 5DKRA 2BBMA 1AP4A 4ICBA 1ZFSA 1A29A 1J55A 1KFXL 4JQ0D 4MLWA 4YGEB 1S6CA 1J7QA 1QTXA 1B8RA 5I8NA 2WORA 1A4PA 2M0RA 2F3ZA 1DT7B 1YUSA 3IQQA 3LL8B 1SR6C 1MR8A 4USLA 4XJKA 3OB1B 1BG1A 2LM5A 3OHMB 3NSOA 2OS8B 1SBJA 1G33A 1JUOA 4C0JA 1B8LA 2V53A 2L98A 3ZWHA 3TUYB 5K89A 1IRJA 1CLBA 3JVTC 4PHKA 2KFHA 2JPTA 3BXKA 5DKNA 1F70A 2JTZA 2BE4A 3EK8A 2KAYA 2RGIA 5B8IB 1SMGA 2Y4QA 3I5IB 3VRRA 4PHNA 4I5JA 3M0WA 3NSKA 4HREE 1CFPA 1CMGA 1AJ4A 4D1EA 2BCAA 1K95A 1YURA 1SL7A 4I5NB 1SYMA 5F6TA 1B7TZ 4C0LA 5BPJA 1OMRA 1DJXA 1KCYA 2JRFA 2WNDA 3TDIA 1ZUZA 2NCOA 2KYCA 5GQQC 2WOSA 3OP0A 2M49B 1AHRA 1NWDA 2LAPA 1JWDA 2BKHB 1IWQA 2F2PA 2ZN9A 4U8DA 1Y1XA 2BL0B 2LC5A 5D7FA 3VGOA 1KFUS 2LNKA 5KU1A 1HT9A 2CT9A 5AFPA 4WQ2A 5HYDA 1WRLA 3FS7A 2LV7A 2PASA 1ALWA 1M45A 4GFTA 1EH2A 1M39A 4WRIA 1WRZA 5ER4X 2KBIA 4GGNA 2WCEA 4NQGA 1YUUA 3SG5A 1HQVA 1KQMB 2KOTA 3TS5C 2ZNDA 1AK8A 1S6JA 2EC6B 1CM4A 3GOFA 4MZJA 2JOJA 1JBAA 3RM1A 1QLSA 4QJ3B 2L2EA 4C0KA 4AOMA 2H61C 2KYFA 1QX5B 3SIAA 1WLMA 2LVVA 2KI4C 4ZCVA 5CSIA 1BMOA 1YX7A 2SASA 1L7ZA 1ODBA 4GNKB 1K9PA 1QJTA 2FJUB 5J3XA 2QPTA 4WQ3A 1JFJA 4M2OA 3HCMA 1KWOB 1V1GA 1OZOA 1YTZC 4MZLA 2TN4A 2HQWA 2MA2A 1RK9A 3CLNA 3E3RA 1F8HA 1PVAA 2EHBA 1K94A 2JC2A 4OCIA 1N65A 2KFFA 1EXRA 2KQ6A 1CDNA 1WDCB 2I2RE 5AEQA 2LP2A 1XFZO 3LK1A 1YR5A 4YI8A 4A4CA 2LP3A 4IL1A 2KAXA 4YGAA 2CCMA 4GPLB 1C7VA 2LANA 2BE6A 1SCMB 1PSBA 1K9KA 1M46A 1YVLA 2KQYA 3EVUA 3BOWA 5CPVA 1QVIZ 2K8MB 3I5FB 1CB1A 1M31A 2VRGA 4CFRA 3AKAA 1AUIB 3VROA 1K8UA 3ICBA 1W7JB 2FCDA 1TNQA 2JU0A 1PALA 1K93D 1CFDA 3DD4A 3EK4A 4YGBB 2NXQA 3BQ3A 2MBXA 2WCBA 1BT6A 1S26D 2M9GA 1RTP1 3F45A 4OR9B 1QX7A 3I5GB 1MWNA 1CTRA 2KI6D 3KO0A 1UUSA 4YBHB 4AQJA 1JFKA 3GK4X 4ORBB 4Q04A 1B47A 4JWQA 2K0JA 3AAJA 2OS8C 3VRNA 4GAOA 1F4OA 2B1UA 1QV0A 4ORAB 1J7RA 1DJZA 2KNEA 2NLNA 1DF0A 2M1KB 2Q4UA 3SG7A 1DJWA 1K90D 4P2YB 2ISDA 4PHMA 2KBMA 2CNPA 4PCWA 2ZKMX 1XFWO 1BR4B 1SW8A 2I7AA 1ZMZA 2F3YA 2LCPA 1JF0A 2LMTA 3BYAA 3I5IC 2KI6C 2Y1NA 2NZ0A 1NX1A 2EGDA 2O5GA 4PE1A 1SL8A 5TNCA 3MSEB 5FYXA 2M1UA 4OVNF 1KSMA 1S5GZ 3SG6A 3HX4A 3GK1A 1DJIA 4CFQA 2JWWA 4PDZA 4CPVA 2M7LA 4YGDB 2KDHA 2JT8A 1U5IB 3FWCA 3OX6A 5CSNA 5PALA 4ETOA 1R2UA 1NYAA 2JT0A 1XO5A 2K7BA 4MZKA 4MBEA 1TNPA 1Y0VH 1NPQA 1BOCA 1XFVO 2JNFA 1CDPA 1J1EA 1SKTA 2L4IA 2NCPA 1PSRA 1AJ5A 1BR1B 4GBAA 2K61A 4GUKA 1CDLA 1DJHA 1S36A 1K9UA 1EG4A 3A4UB 3O6BA 3O4YA 1KQMC 2Q91A 2MRDA
chains in the Genus database with same CATH superfamily
1G4YR 1BLQA 4GGFA 2HPSA 1XFUO 2EC6C 2PSRA 1K2HA 1XFXO 2MLFC 3K1EA 3PALA 1U5IA 2WCFA 4F0ZB 1XK4A 1WRKA 2JZIA 2R2IA 1NP8A 2H2KA 1YRUB 5ER5A 2LE9B 3TDUA 5AERA 2LLTA 2BAPA 1YVHA 2OTGC 4BY4A 1EJ3A 3GK2A 1J1DA 1KFUL 2AAOA 1OE9B 2L5XB 3BFBA 4MRXA 2BCXA 2PYQA 1B7TY 1C3YA 1QX2A 1KWOC 2L0PA 4I5KA 3FE9A 1JF2A 2BKIB 3SS3A 1BJFA 1UHKA 2AUCA 2PRUA 1CKKA 1J7PA 1FI5A 3BFHA 1N0YA 2KFGA 3JTDB 1KK8C 2JXCA 1CLMA 4NDDA 1CFCA 3L47A 3CZ2A 1IGVA 1H4BA 1DGUA 1NSHA 3BUWB 3BOWB 5I2LA 3OX5A 3CTNA 2O60A 1F4QA 3PLFB 4INXA 1UHHA 1SY9A 1OMVA 2CBLA 3QRXA 4M2PA 4ZCUA 1Y6WA 2LMVA 1SCMC 1AVSA 2LVIA 1B8CA 1XYDA 3FWBA 1PULA 1QS7A 3I5FC 2D8NA 1NCZA 1BF5A 1TCFA 3D10A 3LK0A 3CDNA 3WHUB 1OZSA 3CYZA 1IH0A 1SK6D 1TCOB 2WCJA 3LLEA 5KSZA 1SCVA 3CR5X 3EKHA 2KSPA 3PN7C 3CZTX 4PHJA 5HLOA 1DJYA 1UHIA 4YRUA 4E68A 3NXAA 5HKZA 2LHLA 3KHEA 1OOJA 2LLSA 3I5GC 3RLZA 4OV2A 2KI4B 3TDZA 4AQIA 3PM8A 1IJ5A 1LA3A 2M97A 1DF0B 3EVVA 1KK7Z 1UHJA 1DVIA 1GGWA 4MVFA 3DYEA 3OGNA 3KPXA 5KTYA 2KGRA 3CZ0A 4YI9A 3BUXB 1ZOTB 4OZDA 1FI6A 2SCPA 1CM1A 3KEVA 2LLUA 2JNXA 1E8AA 1RWYA 1W7IB 1MXLC 1OQPA 1L2OB 3B7AA 1TTXA 3DZTA 2LVJA 1XA5A 3FIAA 4L9MA 1K96A 4JPZB 4INWA 5CSFA 1UWOA 2K2AA 2G2BA 4MEWA 1Y1AA 3KF9A 1X02A 3I5HB 1ZACA 3SS4A 1MXEA 1F55A 4HSZA 3TUYC 2JQ6A 4I5LB 4N1GA 3VRQA 2Y1MA 5DKQA 1KFXS 1VRKA 2M8UA 1C3ZA 1QVIY 4GGFC 2BECA 1CNPA 1G8IA 1WLZA 3NSIA 3VB1A 3SG2A 4BY5A 3VRPA 1FPWA 1YUTA 4YGCB 2LHIA 2E6WA 4DRWA 1NIWA 2WC8A 4PALA 1LVCD 3S0AA 1XVJA 3DVJA 4FQOA 2PMYA 2K2FA 2OPOA 1TWOA 3OB2B 1FW4A 2JULA 2G9BA 3AAKA 4R1EA 1SL9A 3NSLA 2K7OA 3D77A 1A75A 1NCXA 1LINA 1TOPA 5I2QA 2BL0C 3D0YB 1UURA 3EVRA 2KGBC 2QDIA 4PT1A 1DQEA 3TZ1A 1SRAA 2I18A 5CSJA 3C1VA 4PE4A 4DIRA 2HF5A 2ZRTA 1S1EA 3O2PA 4DCKA 2ZFDA 1KSOA 1UHNA 1SR6B 2GV5A 2YGUA 5D3OA 3B87A 4HRHA 1GM0A 1OOGA 1QASA 1F71A 1IIOA 1NX2A 1QWVA 1Q80A 1OMDA 1LKJA 1S5GY 1YX8A 2K7DA 3CR2A 3WHTB 4UPGA 1GQMA 1DMOA 4P5OE 3JVTB 3SG3A 3D0YA 1S6IA 3AKBA 3LCPC 5DICA 3JTDC 2FOTA 3WXAA 3S0FA 1MUXA 2QACA 1B4CA 1LXFC 1TNXA 4NDBA 1BODA 1CFFA 1OSAA 1QV1A 1MQ1A 2JTTA 2WCKA 2I94A 2LMUA 3OBVA 1CDMA 3CS1A 3CWGA 3L4LA 5JOLA 4QJ4B 2BBNA 2HETA 4FTGA 5JJGA 2LUXA 2MHHA 2KAVA 1V1FA 1QLKA 1RECA 3WNXB 2HQ8A 4XYNA 2FCEA 2KPHA 3R1OA 3S0EA 1JSAA 1QATA 1TN4A 1MHOA 2M7NA 1WDCC 1EG3A 4NDCA 1NCYA 2MAZA 1CLLA 3K21A 4MRYA 2IS9A 3B88A 2DOQA 1QXPA 3BJHA 3BUMB 5G08A 2P6BB 1F54A 3O78A 4N1FA 2LUCA 1Y1UA 5I2OA 1N2DA 3EK7A 4DUQA 3CGAA 1SPYA 5HKYA 1R6PA 1ALVA 2CXJA 3D78A 3PSRA 1PK0D 1A03A 1A2XA 1DJGA 4MSPA 3TS5B 2OTGB 4TNCA 3DVEA 