1NX3A

Calpain domain vi in complex with the inhibitor pd150606
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 63
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx3A00
5K89A 2M97A 4XJKA 4GNKB 1AHRA 1DJWA 4AOMA 3FIAA 2KSPA 3VRRA 4YRUA 2CXJA 2FCEA 3WHUB 5I2LA 3PN7B 3F45A 3SG3A 1NX2A 1A2XA 1DVIA 4FQOA 3SG2A 1TNWA 4AQJA 1YX8A 1TTXA 1SK6D 1S26D 2K0JA 1IG5A 2LC5A 1CFFA 4OKHA 1EG3A 1RJVA 1NP8A 1AVSA 2PALA 1OMVA 4ZCVA 4F0ZB 1PVAA 1C7WA 1HT9A 1XK4A 3I5HB 1CDNA 1F54A 2L98A 2BL0B 1MXLC 3HX4A 1ALVA 1S1EA 2JC2A 2NLNA 3GK1A 2LMTA 2JT0A 2M9GA 3IQOA 4MZLA 5HKWA 5AERA 1DF0B 2KI6C 2JPTA 4PE4A 3JTDB 1KFUL 2MBXA 3BUNB 3VRPA 1KK8B 3PN7C 1M46A 1A4PA 1E8AA 3E3RA 3LL8B 3PLFB 2JOJA 1EG4A 4ETOA 3DVEA 1RECA 2BKIB 1YTZC 2MHHA 2ISDA 1K96A 5HKZA 1SL8A 1SNLA 3MSEB 3NSLA 1CB1A 4M2QA 3O2PA 1QLSA 2EGDA 2IS9A 2E30A 2I18A 1A03A 1CDLA 3CGAA 1K9PA 2RGIA 4TNCA 3SG5A 1Q80A 1OSAA 1XFUO 4N1FA 1PSBA 4GBAA 1BT6A 1UP5A 2WCEA 1WLMA 2H61A 2PVBA 3ZNIA 1LINA 3I5HC 2HQ8A 1SL9A 4E68A 4MZJA 3NXAA 2BL0C 2H61C 1DF0A 3EVVA 1G4YR 1DT7B 1QTXA 3LK1A 2M7LA 4MRYA 2P6BB 2QACA 2WOSA 1B47A 1NCXA 3TDZA 2E6WA 1J7PA 1OOJA 2LUCA 1DJIA 1KK8C 4DIRA 3EVUA 4BY5A 1BOCA 1J55A 1NUBA 2KBIA 2HQWA 2PRUA 1S6JA 4PHMA 2K61A 1PALA 3DF0B 1MHOA 2CT9A 4USLA 1YRUB 1K8UA 1S6CA 4WRIA 1OE9B 1UURA 3GK2A 2KYFA 1U5IB 4PE7A 4AQIA 2M0RA 3OB2B 2CNPA 4I5KA 1SW8A 2KAXA 2OPOA 1FF1A 2Y4QA 1M31A 2KFHA 2MA2A 3EVRA 2BCAA 5KTYA 2O60A 1QX5B 4PE0A 2LVVA 1J1EA 3PATA 1F70A 1Y6WA 3KO0A 3BXKA 3KEVA 1N2DA 1K90D 4XJKB 3AAKA 1J7OA 1WRZA 3LLEA 1CM4A 2COLB 1WDCB 5KU1A 1KQMB 3EK8A 1KFXL 1ZOTB 1LA3A 1F4OA 2CBLA 2FOTA 2B1UA 5AXIA 1B8CA 5TNCA 1X02A 2M3WA 1A29A 1PVBA 1NYAA 1EXRA 4GAOA 4YGEB 1CFCA 1JFKA 1FW4A 3DF0A 4GFTA 5ER4X 1KQVA 2JU0A 1KSOA 2WNDA 3BOWB 4OCIA 4YI8A 1ODBA 3GK4X 3WNXB 3FWCA 1BF5A 2A4JA 1XA5A 4YGBB 1K9KA 2LNKA 4WQ2A 2LCPA 1JUOA 1PSRA 3TZ1A 3A4UB 3PALA 1SKTA 3JVTC 5DKRA 1S36A 4ZCUA 1IRJA 1GJYA 2CTNA 2LAPA 2KQYA 1CMFA 1PRWA 2EHBA 2JULA 2LLTA 3CR2A 4HRGA 1KSMA 1FI6A 1AJ4A 2KDHA 4C0JA 2JNXA 2ZN9A 1TNQA 1J7RA 4CPVA 2EC6C 2JRFA 1RFJA 1R6PA 2L5XB 1Y1XA 2JT3A 1M39A 1OMDA 1GGWA 5CSFA 2LP2A 1BR4B 1WLZA 2JWWA 2PSRA 3DVJA 3FS7A 2LP3A 3I5IC 4YBHB 2DOQA 2PASA 4MLWA 2K7CA 1DGVA 3BOWA 2JTZA 1QV0A 1YRTB 3VRQA 1SCMC 1B9AA 1BMOA 1UWOA 1J7QA 1QX2A 1CLLA 3H4SE 3OHMB 1ZFSA 3AKAA 2L0PA 2KGBC 2O5GA 1DMOA 4OR9B 2GGMA 1BLQA 1H8BA 4DRWA 1L2OB 2NXQA 2HPSA 3I5GB 4GUKA 1PULA 1XK4C 1TNXA 1NWDA 1UHNA 5PALA 1QIWA 4QJ5B 2KFFA 4ORBB 3TUYB 3DVKA 3TDIA 2FJUB 3KHEA 1C07A 2M8UA 1DGUA 2LANA 1DTLA 5AEQA 3CR4X 1AP4A 2BKHB 1TNPA 2KYCA 3AAJA 1CLBA 1A75B 1W7IB 3CR5X 2GV5A 2G9BA 1SY9A 5ER5A 3EK4A 1RWYA 4A4BA 1NX3A 3GOFA 5D69A 4CFRA 3DD4A 1B7TY 3BUWB 3KF9A 1DJZA 1MWNA 3A8RA 1BODA 1B8LA 2LM5A 4PDZA 1JBAA 4ORCB 1QIVA 1L2OC 1NX0A 1XFZO 1TOPA 2BBMA 1CTRA 2JT8A 1IQ5A 3WXAA 2L51A 1QASA 1CLMA 1XFXO 3TUYC 3NSIA 1QATA 2OS8B 3TS5B 1WRLA 3IF7A 1WRKA 4GGFA 3JTDC 5JOLA 4PALA 1G8IA 2F33A 2L4HA 3QRXA 3VGOA 5HKYA 1EL4A 1A75A 2PMYA 3PM8A 1ZUZA 2WORA 1YURA 5CSNA 1ALWA 1GGZA 2R2IA 2Q4UA 2KFGA 2M1UA 4YI9A 2NZ0A 1FI5A 1FPWA 5JJGA 1R2UA 2BBNA 4CFQA 1J1DA 1LKJA 1NIWA 3LCPC 1FBVA 4MSPA 2M7NA 3ICBA 4PHKA 1JC2A 2BECA 2K7DA 3VROA 4QJ3B 2L2EA 4I5LB 4C0LA 3SG7A 1S6IA 1GQMA 1YVLA 5HLVA 2JXCA 5I2OA 4NQGA 4PCWA 2KNEA 5HLOA 1QLKA 2OTGB 2ZRSA 2M49B 2K2AA 1IH0A 3BQ3A 2LMUA 2OS8C 5I8NA 2I7AA 3SIAA 1DJGA 2V53A 2I2RE 1K95A 1CDMA 1MR8A 1SBJA 2K7BA 3CS1A 4YGDB 3EK7A 4GPLB 1OZSA 3DVMA 4MVFA 1UHHA 5BPJA 1BG1A 3AKBA 1OQPA 1H4BA 4WQ3A 3HCMA 3FWBA 2LLUA 4Q04A 4L9MA 4I5NB 1TCOB 2F2PA 2F8PA 4FTGA 3WHTB 5FYXA 2SCPA 2KQ6A 1MF8B 5I2QA 2WCFA 4OV2A 2ZFDA 4M2OA 3OP0A 3SG6A 3VRNA 1N65A 1RROA 1DJHA 1QS7A 2MLEC 1K2HA 3EKJA 1CFPA 2KAVA 3PSRA 1CDPA 2VRGA 4XYNA 1QVIZ 3CZTX 1WDCC 1KQMC 1SRAA 1UHIA 5F6TA 2LMVA 3OX6A 2KGRA 1KCYA 1YUTA 5KSZA 1EH2A 2Q91A 1CNPA 2D8NA 3BUMB 4YGCB 1TRFA 5G08A 1C7VA 5DKQA 1F8HA 2QPTA 1RTP1 4R1EA 5CSIA 1HQVA 3O6BA 4JPZB 2SASA 1K94A 1NCZA 4ICBA 5GQQC 2LVIA 2MLFC 4DS7A 1OZOA 2GGZA 4JQ0D 1B7TZ 2HF5A 1CMGA 3BYAA 4GGNA 1PK0D 2BE4A 1UHKA 4PHJA 1KFUS 1CFDA 1NX1A 1S3PA 1UUSA 4M2PA 1KWOB 3RM1A 3LK0A 5J3XA 3KPXA 1JF2A 1F71A 1AJ5A 1F55A 1SPYA 2ZRTA 1AK8A 1QVIY 4BY4A 2AAOA 1XVJA 4N1GA 2G2BA 3TDUA 2F3ZA 2LVJA 2WCBA 2ZNEA 1JF0A 1XFVO 3EKHA 2CCMA 2ZN8A 2KBMA 2WC8A 1M63B 1S5GY 1SL7A 1SYMA 2AMIA 3D10A 2Y1NA 3SIBA 2KHNA 2JXLA 3SJSA 1IWQA 4U8DA 1N0YA 1VRKA 1F4QA 2KI4B 2L4IA 4IL1A 3K21A 4DCKA 3BUOB 3NSOA 5B8IB 1XFWO 2BE6A 1LVCD 2MJWB 5HYDA 2JZIA 1AUIB 4C0KA 3I5GC 4PHNA 1KWOC 1YR5A 4NDBA 2K7OA 2BCBA 4MN0A 2K2FA 1YUSA 1SR6B 2MAZA 3CTNA 1DJYA 4OVNF 2BCXA 2I94A 4I5JA 1NPQA 4NDCA 1MXEA 3NSKA 4HRHA 1OMRA 1ZACA 4GGFC 2FCDA 1YVHA 4UPGA 2F2OA 4JWQA 2Y5IA 2K8MB 1CKKA 3BUXB 3OB1B 1W7JB 2LHIA 3C1VA 2ZNDA 1BR1B 2JQ6A 2LE9B 2JTTA 1KK7Z 2NCOA 1TN4A 1G33A 4MZKA 1DJXA 1CM1A 1IKUA 1Y1AA 1B8RA 4MRXA 4NDDA 1JWDA 1NSHA 2KI4C 1V1GA 3D0YB 1KFXS 2KI6D 3M0WA 3I5FB 3OX5A 1TCFA 1BJFA 2LUXA 4P5OE 1SMGA 4YGAA 2Y1MA 4HSZA 4CIDA 2LVKA 2MRDA 2ZKMX 2M29A 1K9UA 1MUXA 5AFPA 1YUUA 1XO5A 1YX7A 1QXPA 3PFVA 4MBEA 1SR6C 3TS5C 2KAYA 1IJ6A 1TIZA 4DUQA 1IQ3A 1L7ZA 1XFYO 1K93D 2LV7A 3JVTB 1EJ3A 2KOTA 2M1KB 4P2YB 2JNFA 3CLNA 1BU3A 5DKNA 4HREE 3IQQA 5AANA 2L50A 2LLSA 1UHJA 1V1FA 5CSJA 4ORAB 5D7FA 2LHLA 1Y0VH 2EC6B 3O78A 2AUCA 3O4YA 1JSAA 4QJ4B 1KK7Y 3SG4A 1LXFC 3CWGA 3D0YA 3RLZA 1IGVA 4MEWA 1D1OA 1M45A 1ZMZA 1IJ5A 3I5IB 3I5FC 1JFJA 3ZWHA 1QV1A 1Y1UA 1WY9A 1QX7A 1SCMB 4A4CA 5CPVA 4CLNA 1QJTA 5IBWA 1B1GA 1SCVA 4D1EA 2OTGC 1U5IA 1LA0A 2NCPA 4N5XA 1XYDA 2TN4A 1NCYA 1MQ1A 2H2KA 2F3YA 1S5GZ 2HETA 1B4CA 4PE1A 1RK9A
