2KOTA

Solution structure of s100a13 with a drug amlexanox
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Molecular level interactions of S100A13 with amlexanox: inhibitor for the formation of multi-protein complex in non-classical pathway of the acidic fibroblast growth factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kotA00
4DUQA 2JULA 3BUNB 1BLQA 2BL0B 1DJYA 4M2QA 1KSOA 3BYAA 2M49B 1QJTA 5JOLA 2JT8A 1YTZC 2M3WA 3DD4A 5BPJA 1K95A 3FIAA 5KU1A 1DTLA 1KCYA 2EHBA 3VGOA 1K9KA 3OHMB 3D10A 2PSRA 1G8IA 4MRYA 3TZ1A 1K96A 4R1EA 1KK7Y 1KFXS 2NZ0A 2F8PA 1QTXA 1QX5B 1R2UA 1TNPA 3DF0A 1S26D 5HKZA 2L98A 2KFFA 1QV1A 2BCXA 1BR1B 1ZUZA 3AAJA 1JF0A 2BE4A 1CLLA 1XK4C 2HF5A 2MLFC 2KHNA 1SW8A 4HREE 1S6IA 3FWCA 1KWOB 1TNXA 1A4PA 4YGBB 3SIAA 2F2PA 2O60A 1TRFA 1PULA 3AAKA 4JQ0D 3CWGA 2HQWA 1HT9A 1AJ5A 1MR8A 3MSEB 1C7VA 2HQ8A 4MZKA 5TNCA 3TDIA 1BF5A 2MHHA 1QVIZ 1ODBA 1WY9A 2L0PA 1F8HA 1ZOTB 4QJ5B 5AFPA 4E68A 1SCMC 2KAXA 1QX7A 5KSZA 1CDLA 4ORCB 3WNXB 1QLSA 3OB2B 2LVJA 3VRQA 5AEQA 1XFWO 4WRIA 1PVAA 3TS5B 1ZMZA 5B8IB 2G2BA 3QRXA 1QV0A 1MF8B 1AUIB 2L5XB 1BJFA 5D7FA 1XFZO 2PALA 5CSFA 1GGZA 1Y0VH 2R2IA 1SBJA 2KSPA 3I5GC 1NYAA 2KQ6A 2JU0A 1SK6D 1B8LA 4CLNA 1CFDA 3CTNA 2H61C 5CPVA 2WORA 2EC6B 3PN7B 2ZRTA 1IJ6A 3NSLA 5FYXA 2L4HA 1JFJA 3BUOB 1QLKA 2BL0C 2LVIA 2OS8C 3BOWA 1DF0B 1OOJA 1EXRA 4PHJA 4USLA 1B1GA 1F54A 1EG4A 4DS7A 1NCYA 3SG2A 2PASA 3F45A 2JNXA 5I8NA 1AHRA 2I2RE 3LK0A 3RLZA 4HRHA 2M7LA 3O6BA 1VRKA 2GV5A 5AERA 2M1KB 1IH0A 2LC5A 4MLWA 1E8AA 4CFRA 2QACA 2KI4B 2VRGA 2WC8A 1U5IB 2Y1MA 2I18A 1F4OA 2F3ZA 4GGFA 2E6WA 3LK1A 1ZACA 1L2OC 4GBAA 2K7DA 2B1UA 1BODA 2GGMA 1PALA 4MRXA 2BE6A 2AMIA 5K89A 2JXLA 1OSAA 2KI6C 4FQOA 3SG6A 2M9GA 2L4IA 2M97A 3CLNA 1MWNA 1OE9B 1XA5A 1L7ZA 2F33A 1YVHA 4N1GA 2LLUA 3M0WA 5D69A 4AQJA 2V53A 1GQMA 1QVIY 1AK8A 2JC2A 2KNEA 1F4QA 3GK2A 1YRUB 2M8UA 2JRFA 3JVTB 1M45A 2M7NA 2LVVA 3A4UB 1NIWA 3SJSA 4PE4A 4YRUA 4A4CA 4YGDB 1IRJA 5AANA 1B4CA 1NX1A 1IQ5A 2PMYA 4YI9A 2JWWA 2NXQA 4GNKB 1YURA 3GK1A 3BUMB 2CT9A 2MJWB 2P6BB 1S3PA 1M46A 1OMVA 3ICBA 2IS9A 1FW4A 5DKRA 1G4YR 1XVJA 3EVUA 1QASA 2K7BA 4YGEB 1N0YA 2AUCA 2ISDA 1V1FA 4C0LA 4ZCVA 4YGCB 1B9AA 3D0YA 4OKHA 1F70A 1FPWA 2ZKMX 2KYCA 1UHHA 1SR6B 3CGAA 2ZRSA 5JJGA 1FI6A 3PM8A 3PLFB 3KEVA 1LINA 2LMVA 2KYFA 1MQ1A 1SRAA 1CLBA 1S1EA 1QIWA 1KFUS 4MEWA 1XO5A 1EJ3A 2LCPA 5PALA 1FF1A 1DF0A 2JXCA 2KDHA 3IQOA 4PALA 1QX2A 1YRTB 1J7PA 1IGVA 1TCOB 1K2HA 1J7QA 1MUXA 2WCBA 1XK4A 2AAOA 2H2KA 4QJ4B 3TDUA 3K21A 1RJVA 2JZIA 1X02A 1WRKA 2LP3A 1KK8B 2K2AA 1B8RA 2BKHB 2K7CA 3BQ3A 4AOMA 3I5HB 1QS7A 1DVIA 1F55A 1TOPA 1DGVA 1R6PA 1CDPA 2Y4QA 3C1VA 3AKBA 2F2OA 1K94A 1TIZA 2JQ6A 1M39A 1K9UA 2LVKA 2CCMA 1A75A 1NX3A 5CSIA 4DIRA 1N65A 3EK7A 1DJZA 1CM1A 1LA0A 1M63B 4MVFA 1DJHA 2CXJA 3EKJA 3BUXB 3BUWB 2E30A 2LLSA 1K9PA 3OP0A 1NX2A 3O2PA 2GGZA 1W7JB 1CMGA 2TN4A 2K2FA 4ICBA 3OB1B 1HQVA 3NXAA 4P2YB 1KQMC 2WNDA 2ZNEA 1JC2A 4MZJA 2L50A 3TUYB 3JVTC 1YR5A 3NSIA 4GPLB 1Q80A 2CNPA 1WLMA 1OMRA 2JT3A 2H61A 1LVCD 1J55A 3CR4X 2FOTA 1WRZA 1UHKA 4PE1A 1J7RA 2KFGA 2LUCA 3DVEA 2ZN8A 2LNKA 1DMOA 3LLEA 1NPQA 3CR5X 1PRWA 5ER4X 4OR9B 2JNFA 3RM1A 3KHEA 4M2PA 1SKTA 4PHMA 2Q91A 1OZSA 1SCVA 3SG3A 3I5FB 1XYDA 4ZCUA 4MN0A 2ZN9A 2K8MB 1NP8A 5HKYA 1CNPA 2KBIA 2KAVA 3A8RA 1SR6C 1RROA 1XFYO 4N5XA 1CDNA 2WOSA 3DF0B 1YUTA 5GQQC 3JTDB 4FTGA 1C07A 1JFKA 3NSKA 2L2EA 1CLMA 3LCPC 3VRRA 1AVSA 1SMGA 1DJWA 3NSOA 1MXLC 5F6TA 3VRNA 1KWOC 3KO0A 2JPTA 1MXEA 2JTZA 1QATA 3CZTX 1YUSA 1J1DA 1YUUA 3EK4A 4M2OA 4ORBB 3I5HC 1B8CA 3VROA 4PHNA 1WLZA 1YX7A 3FWBA 1DJGA 2FJUB 2HETA 2FCDA 1PSBA 3EK8A 5HKWA 1S36A 2CBLA 3OX5A 2BCAA 2QPTA 4MBEA 4XYNA 3EVVA 3AKAA 5HYDA 1A03A 1C7WA 1J7OA 2ZNDA 3TS5C 3I5IB 1OZOA 3SG7A 3IF7A 1J1EA 2MRDA 1IQ3A 5I2LA 1B7TZ 1S5GZ 1UUSA 3PALA 1ALWA 1GJYA 1TCFA 4P5OE 1OMDA 1RTP1 5AXIA 1M31A 3TUYC 3WHTB 4HSZA 4PDZA 1CMFA 2LMTA 2DOQA 1XFXO 2KOTA 4I5KA 5HLOA 2PRUA 2WCEA 2LP2A 2OTGB 2Y1NA 2EC6C 4CPVA 3PN7C 1LA3A 1UURA 3FS7A 5DKNA 4C0KA 4OCIA 2LANA 2KFHA 3DVKA 3OX6A 5DKQA 2I94A 1H4BA 4N1FA 1SL7A 1H8BA 1TN4A 2KI6D 1CKKA 2D8NA 3BOWB 1XFUO 2OS8B 2M0RA 3ZWHA 1TNQA 1UHIA 3PFVA 4DCKA 1B47A 2Y5IA 3I5FC 1NCZA 2BBNA 3PSRA 4GFTA 1ALVA 4MSPA 3TDZA 2Q4UA 2LV7A 2CTNA 1ZFSA 2KGBC 4PHKA 3E3RA 2K0JA 5ER5A 2KI4C 5J3XA 2LHIA 1K8UA 3H4SE 3JTDC 4NQGA 1FBVA 4NDDA 1U5IA 1EL4A 3SIBA 3ZNIA 2JOJA 2M1UA 4WQ3A 1WRLA 4Q04A 3HCMA 1L2OB 1IWQA 3VRPA 1JBAA 1SY9A 2G9BA 2SCPA 2KQYA 1BT6A 1TNWA 4U8DA 2HPSA 1SNLA 1Y1XA 4PE0A 4BY5A 4YBHB 1Y1UA 4GUKA 4UPGA 1K90D 1JSAA 3O4YA 4XJKB 1NUBA 4BY4A 1IKUA 4A4BA 1A2XA 4PE7A 1PVBA 4CFQA 1CFPA 2WCFA 5CSJA 3CS1A 3KPXA 2O5GA 1NWDA 1IJ5A 2LE9B 1CFFA 1CM4A 1LKJA 4AQIA 4IL1A 3I5IC 1WDCB 1A29A 1W7IB 1YVLA 1IG5A 2A4JA 2NCPA 1B7TY 1S5GY 1KFXL 1SL9A 1SL8A 2JTTA 3SG5A 1AP4A 3HX4A 5KTYA 1UHJA 2K61A 4F0ZB 5IBWA 1RFJA 5I2QA 1K93D 2FCEA 2NLNA 4TNCA 1KFUL 4GGNA 4MZLA 1BG1A 1S6CA 2I7AA 1MHOA 2OTGC 3GOFA 1OQPA 1EH2A 1G33A 4ETOA 2LUXA 1QXPA 1KK7Z 3D0YB 1FI5A 2MA2A 2LAPA 4I5LB 1NSHA 4DRWA 4QJ3B 3IQQA 2OPOA 3DVJA 4JPZB 1RWYA 5HLVA 5I2OA 2BCBA 2JT0A 2RGIA 4I5NB 4NDBA 1AJ4A 1BMOA 1NCXA 4PCWA 2MBXA 1Y1AA 1KQVA 4HRGA 3WHUB 2KGRA 2SASA 4OV2A 1DGUA 2PVBA 1KK8C 1S6JA 2L51A 4NDCA 1EG3A 2LHLA 3KF9A 1BU3A 5CSNA 1CFCA 1JWDA 2LLTA 4L9MA 3CR2A 2F3YA 1RECA 1V1GA 1F71A 1LXFC 1DT7B 1YX8A 1TTXA 4WQ2A 1DJIA 2EGDA 4GGFC 3SG4A 4C0JA 1GGWA 1RK9A 3BXKA 2BBMA 2COLB 1SCMB 2NCOA 2MLEC 1A75B 1UHNA 2MAZA 2BECA 1NX0A 1JF2A 4YGAA 4I5JA 2KAYA 1SPYA 1N2DA 1BOCA 1JUOA 3DVMA 4ORAB 3EKHA 3O78A 3GK4X 2BKIB 1QIVA 1KSMA 1UP5A 2LM5A 3EVRA 4XJKA 4D1EA 3LL8B 5G08A 1SYMA 1XFVO 2LMUA 1Y6WA 1CTRA 1BR4B 1KQMB 1PK0D 4CIDA 3I5GB 2K7OA 3PATA 1UWOA 1D1OA 4OVNF 1WDCC 2M29A 4YI8A 1CB1A 3WXAA 2ZFDA 1PSRA 2KBMA 4GAOA 1CDMA 4JWQA 1DJXA