5FI7A 1SSEB 3SJSA 4CIDA 2ZNEA 2ZRSA 2GGMA 2CTNA 3CR4X 2JPOA 3EKJA 4N5XA 5HKWA 2M3WA 4F7FA 4QJ5B 3IF7A 2WC5A 1DC1A 2GGZA 1NX3A 2E30A 2QEBA 2MLEC 2COLB 2LVKA 1UP5A 3SG4A 1KQVA 2M29A 3SIBA 1B9AA 1L2OC 2FJYA 2BNXA 2F33A 3NHIA 4OKHA 3V2LA 1SNLA 1B1GA 2F8PA 3DF0B 3S0BA 1KK8B 1RFJA 2ERBA 2L51A 1LA0A 1XFYO 1PVBA 3DVKA 2L50A 3I5HC 1S3PA 3BUOB 3PJIA 1IG5A 2KHNA 5AXIA 4A4BA 2AMIA 2JXLA 2BCBA 1FBVA 4M2QA 5HLVA 3ZNIA 4DS7A 2A4JA 2PVBA 1H8BA 1YRTB 3DVMA 5IBWA 3IQOA 4PE0A 2P71A 5D69A 4ORCB 4PE7A 1TNWA 4CLNA 2F2OA 4JD9A 3S0GA 1IQ3A 1FF1A 1TRFA 3D76A 1IJ6A 1C7WA 1NX0A 2L4HA 3BUNB 3PATA 1GJYA 1WY9A 3H4SE 1QIVA 2H61A 1RROA 1MF8B 5AANA 3S0DA 1EL4A 3DF0A 3PN7B 1QIWA 2Y5IA 1A75B 1J7OA 2MJWB 1PRWA 1BU3A 2K7CA 1DTLA 4XJKB 4MN0A 2KLDA 3SS5A 1D1OA 1XK4C 1M63B 1KK7Y 1RJVA 2PALA 2WCHA 3A8RA 4HRGA 2ZN8A 1OW4A 1JC2A 1CMFA 1Z2CB 1TIZA 1GGZA 1IQ5A 3PFVA 1NUBA 1DGVA 1C07A 2WCLA 1IKUA 2JT3A 5DKRA 2BBMA 1OOHA 1AP4A 4ICBA 5EL2A 1ZFSA 1A29A 1J55A 1KFXL 4JQ0D 4MLWA 4YGEB 1S6CA 1J7QA 1QTXA 1W9ZA 3D74A 1B8RA 5I8NA 2WORA 1A4PA 2M0RA 2P70A 2L5YA 2F3ZA 3NGVA 3B86A 1YUSA 3R72A 3IQQA 3LL8B 1SR6C 1MR8A 1DT7B 4USLA 4XJKA 3OB1B 1BG1A 2LM5A 3OHMB 3D73A 2OS8B 3NSOA 1SBJA 1G33A 3EG5B 3UO9A 1JUOA 4C0JA 1B8LA 3CABA 2V53A 1TUJA 2K60A 2L98A 3ZWHA 3TUYB 1P28A 5K89A 1IRJA 1CLBA 3JVTC 1OOFA 2KFHA 4PHKA 2WC6A 2JPTA 3BXKA 5DKNA 1F70A 2JTZA 3DXLA 2BE4A 3EK8A 3B6XA 3RZSA 2KAYA 2RGIA 5B8IB 1SMGA 2Y4QA 3I5IB 3VRRA 4PHNA 4I5JA 3M0WA 3NSKA 4HREE 1CFPA 1CMGA 1AJ4A 4D1EA 2BCAA 1K95A 1YURA 1SL7A 4I5NB 1SYMA 3N7HA 1B7TZ 3NHTA 5F6TA 4C0LA 1OMRA 5BPJA 1DJXA 1KCYA 1LS8A 2JRFA 2WNDA 3TDIA 1ZUZA 2NCOA 2KYCA 3QMEA 2WOSA 3OP0A 2KLEA 2M49B 5FI6A 5GQQC 1AHRA 1NWDA 2LAPA 1JWDA 2BKHB 1IWQA 3DY9A 2F2PA 2ZN9A 4U8DA 1Y1XA 2BL0B 2LC5A 5D7FA 3VGOA 1KFUS 1OOIX 2LNKA 5KU1A 1HT9A 2CT9A 1DEKA 5AFPA 3FE8A 3Q8IA 4WQ2A 5HYDA 1WRLA 3FS7A 2LV7A 3L4AA 2PASA 1ALWA 1M45A 4GFTA 1EH2A 1M39A 4WRIA 1WRZA 5ER4X 2KBIA 4GGNA 2WCEA 4NQGA 1YUUA 3SG5A 1HQVA 1KQMB 2KOTA 3TS5C 2ZNDA 1AK8A 1S6JA 2EC6B 1CM4A 3GOFA 4MZJA 2JOJA 1JBAA 3RM1A 3BFAA 3R1PA 1QLSA 4QJ3B 2L2EA 4C0KA 4AOMA 2H61C 2KYFA 1QX5B 3SIAA 1WLMA 2LVVA 2KI4C 4ZCVA 5CSIA 1BMOA 1YX7A 2SASA 1L7ZA 1ODBA 4GNKB 1K9PA 1TUZA 1QJTA 2FJUB 5J3XA 1XFRA 2QPTA 4WQ3A 4M2OA 1JFJA 3HCMA 2PQLA 1KWOB 1V1GA 1OZOA 1YTZC 4MZLA 2TN4A 2HQWA 2MA2A 1RK9A 3CLNA 3E3RA 1F8HA 1PVAA 2EHBA 1K94A 2JC2A 4OCIA 1N65A 2KFFA 1EXRA 2KQ6A 2QEOA 1CDNA 1WDCB 2I2RE 5AEQA 2LP2A 1XFZO 3LK1A 5FI2A 1YR5A 4YI8A 4A4CA 2LP3A 4IL1A 2KAXA 4YGAA 2CCMA 4GPLB 1C7VA 2LANA 1SCMB 1Z4HA 2BE6A 1PSBA 1K9KA 1M46A 1YVLA 2H8VA 2KQYA 3BOWA 3EVUA 1QVIZ 5CPVA 2K8MB 3I5FB 1CB1A 1M31A 2VRGA 4CFRA 3AKAA 1AUIB 3VROA 1K8UA 3ICBA 3IVTA 1W7JB 2FCDA 1TNQA 2JU0A 1PALA 1K93D 1CFDA 3DD4A 4IJ7A 3EK4A 4YGBB 2NXQA 3BQ3A 2MBXA 2WCBA 1BT6A 1S26D 2M9GA 1RTP1 2WCMA 3F45A 4OR9B 1QX7A 3I5GB 1MWNA 1CTRA 2KI6D 1ORGA 1DELA 1UUSA 3KO0A 4YBHB 4AQJA 1JFKA 3GK4X 4ORBB 4Q04A 1B47A 4JWQA 2K0JA 3AAJA 2OS8C 3VRNA 4GAOA 1F4OA 2B1UA 1QV0A 4ORAB 1J7RA 1DJZA 2KNEA 2NLNA 1DF0A 2M1KB 2Q4UA 3PM2A 3SG7A 1DJWA 1K90D 4P2YB 2ISDA 4PHMA 2KBMA 2CNPA 4PCWA 2ZKMX 1XFWO 1BR4B 1SW8A 2I7AA 1ZMZA 2F3YA 2LCPA 1JF0A 2LMTA 3BYAA 3CZ1A 3I5IC 2KI6C 2Y1NA 2NZ0A 1NX1A 2EGDA 4KYNA 2O5GA 4PE1A 3FE6A 1SL8A 5TNCA 3MSEB 5FYXA 2M1UA 4OVNF 2QEVA 1KSMA 1S5GZ 3UNWA 1T14A 3SG6A 5HL1A 3HX4A 3GK1A 1DJIA 4CFQA 2JWWA 4PDZA 4CPVA 2M7LA 4YGDB 2KDHA 5I94A 2JT8A 1U5IB 3R1VA 3O4XA 2QEHA 3FWCA 3OX6A 5CSNA 5PALA 4ETOA 1R2UA 1NYAA 2JT0A 1XO5A 2K7BA 4MZKA 4MBEA 1TNPA 1Y0VH 1NPQA 1BOCA 1XFVO 4FQTA 2L2CA 2JNFA 1CDPA 1J1EA 2GTEA 1SKTA 2L4IA 2NCPA 1PSRA 1AJ5A 1BR1B 3D75A 4GBAA 4JKTA 2K61A 4GUKA 1CDLA 1DJHA 1S36A 1K9UA 1EG4A 3A4UB 3O6BA 3O4YA 1KQMC 2Q91A 2MRDA
chains in the Genus database with same CATH topology
1G4YR 1BLQA 4GGFA 2HPSA 1XFUO 2EC6C 2PSRA 1K2HA 1XFXO 2MLFC 3PALA 1U5IA 2WCFA 4F0ZB 1XK4A 1WRKA 2JZIA 2R2IA 1NP8A 2H2KA 1YRUB 5ER5A 2LE9B 3TDUA 5AERA 2LLTA 1YVHA 2OTGC 4BY4A 1EJ3A 3GK2A 1J1DA 1KFUL 2AAOA 1OE9B 2L5XB 4MRXA 2BCXA 1B7TY 1QX2A 1KWOC 2L0PA 4I5KA 1JF2A 2BKIB 1BJFA 1UHKA 2AUCA 2PRUA 1CKKA 1J7PA 1FI5A 1N0YA 2KFGA 3JTDB 1KK8C 2JXCA 1CLMA 4NDDA 1CFCA 1IGVA 1H4BA 1DGUA 1NSHA 3BUWB 3BOWB 5I2LA 3OX5A 3CTNA 2O60A 1F4QA 3PLFB 1UHHA 1SY9A 1OMVA 2CBLA 3QRXA 4M2PA 4ZCUA 1Y6WA 2LMVA 1SCMC 1AVSA 2LVIA 1B8CA 1XYDA 3FWBA 1PULA 1QS7A 3I5FC 2D8NA 1NCZA 1BF5A 1TCFA 3D10A 3LK0A 3WHUB 1OZSA 1IH0A 1SK6D 1TCOB 3LLEA 5KSZA 1SCVA 3CR5X 3EKHA 2KSPA 3PN7C 3CZTX 4PHJA 5HLOA 1DJYA 1UHIA 4YRUA 4E68A 3NXAA 5HKZA 2LHLA 3KHEA 1OOJA 2LLSA 3I5GC 3RLZA 4OV2A 2KI4B 3TDZA 4AQIA 3PM8A 1IJ5A 1LA3A 2M97A 1DF0B 3EVVA 1KK7Z 1UHJA 1DVIA 1GGWA 4MVFA 5KTYA 3KPXA 2KGRA 4YI9A 3BUXB 1ZOTB 1FI6A 2SCPA 1CM1A 3KEVA 2LLUA 2JNXA 1E8AA 1RWYA 1W7IB 1MXLC 1OQPA 1L2OB 1TTXA 2LVJA 1XA5A 3FIAA 4L9MA 1K96A 4JPZB 5CSFA 1UWOA 2K2AA 2G2BA 4MEWA 1Y1AA 3KF9A 1X02A 3I5HB 1ZACA 1MXEA 1F55A 4HSZA 3TUYC 2JQ6A 4I5LB 4N1GA 3VRQA 2Y1MA 5DKQA 1KFXS 1VRKA 2M8UA 1QVIY 4GGFC 2BECA 1CNPA 