chains in the Genus database with same CATH superfamily
5K89A 2M97A 4XJKA 1DEKA 1AHRA 1DJWA 4GNKB 4AOMA 3FIAA 2KSPA 1OW4A 3VRRA 4YRUA 2CXJA 2FCEA 3WHUB 5I2LA 3PN7B 3F45A 3SS3A 3SG3A 1NX2A 1A2XA 1DVIA 3S0EA 4FQOA 3SG2A 1TNWA 4AQJA 1YX8A 1TTXA 1SK6D 1S26D 2K0JA 1IG5A 2LC5A 2QDIA 1CFFA 4OKHA 1EG3A 1RJVA 1NP8A 1AVSA 2PALA 1OMVA 4ZCVA 4F0ZB 3S0FA 3B7AA 1PVAA 1T14A 1C7WA 1HT9A 3FE9A 1XK4A 3I5HB 1CDNA 1F54A 2L98A 2BL0B 1MXLC 3HX4A 1ALVA 1S1EA 2JC2A 2NLNA 3GK1A 2LMTA 2JT0A 2M9GA 3CZ1A 3IQOA 4MZLA 5HKWA 5AERA 1DF0B 2KI6C 2JPTA 3D78A 4PE4A 3JTDB 1KFUL 2MBXA 3BUNB 3VRPA 1KK8B 3PN7C 1M46A 1A4PA 1E8AA 3E3RA 3LL8B 3PLFB 2JOJA 1EG4A 5DICA 3DVEA 4KYNA 1RECA 1XFRA 4ETOA 2BKIB 1YTZC 2MHHA 3BFAA 2ISDA 1K96A 5HKZA 1SL8A 3B88A 1SNLA 3MSEB 3NSLA 1CB1A 4M2QA 3O2PA 1QLSA 2EGDA 2IS9A 2E30A 2I18A 3V2LA 1CDLA 3CGAA 1K9PA 1A03A 2RGIA 4TNCA 3SG5A 1Q80A 1OSAA 1OOHA 1XFUO 1PSBA 4GBAA 3DZTA 4N1FA 1BT6A 3DY9A 1UP5A 4JKTA 2WCEA 1WLMA 2H61A 2PVBA 2WCMA 2ERBA 1LINA 3ZNIA 3I5HC 2HQ8A 1SL9A 4E68A 4MZJA 3NXAA 2BL0C 3R72A 2H61C 1DF0A 3EVVA 1G4YR 1DT7B 1QTXA 3LK1A 2M7LA 4MRYA 2P6BB 2QACA 2WOSA 1B47A 1NCXA 3TDZA 2E6WA 1J7PA 1OOJA 2LUCA 1DJIA 1KK8C 4JD9A 3S0BA 4DIRA 3EVUA 4BY5A 1BOCA 1J55A 1NUBA 2KBIA 2HQWA 2PRUA 1S6JA 2WCLA 2K61A 1PALA 4PHMA 3DF0B 1MHOA 2CT9A 3NGVA 1YRUB 4USLA 1K8UA 1S6CA 4WRIA 1OE9B 1UURA 3GK2A 2KYFA 1U5IB 1TUJA 4PE7A 4AQIA 2M0RA 3OB2B 2CNPA 4I5KA 1SW8A 2KAXA 2OPOA 1FF1A 2Y4QA 1M31A 2KFHA 2MA2A 3EVRA 2BCAA 5KTYA 3B87A 2O60A 3L4AA 1QX5B 4PE0A 2LVVA 1J1EA 3PATA 1F70A 1Y6WA 3KO0A 3BXKA 3KEVA 1P28A 3DXLA 3QMEA 1N2DA 1K90D 4INWA 1Z2CB 3AAKA 4XJKB 1J7OA 1WRZA 3LLEA 1CM4A 2COLB 1WDCB 5KU1A 1KQMB 3EK8A 1KFXL 1ZOTB 1LA3A 2P71A 1F4OA 2CBLA 2FOTA 2B1UA 5AXIA 1B8CA 5TNCA 1X02A 3BFHA 2M3WA 1A29A 1PVBA 1NYAA 1EXRA 4GAOA 4YGEB 4PT1A 1CFCA 1JFKA 1FW4A 3DF0A 4GFTA 5ER4X 1KQVA 2JU0A 1KSOA 2WNDA 3BOWB 4OCIA 2WCKA 4YI8A 2WCHA 1ODBA 3GK4X 3WNXB 3FWCA 1BF5A 2A4JA 1XA5A 4YGBB 1K9KA 2LNKA 4WQ2A 2LCPA 3S0GA 2FJYA 1JUOA 3PM2A 1PSRA 3TZ1A 3A4UB 2KLDA 3PALA 1SKTA 3JVTC 5DKRA 3S0DA 1S36A 4ZCUA 1IRJA 1GJYA 2CTNA 2LAPA 2KQYA 3D77A 1CMFA 1PRWA 2EHBA 2JULA 2LLTA 3CR2A 4HRGA 1KSMA 3BJHA 1FI6A 1AJ4A 2GTEA 2KDHA 4C0JA 2JNXA 2ZN9A 1TNQA 1J7RA 4CPVA 2EC6C 2JRFA 1RFJA 1R6PA 2L5XB 1Y1XA 2JT3A 1M39A 1OMDA 1GGWA 5CSFA 1OOGA 2LP2A 1BR4B 1WLZA 2JWWA 2PSRA 3DVJA 3FS7A 2LP3A 2PQLA 3I5IC 4YBHB 2DOQA 2PASA 4MLWA 2K7CA 1DGVA 3BOWA 2JTZA 1QV0A 1YRTB 3VRQA 3D75A 3PJIA 1SCMC 2H8VA 1B9AA 1BMOA 1UWOA 1J7QA 1QX2A 1CLLA 3H4SE 3OHMB 1ZFSA 3AKAA 2L0PA 2KGBC 2O5GA 1DMOA 4OR9B 2GGMA 1BLQA 1H8BA 4DRWA 1L2OB 2NXQA 3S0AA 3R1OA 2HPSA 3I5GB 4INXA 4GUKA 1PULA 1XK4C 1TNXA 1NWDA 1UHNA 5PALA 1QIWA 4QJ5B 2KFFA 4ORBB 3TUYB 3DVKA 3TDIA 2FJUB 2QEHA 3KHEA 1C07A 2M8UA 1DGUA 2LANA 1DTLA 5AEQA 3CR4X 1AP4A 2BKHB 1TNPA 2KYCA 3CZ2A 3B86A 3AAJA 3O4XA 1CLBA 1A75B 1W7IB 3D76A 2KLEA 3CZ0A 3CR5X 2GV5A 2G9BA 3IVTA 1SY9A 5ER5A 3EK4A 1RWYA 4A4BA 1NX3A 3GOFA 5D69A 4CFRA 3DD4A 1B7TY 3BUWB 3KF9A 1DJZA 1MWNA 3SS5A 3A8RA 1BODA 1B8LA 2LM5A 4PDZA 1JBAA 1OOIX 4ORCB 1QIVA 1L2OC 1NX0A 1XFZO 1TOPA 2BBMA 1CTRA 2JT8A 1IQ5A 3WXAA 2L51A 1QASA 1CLMA 1XFXO 3TUYC 3NSIA 1QATA 2OS8B 3TS5B 1WRLA 3IF7A 1WRKA 4GGFA 3JTDC 5JOLA 4PALA 1G8IA 3D74A 2F33A 2L4HA 3D73A 3QRXA 3VGOA 5HKYA 1EL4A 1A75A 2PMYA 2QEOA 3PM8A 3OGNA 1DELA 1ZUZA 4F7FA 2WORA 1GM0A 3FE8A 1YURA 5CSNA 1ALWA 1GGZA 2R2IA 2Q4UA 2KFGA 2M1UA 3K1EA 4YI9A 2NZ0A 1FI5A 1FPWA 5JJGA 1R2UA 2BBNA 4CFQA 1J1DA 1LKJA 3BFBA 1NIWA 3LCPC 1FBVA 4MSPA 2M7NA 3ICBA 4PHKA 1JC2A 2BECA 2K7DA 3VROA 4QJ3B 2L2EA 4I5LB 4C0LA 3SG7A 1S6IA 1GQMA 1YVLA 5HLVA 2JXCA 5I2OA 4NQGA 5FI2A 4PCWA 2KNEA 5HLOA 1QLKA 2OTGB 2ZRSA 2M49B 2K2AA 1IH0A 4FQTA 3BQ3A 2LMUA 3CYZA 2OS8C 5I8NA 2I7AA 3SIAA 1DJGA 2V53A 2I2RE 1K95A 1CDMA 1MR8A 1SBJA 2K7BA 3CS1A 4YGDB 3EK7A 4GPLB 1OZSA 1TUZA 3DVMA 4MVFA 1UHHA 5BPJA 1BG1A 3AKBA 1OQPA 1H4BA 4WQ3A 3HCMA 3FWBA 2LLUA 4Q04A 4L9MA 4I5NB 1TCOB 2F2PA 2F8PA 4FTGA 3WHTB 5FYXA 2SCPA 2KQ6A 1MF8B 5I2QA 2WCFA 4OV2A 3OBVA 2ZFDA 4M2OA 3OP0A 3SG6A 3VRNA 1N65A 1RROA 1DJHA 1QS7A 2MLEC 1K2HA 3CABA 3EKJA 1CFPA 2KAVA 3PSRA 1CDPA 2VRGA 4XYNA 1QVIZ 3N7HA 3CZTX 3DYEA 1WDCC 1KQMC 1SRAA 1UHIA 5F6TA 2LMVA 2WC6A 3OX6A 2KGRA 1KCYA 1YUTA 5FI7A 5KSZA 1EH2A 2Q91A 1CNPA 1DC1A 2D8NA 3BUMB 4YGCB 3VB1A 2K60A 1TRFA 5G08A 1C7VA 5DKQA 1SSEB 1F8HA 2QPTA 5FI6A 1RTP1 4R1EA 5CSIA 1C3ZA 1HQVA 3O6BA 2SASA 4JPZB 1K94A 1NCZA 4ICBA 5GQQC 2LVIA 2MLFC 2PYQA 4DS7A 1OZOA 2GGZA 4JQ0D 1B7TZ 2HF5A 1QWVA 3FE6A 1CMGA 3BYAA 4GGNA 1PK0D 3UO9A 2BE4A 1UHKA 4PHJA 1KFUS 1UUSA 1CFDA 1NX1A 1S3PA 4M2PA 1KWOB 2WC5A 5D3OA 3LK0A 3RM1A 5J3XA 3KPXA 2QEBA 1JF2A 1F71A 1AJ5A 1Z4HA 1W9ZA 3NHTA 1F55A 1SPYA 2ZRTA 1AK8A 3CDNA 1QVIY 4BY4A 2AAOA 1XVJA 4N1GA 3UNWA 2G2BA 2P70A 3TDUA 2F3ZA 2LVJA 2BAPA 2WCBA 2ZNEA 1JF0A 1XFVO 3EKHA 2CCMA 2QEVA 2L5YA 2ZN8A 5EL2A 1TWOA 2L2CA 2KBMA 2WC8A 1M63B 1S5GY 1SL7A 1SYMA 2AMIA 3D10A 2Y1NA 3SIBA 2KHNA 2JXLA 3SJSA 1IWQA 4U8DA 1N0YA 1VRKA 1F4QA 3RZSA 2KI4B 2L4IA 4IL1A 3K21A 4DCKA 1OOFA 3BUOB 3NSOA 5B8IB 1IIOA 3Q8IA 3R1PA 1XFWO 2BE6A 1LVCD 2MJWB 5HYDA 2JZIA 1AUIB 4C0KA 3I5GC 4PHNA 4IJ7A 1KWOC 1YR5A 4NDBA 2K7OA 2BCBA 4MN0A 2K2FA 1YUSA 1SR6B 2MAZA 3CTNA 1DJYA 