chains in the Genus database with same CATH superfamily
4DUQA 2JULA 3BUNB 1BLQA 2BL0B 1DJYA 3D75A 4M2QA 1KSOA 3BYAA 2PQLA 2BNXA 2M49B 1QJTA 5JOLA 1P28A 2JT8A 5DICA 1YTZC 2M3WA 3UNWA 3DD4A 5BPJA 1K95A 3FIAA 2KPHA 5KU1A 1DTLA 1KCYA 2EHBA 3VGOA 1K9KA 3OHMB 3D10A 2PSRA 1G8IA 4MRYA 3TZ1A 1K96A 4R1EA 1KK7Y 1KFXS 2NZ0A 2F8PA 1QTXA 1QX5B 1R2UA 1TNPA 1DC1A 3B88A 3DF0A 1S26D 3B7AA 5HKZA 2L98A 2P71A 2KFFA 1QV1A 2BCXA 1BR1B 1ZUZA 3AAJA 1JF0A 2BE4A 1CLLA 1XK4C 2HF5A 2MLFC 2KHNA 1SW8A 4HREE 1S6IA 3FWCA 1KWOB 1TNXA 1A4PA 4YGBB 3SIAA 5FI6A 3S0AA 2F2PA 3IVTA 3RZSA 2O60A 1TRFA 1PULA 3AAKA 4JQ0D 3CWGA 2HQWA 1HT9A 1AJ5A 1MR8A 1ORGA 3MSEB 1C7VA 2HQ8A 4MZKA 5TNCA 3TDIA 1BF5A 2MHHA 1QVIZ 1ODBA 1WY9A 2L0PA 1F8HA 1ZOTB 4QJ5B 5AFPA 4E68A 1SCMC 2KAXA 1GM0A 1QX7A 5KSZA 4JKTA 1CDLA 4ORCB 3WNXB 1QLSA 3OB2B 2LVJA 4INWA 3VRQA 5AEQA 1XFWO 4WRIA 1PVAA 3TS5B 1ZMZA 5B8IB 2G2BA 3QRXA 1QV0A 1MF8B 1AUIB 1OOHA 2L5XB 1BJFA 3B87A 5D7FA 1XFZO 2PALA 5CSFA 1GGZA 1Y0VH 5I94A 1TUJA 2R2IA 1SBJA 2KSPA 3I5GC 1NYAA 2KQ6A 2JU0A 1SK6D 1B8LA 4CLNA 1CFDA 3CTNA 2H61C 5CPVA 2WORA 2EC6B 3PN7B 2ZRTA 1IJ6A 3N7HA 3NSLA 1Z2CB 5FYXA 2L4HA 1JFJA 3BUOB 5HL1A 1QLKA 2BL0C 2LVIA 2OS8C 3BOWA 2L5YA 1DF0B 1OOJA 1EXRA 4PHJA 4USLA 3L47A 1B1GA 1F54A 1EG4A 3SS4A 3SS3A 4DS7A 1NCYA 3SG2A 2PASA 3BFAA 3UO9A 3F45A 2JNXA 5I8NA 1AHRA 2I2RE 3LK0A 3RLZA 4HRHA 2M7LA 3O6BA 1VRKA 2GV5A 5AERA 2M1KB 1IH0A 2LC5A 4MLWA 1E8AA 4CFRA 2QACA 2KI4B 2VRGA 2WC8A 1U5IB 2Y1MA 2I18A 1F4OA 2F3ZA 4GGFA 2E6WA 3LK1A 1ZACA 2P70A 1L2OC 5FI2A 4GBAA 2K7DA 2B1UA 3B86A 1BODA 2GGMA 1PALA 4MRXA 2BE6A 2AMIA 5K89A 2JXLA 1OSAA 2KI6C 4FQOA 3SG6A 2M9GA 2L4IA 2M97A 2QEHA 3CLNA 3S0BA 1MWNA 1OE9B 1XA5A 1L7ZA 2F33A 1YVHA 4N1GA 2LLUA 3M0WA 5D69A 4AQJA 2V53A 1GQMA 1QVIY 1AK8A 2JC2A 2KNEA 1F4QA 3CABA 3GK2A 1YRUB 2M8UA 2JRFA 3JVTB 1M45A 2M7NA 3CZ0A 2LVVA 3A4UB 1NIWA 3SJSA 4PE4A 4YRUA 1XFRA 1DEKA 4A4CA 4YGDB 1IRJA 5AANA 1B4CA 1NX1A 1IQ5A 2PMYA 4YI9A 2JWWA 2NXQA 3DZTA 4GNKB 1YURA 3GK1A 3BUMB 2CT9A 2MJWB 2P6BB 1S3PA 4INXA 1M46A 1OMVA 3ICBA 2IS9A 3S0FA 1FW4A 3K1EA 5DKRA 1G4YR 1XVJA 3EVUA 4FQTA 1QASA 2K7BA 4YGEB 1N0YA 2AUCA 2ISDA 1V1FA 4C0LA 2K60A 4YGCB 1B9AA 3D0YA 4OKHA 4ZCVA 1F70A 2ZKMX 1FPWA 2KYCA 1UHHA 1SR6B 3CGAA 2ZRSA 5JJGA 1FI6A 3PM8A 3PLFB 3KEVA 1LINA 2LMVA 2KYFA 1MQ1A 1SRAA 1CLBA 1S1EA 1QIWA 3NHTA 1KFUS 4MEWA 1XO5A 1EJ3A 2LCPA 5PALA 1FF1A 1DF0A 2JXCA 2KDHA 3IQOA 4PALA 1QX2A 1YRTB 1J7PA 1IGVA 1TCOB 1OOIX 1K2HA 1J7QA 1MUXA 2WCBA 1XK4A 2AAOA 2H2KA 4QJ4B 3TDUA 3K21A 1RJVA 2JZIA 4IJ7A 4F7FA 1X02A 1WRKA 2LP3A 1KK8B 2K2AA 1B8RA 2BKHB 2K7CA 3BQ3A 4AOMA 3I5HB 1QS7A 1DVIA 2L2CA 1F55A 1TOPA 1DGVA 1T14A 3R1OA 1R6PA 1CDPA 2WCMA 2Y4QA 3C1VA 3AKBA 4PT1A 2F2OA 1K94A 1TIZA 1IIOA 5FI7A 2JQ6A 1M39A 1K9UA 2LVKA 2CCMA 1A75A 1NX3A 5CSIA 4DIRA 1N65A 3EK7A 1DJZA 1CM1A 1LA0A 1M63B 4MVFA 1DJHA 2CXJA 3EKJA 1W9ZA 3BUXB 3BUWB 2E30A 2LLSA 1K9PA 3OP0A 3DXLA 1NX2A 3O2PA 2GGZA 1W7JB 1CMGA 2TN4A 3S0DA 2K2FA 4ICBA 3OB1B 1HQVA 3NXAA 4P2YB 1KQMC 2WNDA 2ZNEA 1JC2A 1C3ZA 2WCHA 2L50A 4MZJA 3TUYB 2FJYA 3JVTC 1YR5A 3D73A 3R1PA 3NSIA 4GPLB 1Q80A 2CNPA 1WLMA 1OMRA 2JT3A 2H61A 1LVCD 1J55A 3CR4X 3S0GA 2KLEA 2FOTA 1WRZA 1UHKA 4PE1A 1J7RA 2KFGA 2LUCA 3DVEA 1QWVA 2LNKA 2ZN8A 1DMOA 3LLEA 1NPQA 2WC5A 3CR5X 1PRWA 5ER4X 3VB1A 4OR9B 2JPOA 2JNFA 2WCLA 3RM1A 3KHEA 4M2PA 1SKTA 4PHMA 2Q91A 3L4AA 1OZSA 1SCVA 3SG3A 3I5FB 1XYDA 4ZCUA 2QEBA 1Z4HA 4MN0A 2ZN9A 3OBVA 2K8MB 1NP8A 5HKYA 1CNPA 2KBIA 3BFBA 2KAVA 3A8RA 1SR6C 1RROA 1XFYO 2YGUA 4N5XA 1CDNA 2WOSA 3DF0B 1YUTA 5GQQC 3JTDB 4FTGA 1C07A 2ERBA 1OOGA 1JFKA 3NSKA 2L2EA 1CLMA 3LCPC 3VRRA 1AVSA 1SMGA 1DJWA 3NSOA 1MXLC 5F6TA 3VRNA 1KWOC 3KO0A 2JPTA 1MXEA 2JTZA 1QATA 3CZ1A 3CZTX 1YUSA 1J1DA 1YUUA 3EK4A 4M2OA 4ORBB 3D77A 3I5HC 1B8CA 3VROA 4OZDA 4PHNA 1WLZA 5EL2A 1YX7A 3FWBA 1DJGA 2FJUB 2HETA 2FCDA 1PSBA 3EK8A 5HKWA 3NHIA 1S36A 3CDNA 2CBLA 3OX5A 2BCAA 2QPTA 4MBEA 4XYNA 3EVVA 3AKAA 5HYDA 3B6XA 3QMEA 1A03A 1C7WA 1J7OA 2ZNDA 3TS5C 2WCJA 3I5IB 1OZOA 3SG7A 3IF7A 1J1EA 2MRDA 1IQ3A 3Q8IA 5I2LA 1B7TZ 1S5GZ 3PJIA 1UUSA 1C3YA 3PALA 1ALWA 1GJYA 1TCFA 4P5OE 1OMDA 1RTP1 5AXIA 1M31A 3TUYC 3WHTB 4HSZA 4PDZA 2H8VA 1CMFA 2LMTA 2DOQA 3S0EA 1XFXO 2KOTA 4I5KA 5HLOA 2PRUA 2WCEA 2LP2A 2OTGB 2Y1NA 1JWDA 2EC6C 4KYNA 4CPVA 3PN7C 1LA3A 1UURA 3FS7A 5DKNA 4C0KA 4OCIA 2LANA 2KFHA 3DVKA 3OX6A 2QEVA 2I94A 5DKQA 4N1FA 1SL7A 1H4BA 3BFHA 1TN4A 1H8BA 2KI6D 1CKKA 2D8NA 3BOWB 1XFUO 2OS8B 2M0RA 3ZWHA 1TNQA 1UHIA 3PFVA 4DCKA 1B47A 2QEOA 2Y5IA 1NCZA 3I5FC 2BBNA 3PSRA 4GFTA 1ALVA 4MSPA 3TDZA 2Q4UA 2LV7A 2CTNA 1ZFSA 2KGBC 4PHKA 3E3RA 2K0JA 5ER5A 2KI4C 5J3XA 2LHIA 1K8UA 3CZ2A 3H4SE 3JTDC 4NQGA 1FBVA 4NDDA 1U5IA 1EL4A 3SIBA 2GTEA 3ZNIA 2JOJA 2M1UA 4WQ3A 1WRLA 4Q04A 3D78A 3HCMA 2KLDA 1L2OB 1IWQA 3VRPA 1JBAA 1SY9A 2G9BA 2SCPA 2KQYA 1BT6A 1TNWA 4U8DA 2HPSA 1SNLA 1Y1XA 3R72A 4PE0A 4BY5A 4YBHB 1Y1UA 4GUKA 4UPGA 1K90D 1JSAA 3O4YA 4XJKB 1NUBA 1DELA 4BY4A 1IKUA 4A4BA 1A2XA 3DY9A 4PE7A 1PVBA 4CFQA 1CFPA 2WCFA 1TWOA 5CSJA 3CS1A 3KPXA 2O5GA 1NWDA 1IJ5A 2LE9B 3V2LA 2WCKA 1CFFA 1CM4A 1LKJA 4AQIA 4IL1A 