1G8IA 1WLZA 3NSIA 3SG2A 4BY5A 3VRPA 1FPWA 1YUTA 4YGCB 2LHIA 2E6WA 4DRWA 1NIWA 2WC8A 4PALA 1LVCD 1XVJA 3DVJA 4FQOA 2PMYA 2K2FA 2OPOA 3OB2B 1FW4A 2JULA 2G9BA 3AAKA 4R1EA 1SL9A 3NSLA 2K7OA 5I2QA 1A75A 1NCXA 1LINA 1TOPA 2BL0C 3D0YB 1UURA 3EVRA 2KGBC 3TZ1A 1SRAA 2I18A 5CSJA 3C1VA 4PE4A 4DIRA 2HF5A 2ZRTA 1S1EA 3O2PA 4DCKA 2ZFDA 1KSOA 1UHNA 1SR6B 2GV5A 4HRHA 1QASA 1F71A 1NX2A 1S5GY 1Q80A 1OMDA 1LKJA 1YX8A 2K7DA 3CR2A 3WHTB 4UPGA 1DMOA 1GQMA 4P5OE 3JVTB 3SG3A 3D0YA 1S6IA 3AKBA 3LCPC 3WXAA 3JTDC 2FOTA 1B4CA 1MUXA 2QACA 1LXFC 1TNXA 4NDBA 1BODA 1CFFA 1OSAA 1QV1A 1MQ1A 2JTTA 2I94A 2LMUA 4QJ4B 1CDMA 3CS1A 3CWGA 5JOLA 2BBNA 2HETA 4FTGA 5JJGA 2LUXA 2MHHA 2KAVA 1V1FA 1QLKA 1RECA 3WNXB 2HQ8A 4XYNA 2FCEA 1JSAA 1QATA 1TN4A 1MHOA 2M7NA 1WDCC 1EG3A 4NDCA 1NCYA 2MAZA 1CLLA 3K21A 4MRYA 2IS9A 2DOQA 1QXPA 3BUMB 5G08A 1F54A 2P6BB 3O78A 4N1FA 2LUCA 1Y1UA 5I2OA 1N2DA 3EK7A 4DUQA 3CGAA 1SPYA 5HKYA 1R6PA 1ALVA 2CXJA 3PSRA 1PK0D 1A03A 1A2XA 1DJGA 4MSPA 3TS5B 2OTGB 4TNCA 3DVEA 3SJSA 4CIDA 2ZNEA 2ZRSA 2GGMA 2CTNA 3CR4X 3EKJA 4N5XA 5HKWA 2M3WA 4QJ5B 3IF7A 2GGZA 1NX3A 2E30A 2MLEC 2COLB 2LVKA 1UP5A 3SG4A 1KQVA 2M29A 3SIBA 1B9AA 1L2OC 4OKHA 2F33A 1SNLA 1B1GA 2F8PA 3DF0B 1KK8B 1RFJA 2L51A 1LA0A 1XFYO 1PVBA 3DVKA 2L50A 3I5HC 1S3PA 3BUOB 1IG5A 2KHNA 5AXIA 4A4BA 2AMIA 2JXLA 2BCBA 1FBVA 4M2QA 5HLVA 3ZNIA 4DS7A 2A4JA 2PVBA 1H8BA 1YRTB 3DVMA 5IBWA 3IQOA 4PE0A 5D69A 4ORCB 4PE7A 1TNWA 4CLNA 2F2OA 1IQ3A 1FF1A 1TRFA 1IJ6A 1C7WA 1NX0A 2L4HA 3BUNB 3PATA 1GJYA 1WY9A 3H4SE 1QIVA 2H61A 1RROA 1MF8B 5AANA 1EL4A 3DF0A 3PN7B 1QIWA 2Y5IA 1A75B 1J7OA 2MJWB 1PRWA 1BU3A 2K7CA 1DTLA 4XJKB 4MN0A 1D1OA 1XK4C 1M63B 1KK7Y 1RJVA 2PALA 3A8RA 4HRGA 2ZN8A 1JC2A 1CMFA 1TIZA 1GGZA 1IQ5A 3PFVA 1NUBA 1DGVA 1C07A 1IKUA 2JT3A 5DKRA 2BBMA 1AP4A 4ICBA 1ZFSA 1A29A 1J55A 1KFXL 4JQ0D 4MLWA 4YGEB 1S6CA 1J7QA 1QTXA 1B8RA 5I8NA 2WORA 1A4PA 2M0RA 2F3ZA 1DT7B 1YUSA 3IQQA 3LL8B 1SR6C 1MR8A 4USLA 4XJKA 3OB1B 1BG1A 2LM5A 3OHMB 3NSOA 2OS8B 1SBJA 1G33A 1JUOA 4C0JA 1B8LA 2V53A 2L98A 3ZWHA 3TUYB 5K89A 1IRJA 1CLBA 3JVTC 4PHKA 2KFHA 2JPTA 3BXKA 5DKNA 1F70A 2JTZA 2BE4A 3EK8A 2KAYA 2RGIA 5B8IB 1SMGA 2Y4QA 3I5IB 3VRRA 4PHNA 4I5JA 3M0WA 3NSKA 4HREE 1CFPA 1CMGA 1AJ4A 4D1EA 2BCAA 1K95A 1YURA 1SL7A 4I5NB 1SYMA 5F6TA 1B7TZ 4C0LA 5BPJA 1OMRA 1DJXA 1KCYA 2JRFA 2WNDA 3TDIA 1ZUZA 2NCOA 2KYCA 5GQQC 2WOSA 3OP0A 2M49B 1AHRA 1NWDA 2LAPA 1JWDA 2BKHB 1IWQA 2F2PA 2ZN9A 4U8DA 1Y1XA 2BL0B 2LC5A 5D7FA 3VGOA 1KFUS 2LNKA 5KU1A 1HT9A 2CT9A 5AFPA 4WQ2A 5HYDA 1WRLA 3FS7A 2LV7A 2PASA 1ALWA 1M45A 4GFTA 1EH2A 1M39A 4WRIA 1WRZA 5ER4X 2KBIA 4GGNA 2WCEA 4NQGA 1YUUA 3SG5A 1HQVA 1KQMB 2KOTA 3TS5C 2ZNDA 1AK8A 1S6JA 2EC6B 1CM4A 3GOFA 4MZJA 2JOJA 1JBAA 3RM1A 1QLSA 4QJ3B 2L2EA 4C0KA 4AOMA 2H61C 2KYFA 1QX5B 3SIAA 1WLMA 2LVVA 2KI4C 4ZCVA 5CSIA 1BMOA 1YX7A 2SASA 1L7ZA 1ODBA 4GNKB 1K9PA 1QJTA 2FJUB 5J3XA 2QPTA 4WQ3A 1JFJA 4M2OA 3HCMA 1KWOB 1V1GA 1OZOA 1YTZC 4MZLA 2TN4A 2HQWA 2MA2A 1RK9A 3CLNA 3E3RA 1F8HA 1PVAA 2EHBA 1K94A 2JC2A 4OCIA 1N65A 2KFFA 1EXRA 2KQ6A 1CDNA 1WDCB 2I2RE 5AEQA 2LP2A 1XFZO 3LK1A 1YR5A 4YI8A 4A4CA 2LP3A 4IL1A 2KAXA 4YGAA 2CCMA 4GPLB 1C7VA 2LANA 2BE6A 1SCMB 1PSBA 1K9KA 1M46A 1YVLA 2KQYA 3EVUA 3BOWA 5CPVA 1QVIZ 2K8MB 3I5FB 1CB1A 1M31A 2VRGA 4CFRA 3AKAA 1AUIB 3VROA 1K8UA 3ICBA 1W7JB 2FCDA 1TNQA 2JU0A 1PALA 1K93D 1CFDA 3DD4A 3EK4A 4YGBB 2NXQA 3BQ3A 2MBXA 2WCBA 1BT6A 1S26D 2M9GA 1RTP1 3F45A 4OR9B 1QX7A 3I5GB 1MWNA 1CTRA 2KI6D 3KO0A 1UUSA 4YBHB 4AQJA 1JFKA 3GK4X 4ORBB 4Q04A 1B47A 4JWQA 2K0JA 3AAJA 2OS8C 3VRNA 4GAOA 1F4OA 2B1UA 1QV0A 4ORAB 1J7RA 1DJZA 2KNEA 2NLNA 1DF0A 2M1KB 2Q4UA 3SG7A 1DJWA 1K90D 4P2YB 2ISDA 4PHMA 2KBMA 2CNPA 4PCWA 2ZKMX 1XFWO 1BR4B 1SW8A 2I7AA 1ZMZA 2F3YA 2LCPA 1JF0A 2LMTA 3BYAA 3I5IC 2KI6C 2Y1NA 2NZ0A 1NX1A 2EGDA 2O5GA 4PE1A 1SL8A 5TNCA 3MSEB 5FYXA 2M1UA 4OVNF 1KSMA 1S5GZ 3SG6A 3HX4A 3GK1A 1DJIA 4CFQA 2JWWA 4PDZA 4CPVA 2M7LA 4YGDB 2KDHA 2JT8A 1U5IB 3FWCA 3OX6A 5CSNA 5PALA 4ETOA 1R2UA 1NYAA 2JT0A 1XO5A 2K7BA 4MZKA 4MBEA 1TNPA 1Y0VH 1NPQA 1BOCA 1XFVO 2JNFA 1CDPA 1J1EA 1SKTA 2L4IA 2NCPA 1PSRA 1AJ5A 1BR1B 4GBAA 2K61A 4GUKA 1CDLA 1DJHA 1S36A 1K9UA 1EG4A 3A4UB 3O6BA 3O4YA 1KQMC 2Q91A 2MRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4Y R;  1BLQ A;  4GGF A;  2HPS A;  1XFU O;  2EC6 C;  2PSR A;  1K2H A;  1XFX O;  2MLF C;  3PAL A;  1U5I A;  2WCF A;  4F0Z B;  1XK4 A;  1WRK A;  2JZI A;  2R2I A;  1NP8 A;  2H2K A;  1YRU B;  5ER5 A;  2LE9 B;  3TDU A;  5AER A;  2LLT A;  1YVH A;  2OTG C;  4BY4 A;  1EJ3 A;  3GK2 A;  1J1D A;  1KFU L;  2AAO A;  1OE9 B;  2L5X B;  4MRX A;  2BCX A;  1B7T Y;  1QX2 A;  1KWO C;  2L0P A;  4I5K A;  1JF2 A;  2BKI B;  1BJF A;  1UHK A;  2AUC A;  2PRU A;  1CKK A;  1J7P A;  1FI5 A;  1N0Y A;  2KFG A;  3JTD B;  1KK8 C;  2JXC A;  1CLM A;  4NDD A;  1CFC A;  1IGV A;  1H4B A;  1DGU A;  1NSH A;  3BUW B;  3BOW B;  5I2L A;  3OX5 A;  3CTN A;  2O60 A;  1F4Q A;  3PLF B;  1UHH A;  1SY9 A;  1OMV A;  2CBL A;  3QRX A;  4M2P A;  4ZCU A;  1Y6W