4OVNF 2BCXA 2I94A 4I5JA 1NPQA 2BNXA 1MXEA 3NSKA 4NDCA 4HRHA 1OMRA 1ZACA 4GGFC 2FCDA 3NHIA 1YVHA 4UPGA 2F2OA 4JWQA 2Y5IA 2K8MB 1CKKA 3BUXB 4OZDA 3OB1B 1W7JB 2LHIA 3C1VA 2ZNDA 1BR1B 2JQ6A 2LE9B 2JTTA 3L47A 1KK7Z 2NCOA 1TN4A 1G33A 3R1VA 1DJXA 1CM1A 4MZKA 1Y1AA 1B8RA 4MRXA 4NDDA 1IKUA 1JWDA 1NSHA 2KI4C 1V1GA 3EG5B 3D0YB 1KFXS 2KI6D 2WCJA 3I5FB 3M0WA 3OX5A 1TCFA 1BJFA 2LUXA 4P5OE 1SMGA 4YGAA 2YGUA 2Y1MA 4HSZA 4CIDA 2LVKA 2MRDA 2ZKMX 2M29A 1K9UA 1MUXA 5AFPA 1ORGA 1YUUA 1XO5A 1YX7A 1QXPA 5I94A 3B6XA 3PFVA 4MBEA 1SR6C 3TS5C 2KAYA 1IJ6A 1TIZA 4DUQA 1IQ3A 1L7ZA 1XFYO 1K93D 2LV7A 3JVTB 1EJ3A 2KOTA 2M1KB 4P2YB 2JNFA 3CLNA 1BU3A 5DKNA 5HL1A 4HREE 3IQQA 5AANA 2L50A 2LLSA 1UHJA 1V1FA 5CSJA 4ORAB 5D7FA 2LHLA 1Y0VH 2EC6B 3O78A 2AUCA 3O4YA 1C3YA 4QJ4B 1JSAA 1KK7Y 3SG4A 1LXFC 3CWGA 3D0YA 3RLZA 1IGVA 4MEWA 3SS4A 1M45A 1ZMZA 1D1OA 1IJ5A 3I5IB 3I5FC 1JFJA 3L4LA 3ZWHA 1LS8A 1QV1A 1Y1UA 1WY9A 2JPOA 1QX7A 2KPHA 1SCMB 4A4CA 5CPVA 4CLNA 1QJTA 5IBWA 1B1GA 1SCVA 4D1EA 2OTGC 1U5IA 1LA0A 2NCPA 4N5XA 1XYDA 2TN4A 1NCYA 1MQ1A 2H2KA 2F3YA 1S5GZ 2HETA 1DQEA 1B4CA 4PE1A 1RK9A
chains in the Genus database with same CATH topology
5K89A 2M97A 4XJKA 4GNKB 1AHRA 1DJWA 4AOMA 3FIAA 2KSPA 3VRRA 4YRUA 2CXJA 2FCEA 3WHUB 5I2LA 3PN7B 3F45A 3SG3A 1NX2A 1A2XA 1DVIA 4FQOA 3SG2A 1TNWA 4AQJA 1YX8A 1TTXA 1SK6D 1S26D 2K0JA 1IG5A 2LC5A 1CFFA 4OKHA 1EG3A 1RJVA 1NP8A 1AVSA 2PALA 1OMVA 4ZCVA 4F0ZB 1PVAA 1C7WA 1HT9A 1XK4A 3I5HB 1CDNA 1F54A 2L98A 2BL0B 1MXLC 3HX4A 1ALVA 1S1EA 2JC2A 2NLNA 3GK1A 2LMTA 2JT0A 2M9GA 3IQOA 4MZLA 5HKWA 5AERA 1DF0B 2KI6C 2JPTA 4PE4A 3JTDB 1KFUL 2MBXA 3BUNB 3VRPA 1KK8B 3PN7C 1M46A 1A4PA 1E8AA 3E3RA 3LL8B 3PLFB 2JOJA 1EG4A 4ETOA 3DVEA 1RECA 2BKIB 1YTZC 2MHHA 2ISDA 1K96A 5HKZA 1SL8A 1SNLA 3MSEB 3NSLA 1CB1A 4M2QA 3O2PA 1QLSA 2EGDA 2IS9A 2E30A 2I18A 1A03A 1CDLA 3CGAA 1K9PA 2RGIA 4TNCA 3SG5A 1Q80A 1OSAA 1XFUO 4N1FA 1PSBA 4GBAA 1BT6A 1UP5A 2WCEA 1WLMA 2H61A 2PVBA 3ZNIA 1LINA 3I5HC 2HQ8A 1SL9A 4E68A 4MZJA 3NXAA 2BL0C 2H61C 1DF0A 3EVVA 1G4YR 1DT7B 1QTXA 3LK1A 2M7LA 4MRYA 2P6BB 2QACA 2WOSA 1B47A 1NCXA 3TDZA 2E6WA 1J7PA 1OOJA 2LUCA 1DJIA 1KK8C 4DIRA 3EVUA 4BY5A 1BOCA 1J55A 1NUBA 2KBIA 2HQWA 2PRUA 1S6JA 4PHMA 2K61A 1PALA 3DF0B 1MHOA 2CT9A 4USLA 1YRUB 1K8UA 1S6CA 4WRIA 1OE9B 1UURA 3GK2A 2KYFA 1U5IB 4PE7A 4AQIA 2M0RA 3OB2B 2CNPA 4I5KA 1SW8A 2KAXA 2OPOA 1FF1A 2Y4QA 1M31A 2KFHA 2MA2A 3EVRA 2BCAA 5KTYA 2O60A 1QX5B 4PE0A 2LVVA 1J1EA 3PATA 1F70A 1Y6WA 3KO0A 3BXKA 3KEVA 1N2DA 1K90D 4XJKB 3AAKA 1J7OA 1WRZA 3LLEA 1CM4A 2COLB 1WDCB 5KU1A 1KQMB 3EK8A 1KFXL 1ZOTB 1LA3A 1F4OA 2CBLA 2FOTA 2B1UA 5AXIA 1B8CA 5TNCA 1X02A 2M3WA 1A29A 1PVBA 1NYAA 1EXRA 4GAOA 4YGEB 1CFCA 1JFKA 1FW4A 3DF0A 4GFTA 5ER4X 1KQVA 2JU0A 1KSOA 2WNDA 3BOWB 4OCIA 4YI8A 1ODBA 3GK4X 3WNXB 3FWCA 1BF5A 2A4JA 1XA5A 4YGBB 1K9KA 2LNKA 4WQ2A 2LCPA 1JUOA 1PSRA 3TZ1A 3A4UB 3PALA 1SKTA 3JVTC 5DKRA 1S36A 4ZCUA 1IRJA 1GJYA 2CTNA 2LAPA 2KQYA 1CMFA 1PRWA 2EHBA 2JULA 2LLTA 3CR2A 4HRGA 1KSMA 1FI6A 1AJ4A 2KDHA 4C0JA 2JNXA 2ZN9A 1TNQA 1J7RA 4CPVA 2EC6C 2JRFA 1RFJA 1R6PA 2L5XB 1Y1XA 2JT3A 1M39A 1OMDA 1GGWA 5CSFA 2LP2A 1BR4B 1WLZA 2JWWA 2PSRA 3DVJA 3FS7A 2LP3A 3I5IC 4YBHB 2DOQA 2PASA 4MLWA 2K7CA 1DGVA 3BOWA 2JTZA 1QV0A 1YRTB 3VRQA 1SCMC 1B9AA 1BMOA 1UWOA 1J7QA 1QX2A 1CLLA 3H4SE 3OHMB 1ZFSA 3AKAA 2L0PA 2KGBC 2O5GA 1DMOA 4OR9B 2GGMA 1BLQA 1H8BA 4DRWA 1L2OB 2NXQA 2HPSA 3I5GB 4GUKA 1PULA 1XK4C 1TNXA 1NWDA 1UHNA 5PALA 1QIWA 4QJ5B 2KFFA 4ORBB 3TUYB 3DVKA 3TDIA 2FJUB 3KHEA 1C07A 2M8UA 1DGUA 2LANA 1DTLA 5AEQA 3CR4X 1AP4A 2BKHB 1TNPA 2KYCA 3AAJA 1CLBA 1A75B 1W7IB 3CR5X 2GV5A 2G9BA 1SY9A 5ER5A 3EK4A 1RWYA 4A4BA 1NX3A 3GOFA 5D69A 4CFRA 3DD4A 1B7TY 3BUWB 3KF9A 1DJZA 1MWNA 3A8RA 1BODA 1B8LA 2LM5A 4PDZA 1JBAA 4ORCB 1QIVA 1L2OC 1NX0A 1XFZO 1TOPA 2BBMA 1CTRA 2JT8A 1IQ5A 3WXAA 2L51A 1QASA 1CLMA 1XFXO 3TUYC 3NSIA 1QATA 2OS8B 3TS5B 1WRLA 3IF7A 1WRKA 4GGFA 3JTDC 5JOLA 4PALA 1G8IA 2F33A 2L4HA 3QRXA 3VGOA 5HKYA 1EL4A 1A75A 2PMYA 3PM8A 1ZUZA 2WORA 1YURA 5CSNA 1ALWA 1GGZA 2R2IA 2Q4UA 2KFGA 2M1UA 4YI9A 2NZ0A 1FI5A 1FPWA 5JJGA 1R2UA 2BBNA 4CFQA 1J1DA 1LKJA 1NIWA 3LCPC 1FBVA 4MSPA 2M7NA 3ICBA 4PHKA 1JC2A 2BECA 2K7DA 3VROA 4QJ3B 2L2EA 4I5LB 4C0LA 3SG7A 1S6IA 1GQMA 1YVLA 5HLVA 2JXCA 5I2OA 4NQGA 4PCWA 2KNEA 5HLOA 1QLKA 2OTGB 2ZRSA 2M49B 2K2AA 1IH0A 3BQ3A 2LMUA 2OS8C 5I8NA 2I7AA 3SIAA 1DJGA 2V53A 2I2RE 1K95A 1CDMA 1MR8A 1SBJA 2K7BA 3CS1A 4YGDB 3EK7A 4GPLB 1OZSA 3DVMA 4MVFA 1UHHA 5BPJA 1BG1A 3AKBA 1OQPA 1H4BA 4WQ3A 3HCMA 3FWBA 2LLUA 4Q04A 4L9MA 4I5NB 1TCOB 2F2PA 2F8PA 4FTGA 3WHTB 5FYXA 2SCPA 2KQ6A 1MF8B 5I2QA 2WCFA 4OV2A 2ZFDA 4M2OA 3OP0A 3SG6A 3VRNA 1N65A 1RROA 1DJHA 1QS7A 2MLEC 1K2HA 3EKJA 1CFPA 2KAVA 3PSRA 1CDPA 2VRGA 4XYNA 1QVIZ 3CZTX 1WDCC 1KQMC 1SRAA 1UHIA 5F6TA 2LMVA 3OX6A 2KGRA 1KCYA 1YUTA 5KSZA 1EH2A 2Q91A 1CNPA 2D8NA 3BUMB 4YGCB 1TRFA 5G08A 1C7VA 5DKQA 1F8HA 2QPTA 1RTP1 4R1EA 5CSIA 1HQVA 3O6BA 4JPZB 2SASA 1K94A 1NCZA 4ICBA 5GQQC 2LVIA 2MLFC 4DS7A 1OZOA 2GGZA 4JQ0D 1B7TZ 2HF5A 1CMGA 3BYAA 4GGNA 1PK0D 2BE4A 1UHKA 4PHJA 1KFUS 1CFDA 1NX1A 1S3PA 1UUSA 4M2PA 1KWOB 3RM1A 3LK0A 5J3XA 3KPXA 1JF2A 1F71A 1AJ5A 1F55A 1SPYA 2ZRTA 1AK8A 1QVIY 4BY4A 2AAOA 1XVJA 4N1GA 2G2BA 3TDUA 2F3ZA 2LVJA 2WCBA 2ZNEA 1JF0A 1XFVO 3EKHA 2CCMA 2ZN8A 2KBMA 2WC8A 1M63B 1S5GY 1SL7A 1SYMA 2AMIA 3D10A 2Y1NA 3SIBA 2KHNA 2JXLA 3SJSA 1IWQA 4U8DA 1N0YA 1VRKA 1F4QA 2KI4B 2L4IA 