3I5IC 1WDCB 1A29A 1W7IB 1YVLA 1IG5A 2A4JA 2NCPA 3FE8A 3SS5A 1B7TY 1S5GY 3CYZA 1KFXL 2QDIA 1SL9A 1SL8A 2JTTA 3SG5A 1AP4A 3HX4A 5KTYA 3FE6A 1UHJA 4JD9A 1DQEA 2K61A 4F0ZB 1RFJA 5I2QA 1K93D 2FCEA 3D74A 5IBWA 2NLNA 4TNCA 1KFUL 4GGNA 4MZLA 1BG1A 1S6CA 2I7AA 1MHOA 2OTGC 3GOFA 1OQPA 1EH2A 1G33A 4ETOA 2LUXA 1QXPA 1KK7Z 3D0YB 1FI5A 2MA2A 2LAPA 4I5LB 1NSHA 4DRWA 4QJ3B 3IQQA 2OPOA 3PM2A 3DVJA 4JPZB 1RWYA 5HLVA 5I2OA 2BCBA 2JT0A 3BJHA 3NGVA 2RGIA 4I5NB 4NDBA 1AJ4A 1BMOA 1NCXA 3FE9A 4PCWA 1Y1AA 2MBXA 4HRGA 1KQVA 3WHUB 2KGRA 2SASA 4OV2A 3D76A 1DGUA 2PVBA 1KK8C 1S6JA 2L51A 1DJXA 4NDCA 2PYQA 1EG3A 3L4LA 2LHLA 2WC6A 3KF9A 1BU3A 3R1VA 5CSNA 1CFCA 2LLTA 4L9MA 3CR2A 2F3YA 1RECA 1V1GA 1F71A 1LXFC 1DT7B 1YX8A 1TTXA 4WQ2A 1DJIA 1TUZA 2EGDA 4GGFC 3SG4A 4C0JA 1GGWA 1RK9A 3BXKA 2BBMA 2COLB 1SCMB 2NCOA 3EG5B 2MLEC 1A75B 1UHNA 2MAZA 3DYEA 2BECA 1NX0A 1JF2A 4YGAA 4I5JA 2KAYA 1SPYA 1N2DA 1BOCA 1JUOA 3DVMA 4ORAB 5D3OA 3EKHA 3O78A 3GK4X 2BKIB 1OW4A 1KSMA 1QIVA 1UP5A 3O4XA 2LM5A 3EVRA 4XJKA 4D1EA 3LL8B 5G08A 1SYMA 2BAPA 1XFVO 2LMUA 1Y6WA 1CTRA 1BR4B 1KQMB 1LS8A 1PK0D 4CIDA 3I5GB 2K7OA 3PATA 1UWOA 1D1OA 1SSEB 4OVNF 3OGNA 1WDCC 2M29A 4YI8A 1CB1A 3WXAA 2ZFDA 1PSRA 2KBMA 4GAOA 1CDMA 4JWQA 1OOFA
chains in the Genus database with same CATH topology
4DUQA 2JULA 3BUNB 1BLQA 2BL0B 1DJYA 4M2QA 1KSOA 3BYAA 2M49B 1QJTA 5JOLA 2JT8A 1YTZC 2M3WA 3DD4A 5BPJA 1K95A 3FIAA 5KU1A 1DTLA 1KCYA 2EHBA 3VGOA 1K9KA 3OHMB 3D10A 2PSRA 1G8IA 4MRYA 3TZ1A 1K96A 4R1EA 1KK7Y 1KFXS 2NZ0A 2F8PA 1QTXA 1QX5B 1R2UA 1TNPA 3DF0A 1S26D 5HKZA 2L98A 2KFFA 1QV1A 2BCXA 1BR1B 1ZUZA 3AAJA 1JF0A 2BE4A 1CLLA 1XK4C 2HF5A 2MLFC 2KHNA 1SW8A 4HREE 1S6IA 3FWCA 1KWOB 1TNXA 1A4PA 4YGBB 3SIAA 2F2PA 2O60A 1TRFA 1PULA 3AAKA 4JQ0D 3CWGA 2HQWA 1HT9A 1AJ5A 1MR8A 3MSEB 1C7VA 2HQ8A 4MZKA 5TNCA 3TDIA 1BF5A 2MHHA 1QVIZ 1ODBA 1WY9A 2L0PA 1F8HA 1ZOTB 4QJ5B 5AFPA 4E68A 1SCMC 2KAXA 1QX7A 5KSZA 1CDLA 4ORCB 3WNXB 1QLSA 3OB2B 2LVJA 3VRQA 5AEQA 1XFWO 4WRIA 1PVAA 3TS5B 1ZMZA 5B8IB 2G2BA 3QRXA 1QV0A 1MF8B 1AUIB 2L5XB 1BJFA 5D7FA 1XFZO 2PALA 5CSFA 1GGZA 1Y0VH 2R2IA 1SBJA 2KSPA 3I5GC 1NYAA 2KQ6A 2JU0A 1SK6D 1B8LA 4CLNA 1CFDA 3CTNA 2H61C 5CPVA 2WORA 2EC6B 3PN7B 2ZRTA 1IJ6A 3NSLA 5FYXA 2L4HA 1JFJA 3BUOB 1QLKA 2BL0C 2LVIA 2OS8C 3BOWA 1DF0B 1OOJA 1EXRA 4PHJA 4USLA 1B1GA 1F54A 1EG4A 4DS7A 1NCYA 3SG2A 2PASA 3F45A 2JNXA 5I8NA 1AHRA 2I2RE 3LK0A 3RLZA 4HRHA 2M7LA 3O6BA 1VRKA 2GV5A 5AERA 2M1KB 1IH0A 2LC5A 4MLWA 1E8AA 4CFRA 2QACA 2KI4B 2VRGA 2WC8A 1U5IB 2Y1MA 2I18A 1F4OA 2F3ZA 4GGFA 2E6WA 3LK1A 1ZACA 1L2OC 4GBAA 2K7DA 2B1UA 1BODA 2GGMA 1PALA 4MRXA 2BE6A 2AMIA 5K89A 2JXLA 1OSAA 2KI6C 4FQOA 3SG6A 2M9GA 2L4IA 2M97A 3CLNA 1MWNA 1OE9B 1XA5A 1L7ZA 2F33A 1YVHA 4N1GA 2LLUA 3M0WA 5D69A 4AQJA 2V53A 1GQMA 1QVIY 1AK8A 2JC2A 2KNEA 1F4QA 3GK2A 1YRUB 2M8UA 2JRFA 3JVTB 1M45A 2M7NA 2LVVA 3A4UB 1NIWA 3SJSA 4PE4A 4YRUA 4A4CA 4YGDB 1IRJA 5AANA 1B4CA 1NX1A 1IQ5A 2PMYA 4YI9A 2JWWA 2NXQA 4GNKB 1YURA 3GK1A 3BUMB 2CT9A 2MJWB 2P6BB 1S3PA 1M46A 1OMVA 3ICBA 2IS9A 1FW4A 5DKRA 1G4YR 1XVJA 3EVUA 1QASA 2K7BA 4YGEB 1N0YA 2AUCA 2ISDA 1V1FA 4C0LA 4ZCVA 4YGCB 1B9AA 3D0YA 4OKHA 1F70A 1FPWA 2ZKMX 2KYCA 1UHHA 1SR6B 3CGAA 2ZRSA 5JJGA 1FI6A 3PM8A 3PLFB 3KEVA 1LINA 2LMVA 2KYFA 1MQ1A 1SRAA 1CLBA 1S1EA 1QIWA 1KFUS 4MEWA 1XO5A 1EJ3A 2LCPA 5PALA 1FF1A 1DF0A 2JXCA 2KDHA 3IQOA 4PALA 1QX2A 1YRTB 1J7PA 1IGVA 1TCOB 1K2HA 1J7QA 1MUXA 2WCBA 1XK4A 2AAOA 2H2KA 4QJ4B 3TDUA 3K21A 1RJVA 2JZIA 1X02A 1WRKA 2LP3A 1KK8B 2K2AA 1B8RA 2BKHB 2K7CA 3BQ3A 4AOMA 3I5HB 1QS7A 1DVIA 1F55A 1TOPA 1DGVA 1R6PA 1CDPA 2Y4QA 3C1VA 3AKBA 2F2OA 1K94A 1TIZA 2JQ6A 1M39A 1K9UA 2LVKA 2CCMA 1A75A 1NX3A 5CSIA 4DIRA 1N65A 3EK7A 1DJZA 1CM1A 1LA0A 1M63B 4MVFA 1DJHA 2CXJA 3EKJA 3BUXB 3BUWB 2E30A 2LLSA 1K9PA 3OP0A 1NX2A 3O2PA 2GGZA 1W7JB 1CMGA 2TN4A 2K2FA 4ICBA 3OB1B 1HQVA 3NXAA 4P2YB 1KQMC 2WNDA 2ZNEA 1JC2A 4MZJA 2L50A 3TUYB 3JVTC 1YR5A 3NSIA 4GPLB 1Q80A 2CNPA 1WLMA 1OMRA 2JT3A 2H61A 1LVCD 1J55A 3CR4X 2FOTA 1WRZA 1UHKA 4PE1A 1J7RA 2KFGA 2LUCA 3DVEA 2ZN8A 2LNKA 1DMOA 3LLEA 1NPQA 3CR5X 1PRWA 5ER4X 4OR9B 2JNFA 3RM1A 3KHEA 4M2PA 1SKTA 4PHMA 2Q91A 1OZSA 1SCVA 3SG3A 3I5FB 1XYDA 4ZCUA 4MN0A 2ZN9A 2K8MB 1NP8A 5HKYA 1CNPA 2KBIA 2KAVA 3A8RA 1SR6C 1RROA 1XFYO 4N5XA 1CDNA 2WOSA 3DF0B 1YUTA 5GQQC 3JTDB 4FTGA 1C07A 1JFKA 3NSKA 2L2EA 1CLMA 3LCPC 3VRRA 1AVSA 1SMGA 1DJWA 3NSOA 1MXLC 5F6TA 3VRNA 1KWOC 3KO0A 2JPTA 1MXEA 2JTZA 1QATA 3CZTX 1YUSA 1J1DA 1YUUA 3EK4A 4M2OA 4ORBB 3I5HC 1B8CA 3VROA 4PHNA 1WLZA 1YX7A 3FWBA 1DJGA 2FJUB 2HETA 2FCDA 1PSBA 3EK8A 5HKWA 1S36A 2CBLA 3OX5A 2BCAA 2QPTA 4MBEA 4XYNA 3EVVA 3AKAA 5HYDA 1A03A 1C7WA 1J7OA 2ZNDA 3TS5C 3I5IB 1OZOA 3SG7A 3IF7A 1J1EA 2MRDA 1IQ3A 5I2LA 1B7TZ 1S5GZ 1UUSA 3PALA 1ALWA 1GJYA 1TCFA 4P5OE 1OMDA 1RTP1 5AXIA 1M31A 3TUYC 3WHTB 4HSZA 4PDZA 1CMFA 2LMTA 2DOQA 1XFXO 2KOTA 4I5KA 5HLOA 2PRUA 2WCEA 2LP2A 2OTGB 2Y1NA 2EC6C 4CPVA 3PN7C 1LA3A 1UURA 3FS7A 5DKNA 4C0KA 4OCIA 2LANA 2KFHA 3DVKA 3OX6A 5DKQA 2I94A 1H4BA 4N1FA 1SL7A 1H8BA 1TN4A 2KI6D 1CKKA 2D8NA 3BOWB 1XFUO 2OS8B 2M0RA 3ZWHA 1TNQA 1UHIA 3PFVA 4DCKA 1B47A 2Y5IA 3I5FC 1NCZA 2BBNA 3PSRA 4GFTA 1ALVA 4MSPA 3TDZA 2Q4UA 2LV7A 2CTNA 1ZFSA 2KGBC 4PHKA 3E3RA 2K0JA 5ER5A 2KI4C 5J3XA 2LHIA 1K8UA 3H4SE 3JTDC 4NQGA 1FBVA 4NDDA 1U5IA 1EL4A 3SIBA 3ZNIA 2JOJA 2M1UA 4WQ3A 1WRLA 4Q04A 3HCMA 1L2OB 1IWQA 3VRPA 1JBAA 1SY9A 2G9BA 2SCPA 2KQYA 1BT6A 1TNWA 4U8DA 2HPSA 1SNLA 