A;  2LMV A;  1SCM C;  1AVS A;  2LVI A;  1B8C A;  1XYD A;  3FWB A;  1PUL A;  1QS7 A;  3I5F C;  2D8N A;  1NCZ A;  1BF5 A;  1TCF A;  3D10 A;  3LK0 A;  3WHU B;  1OZS A;  1IH0 A;  1SK6 D;  1TCO B;  3LLE A;  5KSZ A;  1SCV A;  3CR5 X;  3EKH A;  2KSP A;  3PN7 C;  3CZT X;  4PHJ A;  5HLO A;  1DJY A;  1UHI A;  4YRU A;  4E68 A;  3NXA A;  5HKZ A;  2LHL A;  3KHE A;  1OOJ A;  2LLS A;  3I5G C;  3RLZ A;  4OV2 A;  2KI4 B;  3TDZ A;  4AQI A;  3PM8 A;  1IJ5 A;  1LA3 A;  2M97 A;  1DF0 B;  3EVV A;  1KK7 Z;  1UHJ A;  1DVI A;  1GGW A;  4MVF A;  5KTY A;  3KPX A;  2KGR A;  4YI9 A;  3BUX B;  1ZOT B;  1FI6 A;  2SCP A;  1CM1 A;  3KEV A;  2LLU A;  2JNX A;  1E8A A;  1RWY A;  1W7I B;  1MXL C;  1OQP A;  1L2O B;  1TTX A;  2LVJ A;  1XA5 A;  3FIA A;  4L9M A;  1K96 A;  4JPZ B;  5CSF A;  1UWO A;  2K2A A;  2G2B A;  4MEW A;  1Y1A A;  3KF9 A;  1X02 A;  3I5H B;  1ZAC A;  1MXE A;  1F55 A;  4HSZ A;  3TUY C;  2JQ6 A;  4I5L B;  4N1G A;  3VRQ A;  2Y1M A;  5DKQ A;  1KFX S;  1VRK A;  2M8U A;  1QVI Y;  4GGF C;  2BEC A;  1CNP A;  1G8I A;  1WLZ A;  3NSI A;  3SG2 A;  4BY5 A;  3VRP A;  1FPW A;  1YUT A;  4YGC B;  2LHI A;  2E6W A;  4DRW A;  1NIW A;  2WC8 A;  4PAL A;  1LVC D;  1XVJ A;  3DVJ A;  4FQO A;  2PMY A;  2K2F A;  2OPO A;  3OB2 B;  1FW4 A;  2JUL A;  2G9B A;  3AAK A;  4R1E A;  1SL9 A;  3NSL A;  2K7O A;  5I2Q A;  1A75 A;  1NCX A;  1LIN A;  1TOP A;  2BL0 C;  3D0Y B;  1UUR A;  3EVR A;  2KGB C;  3TZ1 A;  1SRA A;  2I18 A;  5CSJ A;  3C1V A;  4PE4 A;  4DIR A;  2HF5 A;  2ZRT A;  1S1E A;  3O2P A;  4DCK A;  2ZFD A;  1KSO A;  1UHN A;  1SR6 B;  2GV5 A;  4HRH A;  1QAS A;  1F71 A;  1NX2 A;  1S5G Y;  1Q80 A;  1OMD A;  1LKJ A;  1YX8 A;  2K7D A;  3CR2 A;  3WHT B;  4UPG A;  1DMO A;  1GQM A;  4P5O E;  3JVT B;  3SG3 A;  3D0Y A;  1S6I A;  3AKB A;  3LCP C;  3WXA A;  3JTD C;  2FOT A;  1B4C A;  1MUX A;  2QAC A;  1LXF C;  1TNX A;  4NDB A;  1BOD A;  1CFF A;  1OSA A;  1QV1 A;  1MQ1 A;  2JTT A;  2I94 A;  2LMU A;  4QJ4 B;  1CDM A;  3CS1 A;  3CWG A;  5JOL A;  2BBN A;  2HET A;  4FTG A;  5JJG A;  2LUX A;  2MHH A;  2KAV A;  1V1F A;  1QLK A;  1REC A;  3WNX B;  2HQ8 A;  4XYN A;  2FCE A;  1JSA A;  1QAT A;  1TN4 A;  1MHO A;  2M7N A;  1WDC C;  1EG3 A;  4NDC A;  1NCY A;  2MAZ A;  1CLL A;  3K21 A;  4MRY A;  2IS9 A;  2DOQ A;  1QXP A;  3BUM B;  5G08 A;  1F54 A;  2P6B B;  3O78 A;  4N1F A;  2LUC A;  1Y1U A;  5I2O A;  1N2D A;  3EK7 A;  4DUQ A;  3CGA A;  1SPY A;  5HKY A;  1R6P A;  1ALV A;  2CXJ A;  3PSR A;  1PK0 D;  1A03 A;  1A2X A;  1DJG A;  4MSP A;  3TS5 B;  2OTG B;  4TNC A;  3DVE A;  3SJS A;  4CID A;  2ZNE A;  2ZRS A;  2GGM A;  2CTN A;  3CR4 X;  3EKJ A;  4N5X A;  5HKW A;  2M3W A;  4QJ5 B;  3IF7 A;  2GGZ A;  1NX3 A;  2E30 A;  2MLE C;  2COL B;  2LVK A;  1UP5 A;  3SG4 A;  1KQV A;  2M29 A;  3SIB A;  1B9A A;  1L2O C;  4OKH A;  2F33 A;  1SNL A;  1B1G A;  2F8P A;  3DF0 B;  1KK8 B;  1RFJ A;  2L51 A;  1LA0 A;  1XFY O;  1PVB A;  3DVK A;  2L50 A;  3I5H C;  1S3P A;  3BUO B;  1IG5 A;  2KHN A;  5AXI A;  4A4B A;  2AMI A;  2JXL A;  2BCB A;  1FBV A;  4M2Q A;  5HLV A;  3ZNI A;  4DS7 A;  2A4J A;  2PVB A;  1H8B A;  1YRT B;  3DVM A;  5IBW A;  3IQO A;  4PE0 A;  5D69 A;  4ORC B;  4PE7 A;  1TNW A;  4CLN A;  2F2O A;  1IQ3 A;  1FF1 A;  1TRF A;  1IJ6 A;  1C7W A;  1NX0 A;  2L4H A;  3BUN B;  3PAT A;  1GJY A;  1WY9 A;  3H4S E;  1QIV A;  2H61 A;  1RRO A;  1MF8 B;  5AAN A;  1EL4 A;  3DF0 A;  3PN7 B;  1QIW A;  2Y5I A;  1A75 B;  1J7O A;  2MJW B;  1PRW A;  1BU3 A;  2K7C A;  1DTL A;  4XJK B;  4MN0 A;  1D1O A;  1XK4 C;  1M63 B;  1KK7 Y;  1RJV A;  2PAL A;  3A8R A;  4HRG A;  2ZN8 A;  1JC2 A;  1CMF A;  1TIZ A;  1GGZ A;  1IQ5 A;  3PFV A;  1NUB A;  1DGV A;  1C07 A;  1IKU A;  2JT3 A;  5DKR A;  2BBM A;  1AP4 A;  4ICB A;  1ZFS A;  1A29 A;  1J55 A;  1KFX L;  4JQ0 D;  4MLW A;  4YGE B;  1S6C A;  1J7Q A;  1QTX A;  1B8R A;  5I8N A;  2WOR A;  1A4P A;  2M0R A;  2F3Z A;  1DT7 B;  1YUS A;  3IQQ A;  3LL8 B;  1SR6 C;  1MR8 A;  4USL A;  4XJK A;  3OB1 B;  1BG1 A;  2LM5 A;  3OHM B;  3NSO A;  2OS8 B;  1SBJ A;  1G33 A;  1JUO A;  4C0J A;  1B8L A;  2V53 A;  2L98 A;  3ZWH A;  3TUY B;  5K89 A;  1IRJ A;  1CLB A;  3JVT C;  4PHK A;  2KFH A;  2JPT A;  3BXK A;  5DKN A;  1F70 A;  2JTZ A;  2BE4 A;  3EK8 A;  2KAY A;  2RGI A;  5B8I B;  1SMG A;  2Y4Q A;  3I5I B;  3VRR A;  4PHN A;  4I5J A;  3M0W A;  3NSK A;  4HRE E;  1CFP A;  1CMG A;  1AJ4 A;  4D1E A;  2BCA A;  1K95 A;  1YUR A;  1SL7 A;  4I5N B;  1SYM A;  5F6T A;  1B7T Z;  4C0L A;  5BPJ A;  1OMR A;  1DJX A;  1KCY A;  2JRF A;  2WND A;  3TDI A;  1ZUZ A;  2NCO A;  2KYC A;  5GQQ C;  2WOS A;  3OP0 A;  2M49 B;  1AHR A;  1NWD A;  2LAP A;  1JWD A;  2BKH B;  1IWQ A;  2F2P A;  2ZN9 A;  4U8D A;  1Y1X A;  2BL0 B;  2LC5 A;  5D7F A;  3VGO A;  1KFU S;  2LNK A;  5KU1 A;  1HT9 A;  2CT9 A;  5AFP A;  4WQ2 A;  5HYD A;  1WRL A;  3FS7 A;  2LV7 A;  2PAS A;  1ALW A;  1M45 A;  4GFT A;  1EH2 A;  1M39 A;  4WRI A;  1WRZ A;  5ER4 X;  2KBI A;  4GGN A;  2WCE A;  4NQG A;  1YUU A;  