4IL1A 3K21A 4DCKA 3BUOB 3NSOA 5B8IB 1XFWO 2BE6A 1LVCD 2MJWB 5HYDA 2JZIA 1AUIB 4C0KA 3I5GC 4PHNA 1KWOC 1YR5A 4NDBA 2K7OA 2BCBA 4MN0A 2K2FA 1YUSA 1SR6B 2MAZA 3CTNA 1DJYA 4OVNF 2BCXA 2I94A 4I5JA 1NPQA 4NDCA 1MXEA 3NSKA 4HRHA 1OMRA 1ZACA 4GGFC 2FCDA 1YVHA 4UPGA 2F2OA 4JWQA 2Y5IA 2K8MB 1CKKA 3BUXB 3OB1B 1W7JB 2LHIA 3C1VA 2ZNDA 1BR1B 2JQ6A 2LE9B 2JTTA 1KK7Z 2NCOA 1TN4A 1G33A 4MZKA 1DJXA 1CM1A 1IKUA 1Y1AA 1B8RA 4MRXA 4NDDA 1JWDA 1NSHA 2KI4C 1V1GA 3D0YB 1KFXS 2KI6D 3M0WA 3I5FB 3OX5A 1TCFA 1BJFA 2LUXA 4P5OE 1SMGA 4YGAA 2Y1MA 4HSZA 4CIDA 2LVKA 2MRDA 2ZKMX 2M29A 1K9UA 1MUXA 5AFPA 1YUUA 1XO5A 1YX7A 1QXPA 3PFVA 4MBEA 1SR6C 3TS5C 2KAYA 1IJ6A 1TIZA 4DUQA 1IQ3A 1L7ZA 1XFYO 1K93D 2LV7A 3JVTB 1EJ3A 2KOTA 2M1KB 4P2YB 2JNFA 3CLNA 1BU3A 5DKNA 4HREE 3IQQA 5AANA 2L50A 2LLSA 1UHJA 1V1FA 5CSJA 4ORAB 5D7FA 2LHLA 1Y0VH 2EC6B 3O78A 2AUCA 3O4YA 1JSAA 4QJ4B 1KK7Y 3SG4A 1LXFC 3CWGA 3D0YA 3RLZA 1IGVA 4MEWA 1D1OA 1M45A 1ZMZA 1IJ5A 3I5IB 3I5FC 1JFJA 3ZWHA 1QV1A 1Y1UA 1WY9A 1QX7A 1SCMB 4A4CA 5CPVA 4CLNA 1QJTA 5IBWA 1B1GA 1SCVA 4D1EA 2OTGC 1U5IA 1LA0A 2NCPA 4N5XA 1XYDA 2TN4A 1NCYA 1MQ1A 2H2KA 2F3YA 1S5GZ 2HETA 1B4CA 4PE1A 1RK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K89 A;  2M97 A;  4XJK A;  4GNK B;  1AHR A;  1DJW A;  4AOM A;  3FIA A;  2KSP A;  3VRR A;  4YRU A;  2CXJ A;  2FCE A;  3WHU B;  5I2L A;  3PN7 B;  3F45 A;  3SG3 A;  1NX2 A;  1A2X A;  1DVI A;  4FQO A;  3SG2 A;  1TNW A;  4AQJ A;  1YX8 A;  1TTX A;  1SK6 D;  1S26 D;  2K0J A;  1IG5 A;  2LC5 A;  1CFF A;  4OKH A;  1EG3 A;  1RJV A;  1NP8 A;  1AVS A;  2PAL A;  1OMV A;  4ZCV A;  4F0Z B;  1PVA A;  1C7W A;  1HT9 A;  1XK4 A;  3I5H B;  1CDN A;  1F54 A;  2L98 A;  2BL0 B;  1MXL C;  3HX4 A;  1ALV A;  1S1E A;  2JC2 A;  2NLN A;  3GK1 A;  2LMT A;  2JT0 A;  2M9G A;  3IQO A;  4MZL A;  5HKW A;  5AER A;  1DF0 B;  2KI6 C;  2JPT A;  4PE4 A;  3JTD B;  1KFU L;  2MBX A;  3BUN B;  3VRP A;  1KK8 B;  3PN7 C;  1M46 A;  1A4P A;  1E8A A;  3E3R A;  3LL8 B;  3PLF B;  2JOJ A;  1EG4 A;  4ETO A;  3DVE A;  1REC A;  2BKI B;  1YTZ C;  2MHH A;  2ISD A;  1K96 A;  5HKZ A;  1SL8 A;  1SNL A;  3MSE B;  3NSL A;  1CB1 A;  4M2Q A;  3O2P A;  1QLS A;  2EGD A;  2IS9 A;  2E30 A;  2I18 A;  1A03 A;  1CDL A;  3CGA A;  1K9P A;  2RGI A;  4TNC A;  3SG5 A;  1Q80 A;  1OSA A;  1XFU O;  4N1F A;  1PSB A;  4GBA A;  1BT6 A;  1UP5 A;  2WCE A;  1WLM A;  2H61 A;  2PVB A;  3ZNI A;  1LIN A;  3I5H C;  2HQ8 A;  1SL9 A;  4E68 A;  4MZJ A;  3NXA A;  2BL0 C;  2H61 C;  1DF0 A;  3EVV A;  1G4Y R;  1DT7 B;  1QTX A;  3LK1 A;  2M7L A;  4MRY A;  2P6B B;  2QAC A;  2WOS A;  1B47 A;  1NCX A;  3TDZ A;  2E6W A;  1J7P A;  1OOJ A;  2LUC A;  1DJI A;  1KK8 C;  4DIR A;  3EVU A;  4BY5 A;  1BOC A;  1J55 A;  1NUB A;  2KBI A;  2HQW A;  2PRU A;  1S6J A;  4PHM A;  2K61 A;  1PAL A;  3DF0 B;  1MHO A;  2CT9 A;  4USL A;  1YRU B;  1K8U A;  1S6C A;  4WRI A;  1OE9 B;  1UUR A;  3GK2 A;  2KYF A;  1U5I B;  4PE7 A;  4AQI A;  2M0R A;  3OB2 B;  2CNP A;  4I5K A;  1SW8 A;  2KAX A;  2OPO A;  1FF1 A;  2Y4Q A;  1M31 A;  2KFH A;  2MA2 A;  3EVR A;  2BCA A;  5KTY A;  2O60 A;  1QX5 B;  4PE0 A;  2LVV A;  1J1E A;  3PAT A;  1F70 A;  1Y6W A;  3KO0 A;  3BXK A;  3KEV A;  1N2D A;  1K90 D;  4XJK B;  3AAK A;  1J7O A;  1WRZ A;  3LLE A;  1CM4 A;  2COL B;  1WDC B;  5KU1 A;  1KQM B;  3EK8 A;  1KFX L;  1ZOT B;  1LA3 A;  1F4O A;  2CBL A;  2FOT A;  2B1U A;  5AXI A;  1B8C A;  5TNC A;  1X02 A;  2M3W A;  1A29 A;  1PVB A;  1NYA A;  1EXR A;  4GAO A;  4YGE B;  1CFC A;  1JFK A;  1FW4 A;  3DF0 A;  4GFT A;  5ER4 X;  1KQV A;  2JU0 A;  1KSO A;  2WND A;  3BOW B;  4OCI A;  4YI8 A;  1ODB A;  3GK4 X;  3WNX B;  3FWC A;  1BF5 A;  2A4J A;  1XA5 A;  4YGB B;  1K9K A;  2LNK A;  4WQ2 A;  2LCP A;  1JUO A;  1PSR A;  3TZ1 A;  3A4U B;  3PAL A;  1SKT A;  3JVT C;  5DKR A;  1S36 A;  4ZCU A;  1IRJ A;  1GJY A;  2CTN A;  2LAP A;  2KQY A;  1CMF A;  1PRW A;  2EHB A;  2JUL A;  2LLT A;  3CR2 A;  4HRG A;  1KSM A;  1FI6 A;  1AJ4 A;  2KDH A;  4C0J A;  2JNX A;  2ZN9 A;  1TNQ A;  1J7R A;  4CPV A;  2EC6 C;  2JRF A;  1RFJ A;  1R6P A;  2L5X B;  1Y1X A;  2JT3 A;  1M39 A;  1OMD A;  1GGW A;  5CSF A;  2LP2 A;  1BR4 B;  1WLZ A;  2JWW A;  2PSR A;  3DVJ A;  3FS7 A;  2LP3 A;  3I5I C;  4YBH B;  2DOQ A;  2PAS A;  4MLW A;  2K7C A;  1DGV A;  3BOW A;  2JTZ A;  1QV0 A;  1YRT B;  3VRQ A;  1SCM C;  1B9A A;  1BMO A;  1UWO A;  1J7Q A;  1QX2 A;  1CLL A;  3H4S E;  3OHM B;  1ZFS A;  3AKA A;  2L0P A;  2KGB C;  2O5G A;  1DMO A;  4OR9 B;  2GGM A;  1BLQ A;  1H8B A;  4DRW A;  1L2O B;  2NXQ A;  2HPS A;  3I5G B;  4GUK A;  1PUL A;  1XK4 C;  1TNX A;  1NWD A;  1UHN A;  5PAL A;  1QIW A;  4QJ5 B;  2KFF A;  4ORB B;  3TUY B;  3DVK A;  3TDI A;  2FJU B;  3KHE A;  1C07 A;  2M8U A;  1DGU A;  2LAN A;  1DTL A;  5AEQ A;  3CR4 X;  1AP4 A;  2BKH B;  1TNP A;  2KYC A;  3AAJ A;  1CLB A;  1A75 B;  1W7I B;  3CR5 X;  2GV5 A;  2G9B A;  1SY9 A;  5ER5 A;  3EK4 A;  1RWY A;  4A4B A;  1NX3 A;  3GOF A;  5D69 A;  4CFR A;  3DD4 A;  1B7T Y;  3BUW B;  3KF9 A;  1DJZ A;  1MWN A;  3A8R A;  1BOD A;  1B8L A;  2LM5 A;  4PDZ A;  1JBA A;  4ORC B;  1QIV A;  1L2O C;  1NX0 A;  1XFZ O;  1TOP A;  2BBM A;  1CTR A;  2JT8 A;  1IQ5 A;  3WXA A;  2L51 A;  1QAS A;  1CLM A;  1XFX O;  3TUY C;  3NSI A;  1QAT A;  2OS8 B;  3TS5 B;  1WRL A;  3IF7 A;  1WRK A;  4GGF A;  3JTD C;  5JOL A;  4PAL A;  1G8I A;  2F33 A;  2L4H A;  3QRX A;  3VGO