1Y1XA 4PE0A 4BY5A 4YBHB 1Y1UA 4GUKA 4UPGA 1K90D 1JSAA 3O4YA 4XJKB 1NUBA 4BY4A 1IKUA 4A4BA 1A2XA 4PE7A 1PVBA 4CFQA 1CFPA 2WCFA 5CSJA 3CS1A 3KPXA 2O5GA 1NWDA 1IJ5A 2LE9B 1CFFA 1CM4A 1LKJA 4AQIA 4IL1A 3I5IC 1WDCB 1A29A 1W7IB 1YVLA 1IG5A 2A4JA 2NCPA 1B7TY 1S5GY 1KFXL 1SL9A 1SL8A 2JTTA 3SG5A 1AP4A 3HX4A 5KTYA 1UHJA 2K61A 4F0ZB 5IBWA 1RFJA 5I2QA 1K93D 2FCEA 2NLNA 4TNCA 1KFUL 4GGNA 4MZLA 1BG1A 1S6CA 2I7AA 1MHOA 2OTGC 3GOFA 1OQPA 1EH2A 1G33A 4ETOA 2LUXA 1QXPA 1KK7Z 3D0YB 1FI5A 2MA2A 2LAPA 4I5LB 1NSHA 4DRWA 4QJ3B 3IQQA 2OPOA 3DVJA 4JPZB 1RWYA 5HLVA 5I2OA 2BCBA 2JT0A 2RGIA 4I5NB 4NDBA 1AJ4A 1BMOA 1NCXA 4PCWA 2MBXA 1Y1AA 1KQVA 4HRGA 3WHUB 2KGRA 2SASA 4OV2A 1DGUA 2PVBA 1KK8C 1S6JA 2L51A 4NDCA 1EG3A 2LHLA 3KF9A 1BU3A 5CSNA 1CFCA 1JWDA 2LLTA 4L9MA 3CR2A 2F3YA 1RECA 1V1GA 1F71A 1LXFC 1DT7B 1YX8A 1TTXA 4WQ2A 1DJIA 2EGDA 4GGFC 3SG4A 4C0JA 1GGWA 1RK9A 3BXKA 2BBMA 2COLB 1SCMB 2NCOA 2MLEC 1A75B 1UHNA 2MAZA 2BECA 1NX0A 1JF2A 4YGAA 4I5JA 2KAYA 1SPYA 1N2DA 1BOCA 1JUOA 3DVMA 4ORAB 3EKHA 3O78A 3GK4X 2BKIB 1QIVA 1KSMA 1UP5A 2LM5A 3EVRA 4XJKA 4D1EA 3LL8B 5G08A 1SYMA 1XFVO 2LMUA 1Y6WA 1CTRA 1BR4B 1KQMB 1PK0D 4CIDA 3I5GB 2K7OA 3PATA 1UWOA 1D1OA 4OVNF 1WDCC 2M29A 4YI8A 1CB1A 3WXAA 2ZFDA 1PSRA 2KBMA 4GAOA 1CDMA 4JWQA 1DJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUQ A;  2JUL A;  3BUN B;  1BLQ A;  2BL0 B;  1DJY A;  4M2Q A;  1KSO A;  3BYA A;  2M49 B;  1QJT A;  5JOL A;  2JT8 A;  1YTZ C;  2M3W A;  3DD4 A;  5BPJ A;  1K95 A;  3FIA A;  5KU1 A;  1DTL A;  1KCY A;  2EHB A;  3VGO A;  1K9K A;  3OHM B;  3D10 A;  2PSR A;  1G8I A;  4MRY A;  3TZ1 A;  1K96 A;  4R1E A;  1KK7 Y;  1KFX S;  2NZ0 A;  2F8P A;  1QTX A;  1QX5 B;  1R2U A;  1TNP A;  3DF0 A;  1S26 D;  5HKZ A;  2L98 A;  2KFF A;  1QV1 A;  2BCX A;  1BR1 B;  1ZUZ A;  3AAJ A;  1JF0 A;  2BE4 A;  1CLL A;  1XK4 C;  2HF5 A;  2MLF C;  2KHN A;  1SW8 A;  4HRE E;  1S6I A;  3FWC A;  1KWO B;  1TNX A;  1A4P A;  4YGB B;  3SIA A;  2F2P A;  2O60 A;  1TRF A;  1PUL A;  3AAK A;  4JQ0 D;  3CWG A;  2HQW A;  1HT9 A;  1AJ5 A;  1MR8 A;  3MSE B;  1C7V A;  2HQ8 A;  4MZK A;  5TNC A;  3TDI A;  1BF5 A;  2MHH A;  1QVI Z;  1ODB A;  1WY9 A;  2L0P A;  1F8H A;  1ZOT B;  4QJ5 B;  5AFP A;  4E68 A;  1SCM C;  2KAX A;  1QX7 A;  5KSZ A;  1CDL A;  4ORC B;  3WNX B;  1QLS A;  3OB2 B;  2LVJ A;  3VRQ A;  5AEQ A;  1XFW O;  4WRI A;  1PVA A;  3TS5 B;  1ZMZ A;  5B8I B;  2G2B A;  3QRX A;  1QV0 A;  1MF8 B;  1AUI B;  2L5X B;  1BJF A;  5D7F A;  1XFZ O;  2PAL A;  5CSF A;  1GGZ A;  1Y0V H;  2R2I A;  1SBJ A;  2KSP A;  3I5G C;  1NYA A;  2KQ6 A;  2JU0 A;  1SK6 D;  1B8L A;  4CLN A;  1CFD A;  3CTN A;  2H61 C;  5CPV A;  2WOR A;  2EC6 B;  3PN7 B;  2ZRT A;  1IJ6 A;  3NSL A;  5FYX A;  2L4H A;  1JFJ A;  3BUO B;  1QLK A;  2BL0 C;  2LVI A;  2OS8 C;  3BOW A;  1DF0 B;  1OOJ A;  1EXR A;  4PHJ A;  4USL A;  1B1G A;  1F54 A;  1EG4 A;  4DS7 A;  1NCY A;  3SG2 A;  2PAS A;  3F45 A;  2JNX A;  5I8N A;  1AHR A;  2I2R E;  3LK0 A;  3RLZ A;  4HRH A;  2M7L A;  3O6B A;  1VRK A;  2GV5 A;  5AER A;  2M1K B;  1IH0 A;  2LC5 A;  4MLW A;  1E8A A;  4CFR A;  2QAC A;  2KI4 B;  2VRG A;  2WC8 A;  1U5I B;  2Y1M A;  2I18 A;  1F4O A;  2F3Z A;  4GGF A;  2E6W A;  3LK1 A;  1ZAC A;  1L2O C;  4GBA A;  2K7D A;  2B1U A;  1BOD A;  2GGM A;  1PAL A;  4MRX A;  2BE6 A;  2AMI A;  5K89 A;  2JXL A;  1OSA A;  2KI6 C;  4FQO A;  3SG6 A;  2M9G A;  2L4I A;  2M97 A;  3CLN A;  1MWN A;  1OE9 B;  1XA5 A;  1L7Z A;  2F33 A;  1YVH A;  4N1G A;  2LLU A;  3M0W A;  5D69 A;  4AQJ A;  2V53 A;  1GQM A;  1QVI Y;  1AK8 A;  2JC2 A;  2KNE A;  1F4Q A;  3GK2 A;  1YRU B;  2M8U A;  2JRF A;  3JVT B;  1M45 A;  2M7N A;  2LVV A;  3A4U B;  1NIW A;  3SJS A;  4PE4 A;  4YRU A;  4A4C A;  4YGD B;  1IRJ A;  5AAN A;  1B4C A;  1NX1 A;  1IQ5 A;  2PMY A;  4YI9 A;  2JWW A;  2NXQ A;  4GNK B;  1YUR A;  3GK1 A;  3BUM B;  2CT9 A;  2MJW B;  2P6B B;  1S3P A;  1M46 A;  1OMV A;  3ICB A;  2IS9 A;  1FW4 A;  5DKR A;  1G4Y R;  1XVJ A;  3EVU A;  1QAS A;  2K7B A;  4YGE B;  1N0Y A;  2AUC A;  2ISD A;  1V1F A;  4C0L A;  4ZCV A;  4YGC B;  1B9A A;  3D0Y A;  4OKH A;  1F70 A;  1FPW A;  2ZKM X;  2KYC A;  1UHH A;  1SR6 B;  3CGA A;  2ZRS A;  5JJG A;  1FI6 A;  3PM8 A;  3PLF B;  3KEV A;  1LIN A;  2LMV A;  2KYF A;  1MQ1 A;  1SRA A;  1CLB A;  1S1E A;  1QIW A;  1KFU S;  4MEW A;  1XO5 A;  1EJ3 A;  2LCP A;  5PAL A;  1FF1 A;  1DF0 A;  2JXC A;  2KDH A;  3IQO A;  4PAL A;  1QX2 A;  1YRT B;  1J7P A;  1IGV A;  1TCO B;  1K2H A;  1J7Q A;  1MUX A;  2WCB A;  1XK4 A;  2AAO A;  2H2K A;  4QJ4 B;  3TDU A;  3K21 A;  1RJV A;  2JZI A;  1X02 A;  1WRK A;  2LP3 A;  1KK8 B;  2K2A A;  1B8R A;  2BKH B;  2K7C A;  3BQ3 A;  4AOM A;  3I5H B;  1QS7 A;  1DVI A;  1F55 A;  1TOP A;  1DGV A;  1R6P A;  1CDP A;  2Y4Q A;  3C1V A;  3AKB A;  2F2O A;  1K94 A;  1TIZ A;  2JQ6 A;  1M39 A;  1K9U A;  2LVK A;  2CCM A;  1A75 A;  1NX3 A;  5CSI A;  4DIR A;  1N65 A;  3EK7 A;  1DJZ A;  1CM1 A;  1LA0 A;  1M63 B;  4MVF A;  1DJH A;  2CXJ A;  3EKJ A;  3BUX B;  3BUW B;  2E30 A;  2LLS A;  1K9P A;  3OP0 A;  1NX2 A;  3O2P A;  2GGZ A;  1W7J B;  1CMG A;  2TN4 A;  2K2F A;  4ICB A;  3OB1 B;  1HQV A;  3NXA A;  4P2Y B;  1KQM C;  2WND A;  2ZNE A;  1JC2 A;  4MZJ A;  2L50 A;  3TUY B;  3JVT C;  1YR5 A;  3NSI A;  4GPL B;  1Q80 A;  2CNP A;  1WLM A;  1OMR A;  2JT3 A;  2H61 A;  1LVC D;  1J55 A;  3CR4 X;  2FOT A;  1WRZ A;  1UHK A;  4PE1 A;  1J7R A;  2KFG A;  2LUC