3SG5 A;  1HQV A;  1KQM B;  2KOT A;  3TS5 C;  2ZND A;  1AK8 A;  1S6J A;  2EC6 B;  1CM4 A;  3GOF A;  4MZJ A;  2JOJ A;  1JBA A;  3RM1 A;  1QLS A;  4QJ3 B;  2L2E A;  4C0K A;  4AOM A;  2H61 C;  2KYF A;  1QX5 B;  3SIA A;  1WLM A;  2LVV A;  2KI4 C;  4ZCV A;  5CSI A;  1BMO A;  1YX7 A;  2SAS A;  1L7Z A;  1ODB A;  4GNK B;  1K9P A;  1QJT A;  2FJU B;  5J3X A;  2QPT A;  4WQ3 A;  1JFJ A;  4M2O A;  3HCM A;  1KWO B;  1V1G A;  1OZO A;  1YTZ C;  4MZL A;  2TN4 A;  2HQW A;  2MA2 A;  1RK9 A;  3CLN A;  3E3R A;  1F8H A;  1PVA A;  2EHB A;  1K94 A;  2JC2 A;  4OCI A;  1N65 A;  2KFF A;  1EXR A;  2KQ6 A;  1CDN A;  1WDC B;  2I2R E;  5AEQ A;  2LP2 A;  1XFZ O;  3LK1 A;  1YR5 A;  4YI8 A;  4A4C A;  2LP3 A;  4IL1 A;  2KAX A;  4YGA A;  2CCM A;  4GPL B;  1C7V A;  2LAN A;  2BE6 A;  1SCM B;  1PSB A;  1K9K A;  1M46 A;  1YVL A;  2KQY A;  3EVU A;  3BOW A;  5CPV A;  1QVI Z;  2K8M B;  3I5F B;  1CB1 A;  1M31 A;  2VRG A;  4CFR A;  3AKA A;  1AUI B;  3VRO A;  1K8U A;  3ICB A;  1W7J B;  2FCD A;  1TNQ A;  2JU0 A;  1PAL A;  1K93 D;  1CFD A;  3DD4 A;  3EK4 A;  4YGB B;  2NXQ A;  3BQ3 A;  2MBX A;  2WCB A;  1BT6 A;  1S26 D;  2M9G A;  1RTP 1;  3F45 A;  4OR9 B;  1QX7 A;  3I5G B;  1MWN A;  1CTR A;  2KI6 D;  3KO0 A;  1UUS A;  4YBH B;  4AQJ A;  1JFK A;  3GK4 X;  4ORB B;  4Q04 A;  1B47 A;  4JWQ A;  2K0J A;  3AAJ A;  2OS8 C;  3VRN A;  4GAO A;  1F4O A;  2B1U A;  1QV0 A;  4ORA B;  1J7R A;  1DJZ A;  2KNE A;  2NLN A;  1DF0 A;  2M1K B;  2Q4U A;  3SG7 A;  1DJW A;  1K90 D;  4P2Y B;  2ISD A;  4PHM A;  2KBM A;  2CNP A;  4PCW A;  2ZKM X;  1XFW O;  1BR4 B;  1SW8 A;  2I7A A;  1ZMZ A;  2F3Y A;  2LCP A;  1JF0 A;  2LMT A;  3BYA A;  3I5I C;  2KI6 C;  2Y1N A;  2NZ0 A;  1NX1 A;  2EGD A;  2O5G A;  4PE1 A;  1SL8 A;  5TNC A;  3MSE B;  5FYX A;  2M1U A;  4OVN F;  1KSM A;  1S5G Z;  3SG6 A;  3HX4 A;  3GK1 A;  1DJI A;  4CFQ A;  2JWW A;  4PDZ A;  4CPV A;  2M7L A;  4YGD B;  2KDH A;  2JT8 A;  1U5I B;  3FWC A;  3OX6 A;  5CSN A;  5PAL A;  4ETO A;  1R2U A;  1NYA A;  2JT0 A;  1XO5 A;  2K7B A;  4MZK A;  4MBE A;  1TNP A;  1Y0V H;  1NPQ A;  1BOC A;  1XFV O;  2JNF A;  1CDP A;  1J1E A;  1SKT A;  2L4I A;  2NCP A;  1PSR A;  1AJ5 A;  1BR1 B;  4GBA A;  2K61 A;  4GUK A;  1CDL A;  1DJH A;  1S36 A;  1K9U A;  1EG4 A;  3A4U B;  3O6B A;  3O4Y A;  1KQM C;  2Q91 A;  2MRD A; 
#chains in the Genus database with same CATH topology
 1G4Y R;  1BLQ A;  4GGF A;  2HPS A;  1XFU O;  2EC6 C;  2PSR A;  1K2H A;  1XFX O;  2MLF C;  3K1E A;  3PAL A;  1U5I A;  2WCF A;  4F0Z B;  1XK4 A;  1WRK A;  2JZI A;  2R2I A;  1NP8 A;  2H2K A;  1YRU B;  5ER5 A;  2LE9 B;  3TDU A;  5AER A;  2LLT A;  2BAP A;  1YVH A;  2OTG C;  4BY4 A;  1EJ3 A;  3GK2 A;  1J1D A;  1KFU L;  2AAO A;  1OE9 B;  2L5X B;  3BFB A;  4MRX A;  2BCX A;  2PYQ A;  1B7T Y;  1C3Y A;  1QX2 A;  1KWO C;  2L0P A;  4I5K A;  3FE9 A;  1JF2 A;  2BKI B;  3SS3 A;  1BJF A;  1UHK A;  2AUC A;  2PRU A;  1CKK A;  1J7P A;  1FI5 A;  3BFH A;  1N0Y A;  2KFG A;  3JTD B;  1KK8 C;  2JXC A;  1CLM A;  4NDD A;  1CFC A;  3L47 A;  3CZ2 A;  1IGV A;  1H4B A;  1DGU A;  1NSH A;  3BUW B;  3BOW B;  5I2L A;  3OX5 A;  3CTN A;  2O60 A;  1F4Q A;  3PLF B;  4INX A;  1UHH A;  1SY9 A;  1OMV A;  2CBL A;  3QRX A;  4M2P A;  4ZCU A;  1Y6W A;  2LMV A;  1SCM C;  1AVS A;  2LVI A;  1B8C A;  1XYD A;  3FWB A;  1PUL A;  1QS7 A;  3I5F C;  2D8N A;  1NCZ A;  1BF5 A;  1TCF A;  3D10 A;  3LK0 A;  3CDN A;  3WHU B;  1OZS A;  3CYZ A;  1IH0 A;  1SK6 D;  1TCO B;  2WCJ A;  3LLE A;  5KSZ A;  1SCV A;  3CR5 X;  3EKH A;  2KSP A;  3PN7 C;  3CZT X;  4PHJ A;  5HLO A;  1DJY A;  1UHI A;  4YRU A;  4E68 A;  3NXA A;  5HKZ A;  2LHL A;  3KHE A;  1OOJ A;  2LLS A;  3I5G C;  3RLZ A;  4OV2 A;  2KI4 B;  3TDZ A;  4AQI A;  3PM8 A;  1IJ5 A;  1LA3 A;  2M97 A;  1DF0 B;  3EVV A;  1KK7 Z;  1UHJ A;  1DVI A;  1GGW A;  4MVF A;  3DYE A;  3OGN A;  3KPX A;  5KTY A;  2KGR A;  3CZ0 A;  4YI9 A;  3BUX B;  1ZOT B;  4OZD A;  1FI6 A;  2SCP A;  1CM1 A;  3KEV A;  2LLU A;  2JNX A;  1E8A A;  1RWY A;  1W7I B;  1MXL C;  1OQP A;  1L2O B;  3B7A A;  1TTX A;  3DZT A;  2LVJ A;  1XA5 A;  3FIA A;  4L9M A;  1K96 A;  4JPZ B;  4INW A;  5CSF A;  1UWO A;  2K2A A;  2G2B A;  4MEW A;  1Y1A A;  3KF9 A;  1X02 A;  3I5H B;  1ZAC A;  3SS4 A;  1MXE A;  1F55 A;  4HSZ A;  3TUY C;  2JQ6 A;  4I5L B;  4N1G A;  3VRQ A;  2Y1M A;  5DKQ A;  1KFX S;  1VRK A;  2M8U A;  1C3Z A;  1QVI Y;  4GGF C;  2BEC A;  1CNP A;  1G8I A;  1WLZ A;  3NSI A;  3VB1 A;  3SG2 A;  4BY5 A;  3VRP A;  1FPW A;  1YUT A;  4YGC B;  2LHI A;  2E6W A;  4DRW A;  1NIW A;  2WC8 A;  4PAL A;  1LVC D;  3S0A A;  1XVJ A;  3DVJ A;  4FQO A;  2PMY A;  2K2F A;  2OPO A;  1TWO A;  3OB2 B;  1FW4 A;  2JUL A;  2G9B A;  3AAK A;  4R1E A;  1SL9 A;  3NSL A;  2K7O A;  3D77 A;  1A75 A;  1NCX A;  1LIN A;  1TOP A;  5I2Q A;  2BL0 C;  3D0Y B;  1UUR A;  3EVR A;  2KGB C;  2QDI A;  4PT1 A;  1DQE A;  3TZ1 A;  1SRA A;  2I18 A;  5CSJ A;  3C1V A;  4PE4 A;  4DIR A;  2HF5 A;  2ZRT A;  1S1E A;  3O2P A;  4DCK A;  2ZFD