A;  5HKY A;  1EL4 A;  1A75 A;  2PMY A;  3PM8 A;  1ZUZ A;  2WOR A;  1YUR A;  5CSN A;  1ALW A;  1GGZ A;  2R2I A;  2Q4U A;  2KFG A;  2M1U A;  4YI9 A;  2NZ0 A;  1FI5 A;  1FPW A;  5JJG A;  1R2U A;  2BBN A;  4CFQ A;  1J1D A;  1LKJ A;  1NIW A;  3LCP C;  1FBV A;  4MSP A;  2M7N A;  3ICB A;  4PHK A;  1JC2 A;  2BEC A;  2K7D A;  3VRO A;  4QJ3 B;  2L2E A;  4I5L B;  4C0L A;  3SG7 A;  1S6I A;  1GQM A;  1YVL A;  5HLV A;  2JXC A;  5I2O A;  4NQG A;  4PCW A;  2KNE A;  5HLO A;  1QLK A;  2OTG B;  2ZRS A;  2M49 B;  2K2A A;  1IH0 A;  3BQ3 A;  2LMU A;  2OS8 C;  5I8N A;  2I7A A;  3SIA A;  1DJG A;  2V53 A;  2I2R E;  1K95 A;  1CDM A;  1MR8 A;  1SBJ A;  2K7B A;  3CS1 A;  4YGD B;  3EK7 A;  4GPL B;  1OZS A;  3DVM A;  4MVF A;  1UHH A;  5BPJ A;  1BG1 A;  3AKB A;  1OQP A;  1H4B A;  4WQ3 A;  3HCM A;  3FWB A;  2LLU A;  4Q04 A;  4L9M A;  4I5N B;  1TCO B;  2F2P A;  2F8P A;  4FTG A;  3WHT B;  5FYX A;  2SCP A;  2KQ6 A;  1MF8 B;  5I2Q A;  2WCF A;  4OV2 A;  2ZFD A;  4M2O A;  3OP0 A;  3SG6 A;  3VRN A;  1N65 A;  1RRO A;  1DJH A;  1QS7 A;  2MLE C;  1K2H A;  3EKJ A;  1CFP A;  2KAV A;  3PSR A;  1CDP A;  2VRG A;  4XYN A;  1QVI Z;  3CZT X;  1WDC C;  1KQM C;  1SRA A;  1UHI A;  5F6T A;  2LMV A;  3OX6 A;  2KGR A;  1KCY A;  1YUT A;  5KSZ A;  1EH2 A;  2Q91 A;  1CNP A;  2D8N A;  3BUM B;  4YGC B;  1TRF A;  5G08 A;  1C7V A;  5DKQ A;  1F8H A;  2QPT A;  1RTP 1;  4R1E A;  5CSI A;  1HQV A;  3O6B A;  4JPZ B;  2SAS A;  1K94 A;  1NCZ A;  4ICB A;  5GQQ C;  2LVI A;  2MLF C;  4DS7 A;  1OZO A;  2GGZ A;  4JQ0 D;  1B7T Z;  2HF5 A;  1CMG A;  3BYA A;  4GGN A;  1PK0 D;  2BE4 A;  1UHK A;  4PHJ A;  1KFU S;  1CFD A;  1NX1 A;  1S3P A;  1UUS A;  4M2P A;  1KWO B;  3RM1 A;  3LK0 A;  5J3X A;  3KPX A;  1JF2 A;  1F71 A;  1AJ5 A;  1F55 A;  1SPY A;  2ZRT A;  1AK8 A;  1QVI Y;  4BY4 A;  2AAO A;  1XVJ A;  4N1G A;  2G2B A;  3TDU A;  2F3Z A;  2LVJ A;  2WCB A;  2ZNE A;  1JF0 A;  1XFV O;  3EKH A;  2CCM A;  2ZN8 A;  2KBM A;  2WC8 A;  1M63 B;  1S5G Y;  1SL7 A;  1SYM A;  2AMI A;  3D10 A;  2Y1N A;  3SIB A;  2KHN A;  2JXL A;  3SJS A;  1IWQ A;  4U8D A;  1N0Y A;  1VRK A;  1F4Q A;  2KI4 B;  2L4I A;  4IL1 A;  3K21 A;  4DCK A;  3BUO B;  3NSO A;  5B8I B;  1XFW O;  2BE6 A;  1LVC D;  2MJW B;  5HYD A;  2JZI A;  1AUI B;  4C0K A;  3I5G C;  4PHN A;  1KWO C;  1YR5 A;  4NDB A;  2K7O A;  2BCB A;  4MN0 A;  2K2F A;  1YUS A;  1SR6 B;  2MAZ A;  3CTN A;  1DJY A;  4OVN F;  2BCX A;  2I94 A;  4I5J A;  1NPQ A;  4NDC A;  1MXE A;  3NSK A;  4HRH A;  1OMR A;  1ZAC A;  4GGF C;  2FCD A;  1YVH A;  4UPG A;  2F2O A;  4JWQ A;  2Y5I A;  2K8M B;  1CKK A;  3BUX B;  3OB1 B;  1W7J B;  2LHI A;  3C1V A;  2ZND A;  1BR1 B;  2JQ6 A;  2LE9 B;  2JTT A;  1KK7 Z;  2NCO A;  1TN4 A;  1G33 A;  4MZK A;  1DJX A;  1CM1 A;  1IKU A;  1Y1A A;  1B8R A;  4MRX A;  4NDD A;  1JWD A;  1NSH A;  2KI4 C;  1V1G A;  3D0Y B;  1KFX S;  2KI6 D;  3M0W A;  3I5F B;  3OX5 A;  1TCF A;  1BJF A;  2LUX A;  4P5O E;  1SMG A;  4YGA A;  2Y1M A;  4HSZ A;  4CID A;  2LVK A;  2MRD A;  2ZKM X;  2M29 A;  1K9U A;  1MUX A;  5AFP A;  1YUU A;  1XO5 A;  1YX7 A;  1QXP A;  3PFV A;  4MBE A;  1SR6 C;  3TS5 C;  2KAY A;  1IJ6 A;  1TIZ A;  4DUQ A;  1IQ3 A;  1L7Z A;  1XFY O;  1K93 D;  2LV7 A;  3JVT B;  1EJ3 A;  2KOT A;  2M1K B;  4P2Y B;  2JNF A;  3CLN A;  1BU3 A;  5DKN A;  4HRE E;  3IQQ A;  5AAN A;  2L50 A;  2LLS A;  1UHJ A;  1V1F A;  5CSJ A;  4ORA B;  5D7F A;  2LHL A;  1Y0V H;  2EC6 B;  3O78 A;  2AUC A;  3O4Y A;  1JSA A;  4QJ4 B;  1KK7 Y;  3SG4 A;  1LXF C;  3CWG A;  3D0Y A;  3RLZ A;  1IGV A;  4MEW A;  1D1O A;  1M45 A;  1ZMZ A;  1IJ5 A;  3I5I B;  3I5F C;  1JFJ A;  3ZWH A;  1QV1 A;  1Y1U A;  1WY9 A;  1QX7 A;  1SCM B;  4A4C A;  5CPV A;  4CLN A;  1QJT A;  5IBW A;  1B1G A;  1SCV A;  4D1E A;  2OTG C;  1U5I A;  1LA0 A;  2NCP A;  4N5X A;  1XYD A;  2TN4 A;  1NCY A;  1MQ1 A;  2H2K A;  2F3Y A;  1S5G Z;  2HET A;  1B4C A;  4PE1 A;  1RK9 A; 
#chains in the Genus database with same CATH topology
 5K89 A;  2M97 A;  4XJK A;  1DEK A;  1AHR A;  1DJW A;  4GNK B;  4AOM A;  3FIA A;  2KSP A;  1OW4 A;  3VRR A;  4YRU A;  2CXJ A;  2FCE A;  3WHU B;  5I2L A;  3PN7 B;  3F45 A;  3SS3 A;  3SG3 A;  1NX2 A;  1A2X A;  1DVI A;  3S0E A;  4FQO A;  3SG2 A;  1TNW A;  4AQJ A;  1YX8 A;  1TTX A;  1SK6 D;  1S26 D;  2K0J A;  1IG5 A;  2LC5 A;  2QDI A;  1CFF A;  4OKH A;  1EG3 A;  1RJV A;  1NP8 A;  1AVS A;  2PAL A;  1OMV A;  4ZCV A;  4F0Z B;  3S0F A;  3B7A A;  1PVA A;  1T14 A;  1C7W A;  1HT9 A;  3FE9 A;  1XK4 A;  3I5H B;  1CDN A;  1F54 A;  2L98 A;  2BL0 B;  1MXL C;  3HX4 A;  1ALV A;  1S1E A;  2JC2 A;  2NLN A;  3GK1 A;  2LMT A;  2JT0 A;  2M9G A;  3CZ1 A;  3IQO A;  4MZL A;  5HKW A;  5AER A;  1DF0 B;  2KI6 C;  2JPT A;  3D78 A;  4PE4 A;  3JTD B;  1KFU L;  2MBX A;  3BUN B;  3VRP A;  1KK8 B;  3PN7 C;  1M46 A;  1A4P A;  1E8A A;  3E3R A;  3LL8 B;  3PLF B;  2JOJ A;  1EG4 A;  5DIC A;  3DVE A;  4KYN A;  1REC A;  1XFR A;  4ETO A;  2BKI B;  1YTZ C;  2MHH A;  3BFA A;  2ISD A;  1K96 A;  5HKZ A;  1SL8 A;  3B88 A;  1SNL A;  3MSE B;  3NSL A;  1CB1 A;  4M2Q A;  3O2P A;  1QLS A;  2EGD A;  2IS9 A;  2E30 A;  2I18 A;  3V2L A;  1CDL A;  3CGA A;  1K9P A;  1A03 A;  2RGI A;  4TNC A;  3SG5 A;  1Q80 A;  1OSA A;  1OOH A;  1XFU O;  1PSB A;  4GBA A;  3DZT A;  4N1F A;  1BT6 A;  3DY9 A;  1UP5 A;  4JKT A;  2WCE A;  1WLM A;  2H61 A;  2PVB A;  2WCM A;  2ERB A;  1LIN A;  3ZNI