A;  3DVE A;  2ZN8 A;  2LNK A;  1DMO A;  3LLE A;  1NPQ A;  3CR5 X;  1PRW A;  5ER4 X;  4OR9 B;  2JNF A;  3RM1 A;  3KHE A;  4M2P A;  1SKT A;  4PHM A;  2Q91 A;  1OZS A;  1SCV A;  3SG3 A;  3I5F B;  1XYD A;  4ZCU A;  4MN0 A;  2ZN9 A;  2K8M B;  1NP8 A;  5HKY A;  1CNP A;  2KBI A;  2KAV A;  3A8R A;  1SR6 C;  1RRO A;  1XFY O;  4N5X A;  1CDN A;  2WOS A;  3DF0 B;  1YUT A;  5GQQ C;  3JTD B;  4FTG A;  1C07 A;  1JFK A;  3NSK A;  2L2E A;  1CLM A;  3LCP C;  3VRR A;  1AVS A;  1SMG A;  1DJW A;  3NSO A;  1MXL C;  5F6T A;  3VRN A;  1KWO C;  3KO0 A;  2JPT A;  1MXE A;  2JTZ A;  1QAT A;  3CZT X;  1YUS A;  1J1D A;  1YUU A;  3EK4 A;  4M2O A;  4ORB B;  3I5H C;  1B8C A;  3VRO A;  4PHN A;  1WLZ A;  1YX7 A;  3FWB A;  1DJG A;  2FJU B;  2HET A;  2FCD A;  1PSB A;  3EK8 A;  5HKW A;  1S36 A;  2CBL A;  3OX5 A;  2BCA A;  2QPT A;  4MBE A;  4XYN A;  3EVV A;  3AKA A;  5HYD A;  1A03 A;  1C7W A;  1J7O A;  2ZND A;  3TS5 C;  3I5I B;  1OZO A;  3SG7 A;  3IF7 A;  1J1E A;  2MRD A;  1IQ3 A;  5I2L A;  1B7T Z;  1S5G Z;  1UUS A;  3PAL A;  1ALW A;  1GJY A;  1TCF A;  4P5O E;  1OMD A;  1RTP 1;  5AXI A;  1M31 A;  3TUY C;  3WHT B;  4HSZ A;  4PDZ A;  1CMF A;  2LMT A;  2DOQ A;  1XFX O;  2KOT A;  4I5K A;  5HLO A;  2PRU A;  2WCE A;  2LP2 A;  2OTG B;  2Y1N A;  2EC6 C;  4CPV A;  3PN7 C;  1LA3 A;  1UUR A;  3FS7 A;  5DKN A;  4C0K A;  4OCI A;  2LAN A;  2KFH A;  3DVK A;  3OX6 A;  5DKQ A;  2I94 A;  1H4B A;  4N1F A;  1SL7 A;  1H8B A;  1TN4 A;  2KI6 D;  1CKK A;  2D8N A;  3BOW B;  1XFU O;  2OS8 B;  2M0R A;  3ZWH A;  1TNQ A;  1UHI A;  3PFV A;  4DCK A;  1B47 A;  2Y5I A;  3I5F C;  1NCZ A;  2BBN A;  3PSR A;  4GFT A;  1ALV A;  4MSP A;  3TDZ A;  2Q4U A;  2LV7 A;  2CTN A;  1ZFS A;  2KGB C;  4PHK A;  3E3R A;  2K0J A;  5ER5 A;  2KI4 C;  5J3X A;  2LHI A;  1K8U A;  3H4S E;  3JTD C;  4NQG A;  1FBV A;  4NDD A;  1U5I A;  1EL4 A;  3SIB A;  3ZNI A;  2JOJ A;  2M1U A;  4WQ3 A;  1WRL A;  4Q04 A;  3HCM A;  1L2O B;  1IWQ A;  3VRP A;  1JBA A;  1SY9 A;  2G9B A;  2SCP A;  2KQY A;  1BT6 A;  1TNW A;  4U8D A;  2HPS A;  1SNL A;  1Y1X A;  4PE0 A;  4BY5 A;  4YBH B;  1Y1U A;  4GUK A;  4UPG A;  1K90 D;  1JSA A;  3O4Y A;  4XJK B;  1NUB A;  4BY4 A;  1IKU A;  4A4B A;  1A2X A;  4PE7 A;  1PVB A;  4CFQ A;  1CFP A;  2WCF A;  5CSJ A;  3CS1 A;  3KPX A;  2O5G A;  1NWD A;  1IJ5 A;  2LE9 B;  1CFF A;  1CM4 A;  1LKJ A;  4AQI A;  4IL1 A;  3I5I C;  1WDC B;  1A29 A;  1W7I B;  1YVL A;  1IG5 A;  2A4J A;  2NCP A;  1B7T Y;  1S5G Y;  1KFX L;  1SL9 A;  1SL8 A;  2JTT A;  3SG5 A;  1AP4 A;  3HX4 A;  5KTY A;  1UHJ A;  2K61 A;  4F0Z B;  5IBW A;  1RFJ A;  5I2Q A;  1K93 D;  2FCE A;  2NLN A;  4TNC A;  1KFU L;  4GGN A;  4MZL A;  1BG1 A;  1S6C A;  2I7A A;  1MHO A;  2OTG C;  3GOF A;  1OQP A;  1EH2 A;  1G33 A;  4ETO A;  2LUX A;  1QXP A;  1KK7 Z;  3D0Y B;  1FI5 A;  2MA2 A;  2LAP A;  4I5L B;  1NSH A;  4DRW A;  4QJ3 B;  3IQQ A;  2OPO A;  3DVJ A;  4JPZ B;  1RWY A;  5HLV A;  5I2O A;  2BCB A;  2JT0 A;  2RGI A;  4I5N B;  4NDB A;  1AJ4 A;  1BMO A;  1NCX A;  4PCW A;  2MBX A;  1Y1A A;  1KQV A;  4HRG A;  3WHU B;  2KGR A;  2SAS A;  4OV2 A;  1DGU A;  2PVB A;  1KK8 C;  1S6J A;  2L51 A;  4NDC A;  1EG3 A;  2LHL A;  3KF9 A;  1BU3 A;  5CSN A;  1CFC A;  1JWD A;  2LLT A;  4L9M A;  3CR2 A;  2F3Y A;  1REC A;  1V1G A;  1F71 A;  1LXF C;  1DT7 B;  1YX8 A;  1TTX A;  4WQ2 A;  1DJI A;  2EGD A;  4GGF C;  3SG4 A;  4C0J A;  1GGW A;  1RK9 A;  3BXK A;  2BBM A;  2COL B;  1SCM B;  2NCO A;  2MLE C;  1A75 B;  1UHN A;  2MAZ A;  2BEC A;  1NX0 A;  1JF2 A;  4YGA A;  4I5J A;  2KAY A;  1SPY A;  1N2D A;  1BOC A;  1JUO A;  3DVM A;  4ORA B;  3EKH A;  3O78 A;  3GK4 X;  2BKI B;  1QIV A;  1KSM A;  1UP5 A;  2LM5 A;  3EVR A;  4XJK A;  4D1E A;  3LL8 B;  5G08 A;  1SYM A;  1XFV O;  2LMU A;  1Y6W A;  1CTR A;  1BR4 B;  1KQM B;  1PK0 D;  4CID A;  3I5G B;  2K7O A;  3PAT A;  1UWO A;  1D1O A;  4OVN F;  1WDC C;  2M29 A;  4YI8 A;  1CB1 A;  3WXA A;  2ZFD A;  1PSR A;  2KBM A;  4GAO A;  1CDM A;  4JWQ A;  1DJX A; 
#chains in the Genus database with same CATH topology
 4DUQ A;  2JUL A;  3BUN B;  1BLQ A;  2BL0 B;  1DJY A;  3D75 A;  4M2Q A;  1KSO A;  3BYA A;  2PQL A;  2BNX A;  2M49 B;  1QJT A;  5JOL A;  1P28 A;  2JT8 A;  5DIC A;  1YTZ C;  2M3W A;  3UNW A;  3DD4 A;  5BPJ A;  1K95 A;  3FIA A;  2KPH A;  5KU1 A;  1DTL A;  1KCY A;  2EHB A;  3VGO A;  1K9K A;  3OHM B;  3D10 A;  2PSR A;  1G8I A;  4MRY A;  3TZ1 A;  1K96 A;  4R1E A;  1KK7 Y;  1KFX S;  2NZ0 A;  2F8P A;  1QTX A;  1QX5 B;  1R2U A;  1TNP A;  1DC1 A;  3B88 A;  3DF0 A;  1S26 D;  3B7A A;  5HKZ A;  2L98 A;  2P71 A;  2KFF A;  1QV1 A;  2BCX A;  1BR1 B;  1ZUZ A;  3AAJ A;  1JF0 A;  2BE4 A;  1CLL A;  1XK4 C;  2HF5 A;  2MLF C;  2KHN A;  1SW8 A;  4HRE E;  1S6I A;  3FWC A;  1KWO B;  1TNX A;  1A4P A;  4YGB B;  3SIA A;  5FI6 A;  3S0A A;  2F2P A;  3IVT A;  3RZS A;  2O60 A;  1TRF A;  1PUL A;  3AAK A;  4JQ0 D;  3CWG A;  2HQW A;  1HT9 A;  1AJ5 A;  1MR8 A;  1ORG A;  3MSE B;  1C7V A;  2HQ8 A;  4MZK A;  5TNC A;  3TDI A;  1BF5 A;  2MHH A;  1QVI Z;  1ODB A;  1WY9 A;  2L0P A;  1F8H A;  1ZOT B;  4QJ5 B;  5AFP A;  4E68 A;  1SCM C;  2KAX A;  1GM0 A;  1QX7 A;  5KSZ A;  4JKT A;  1CDL A;  4ORC B;  3WNX B;  1QLS A;  3OB2 B;  2LVJ A;  4INW A;  3VRQ A;  5AEQ A;  1XFW O;  4WRI A;  1PVA A;  3TS5 B;  1ZMZ A;  5B8I B;  2G2B A;  3QRX A;  1QV0 A;  1MF8 B;  1AUI B;  1OOH A;  2L5X B;  1BJF A;  3B87 A;  5D7F