A;  1KSO A;  1UHN A;  1SR6 B;  2GV5 A;  2YGU A;  5D3O A;  3B87 A;  4HRH A;  1GM0 A;  1OOG A;  1QAS A;  1F71 A;  1IIO A;  1NX2 A;  1QWV A;  1Q80 A;  1OMD A;  1LKJ A;  1S5G Y;  1YX8 A;  2K7D A;  3CR2 A;  3WHT B;  4UPG A;  1GQM A;  1DMO A;  4P5O E;  3JVT B;  3SG3 A;  3D0Y A;  1S6I A;  3AKB A;  3LCP C;  5DIC A;  3JTD C;  2FOT A;  3WXA A;  3S0F A;  1MUX A;  2QAC A;  1B4C A;  1LXF C;  1TNX A;  4NDB A;  1BOD A;  1CFF A;  1OSA A;  1QV1 A;  1MQ1 A;  2JTT A;  2WCK A;  2I94 A;  2LMU A;  3OBV A;  1CDM A;  3CS1 A;  3CWG A;  3L4L A;  5JOL A;  4QJ4 B;  2BBN A;  2HET A;  4FTG A;  5JJG A;  2LUX A;  2MHH A;  2KAV A;  1V1F A;  1QLK A;  1REC A;  3WNX B;  2HQ8 A;  4XYN A;  2FCE A;  2KPH A;  3R1O A;  3S0E A;  1JSA A;  1QAT A;  1TN4 A;  1MHO A;  2M7N A;  1WDC C;  1EG3 A;  4NDC A;  1NCY A;  2MAZ A;  1CLL A;  3K21 A;  4MRY A;  2IS9 A;  3B88 A;  2DOQ A;  1QXP A;  3BJH A;  3BUM B;  5G08 A;  2P6B B;  1F54 A;  3O78 A;  4N1F A;  2LUC A;  1Y1U A;  5I2O A;  1N2D A;  3EK7 A;  4DUQ A;  3CGA A;  1SPY A;  5HKY A;  1R6P A;  1ALV A;  2CXJ A;  3D78 A;  3PSR A;  1PK0 D;  1A03 A;  1A2X A;  1DJG A;  4MSP A;  3TS5 B;  2OTG B;  4TNC A;  3DVE A;  5FI7 A;  1SSE B;  3SJS A;  4CID A;  2ZNE A;  2ZRS A;  2GGM A;  2CTN A;  3CR4 X;  2JPO A;  3EKJ A;  4N5X A;  5HKW A;  2M3W A;  4F7F A;  4QJ5 B;  3IF7 A;  2WC5 A;  1DC1 A;  2GGZ A;  1NX3 A;  2E30 A;  2QEB A;  2MLE C;  2COL B;  2LVK A;  1UP5 A;  3SG4 A;  1KQV A;  2M29 A;  3SIB A;  1B9A A;  1L2O C;  2FJY A;  2BNX A;  2F33 A;  3NHI A;  4OKH A;  3V2L A;  1SNL A;  1B1G A;  2F8P A;  3DF0 B;  3S0B A;  1KK8 B;  1RFJ A;  2ERB A;  2L51 A;  1LA0 A;  1XFY O;  1PVB A;  3DVK A;  2L50 A;  3I5H C;  1S3P A;  3BUO B;  3PJI A;  1IG5 A;  2KHN A;  5AXI A;  4A4B A;  2AMI A;  2JXL A;  2BCB A;  1FBV A;  4M2Q A;  5HLV A;  3ZNI A;  4DS7 A;  2A4J A;  2PVB A;  1H8B A;  1YRT B;  3DVM A;  5IBW A;  3IQO A;  4PE0 A;  2P71 A;  5D69 A;  4ORC B;  4PE7 A;  1TNW A;  4CLN A;  2F2O A;  4JD9 A;  3S0G A;  1IQ3 A;  1FF1 A;  1TRF A;  3D76 A;  1IJ6 A;  1C7W A;  1NX0 A;  2L4H A;  3BUN B;  3PAT A;  1GJY A;  1WY9 A;  3H4S E;  1QIV A;  2H61 A;  1RRO A;  1MF8 B;  5AAN A;  3S0D A;  1EL4 A;  3DF0 A;  3PN7 B;  1QIW A;  2Y5I A;  1A75 B;  1J7O A;  2MJW B;  1PRW A;  1BU3 A;  2K7C A;  1DTL A;  4XJK B;  4MN0 A;  2KLD A;  3SS5 A;  1D1O A;  1XK4 C;  1M63 B;  1KK7 Y;  1RJV A;  2PAL A;  2WCH A;  3A8R A;  4HRG A;  2ZN8 A;  1OW4 A;  1JC2 A;  1CMF A;  1Z2C B;  1TIZ A;  1GGZ A;  1IQ5 A;  3PFV A;  1NUB A;  1DGV A;  1C07 A;  2WCL A;  1IKU A;  2JT3 A;  5DKR A;  2BBM A;  1OOH A;  1AP4 A;  4ICB A;  5EL2 A;  1ZFS A;  1A29 A;  1J55 A;  1KFX L;  4JQ0 D;  4MLW A;  4YGE B;  1S6C A;  1J7Q A;  1QTX A;  1W9Z A;  3D74 A;  1B8R A;  5I8N A;  2WOR A;  1A4P A;  2M0R A;  2P70 A;  2L5Y A;  2F3Z A;  3NGV A;  3B86 A;  1YUS A;  3R72 A;  3IQQ A;  3LL8 B;  1SR6 C;  1MR8 A;  1DT7 B;  4USL A;  4XJK A;  3OB1 B;  1BG1 A;  2LM5 A;  3OHM B;  3D73 A;  2OS8 B;  3NSO A;  1SBJ A;  1G33 A;  3EG5 B;  3UO9 A;  1JUO A;  4C0J A;  1B8L A;  3CAB A;  2V53 A;  1TUJ A;  2K60 A;  2L98 A;  3ZWH A;  3TUY B;  1P28 A;  5K89 A;  1IRJ A;  1CLB A;  3JVT C;  1OOF A;  2KFH A;  4PHK A;  2WC6 A;  2JPT A;  3BXK A;  5DKN A;  1F70 A;  2JTZ A;  3DXL A;  2BE4 A;  3EK8 A;  3B6X A;  3RZS A;  2KAY A;  2RGI A;  5B8I B;  1SMG A;  2Y4Q A;  3I5I B;  3VRR A;  4PHN A;  4I5J A;  3M0W A;  3NSK A;  4HRE E;  1CFP A;  1CMG A;  1AJ4 A;  4D1E A;  2BCA A;  1K95 A;  1YUR A;  1SL7 A;  4I5N B;  1SYM A;  3N7H A;  1B7T Z;  3NHT A;  5F6T A;  4C0L A;  1OMR A;  5BPJ A;  1DJX A;  1KCY A;  1LS8 A;  2JRF A;  2WND A;  3TDI A;  1ZUZ A;  2NCO A;  2KYC A;  3QME A;  2WOS A;  3OP0 A;  2KLE A;  2M49 B;  5FI6 A;  5GQQ C;  1AHR A;  1NWD A;  2LAP A;  1JWD A;  2BKH B;  1IWQ A;  3DY9 A;  2F2P A;  2ZN9 A;  4U8D A;  1Y1X A;  2BL0 B;  2LC5 A;  5D7F A;  3VGO A;  1KFU S;  1OOI X;  2LNK A;  5KU1 A;  1HT9 A;  2CT9 A;  1DEK A;  5AFP A;  3FE8 A;  3Q8I A;  4WQ2 A;  5HYD A;  1WRL A;  3FS7 A;  2LV7 A;  3L4A A;  2PAS A;  1ALW A;  1M45 A;  4GFT A;  1EH2 A;  1M39 A;  4WRI A;  1WRZ A;  5ER4 X;  2KBI A;  4GGN A;  2WCE A;  4NQG A;  1YUU A;  3SG5 A;  1HQV A;  1KQM B;  2KOT A;  3TS5 C;  2ZND A;  1AK8 A;  1S6J A;  2EC6 B;  1CM4 A;  3GOF A;  4MZJ A;  2JOJ A;  1JBA A;  3RM1 A;  3BFA A;  3R1P A;  1QLS A;  4QJ3 B;  2L2E A;  4C0K A;  4AOM A;  2H61 C;  2KYF A;  1QX5 B;  3SIA A;  1WLM A;  2LVV A;  2KI4 C;  4ZCV A;  5CSI A;  1BMO A;  1YX7 A;  2SAS A;  1L7Z A;  1ODB A;  4GNK B;  1K9P A;  1TUZ A;  1QJT A;  2FJU B;  5J3X A;  1XFR A;  2QPT A;  4WQ3 A;  4M2O A;  1JFJ A;  3HCM A;  2PQL A;  1KWO B;  1V1G A;  1OZO A;  1YTZ C;  4MZL A;  2TN4 A;  2HQW A;  2MA2 A;  1RK9 A;  3CLN A;  3E3R A;  1F8H A;  1PVA A;  2EHB A;  1K94 A;  2JC2 A;  4OCI A;  1N65 A;  2KFF A;  1EXR A;  2KQ6 A;  2QEO A;  1CDN A;  1WDC B;  2I2R E;  5AEQ A;  2LP2 A;  1XFZ O;  3LK1 A;  5FI2 A;  1YR5 A;  4YI8 A;  4A4C A;  2LP3 A;  4IL1 A;  2KAX A;  4YGA A;  2CCM A;  4GPL B;  