A;  3I5H C;  2HQ8 A;  1SL9 A;  4E68 A;  4MZJ A;  3NXA A;  2BL0 C;  3R72 A;  2H61 C;  1DF0 A;  3EVV A;  1G4Y R;  1DT7 B;  1QTX A;  3LK1 A;  2M7L A;  4MRY A;  2P6B B;  2QAC A;  2WOS A;  1B47 A;  1NCX A;  3TDZ A;  2E6W A;  1J7P A;  1OOJ A;  2LUC A;  1DJI A;  1KK8 C;  4JD9 A;  3S0B A;  4DIR A;  3EVU A;  4BY5 A;  1BOC A;  1J55 A;  1NUB A;  2KBI A;  2HQW A;  2PRU A;  1S6J A;  2WCL A;  2K61 A;  1PAL A;  4PHM A;  3DF0 B;  1MHO A;  2CT9 A;  3NGV A;  1YRU B;  4USL A;  1K8U A;  1S6C A;  4WRI A;  1OE9 B;  1UUR A;  3GK2 A;  2KYF A;  1U5I B;  1TUJ A;  4PE7 A;  4AQI A;  2M0R A;  3OB2 B;  2CNP A;  4I5K A;  1SW8 A;  2KAX A;  2OPO A;  1FF1 A;  2Y4Q A;  1M31 A;  2KFH A;  2MA2 A;  3EVR A;  2BCA A;  5KTY A;  3B87 A;  2O60 A;  3L4A A;  1QX5 B;  4PE0 A;  2LVV A;  1J1E A;  3PAT A;  1F70 A;  1Y6W A;  3KO0 A;  3BXK A;  3KEV A;  1P28 A;  3DXL A;  3QME A;  1N2D A;  1K90 D;  4INW A;  1Z2C B;  3AAK A;  4XJK B;  1J7O A;  1WRZ A;  3LLE A;  1CM4 A;  2COL B;  1WDC B;  5KU1 A;  1KQM B;  3EK8 A;  1KFX L;  1ZOT B;  1LA3 A;  2P71 A;  1F4O A;  2CBL A;  2FOT A;  2B1U A;  5AXI A;  1B8C A;  5TNC A;  1X02 A;  3BFH A;  2M3W A;  1A29 A;  1PVB A;  1NYA A;  1EXR A;  4GAO A;  4YGE B;  4PT1 A;  1CFC A;  1JFK A;  1FW4 A;  3DF0 A;  4GFT A;  5ER4 X;  1KQV A;  2JU0 A;  1KSO A;  2WND A;  3BOW B;  4OCI A;  2WCK A;  4YI8 A;  2WCH A;  1ODB A;  3GK4 X;  3WNX B;  3FWC A;  1BF5 A;  2A4J A;  1XA5 A;  4YGB B;  1K9K A;  2LNK A;  4WQ2 A;  2LCP A;  3S0G A;  2FJY A;  1JUO A;  3PM2 A;  1PSR A;  3TZ1 A;  3A4U B;  2KLD A;  3PAL A;  1SKT A;  3JVT C;  5DKR A;  3S0D A;  1S36 A;  4ZCU A;  1IRJ A;  1GJY A;  2CTN A;  2LAP A;  2KQY A;  3D77 A;  1CMF A;  1PRW A;  2EHB A;  2JUL A;  2LLT A;  3CR2 A;  4HRG A;  1KSM A;  3BJH A;  1FI6 A;  1AJ4 A;  2GTE A;  2KDH A;  4C0J A;  2JNX A;  2ZN9 A;  1TNQ A;  1J7R A;  4CPV A;  2EC6 C;  2JRF A;  1RFJ A;  1R6P A;  2L5X B;  1Y1X A;  2JT3 A;  1M39 A;  1OMD A;  1GGW A;  5CSF A;  1OOG A;  2LP2 A;  1BR4 B;  1WLZ A;  2JWW A;  2PSR A;  3DVJ A;  3FS7 A;  2LP3 A;  2PQL A;  3I5I C;  4YBH B;  2DOQ A;  2PAS A;  4MLW A;  2K7C A;  1DGV A;  3BOW A;  2JTZ A;  1QV0 A;  1YRT B;  3VRQ A;  3D75 A;  3PJI A;  1SCM C;  2H8V A;  1B9A A;  1BMO A;  1UWO A;  1J7Q A;  1QX2 A;  1CLL A;  3H4S E;  3OHM B;  1ZFS A;  3AKA A;  2L0P A;  2KGB C;  2O5G A;  1DMO A;  4OR9 B;  2GGM A;  1BLQ A;  1H8B A;  4DRW A;  1L2O B;  2NXQ A;  3S0A A;  3R1O A;  2HPS A;  3I5G B;  4INX A;  4GUK A;  1PUL A;  1XK4 C;  1TNX A;  1NWD A;  1UHN A;  5PAL A;  1QIW A;  4QJ5 B;  2KFF A;  4ORB B;  3TUY B;  3DVK A;  3TDI A;  2FJU B;  2QEH A;  3KHE A;  1C07 A;  2M8U A;  1DGU A;  2LAN A;  1DTL A;  5AEQ A;  3CR4 X;  1AP4 A;  2BKH B;  1TNP A;  2KYC A;  3CZ2 A;  3B86 A;  3AAJ A;  3O4X A;  1CLB A;  1A75 B;  1W7I B;  3D76 A;  2KLE A;  3CZ0 A;  3CR5 X;  2GV5 A;  2G9B A;  3IVT A;  1SY9 A;  5ER5 A;  3EK4 A;  1RWY A;  4A4B A;  1NX3 A;  3GOF A;  5D69 A;  4CFR A;  3DD4 A;  1B7T Y;  3BUW B;  3KF9 A;  1DJZ A;  1MWN A;  3SS5 A;  3A8R A;  1BOD A;  1B8L A;  2LM5 A;  4PDZ A;  1JBA A;  1OOI X;  4ORC B;  1QIV A;  1L2O C;  1NX0 A;  1XFZ O;  1TOP A;  2BBM A;  1CTR A;  2JT8 A;  1IQ5 A;  3WXA A;  2L51 A;  1QAS A;  1CLM A;  1XFX O;  3TUY C;  3NSI A;  1QAT A;  2OS8 B;  3TS5 B;  1WRL A;  3IF7 A;  1WRK A;  4GGF A;  3JTD C;  5JOL A;  4PAL A;  1G8I A;  3D74 A;  2F33 A;  2L4H A;  3D73 A;  3QRX A;  3VGO A;  5HKY A;  1EL4 A;  1A75 A;  2PMY A;  2QEO A;  3PM8 A;  3OGN A;  1DEL A;  1ZUZ A;  4F7F A;  2WOR A;  1GM0 A;  3FE8 A;  1YUR A;  5CSN A;  1ALW A;  1GGZ A;  2R2I A;  2Q4U A;  2KFG A;  2M1U A;  3K1E A;  4YI9 A;  2NZ0 A;  1FI5 A;  1FPW A;  5JJG A;  1R2U A;  2BBN A;  4CFQ A;  1J1D A;  1LKJ A;  3BFB A;  1NIW A;  3LCP C;  1FBV A;  4MSP A;  2M7N A;  3ICB A;  4PHK A;  1JC2 A;  2BEC A;  2K7D A;  3VRO A;  4QJ3 B;  2L2E A;  4I5L B;  4C0L A;  3SG7 A;  1S6I A;  1GQM A;  1YVL A;  5HLV A;  2JXC A;  5I2O A;  4NQG A;  5FI2 A;  4PCW A;  2KNE A;  5HLO A;  1QLK A;  2OTG B;  2ZRS A;  2M49 B;  2K2A A;  1IH0 A;  4FQT A;  3BQ3 A;  2LMU A;  3CYZ A;  2OS8 C;  5I8N A;  2I7A A;  3SIA A;  1DJG A;  2V53 A;  2I2R E;  1K95 A;  1CDM A;  1MR8 A;  1SBJ A;  2K7B A;  3CS1 A;  4YGD B;  3EK7 A;  4GPL B;  1OZS A;  1TUZ A;  3DVM A;  4MVF A;  1UHH A;  5BPJ A;  1BG1 A;  3AKB A;  1OQP A;  1H4B A;  4WQ3 A;  3HCM A;  3FWB A;  2LLU A;  4Q04 A;  4L9M A;  4I5N B;  1TCO B;  2F2P A;  2F8P A;  4FTG A;  3WHT B;  5FYX A;  2SCP A;  2KQ6 A;  1MF8 B;  5I2Q A;  2WCF A;  4OV2 A;  3OBV A;  2ZFD A;  4M2O A;  3OP0 A;  3SG6 A;  3VRN A;  1N65 A;  1RRO A;  1DJH A;  1QS7 A;  2MLE C;  1K2H A;  3CAB A;  3EKJ A;  1CFP A;  2KAV A;  3PSR A;  1CDP A;  2VRG A;  4XYN A;  1QVI Z;  3N7H A;  3CZT X;  3DYE A;  1WDC C;  1KQM C;  1SRA A;  1UHI A;  5F6T A;  2LMV A;  2WC6 A;  3OX6 A;  2KGR A;  1KCY A;  1YUT A;  5FI7 A;  5KSZ A;  1EH2 A;  2Q91 A;  1CNP A;  1DC1 A;  2D8N A;  3BUM B;  4YGC B;  3VB1 A;  2K60 A;  1TRF A;  5G08 A;  1C7V A;  5DKQ A;  1SSE B;  1F8H A;  2QPT A;  5FI6 A;  1RTP 1;  4R1E A;  5CSI A;  1C3Z A;  1HQV A;  3O6B A;  2SAS A;  4JPZ B;  1K94 A;  1NCZ A;  4ICB A;  5GQQ C;  2LVI A;  2MLF C;  2PYQ A;  4DS7 A;  1OZO A;  2GGZ A;  4JQ0 D;  1B7T Z;  2HF5 A;  1QWV A;  3FE6 A;  1CMG A;  3BYA A;  4GGN A;  1PK0 D;  3UO9 A;  2BE4 A;  1UHK A;  4PHJ A;  1KFU S;  1UUS A;  1CFD A;  1NX1 A;  1S3P A;  4M2P A;  1KWO B;  2WC5 