A;  1XFZ O;  2PAL A;  5CSF A;  1GGZ A;  1Y0V H;  5I94 A;  1TUJ A;  2R2I A;  1SBJ A;  2KSP A;  3I5G C;  1NYA A;  2KQ6 A;  2JU0 A;  1SK6 D;  1B8L A;  4CLN A;  1CFD A;  3CTN A;  2H61 C;  5CPV A;  2WOR A;  2EC6 B;  3PN7 B;  2ZRT A;  1IJ6 A;  3N7H A;  3NSL A;  1Z2C B;  5FYX A;  2L4H A;  1JFJ A;  3BUO B;  5HL1 A;  1QLK A;  2BL0 C;  2LVI A;  2OS8 C;  3BOW A;  2L5Y A;  1DF0 B;  1OOJ A;  1EXR A;  4PHJ A;  4USL A;  3L47 A;  1B1G A;  1F54 A;  1EG4 A;  3SS4 A;  3SS3 A;  4DS7 A;  1NCY A;  3SG2 A;  2PAS A;  3BFA A;  3UO9 A;  3F45 A;  2JNX A;  5I8N A;  1AHR A;  2I2R E;  3LK0 A;  3RLZ A;  4HRH A;  2M7L A;  3O6B A;  1VRK A;  2GV5 A;  5AER A;  2M1K B;  1IH0 A;  2LC5 A;  4MLW A;  1E8A A;  4CFR A;  2QAC A;  2KI4 B;  2VRG A;  2WC8 A;  1U5I B;  2Y1M A;  2I18 A;  1F4O A;  2F3Z A;  4GGF A;  2E6W A;  3LK1 A;  1ZAC A;  2P70 A;  1L2O C;  5FI2 A;  4GBA A;  2K7D A;  2B1U A;  3B86 A;  1BOD A;  2GGM A;  1PAL A;  4MRX A;  2BE6 A;  2AMI A;  5K89 A;  2JXL A;  1OSA A;  2KI6 C;  4FQO A;  3SG6 A;  2M9G A;  2L4I A;  2M97 A;  2QEH A;  3CLN A;  3S0B A;  1MWN A;  1OE9 B;  1XA5 A;  1L7Z A;  2F33 A;  1YVH A;  4N1G A;  2LLU A;  3M0W A;  5D69 A;  4AQJ A;  2V53 A;  1GQM A;  1QVI Y;  1AK8 A;  2JC2 A;  2KNE A;  1F4Q A;  3CAB A;  3GK2 A;  1YRU B;  2M8U A;  2JRF A;  3JVT B;  1M45 A;  2M7N A;  3CZ0 A;  2LVV A;  3A4U B;  1NIW A;  3SJS A;  4PE4 A;  4YRU A;  1XFR A;  1DEK A;  4A4C A;  4YGD B;  1IRJ A;  5AAN A;  1B4C A;  1NX1 A;  1IQ5 A;  2PMY A;  4YI9 A;  2JWW A;  2NXQ A;  3DZT A;  4GNK B;  1YUR A;  3GK1 A;  3BUM B;  2CT9 A;  2MJW B;  2P6B B;  1S3P A;  4INX A;  1M46 A;  1OMV A;  3ICB A;  2IS9 A;  3S0F A;  1FW4 A;  3K1E A;  5DKR A;  1G4Y R;  1XVJ A;  3EVU A;  4FQT A;  1QAS A;  2K7B A;  4YGE B;  1N0Y A;  2AUC A;  2ISD A;  1V1F A;  4C0L A;  2K60 A;  4YGC B;  1B9A A;  3D0Y A;  4OKH A;  4ZCV A;  1F70 A;  2ZKM X;  1FPW A;  2KYC A;  1UHH A;  1SR6 B;  3CGA A;  2ZRS A;  5JJG A;  1FI6 A;  3PM8 A;  3PLF B;  3KEV A;  1LIN A;  2LMV A;  2KYF A;  1MQ1 A;  1SRA A;  1CLB A;  1S1E A;  1QIW A;  3NHT A;  1KFU S;  4MEW A;  1XO5 A;  1EJ3 A;  2LCP A;  5PAL A;  1FF1 A;  1DF0 A;  2JXC A;  2KDH A;  3IQO A;  4PAL A;  1QX2 A;  1YRT B;  1J7P A;  1IGV A;  1TCO B;  1OOI X;  1K2H A;  1J7Q A;  1MUX A;  2WCB A;  1XK4 A;  2AAO A;  2H2K A;  4QJ4 B;  3TDU A;  3K21 A;  1RJV A;  2JZI A;  4IJ7 A;  4F7F A;  1X02 A;  1WRK A;  2LP3 A;  1KK8 B;  2K2A A;  1B8R A;  2BKH B;  2K7C A;  3BQ3 A;  4AOM A;  3I5H B;  1QS7 A;  1DVI A;  2L2C A;  1F55 A;  1TOP A;  1DGV A;  1T14 A;  3R1O A;  1R6P A;  1CDP A;  2WCM A;  2Y4Q A;  3C1V A;  3AKB A;  4PT1 A;  2F2O A;  1K94 A;  1TIZ A;  1IIO A;  5FI7 A;  2JQ6 A;  1M39 A;  1K9U A;  2LVK A;  2CCM A;  1A75 A;  1NX3 A;  5CSI A;  4DIR A;  1N65 A;  3EK7 A;  1DJZ A;  1CM1 A;  1LA0 A;  1M63 B;  4MVF A;  1DJH A;  2CXJ A;  3EKJ A;  1W9Z A;  3BUX B;  3BUW B;  2E30 A;  2LLS A;  1K9P A;  3OP0 A;  3DXL A;  1NX2 A;  3O2P A;  2GGZ A;  1W7J B;  1CMG A;  2TN4 A;  3S0D A;  2K2F A;  4ICB A;  3OB1 B;  1HQV A;  3NXA A;  4P2Y B;  1KQM C;  2WND A;  2ZNE A;  1JC2 A;  1C3Z A;  2WCH A;  2L50 A;  4MZJ A;  3TUY B;  2FJY A;  3JVT C;  1YR5 A;  3D73 A;  3R1P A;  3NSI A;  4GPL B;  1Q80 A;  2CNP A;  1WLM A;  1OMR A;  2JT3 A;  2H61 A;  1LVC D;  1J55 A;  3CR4 X;  3S0G A;  2KLE A;  2FOT A;  1WRZ A;  1UHK A;  4PE1 A;  1J7R A;  2KFG A;  2LUC A;  3DVE A;  1QWV A;  2LNK A;  2ZN8 A;  1DMO A;  3LLE A;  1NPQ A;  2WC5 A;  3CR5 X;  1PRW A;  5ER4 X;  3VB1 A;  4OR9 B;  2JPO A;  2JNF A;  2WCL A;  3RM1 A;  3KHE A;  4M2P A;  1SKT A;  4PHM A;  2Q91 A;  3L4A A;  1OZS A;  1SCV A;  3SG3 A;  3I5F B;  1XYD A;  4ZCU A;  2QEB A;  1Z4H A;  4MN0 A;  2ZN9 A;  3OBV A;  2K8M B;  1NP8 A;  5HKY A;  1CNP A;  2KBI A;  3BFB A;  2KAV A;  3A8R A;  1SR6 C;  1RRO A;  1XFY O;  2YGU A;  4N5X A;  1CDN A;  2WOS A;  3DF0 B;  1YUT A;  5GQQ C;  3JTD B;  4FTG A;  1C07 A;  2ERB A;  1OOG A;  1JFK A;  3NSK A;  2L2E A;  1CLM A;  3LCP C;  3VRR A;  1AVS A;  1SMG A;  1DJW A;  3NSO A;  1MXL C;  5F6T A;  3VRN A;  1KWO C;  3KO0 A;  2JPT A;  1MXE A;  2JTZ A;  1QAT A;  3CZ1 A;  3CZT X;  1YUS A;  1J1D A;  1YUU A;  3EK4 A;  4M2O A;  4ORB B;  3D77 A;  3I5H C;  1B8C A;  3VRO A;  4OZD A;  4PHN A;  1WLZ A;  5EL2 A;  1YX7 A;  3FWB A;  1DJG A;  2FJU B;  2HET A;  2FCD A;  1PSB A;  3EK8 A;  5HKW A;  3NHI A;  1S36 A;  3CDN A;  2CBL A;  3OX5 A;  2BCA A;  2QPT A;  4MBE A;  4XYN A;  3EVV A;  3AKA A;  5HYD A;  3B6X A;  3QME A;  1A03 A;  1C7W A;  1J7O A;  2ZND A;  3TS5 C;  2WCJ A;  3I5I B;  1OZO A;  3SG7 A;  3IF7 A;  1J1E A;  2MRD A;  1IQ3 A;  3Q8I A;  5I2L A;  1B7T Z;  1S5G Z;  3PJI A;  1UUS A;  1C3Y A;  3PAL A;  1ALW A;  1GJY A;  1TCF A;  4P5O E;  1OMD A;  1RTP 1;  5AXI A;  1M31 A;  3TUY C;  3WHT B;  4HSZ A;  4PDZ A;  2H8V A;  1CMF A;  2LMT A;  2DOQ A;  3S0E A;  1XFX O;  2KOT A;  4I5K A;  5HLO A;  2PRU A;  2WCE A;  2LP2 A;  2OTG B;  2Y1N A;  1JWD A;  2EC6 C;  4KYN A;  4CPV A;  3PN7 C;  1LA3 A;  1UUR A;  3FS7 A;  5DKN A;  4C0K A;  4OCI A;  2LAN A;  2KFH A;  3DVK A;  3OX6 A;  2QEV A;  2I94 A;  5DKQ A;  4N1F A;  1SL7 A;  1H4B A;  3BFH A;  1TN4 A;  1H8B A;  2KI6 D;  1CKK A;  2D8N A;  3BOW B;  1XFU O;  2OS8 B;  2M0R A;  3ZWH A;  1TNQ A;  1UHI A;  3PFV A;  4DCK A;  1B47 A;  2QEO A;  2Y5I A;  1NCZ A;  3I5F C;  2BBN A;  3PSR A;  4GFT A;  1ALV A;  4MSP A;  3TDZ A;  2Q4U A;  2LV7 A;  2CTN A;  1ZFS A;  