1C7V A;  2LAN A;  1SCM B;  1Z4H A;  2BE6 A;  1PSB A;  1K9K A;  1M46 A;  1YVL A;  2H8V A;  2KQY A;  3BOW A;  3EVU A;  1QVI Z;  5CPV A;  2K8M B;  3I5F B;  1CB1 A;  1M31 A;  2VRG A;  4CFR A;  3AKA A;  1AUI B;  3VRO A;  1K8U A;  3ICB A;  3IVT A;  1W7J B;  2FCD A;  1TNQ A;  2JU0 A;  1PAL A;  1K93 D;  1CFD A;  3DD4 A;  4IJ7 A;  3EK4 A;  4YGB B;  2NXQ A;  3BQ3 A;  2MBX A;  2WCB A;  1BT6 A;  1S26 D;  2M9G A;  1RTP 1;  2WCM A;  3F45 A;  4OR9 B;  1QX7 A;  3I5G B;  1MWN A;  1CTR A;  2KI6 D;  1ORG A;  1DEL A;  1UUS A;  3KO0 A;  4YBH B;  4AQJ A;  1JFK A;  3GK4 X;  4ORB B;  4Q04 A;  1B47 A;  4JWQ A;  2K0J A;  3AAJ A;  2OS8 C;  3VRN A;  4GAO A;  1F4O A;  2B1U A;  1QV0 A;  4ORA B;  1J7R A;  1DJZ A;  2KNE A;  2NLN A;  1DF0 A;  2M1K B;  2Q4U A;  3PM2 A;  3SG7 A;  1DJW A;  1K90 D;  4P2Y B;  2ISD A;  4PHM A;  2KBM A;  2CNP A;  4PCW A;  2ZKM X;  1XFW O;  1BR4 B;  1SW8 A;  2I7A A;  1ZMZ A;  2F3Y A;  2LCP A;  1JF0 A;  2LMT A;  3BYA A;  3CZ1 A;  3I5I C;  2KI6 C;  2Y1N A;  2NZ0 A;  1NX1 A;  2EGD A;  4KYN A;  2O5G A;  4PE1 A;  3FE6 A;  1SL8 A;  5TNC A;  3MSE B;  5FYX A;  2M1U A;  4OVN F;  2QEV A;  1KSM A;  1S5G Z;  3UNW A;  1T14 A;  3SG6 A;  5HL1 A;  3HX4 A;  3GK1 A;  1DJI A;  4CFQ A;  2JWW A;  4PDZ A;  4CPV A;  2M7L A;  4YGD B;  2KDH A;  5I94 A;  2JT8 A;  1U5I B;  3R1V A;  3O4X A;  2QEH A;  3FWC A;  3OX6 A;  5CSN A;  5PAL A;  4ETO A;  1R2U A;  1NYA A;  2JT0 A;  1XO5 A;  2K7B A;  4MZK A;  4MBE A;  1TNP A;  1Y0V H;  1NPQ A;  1BOC A;  1XFV O;  4FQT A;  2L2C A;  2JNF A;  1CDP A;  1J1E A;  2GTE A;  1SKT A;  2L4I A;  2NCP A;  1PSR A;  1AJ5 A;  1BR1 B;  3D75 A;  4GBA A;  4JKT A;  2K61 A;  4GUK A;  1CDL A;  1DJH A;  1S36 A;  1K9U A;  1EG4 A;  3A4U B;  3O6B A;  3O4Y A;  1KQM C;  2Q91 A;  2MRD A; 
#chains in the Genus database with same CATH homology
 1G4Y R;  1BLQ A;  4GGF A;  2HPS A;  1XFU O;  2EC6 C;  2PSR A;  1K2H A;  1XFX O;  2MLF C;  3PAL A;  1U5I A;  2WCF A;  4F0Z B;  1XK4 A;  1WRK A;  2JZI A;  2R2I A;  1NP8 A;  2H2K A;  1YRU B;  5ER5 A;  2LE9 B;  3TDU A;  5AER A;  2LLT A;  1YVH A;  2OTG C;  4BY4 A;  1EJ3 A;  3GK2 A;  1J1D A;  1KFU L;  2AAO A;  1OE9 B;  2L5X B;  4MRX A;  2BCX A;  1B7T Y;  1QX2 A;  1KWO C;  2L0P A;  4I5K A;  1JF2 A;  2BKI B;  1BJF A;  1UHK A;  2AUC A;  2PRU A;  1CKK A;  1J7P A;  1FI5 A;  1N0Y A;  2KFG A;  3JTD B;  1KK8 C;  2JXC A;  1CLM A;  4NDD A;  1CFC A;  1IGV A;  1H4B A;  1DGU A;  1NSH A;  3BUW B;  3BOW B;  5I2L A;  3OX5 A;  3CTN A;  2O60 A;  1F4Q A;  3PLF B;  1UHH A;  1SY9 A;  1OMV A;  2CBL A;  3QRX A;  4M2P A;  4ZCU A;  1Y6W A;  2LMV A;  1SCM C;  1AVS A;  2LVI A;  1B8C A;  1XYD A;  3FWB A;  1PUL A;  1QS7 A;  3I5F C;  2D8N A;  1NCZ A;  1BF5 A;  1TCF A;  3D10 A;  3LK0 A;  3WHU B;  1OZS A;  1IH0 A;  1SK6 D;  1TCO B;  3LLE A;  5KSZ A;  1SCV A;  3CR5 X;  3EKH A;  2KSP A;  3PN7 C;  3CZT X;  4PHJ A;  5HLO A;  1DJY A;  1UHI A;  4YRU A;  4E68 A;  3NXA A;  5HKZ A;  2LHL A;  3KHE A;  1OOJ A;  2LLS A;  3I5G C;  3RLZ A;  4OV2 A;  2KI4 B;  3TDZ A;  4AQI A;  3PM8 A;  1IJ5 A;  1LA3 A;  2M97 A;  1DF0 B;  3EVV A;  1KK7 Z;  1UHJ A;  1DVI A;  1GGW A;  4MVF A;  5KTY A;  3KPX A;  2KGR A;  4YI9 A;  3BUX B;  1ZOT B;  1FI6 A;  2SCP A;  1CM1 A;  3KEV A;  2LLU A;  2JNX A;  1E8A A;  1RWY A;  1W7I B;  1MXL C;  1OQP A;  1L2O B;  1TTX A;  2LVJ A;  1XA5 A;  3FIA A;  4L9M A;  1K96 A;  4JPZ B;  5CSF A;  1UWO A;  2K2A A;  2G2B A;  4MEW A;  1Y1A A;  3KF9 A;  1X02 A;  3I5H B;  1ZAC A;  1MXE A;  1F55 A;  4HSZ A;  3TUY C;  2JQ6 A;  4I5L B;  4N1G A;  3VRQ A;  2Y1M A;  5DKQ A;  1KFX S;  1VRK A;  2M8U A;  1QVI Y;  4GGF C;  2BEC A;  1CNP A;  1G8I A;  1WLZ A;  3NSI A;  3SG2 A;  4BY5 A;  3VRP A;  1FPW A;  1YUT A;  4YGC B;  2LHI A;  2E6W A;  4DRW A;  1NIW A;  2WC8 A;  4PAL A;  1LVC D;  1XVJ A;  3DVJ A;  4FQO A;  2PMY A;  2K2F A;  2OPO A;  3OB2 B;  1FW4 A;  2JUL A;  2G9B A;  3AAK A;  4R1E A;  1SL9 A;  3NSL A;  2K7O A;  5I2Q A;  1A75 A;  1NCX A;  1LIN A;  1TOP A;  2BL0 C;  3D0Y B;  1UUR A;  3EVR A;  2KGB C;  3TZ1 A;  1SRA A;  2I18 A;  5CSJ A;  3C1V A;  4PE4 A;  4DIR A;  2HF5 A;  2ZRT A;  1S1E A;  3O2P A;  4DCK A;  2ZFD A;  1KSO A;  1UHN A;  1SR6 B;  2GV5 A;  4HRH A;  1QAS A;  1F71 A;  1NX2 A;  1S5G Y;  1Q80 A;  1OMD A;  1LKJ A;  1YX8 A;  2K7D A;  3CR2 A;  3WHT B;  4UPG A;  1DMO A;  1GQM A;  4P5O E;  3JVT B;  3SG3 A;  3D0Y A;  1S6I A;  3AKB A;  3LCP C;  3WXA A;  3JTD C;  2FOT A;  1B4C A;  1MUX A;  2QAC A;  1LXF C;  1TNX A;  4NDB A;  1BOD A;  1CFF A;  1OSA A;  1QV1 A;  1MQ1 A;  2JTT A;  2I94 A;  2LMU A;  4QJ4 B;  1CDM A;  3CS1 A;  3CWG A;  5JOL A;  2BBN A;  2HET A;  4FTG A;  5JJG A;  2LUX A;  2MHH A;  2KAV A;  1V1F A;  1QLK A;  1REC A;  3WNX B;  2HQ8 A;  4XYN A;  2FCE A;  1JSA A;  1QAT A;  1TN4 A;  1MHO A;  2M7N A;  1WDC C;  1EG3 A;  4NDC A;  1NCY A;  2MAZ A;  1CLL A;  3K21 A;  4MRY A;  2IS9 A;  2DOQ A;  1QXP A;  3BUM B;  5G08 A;  1F54 A;  2P6B B;  3O78 A;  4N1F A;  2LUC A;  1Y1U A;  