A;  5D3O A;  3LK0 A;  3RM1 A;  5J3X A;  3KPX A;  2QEB A;  1JF2 A;  1F71 A;  1AJ5 A;  1Z4H A;  1W9Z A;  3NHT A;  1F55 A;  1SPY A;  2ZRT A;  1AK8 A;  3CDN A;  1QVI Y;  4BY4 A;  2AAO A;  1XVJ A;  4N1G A;  3UNW A;  2G2B A;  2P70 A;  3TDU A;  2F3Z A;  2LVJ A;  2BAP A;  2WCB A;  2ZNE A;  1JF0 A;  1XFV O;  3EKH A;  2CCM A;  2QEV A;  2L5Y A;  2ZN8 A;  5EL2 A;  1TWO A;  2L2C A;  2KBM A;  2WC8 A;  1M63 B;  1S5G Y;  1SL7 A;  1SYM A;  2AMI A;  3D10 A;  2Y1N A;  3SIB A;  2KHN A;  2JXL A;  3SJS A;  1IWQ A;  4U8D A;  1N0Y A;  1VRK A;  1F4Q A;  3RZS A;  2KI4 B;  2L4I A;  4IL1 A;  3K21 A;  4DCK A;  1OOF A;  3BUO B;  3NSO A;  5B8I B;  1IIO A;  3Q8I A;  3R1P A;  1XFW O;  2BE6 A;  1LVC D;  2MJW B;  5HYD A;  2JZI A;  1AUI B;  4C0K A;  3I5G C;  4PHN A;  4IJ7 A;  1KWO C;  1YR5 A;  4NDB A;  2K7O A;  2BCB A;  4MN0 A;  2K2F A;  1YUS A;  1SR6 B;  2MAZ A;  3CTN A;  1DJY A;  4OVN F;  2BCX A;  2I94 A;  4I5J A;  1NPQ A;  2BNX A;  1MXE A;  3NSK A;  4NDC A;  4HRH A;  1OMR A;  1ZAC A;  4GGF C;  2FCD A;  3NHI A;  1YVH A;  4UPG A;  2F2O A;  4JWQ A;  2Y5I A;  2K8M B;  1CKK A;  3BUX B;  4OZD A;  3OB1 B;  1W7J B;  2LHI A;  3C1V A;  2ZND A;  1BR1 B;  2JQ6 A;  2LE9 B;  2JTT A;  3L47 A;  1KK7 Z;  2NCO A;  1TN4 A;  1G33 A;  3R1V A;  1DJX A;  1CM1 A;  4MZK A;  1Y1A A;  1B8R A;  4MRX A;  4NDD A;  1IKU A;  1JWD A;  1NSH A;  2KI4 C;  1V1G A;  3EG5 B;  3D0Y B;  1KFX S;  2KI6 D;  2WCJ A;  3I5F B;  3M0W A;  3OX5 A;  1TCF A;  1BJF A;  2LUX A;  4P5O E;  1SMG A;  4YGA A;  2YGU A;  2Y1M A;  4HSZ A;  4CID A;  2LVK A;  2MRD A;  2ZKM X;  2M29 A;  1K9U A;  1MUX A;  5AFP A;  1ORG A;  1YUU A;  1XO5 A;  1YX7 A;  1QXP A;  5I94 A;  3B6X A;  3PFV A;  4MBE A;  1SR6 C;  3TS5 C;  2KAY A;  1IJ6 A;  1TIZ A;  4DUQ A;  1IQ3 A;  1L7Z A;  1XFY O;  1K93 D;  2LV7 A;  3JVT B;  1EJ3 A;  2KOT A;  2M1K B;  4P2Y B;  2JNF A;  3CLN A;  1BU3 A;  5DKN A;  5HL1 A;  4HRE E;  3IQQ A;  5AAN A;  2L50 A;  2LLS A;  1UHJ A;  1V1F A;  5CSJ A;  4ORA B;  5D7F A;  2LHL A;  1Y0V H;  2EC6 B;  3O78 A;  2AUC A;  3O4Y A;  1C3Y A;  4QJ4 B;  1JSA A;  1KK7 Y;  3SG4 A;  1LXF C;  3CWG A;  3D0Y A;  3RLZ A;  1IGV A;  4MEW A;  3SS4 A;  1M45 A;  1ZMZ A;  1D1O A;  1IJ5 A;  3I5I B;  3I5F C;  1JFJ A;  3L4L A;  3ZWH A;  1LS8 A;  1QV1 A;  1Y1U A;  1WY9 A;  2JPO A;  1QX7 A;  2KPH A;  1SCM B;  4A4C A;  5CPV A;  4CLN A;  1QJT A;  5IBW A;  1B1G A;  1SCV A;  4D1E A;  2OTG C;  1U5I A;  1LA0 A;  2NCP A;  4N5X A;  1XYD A;  2TN4 A;  1NCY A;  1MQ1 A;  2H2K A;  2F3Y A;  1S5G Z;  2HET A;  1DQE A;  1B4C A;  4PE1 A;  1RK9 A; 
#chains in the Genus database with same CATH homology
 5K89 A;  2M97 A;  4XJK A;  4GNK B;  1AHR A;  1DJW A;  4AOM A;  3FIA A;  2KSP A;  3VRR A;  4YRU A;  2CXJ A;  2FCE A;  3WHU B;  5I2L A;  3PN7 B;  3F45 A;  3SG3 A;  1NX2 A;  1A2X A;  1DVI A;  4FQO A;  3SG2 A;  1TNW A;  4AQJ A;  1YX8 A;  1TTX A;  1SK6 D;  1S26 D;  2K0J A;  1IG5 A;  2LC5 A;  1CFF A;  4OKH A;  1EG3 A;  1RJV A;  1NP8 A;  1AVS A;  2PAL A;  1OMV A;  4ZCV A;  4F0Z B;  1PVA A;  1C7W A;  1HT9 A;  1XK4 A;  3I5H B;  1CDN A;  1F54 A;  2L98 A;  2BL0 B;  1MXL C;  3HX4 A;  1ALV A;  1S1E A;  2JC2 A;  2NLN A;  3GK1 A;  2LMT A;  2JT0 A;  2M9G A;  3IQO A;  4MZL A;  5HKW A;  5AER A;  1DF0 B;  2KI6 C;  2JPT A;  4PE4 A;  3JTD B;  1KFU L;  2MBX A;  3BUN B;  3VRP A;  1KK8 B;  3PN7 C;  1M46 A;  1A4P A;  1E8A A;  3E3R A;  3LL8 B;  3PLF B;  2JOJ A;  1EG4 A;  4ETO A;  3DVE A;  1REC A;  2BKI B;  1YTZ C;  2MHH A;  2ISD A;  1K96 A;  5HKZ A;  1SL8 A;  1SNL A;  3MSE B;  3NSL A;  1CB1 A;  4M2Q A;  3O2P A;  1QLS A;  2EGD A;  2IS9 A;  2E30 A;  2I18 A;  1A03 A;  1CDL A;  3CGA A;  1K9P A;  2RGI A;  4TNC A;  3SG5 A;  1Q80 A;  1OSA A;  1XFU O;  4N1F A;  1PSB A;  4GBA A;  1BT6 A;  1UP5 A;  2WCE A;  1WLM A;  2H61 A;  2PVB A;  3ZNI A;  1LIN A;  3I5H C;  2HQ8 A;  1SL9 A;  4E68 A;  4MZJ A;  3NXA A;  2BL0 C;  2H61 C;  1DF0 A;  3EVV A;  1G4Y R;  1DT7 B;  1QTX A;  3LK1 A;  2M7L A;  4MRY A;  2P6B B;  2QAC A;  2WOS A;  1B47 A;  1NCX A;  3TDZ A;  2E6W A;  1J7P A;  1OOJ A;  2LUC A;  1DJI A;  1KK8 C;  4DIR A;  3EVU A;  4BY5 A;  1BOC A;  1J55 A;  1NUB A;  2KBI A;  2HQW A;  2PRU A;  1S6J A;  4PHM A;  2K61 A;  1PAL A;  3DF0 B;  1MHO A;  2CT9 A;  4USL A;  1YRU B;  1K8U A;  1S6C A;  4WRI A;  1OE9 B;  1UUR A;  3GK2 A;  2KYF A;  1U5I B;  4PE7 A;  4AQI A;  2M0R A;  3OB2 B;  2CNP A;  4I5K A;  1SW8 A;  2KAX A;  2OPO A;  1FF1 A;  2Y4Q A;  1M31 A;  2KFH A;  2MA2 A;  3EVR A;  2BCA A;  5KTY A;  2O60 A;  1QX5 B;  4PE0 A;  2LVV A;  1J1E A;  3PAT A;  1F70 A;  1Y6W A;  3KO0 A;  3BXK A;  3KEV A;  1N2D A;  1K90 D;  4XJK B;  3AAK A;  1J7O A;  1WRZ A;  3LLE A;  1CM4 A;  2COL B;  1WDC B;  5KU1 A;  1KQM B;  3EK8 A;  1KFX L;  1ZOT B;  1LA3 A;  1F4O A;  2CBL A;  2FOT A;  2B1U A;  5AXI A;  1B8C A;  5TNC A;  1X02 A;  2M3W A;  1A29 A;  1PVB A;  1NYA A;  1EXR A;  4GAO A;  4YGE B;  1CFC A;  1JFK A;  1FW4 A;  3DF0 A;  4GFT A;  5ER4 X;  1KQV A;  2JU0 A;  1KSO A;  2WND A;  3BOW B;  4OCI A;  4YI8 A;  1ODB A;  3GK4 X;  3WNX B;  3FWC A;  1BF5 A;  2A4J A;  1XA5 A;  4YGB B;  1K9K A;  2LNK A;  4WQ2 A;  2LCP A;  1JUO A;  1PSR A;  3TZ1 A;  3A4U B;  3PAL A;  1SKT A;  3JVT C;  5DKR A;  1S36 A;  4ZCU A;  1IRJ A;  1GJY A;  2CTN A;  2LAP A;  2KQY A;  1CMF A;  1PRW A;  2EHB A;  2JUL A;  2LLT A;  3CR2 A;  4HRG A;  1KSM A;  1FI6 A;  1AJ4 