2KGB C;  4PHK A;  3E3R A;  2K0J A;  5ER5 A;  2KI4 C;  5J3X A;  2LHI A;  1K8U A;  3CZ2 A;  3H4S E;  3JTD C;  4NQG A;  1FBV A;  4NDD A;  1U5I A;  1EL4 A;  3SIB A;  2GTE A;  3ZNI A;  2JOJ A;  2M1U A;  4WQ3 A;  1WRL A;  4Q04 A;  3D78 A;  3HCM A;  2KLD A;  1L2O B;  1IWQ A;  3VRP A;  1JBA A;  1SY9 A;  2G9B A;  2SCP A;  2KQY A;  1BT6 A;  1TNW A;  4U8D A;  2HPS A;  1SNL A;  1Y1X A;  3R72 A;  4PE0 A;  4BY5 A;  4YBH B;  1Y1U A;  4GUK A;  4UPG A;  1K90 D;  1JSA A;  3O4Y A;  4XJK B;  1NUB A;  1DEL A;  4BY4 A;  1IKU A;  4A4B A;  1A2X A;  3DY9 A;  4PE7 A;  1PVB A;  4CFQ A;  1CFP A;  2WCF A;  1TWO A;  5CSJ A;  3CS1 A;  3KPX A;  2O5G A;  1NWD A;  1IJ5 A;  2LE9 B;  3V2L A;  2WCK A;  1CFF A;  1CM4 A;  1LKJ A;  4AQI A;  4IL1 A;  3I5I C;  1WDC B;  1A29 A;  1W7I B;  1YVL A;  1IG5 A;  2A4J A;  2NCP A;  3FE8 A;  3SS5 A;  1B7T Y;  1S5G Y;  3CYZ A;  1KFX L;  2QDI A;  1SL9 A;  1SL8 A;  2JTT A;  3SG5 A;  1AP4 A;  3HX4 A;  5KTY A;  3FE6 A;  1UHJ A;  4JD9 A;  1DQE A;  2K61 A;  4F0Z B;  1RFJ A;  5I2Q A;  1K93 D;  2FCE A;  3D74 A;  5IBW A;  2NLN A;  4TNC A;  1KFU L;  4GGN A;  4MZL A;  1BG1 A;  1S6C A;  2I7A A;  1MHO A;  2OTG C;  3GOF A;  1OQP A;  1EH2 A;  1G33 A;  4ETO A;  2LUX A;  1QXP A;  1KK7 Z;  3D0Y B;  1FI5 A;  2MA2 A;  2LAP A;  4I5L B;  1NSH A;  4DRW A;  4QJ3 B;  3IQQ A;  2OPO A;  3PM2 A;  3DVJ A;  4JPZ B;  1RWY A;  5HLV A;  5I2O A;  2BCB A;  2JT0 A;  3BJH A;  3NGV A;  2RGI A;  4I5N B;  4NDB A;  1AJ4 A;  1BMO A;  1NCX A;  3FE9 A;  4PCW A;  1Y1A A;  2MBX A;  4HRG A;  1KQV A;  3WHU B;  2KGR A;  2SAS A;  4OV2 A;  3D76 A;  1DGU A;  2PVB A;  1KK8 C;  1S6J A;  2L51 A;  1DJX A;  4NDC A;  2PYQ A;  1EG3 A;  3L4L A;  2LHL A;  2WC6 A;  3KF9 A;  1BU3 A;  3R1V A;  5CSN A;  1CFC A;  2LLT A;  4L9M A;  3CR2 A;  2F3Y A;  1REC A;  1V1G A;  1F71 A;  1LXF C;  1DT7 B;  1YX8 A;  1TTX A;  4WQ2 A;  1DJI A;  1TUZ A;  2EGD A;  4GGF C;  3SG4 A;  4C0J A;  1GGW A;  1RK9 A;  3BXK A;  2BBM A;  2COL B;  1SCM B;  2NCO A;  3EG5 B;  2MLE C;  1A75 B;  1UHN A;  2MAZ A;  3DYE A;  2BEC A;  1NX0 A;  1JF2 A;  4YGA A;  4I5J A;  2KAY A;  1SPY A;  1N2D A;  1BOC A;  1JUO A;  3DVM A;  4ORA B;  5D3O A;  3EKH A;  3O78 A;  3GK4 X;  2BKI B;  1OW4 A;  1KSM A;  1QIV A;  1UP5 A;  3O4X A;  2LM5 A;  3EVR A;  4XJK A;  4D1E A;  3LL8 B;  5G08 A;  1SYM A;  2BAP A;  1XFV O;  2LMU A;  1Y6W A;  1CTR A;  1BR4 B;  1KQM B;  1LS8 A;  1PK0 D;  4CID A;  3I5G B;  2K7O A;  3PAT A;  1UWO A;  1D1O A;  1SSE B;  4OVN F;  3OGN A;  1WDC C;  2M29 A;  4YI8 A;  1CB1 A;  3WXA A;  2ZFD A;  1PSR A;  2KBM A;  4GAO A;  1CDM A;  4JWQ A;  1OOF A; 
#chains in the Genus database with same CATH homology
 4DUQ A;  2JUL A;  3BUN B;  1BLQ A;  2BL0 B;  1DJY A;  4M2Q A;  1KSO A;  3BYA A;  2M49 B;  1QJT A;  5JOL A;  2JT8 A;  1YTZ C;  2M3W A;  3DD4 A;  5BPJ A;  1K95 A;  3FIA A;  5KU1 A;  1DTL A;  1KCY A;  2EHB A;  3VGO A;  1K9K A;  3OHM B;  3D10 A;  2PSR A;  1G8I A;  4MRY A;  3TZ1 A;  1K96 A;  4R1E A;  1KK7 Y;  1KFX S;  2NZ0 A;  2F8P A;  1QTX A;  1QX5 B;  1R2U A;  1TNP A;  3DF0 A;  1S26 D;  5HKZ A;  2L98 A;  2KFF A;  1QV1 A;  2BCX A;  1BR1 B;  1ZUZ A;  3AAJ A;  1JF0 A;  2BE4 A;  1CLL A;  1XK4 C;  2HF5 A;  2MLF C;  2KHN A;  1SW8 A;  4HRE E;  1S6I A;  3FWC A;  1KWO B;  1TNX A;  1A4P A;  4YGB B;  3SIA A;  2F2P A;  2O60 A;  1TRF A;  1PUL A;  3AAK A;  4JQ0 D;  3CWG A;  2HQW A;  1HT9 A;  1AJ5 A;  1MR8 A;  3MSE B;  1C7V A;  2HQ8 A;  4MZK A;  5TNC A;  3TDI A;  1BF5 A;  2MHH A;  1QVI Z;  1ODB A;  1WY9 A;  2L0P A;  1F8H A;  1ZOT B;  4QJ5 B;  5AFP A;  4E68 A;  1SCM C;  2KAX A;  1QX7 A;  5KSZ A;  1CDL A;  4ORC B;  3WNX B;  1QLS A;  3OB2 B;  2LVJ A;  3VRQ A;  5AEQ A;  1XFW O;  4WRI A;  1PVA A;  3TS5 B;  1ZMZ A;  5B8I B;  2G2B A;  3QRX A;  1QV0 A;  1MF8 B;  1AUI B;  2L5X B;  1BJF A;  5D7F A;  1XFZ O;  2PAL A;  5CSF A;  1GGZ A;  1Y0V H;  2R2I A;  1SBJ A;  2KSP A;  3I5G C;  1NYA A;  2KQ6 A;  2JU0 A;  1SK6 D;  1B8L A;  4CLN A;  1CFD A;  3CTN A;  2H61 C;  5CPV A;  2WOR A;  2EC6 B;  3PN7 B;  2ZRT A;  1IJ6 A;  3NSL A;  5FYX A;  2L4H A;  1JFJ A;  3BUO B;  1QLK A;  2BL0 C;  2LVI A;  2OS8 C;  3BOW A;  1DF0 B;  1OOJ A;  1EXR A;  4PHJ A;  4USL A;  1B1G A;  1F54 A;  1EG4 A;  4DS7 A;  1NCY A;  3SG2 A;  2PAS A;  3F45 A;  2JNX A;  5I8N A;  1AHR A;  2I2R E;  3LK0 A;  3RLZ A;  4HRH A;  2M7L A;  3O6B A;  1VRK A;  2GV5 A;  5AER A;  2M1K B;  1IH0 A;  2LC5 A;  4MLW A;  1E8A A;  4CFR A;  2QAC A;  2KI4 B;  2VRG A;  2WC8 A;  1U5I B;  2Y1M A;  2I18 A;  1F4O A;  2F3Z A;  4GGF A;  2E6W A;  3LK1 A;  1ZAC A;  1L2O C;  4GBA A;  2K7D A;  2B1U A;  1BOD A;  2GGM A;  1PAL A;  4MRX A;  2BE6 A;  2AMI A;  5K89 A;  2JXL A;  1OSA A;  2KI6 C;  4FQO A;  3SG6 A;  2M9G A;  2L4I A;  2M97 A;  3CLN A;  1MWN A;  1OE9 B;  1XA5 A;  1L7Z A;  2F33 A;  1YVH A;  4N1G A;  2LLU A;  3M0W A;  5D69 A;  4AQJ A;  2V53 A;  1GQM A;  1QVI Y;  1AK8 A;  2JC2 A;  2KNE A;  1F4Q A;  3GK2 A;  1YRU B;  2M8U A;  2JRF A;  3JVT B;  1M45 A;  2M7N A;  2LVV A;  3A4U B;  1NIW A;  3SJS A;  4PE4 A;  4YRU A;  4A4C A;  4YGD B;  1IRJ A;  5AAN A;  1B4C A;  1NX1 A;  1IQ5 A;  2PMY A;  4YI9 A;  2JWW A;  2NXQ A;  4GNK B;  1YUR A;  3GK1 A;  3BUM B;  2CT9 A;  2MJW B;  2P6B B;  1S3P A;  1M46 A;  1OMV A;  3ICB A;  2IS9 A;  1FW4 A;  5DKR A;  1G4Y R;  1XVJ A;  3EVU A;  1QAS A;  2K7B A;  4YGE B;  1N0Y A;  2AUC A;  2ISD A;  1V1F A;  4C0L A;  