5I2O A;  1N2D A;  3EK7 A;  4DUQ A;  3CGA A;  1SPY A;  5HKY A;  1R6P A;  1ALV A;  2CXJ A;  3PSR A;  1PK0 D;  1A03 A;  1A2X A;  1DJG A;  4MSP A;  3TS5 B;  2OTG B;  4TNC A;  3DVE A;  3SJS A;  4CID A;  2ZNE A;  2ZRS A;  2GGM A;  2CTN A;  3CR4 X;  3EKJ A;  4N5X A;  5HKW A;  2M3W A;  4QJ5 B;  3IF7 A;  2GGZ A;  1NX3 A;  2E30 A;  2MLE C;  2COL B;  2LVK A;  1UP5 A;  3SG4 A;  1KQV A;  2M29 A;  3SIB A;  1B9A A;  1L2O C;  4OKH A;  2F33 A;  1SNL A;  1B1G A;  2F8P A;  3DF0 B;  1KK8 B;  1RFJ A;  2L51 A;  1LA0 A;  1XFY O;  1PVB A;  3DVK A;  2L50 A;  3I5H C;  1S3P A;  3BUO B;  1IG5 A;  2KHN A;  5AXI A;  4A4B A;  2AMI A;  2JXL A;  2BCB A;  1FBV A;  4M2Q A;  5HLV A;  3ZNI A;  4DS7 A;  2A4J A;  2PVB A;  1H8B A;  1YRT B;  3DVM A;  5IBW A;  3IQO A;  4PE0 A;  5D69 A;  4ORC B;  4PE7 A;  1TNW A;  4CLN A;  2F2O A;  1IQ3 A;  1FF1 A;  1TRF A;  1IJ6 A;  1C7W A;  1NX0 A;  2L4H A;  3BUN B;  3PAT A;  1GJY A;  1WY9 A;  3H4S E;  1QIV A;  2H61 A;  1RRO A;  1MF8 B;  5AAN A;  1EL4 A;  3DF0 A;  3PN7 B;  1QIW A;  2Y5I A;  1A75 B;  1J7O A;  2MJW B;  1PRW A;  1BU3 A;  2K7C A;  1DTL A;  4XJK B;  4MN0 A;  1D1O A;  1XK4 C;  1M63 B;  1KK7 Y;  1RJV A;  2PAL A;  3A8R A;  4HRG A;  2ZN8 A;  1JC2 A;  1CMF A;  1TIZ A;  1GGZ A;  1IQ5 A;  3PFV A;  1NUB A;  1DGV A;  1C07 A;  1IKU A;  2JT3 A;  5DKR A;  2BBM A;  1AP4 A;  4ICB A;  1ZFS A;  1A29 A;  1J55 A;  1KFX L;  4JQ0 D;  4MLW A;  4YGE B;  1S6C A;  1J7Q A;  1QTX A;  1B8R A;  5I8N A;  2WOR A;  1A4P A;  2M0R A;  2F3Z A;  1DT7 B;  1YUS A;  3IQQ A;  3LL8 B;  1SR6 C;  1MR8 A;  4USL A;  4XJK A;  3OB1 B;  1BG1 A;  2LM5 A;  3OHM B;  3NSO A;  2OS8 B;  1SBJ A;  1G33 A;  1JUO A;  4C0J A;  1B8L A;  2V53 A;  2L98 A;  3ZWH A;  3TUY B;  5K89 A;  1IRJ A;  1CLB A;  3JVT C;  4PHK A;  2KFH A;  2JPT A;  3BXK A;  5DKN A;  1F70 A;  2JTZ A;  2BE4 A;  3EK8 A;  2KAY A;  2RGI A;  5B8I B;  1SMG A;  2Y4Q A;  3I5I B;  3VRR A;  4PHN A;  4I5J A;  3M0W A;  3NSK A;  4HRE E;  1CFP A;  1CMG A;  1AJ4 A;  4D1E A;  2BCA A;  1K95 A;  1YUR A;  1SL7 A;  4I5N B;  1SYM A;  5F6T A;  1B7T Z;  4C0L A;  5BPJ A;  1OMR A;  1DJX A;  1KCY A;  2JRF A;  2WND A;  3TDI A;  1ZUZ A;  2NCO A;  2KYC A;  5GQQ C;  2WOS A;  3OP0 A;  2M49 B;  1AHR A;  1NWD A;  2LAP A;  1JWD A;  2BKH B;  1IWQ A;  2F2P A;  2ZN9 A;  4U8D A;  1Y1X A;  2BL0 B;  2LC5 A;  5D7F A;  3VGO A;  1KFU S;  2LNK A;  5KU1 A;  1HT9 A;  2CT9 A;  5AFP A;  4WQ2 A;  5HYD A;  1WRL A;  3FS7 A;  2LV7 A;  2PAS A;  1ALW A;  1M45 A;  4GFT A;  1EH2 A;  1M39 A;  4WRI A;  1WRZ A;  5ER4 X;  2KBI A;  4GGN A;  2WCE A;  4NQG A;  1YUU A;  3SG5 A;  1HQV A;  1KQM B;  2KOT A;  3TS5 C;  2ZND A;  1AK8 A;  1S6J A;  2EC6 B;  1CM4 A;  3GOF A;  4MZJ A;  2JOJ A;  1JBA A;  3RM1 A;  1QLS A;  4QJ3 B;  2L2E A;  4C0K A;  4AOM A;  2H61 C;  2KYF A;  1QX5 B;  3SIA A;  1WLM A;  2LVV A;  2KI4 C;  4ZCV A;  5CSI A;  1BMO A;  1YX7 A;  2SAS A;  1L7Z A;  1ODB A;  4GNK B;  1K9P A;  1QJT A;  2FJU B;  5J3X A;  2QPT A;  4WQ3 A;  1JFJ A;  4M2O A;  3HCM A;  1KWO B;  1V1G A;  1OZO A;  1YTZ C;  4MZL A;  2TN4 A;  2HQW A;  2MA2 A;  1RK9 A;  3CLN A;  3E3R A;  1F8H A;  1PVA A;  2EHB A;  1K94 A;  2JC2 A;  4OCI A;  1N65 A;  2KFF A;  1EXR A;  2KQ6 A;  1CDN A;  1WDC B;  2I2R E;  5AEQ A;  2LP2 A;  1XFZ O;  3LK1 A;  1YR5 A;  4YI8 A;  4A4C A;  2LP3 A;  4IL1 A;  2KAX A;  4YGA A;  2CCM A;  4GPL B;  1C7V A;  2LAN A;  2BE6 A;  1SCM B;  1PSB A;  1K9K A;  1M46 A;  1YVL A;  2KQY A;  3EVU A;  3BOW A;  5CPV A;  1QVI Z;  2K8M B;  3I5F B;  1CB1 A;  1M31 A;  2VRG A;  4CFR A;  3AKA A;  1AUI B;  3VRO A;  1K8U A;  3ICB A;  1W7J B;  2FCD A;  1TNQ A;  2JU0 A;  1PAL A;  1K93 D;  1CFD A;  3DD4 A;  3EK4 A;  4YGB B;  2NXQ A;  3BQ3 A;  2MBX A;  2WCB A;  1BT6 A;  1S26 D;  2M9G A;  1RTP 1;  3F45 A;  4OR9 B;  1QX7 A;  3I5G B;  1MWN A;  1CTR A;  2KI6 D;  3KO0 A;  1UUS A;  4YBH B;  4AQJ A;  1JFK A;  3GK4 X;  4ORB B;  4Q04 A;  1B47 A;  4JWQ A;  2K0J A;  3AAJ A;  2OS8 C;  3VRN A;  4GAO A;  1F4O A;  2B1U A;  1QV0 A;  4ORA B;  1J7R A;  1DJZ A;  2KNE A;  2NLN A;  1DF0 A;  2M1K B;  2Q4U A;  3SG7 A;  1DJW A;  1K90 D;  4P2Y B;  2ISD A;  4PHM A;  2KBM A;  2CNP A;  4PCW A;  2ZKM X;  1XFW O;  1BR4 B;  1SW8 A;  2I7A A;  1ZMZ A;  2F3Y A;  2LCP A;  1JF0 A;  2LMT A;  3BYA A;  3I5I C;  2KI6 C;  2Y1N A;  2NZ0 A;  1NX1 A;  2EGD A;  2O5G A;  4PE1 A;  1SL8 A;  5TNC A;  3MSE B;  5FYX A;  2M1U A;  4OVN F;  1KSM A;  1S5G Z;  3SG6 A;  3HX4 A;  3GK1 A;  1DJI A;  4CFQ A;  2JWW A;  4PDZ A;  4CPV A;  2M7L A;  4YGD B;  2KDH A;  2JT8 A;  1U5I B;  3FWC A;  3OX6 A;  5CSN A;  5PAL A;  4ETO A;  1R2U A;  1NYA A;  2JT0 A;  1XO5 A;  2K7B A;  4MZK A;  4MBE A;  1TNP A;  1Y0V H;  1NPQ A;  1BOC A;  1XFV O;  2JNF A;  1CDP A;  1J1E A;  1SKT A;  2L4I A;  2NCP A;  1PSR A;  1AJ5 A;  1BR1 B;  4GBA A;  2K61 A;  4GUK A;  1CDL A;  1DJH A;  1S36 A;  1K9U A;  1EG4 A;  3A4U B;  3O6B A;  3O4Y A;  1KQM C;  2Q91 A;  2MRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...