A;  2KDH A;  4C0J A;  2JNX A;  2ZN9 A;  1TNQ A;  1J7R A;  4CPV A;  2EC6 C;  2JRF A;  1RFJ A;  1R6P A;  2L5X B;  1Y1X A;  2JT3 A;  1M39 A;  1OMD A;  1GGW A;  5CSF A;  2LP2 A;  1BR4 B;  1WLZ A;  2JWW A;  2PSR A;  3DVJ A;  3FS7 A;  2LP3 A;  3I5I C;  4YBH B;  2DOQ A;  2PAS A;  4MLW A;  2K7C A;  1DGV A;  3BOW A;  2JTZ A;  1QV0 A;  1YRT B;  3VRQ A;  1SCM C;  1B9A A;  1BMO A;  1UWO A;  1J7Q A;  1QX2 A;  1CLL A;  3H4S E;  3OHM B;  1ZFS A;  3AKA A;  2L0P A;  2KGB C;  2O5G A;  1DMO A;  4OR9 B;  2GGM A;  1BLQ A;  1H8B A;  4DRW A;  1L2O B;  2NXQ A;  2HPS A;  3I5G B;  4GUK A;  1PUL A;  1XK4 C;  1TNX A;  1NWD A;  1UHN A;  5PAL A;  1QIW A;  4QJ5 B;  2KFF A;  4ORB B;  3TUY B;  3DVK A;  3TDI A;  2FJU B;  3KHE A;  1C07 A;  2M8U A;  1DGU A;  2LAN A;  1DTL A;  5AEQ A;  3CR4 X;  1AP4 A;  2BKH B;  1TNP A;  2KYC A;  3AAJ A;  1CLB A;  1A75 B;  1W7I B;  3CR5 X;  2GV5 A;  2G9B A;  1SY9 A;  5ER5 A;  3EK4 A;  1RWY A;  4A4B A;  1NX3 A;  3GOF A;  5D69 A;  4CFR A;  3DD4 A;  1B7T Y;  3BUW B;  3KF9 A;  1DJZ A;  1MWN A;  3A8R A;  1BOD A;  1B8L A;  2LM5 A;  4PDZ A;  1JBA A;  4ORC B;  1QIV A;  1L2O C;  1NX0 A;  1XFZ O;  1TOP A;  2BBM A;  1CTR A;  2JT8 A;  1IQ5 A;  3WXA A;  2L51 A;  1QAS A;  1CLM A;  1XFX O;  3TUY C;  3NSI A;  1QAT A;  2OS8 B;  3TS5 B;  1WRL A;  3IF7 A;  1WRK A;  4GGF A;  3JTD C;  5JOL A;  4PAL A;  1G8I A;  2F33 A;  2L4H A;  3QRX A;  3VGO A;  5HKY A;  1EL4 A;  1A75 A;  2PMY A;  3PM8 A;  1ZUZ A;  2WOR A;  1YUR A;  5CSN A;  1ALW A;  1GGZ A;  2R2I A;  2Q4U A;  2KFG A;  2M1U A;  4YI9 A;  2NZ0 A;  1FI5 A;  1FPW A;  5JJG A;  1R2U A;  2BBN A;  4CFQ A;  1J1D A;  1LKJ A;  1NIW A;  3LCP C;  1FBV A;  4MSP A;  2M7N A;  3ICB A;  4PHK A;  1JC2 A;  2BEC A;  2K7D A;  3VRO A;  4QJ3 B;  2L2E A;  4I5L B;  4C0L A;  3SG7 A;  1S6I A;  1GQM A;  1YVL A;  5HLV A;  2JXC A;  5I2O A;  4NQG A;  4PCW A;  2KNE A;  5HLO A;  1QLK A;  2OTG B;  2ZRS A;  2M49 B;  2K2A A;  1IH0 A;  3BQ3 A;  2LMU A;  2OS8 C;  5I8N A;  2I7A A;  3SIA A;  1DJG A;  2V53 A;  2I2R E;  1K95 A;  1CDM A;  1MR8 A;  1SBJ A;  2K7B A;  3CS1 A;  4YGD B;  3EK7 A;  4GPL B;  1OZS A;  3DVM A;  4MVF A;  1UHH A;  5BPJ A;  1BG1 A;  3AKB A;  1OQP A;  1H4B A;  4WQ3 A;  3HCM A;  3FWB A;  2LLU A;  4Q04 A;  4L9M A;  4I5N B;  1TCO B;  2F2P A;  2F8P A;  4FTG A;  3WHT B;  5FYX A;  2SCP A;  2KQ6 A;  1MF8 B;  5I2Q A;  2WCF A;  4OV2 A;  2ZFD A;  4M2O A;  3OP0 A;  3SG6 A;  3VRN A;  1N65 A;  1RRO A;  1DJH A;  1QS7 A;  2MLE C;  1K2H A;  3EKJ A;  1CFP A;  2KAV A;  3PSR A;  1CDP A;  2VRG A;  4XYN A;  1QVI Z;  3CZT X;  1WDC C;  1KQM C;  1SRA A;  1UHI A;  5F6T A;  2LMV A;  3OX6 A;  2KGR A;  1KCY A;  1YUT A;  5KSZ A;  1EH2 A;  2Q91 A;  1CNP A;  2D8N A;  3BUM B;  4YGC B;  1TRF A;  5G08 A;  1C7V A;  5DKQ A;  1F8H A;  2QPT A;  1RTP 1;  4R1E A;  5CSI A;  1HQV A;  3O6B A;  4JPZ B;  2SAS A;  1K94 A;  1NCZ A;  4ICB A;  5GQQ C;  2LVI A;  2MLF C;  4DS7 A;  1OZO A;  2GGZ A;  4JQ0 D;  1B7T Z;  2HF5 A;  1CMG A;  3BYA A;  4GGN A;  1PK0 D;  2BE4 A;  1UHK A;  4PHJ A;  1KFU S;  1CFD A;  1NX1 A;  1S3P A;  1UUS A;  4M2P A;  1KWO B;  3RM1 A;  3LK0 A;  5J3X A;  3KPX A;  1JF2 A;  1F71 A;  1AJ5 A;  1F55 A;  1SPY A;  2ZRT A;  1AK8 A;  1QVI Y;  4BY4 A;  2AAO A;  1XVJ A;  4N1G A;  2G2B A;  3TDU A;  2F3Z A;  2LVJ A;  2WCB A;  2ZNE A;  1JF0 A;  1XFV O;  3EKH A;  2CCM A;  2ZN8 A;  2KBM A;  2WC8 A;  1M63 B;  1S5G Y;  1SL7 A;  1SYM A;  2AMI A;  3D10 A;  2Y1N A;  3SIB A;  2KHN A;  2JXL A;  3SJS A;  1IWQ A;  4U8D A;  1N0Y A;  1VRK A;  1F4Q A;  2KI4 B;  2L4I A;  4IL1 A;  3K21 A;  4DCK A;  3BUO B;  3NSO A;  5B8I B;  1XFW O;  2BE6 A;  1LVC D;  2MJW B;  5HYD A;  2JZI A;  1AUI B;  4C0K A;  3I5G C;  4PHN A;  1KWO C;  1YR5 A;  4NDB A;  2K7O A;  2BCB A;  4MN0 A;  2K2F A;  1YUS A;  1SR6 B;  2MAZ A;  3CTN A;  1DJY A;  4OVN F;  2BCX A;  2I94 A;  4I5J A;  1NPQ A;  4NDC A;  1MXE A;  3NSK A;  4HRH A;  1OMR A;  1ZAC A;  4GGF C;  2FCD A;  1YVH A;  4UPG A;  2F2O A;  4JWQ A;  2Y5I A;  2K8M B;  1CKK A;  3BUX B;  3OB1 B;  1W7J B;  2LHI A;  3C1V A;  2ZND A;  1BR1 B;  2JQ6 A;  2LE9 B;  2JTT A;  1KK7 Z;  2NCO A;  1TN4 A;  1G33 A;  4MZK A;  1DJX A;  1CM1 A;  1IKU A;  1Y1A A;  1B8R A;  4MRX A;  4NDD A;  1JWD A;  1NSH A;  2KI4 C;  1V1G A;  3D0Y B;  1KFX S;  2KI6 D;  3M0W A;  3I5F B;  3OX5 A;  1TCF A;  1BJF A;  2LUX A;  4P5O E;  1SMG A;  4YGA A;  2Y1M A;  4HSZ A;  4CID A;  2LVK A;  2MRD A;  2ZKM X;  2M29 A;  1K9U A;  1MUX A;  5AFP A;  1YUU A;  1XO5 A;  1YX7 A;  1QXP A;  3PFV A;  4MBE A;  1SR6 C;  3TS5 C;  2KAY A;  1IJ6 A;  1TIZ A;  4DUQ A;  1IQ3 A;  1L7Z A;  1XFY O;  1K93 D;  2LV7 A;  3JVT B;  1EJ3 A;  2KOT A;  2M1K B;  4P2Y B;  2JNF A;  3CLN A;  1BU3 A;  5DKN A;  4HRE E;  3IQQ A;  5AAN A;  2L50 A;  2LLS A;  1UHJ A;  1V1F A;  5CSJ A;  4ORA B;  5D7F A;  2LHL A;  1Y0V H;  2EC6 B;  3O78 A;  2AUC A;  3O4Y A;  1JSA A;  4QJ4 B;  1KK7 Y;  3SG4 A;  1LXF C;  3CWG A;  3D0Y A;  3RLZ A;  1IGV A;  4MEW A;  1D1O A;  1M45 A;  1ZMZ A;  1IJ5 A;  3I5I B;  3I5F C;  1JFJ A;  3ZWH A;  1QV1 A;  1Y1U A;  1WY9 A;  1QX7 A;  1SCM B;  4A4C A;  5CPV A;  4CLN A;  1QJT A;  5IBW A;  1B1G A;  1SCV A;  4D1E A;  2OTG C;  1U5I A;  1LA0 A;  2NCP A;  4N5X A;  1XYD A;  2TN4 A;  1NCY A;  1MQ1 A;  2H2K A;  2F3Y A;  1S5G Z;  2HET A;  1B4C A;  4PE1 A;  1RK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...