4ZCV A;  4YGC B;  1B9A A;  3D0Y A;  4OKH A;  1F70 A;  1FPW A;  2ZKM X;  2KYC A;  1UHH A;  1SR6 B;  3CGA A;  2ZRS A;  5JJG A;  1FI6 A;  3PM8 A;  3PLF B;  3KEV A;  1LIN A;  2LMV A;  2KYF A;  1MQ1 A;  1SRA A;  1CLB A;  1S1E A;  1QIW A;  1KFU S;  4MEW A;  1XO5 A;  1EJ3 A;  2LCP A;  5PAL A;  1FF1 A;  1DF0 A;  2JXC A;  2KDH A;  3IQO A;  4PAL A;  1QX2 A;  1YRT B;  1J7P A;  1IGV A;  1TCO B;  1K2H A;  1J7Q A;  1MUX A;  2WCB A;  1XK4 A;  2AAO A;  2H2K A;  4QJ4 B;  3TDU A;  3K21 A;  1RJV A;  2JZI A;  1X02 A;  1WRK A;  2LP3 A;  1KK8 B;  2K2A A;  1B8R A;  2BKH B;  2K7C A;  3BQ3 A;  4AOM A;  3I5H B;  1QS7 A;  1DVI A;  1F55 A;  1TOP A;  1DGV A;  1R6P A;  1CDP A;  2Y4Q A;  3C1V A;  3AKB A;  2F2O A;  1K94 A;  1TIZ A;  2JQ6 A;  1M39 A;  1K9U A;  2LVK A;  2CCM A;  1A75 A;  1NX3 A;  5CSI A;  4DIR A;  1N65 A;  3EK7 A;  1DJZ A;  1CM1 A;  1LA0 A;  1M63 B;  4MVF A;  1DJH A;  2CXJ A;  3EKJ A;  3BUX B;  3BUW B;  2E30 A;  2LLS A;  1K9P A;  3OP0 A;  1NX2 A;  3O2P A;  2GGZ A;  1W7J B;  1CMG A;  2TN4 A;  2K2F A;  4ICB A;  3OB1 B;  1HQV A;  3NXA A;  4P2Y B;  1KQM C;  2WND A;  2ZNE A;  1JC2 A;  4MZJ A;  2L50 A;  3TUY B;  3JVT C;  1YR5 A;  3NSI A;  4GPL B;  1Q80 A;  2CNP A;  1WLM A;  1OMR A;  2JT3 A;  2H61 A;  1LVC D;  1J55 A;  3CR4 X;  2FOT A;  1WRZ A;  1UHK A;  4PE1 A;  1J7R A;  2KFG A;  2LUC A;  3DVE A;  2ZN8 A;  2LNK A;  1DMO A;  3LLE A;  1NPQ A;  3CR5 X;  1PRW A;  5ER4 X;  4OR9 B;  2JNF A;  3RM1 A;  3KHE A;  4M2P A;  1SKT A;  4PHM A;  2Q91 A;  1OZS A;  1SCV A;  3SG3 A;  3I5F B;  1XYD A;  4ZCU A;  4MN0 A;  2ZN9 A;  2K8M B;  1NP8 A;  5HKY A;  1CNP A;  2KBI A;  2KAV A;  3A8R A;  1SR6 C;  1RRO A;  1XFY O;  4N5X A;  1CDN A;  2WOS A;  3DF0 B;  1YUT A;  5GQQ C;  3JTD B;  4FTG A;  1C07 A;  1JFK A;  3NSK A;  2L2E A;  1CLM A;  3LCP C;  3VRR A;  1AVS A;  1SMG A;  1DJW A;  3NSO A;  1MXL C;  5F6T A;  3VRN A;  1KWO C;  3KO0 A;  2JPT A;  1MXE A;  2JTZ A;  1QAT A;  3CZT X;  1YUS A;  1J1D A;  1YUU A;  3EK4 A;  4M2O A;  4ORB B;  3I5H C;  1B8C A;  3VRO A;  4PHN A;  1WLZ A;  1YX7 A;  3FWB A;  1DJG A;  2FJU B;  2HET A;  2FCD A;  1PSB A;  3EK8 A;  5HKW A;  1S36 A;  2CBL A;  3OX5 A;  2BCA A;  2QPT A;  4MBE A;  4XYN A;  3EVV A;  3AKA A;  5HYD A;  1A03 A;  1C7W A;  1J7O A;  2ZND A;  3TS5 C;  3I5I B;  1OZO A;  3SG7 A;  3IF7 A;  1J1E A;  2MRD A;  1IQ3 A;  5I2L A;  1B7T Z;  1S5G Z;  1UUS A;  3PAL A;  1ALW A;  1GJY A;  1TCF A;  4P5O E;  1OMD A;  1RTP 1;  5AXI A;  1M31 A;  3TUY C;  3WHT B;  4HSZ A;  4PDZ A;  1CMF A;  2LMT A;  2DOQ A;  1XFX O;  2KOT A;  4I5K A;  5HLO A;  2PRU A;  2WCE A;  2LP2 A;  2OTG B;  2Y1N A;  2EC6 C;  4CPV A;  3PN7 C;  1LA3 A;  1UUR A;  3FS7 A;  5DKN A;  4C0K A;  4OCI A;  2LAN A;  2KFH A;  3DVK A;  3OX6 A;  5DKQ A;  2I94 A;  1H4B A;  4N1F A;  1SL7 A;  1H8B A;  1TN4 A;  2KI6 D;  1CKK A;  2D8N A;  3BOW B;  1XFU O;  2OS8 B;  2M0R A;  3ZWH A;  1TNQ A;  1UHI A;  3PFV A;  4DCK A;  1B47 A;  2Y5I A;  3I5F C;  1NCZ A;  2BBN A;  3PSR A;  4GFT A;  1ALV A;  4MSP A;  3TDZ A;  2Q4U A;  2LV7 A;  2CTN A;  1ZFS A;  2KGB C;  4PHK A;  3E3R A;  2K0J A;  5ER5 A;  2KI4 C;  5J3X A;  2LHI A;  1K8U A;  3H4S E;  3JTD C;  4NQG A;  1FBV A;  4NDD A;  1U5I A;  1EL4 A;  3SIB A;  3ZNI A;  2JOJ A;  2M1U A;  4WQ3 A;  1WRL A;  4Q04 A;  3HCM A;  1L2O B;  1IWQ A;  3VRP A;  1JBA A;  1SY9 A;  2G9B A;  2SCP A;  2KQY A;  1BT6 A;  1TNW A;  4U8D A;  2HPS A;  1SNL A;  1Y1X A;  4PE0 A;  4BY5 A;  4YBH B;  1Y1U A;  4GUK A;  4UPG A;  1K90 D;  1JSA A;  3O4Y A;  4XJK B;  1NUB A;  4BY4 A;  1IKU A;  4A4B A;  1A2X A;  4PE7 A;  1PVB A;  4CFQ A;  1CFP A;  2WCF A;  5CSJ A;  3CS1 A;  3KPX A;  2O5G A;  1NWD A;  1IJ5 A;  2LE9 B;  1CFF A;  1CM4 A;  1LKJ A;  4AQI A;  4IL1 A;  3I5I C;  1WDC B;  1A29 A;  1W7I B;  1YVL A;  1IG5 A;  2A4J A;  2NCP A;  1B7T Y;  1S5G Y;  1KFX L;  1SL9 A;  1SL8 A;  2JTT A;  3SG5 A;  1AP4 A;  3HX4 A;  5KTY A;  1UHJ A;  2K61 A;  4F0Z B;  5IBW A;  1RFJ A;  5I2Q A;  1K93 D;  2FCE A;  2NLN A;  4TNC A;  1KFU L;  4GGN A;  4MZL A;  1BG1 A;  1S6C A;  2I7A A;  1MHO A;  2OTG C;  3GOF A;  1OQP A;  1EH2 A;  1G33 A;  4ETO A;  2LUX A;  1QXP A;  1KK7 Z;  3D0Y B;  1FI5 A;  2MA2 A;  2LAP A;  4I5L B;  1NSH A;  4DRW A;  4QJ3 B;  3IQQ A;  2OPO A;  3DVJ A;  4JPZ B;  1RWY A;  5HLV A;  5I2O A;  2BCB A;  2JT0 A;  2RGI A;  4I5N B;  4NDB A;  1AJ4 A;  1BMO A;  1NCX A;  4PCW A;  2MBX A;  1Y1A A;  1KQV A;  4HRG A;  3WHU B;  2KGR A;  2SAS A;  4OV2 A;  1DGU A;  2PVB A;  1KK8 C;  1S6J A;  2L51 A;  4NDC A;  1EG3 A;  2LHL A;  3KF9 A;  1BU3 A;  5CSN A;  1CFC A;  1JWD A;  2LLT A;  4L9M A;  3CR2 A;  2F3Y A;  1REC A;  1V1G A;  1F71 A;  1LXF C;  1DT7 B;  1YX8 A;  1TTX A;  4WQ2 A;  1DJI A;  2EGD A;  4GGF C;  3SG4 A;  4C0J A;  1GGW A;  1RK9 A;  3BXK A;  2BBM A;  2COL B;  1SCM B;  2NCO A;  2MLE C;  1A75 B;  1UHN A;  2MAZ A;  2BEC A;  1NX0 A;  1JF2 A;  4YGA A;  4I5J A;  2KAY A;  1SPY A;  1N2D A;  1BOC A;  1JUO A;  3DVM A;  4ORA B;  3EKH A;  3O78 A;  3GK4 X;  2BKI B;  1QIV A;  1KSM A;  1UP5 A;  2LM5 A;  3EVR A;  4XJK A;  4D1E A;  3LL8 B;  5G08 A;  1SYM A;  1XFV O;  2LMU A;  1Y6W A;  1CTR A;  1BR4 B;  1KQM B;  1PK0 D;  4CID A;  3I5G B;  2K7O A;  3PAT A;  1UWO A;  1D1O A;  4OVN F;  1WDC C;  2M29 A;  4YI8 A;  1CB1 A;  3WXA A;  2ZFD A;  1PSR A;  2KBM A;  4GAO A;  1CDM A;  4JWQ A;  1DJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...