2KOTA

Solution structure of s100a13 with a drug amlexanox
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein S100-A13
publication title Molecular level interactions of S100A13 with amlexanox: inhibitor for the formation of multi-protein complex in non-classical pathway of the acidic fibroblast growth factor
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kotA00
3DVJA 2BE6A 1LXFC 1J1DA 2H61C 1K93D 3CR5X 2JT3A 3JVTB 1R6PA 4A4BA 3GK2A 1CMGA 2RGIA 4C0LA 1XFZO 2WCFA 3SG6A 1WRLA 2H61A 4F0ZB 1DF0A 3I5GC 1GGWA 1Q80A 3PLFB 3NXAA 4CIDA 1XYDA 5I2OA 1XK4C 2NZ0A 4I5NB 2L0PA 1PVAA 5HKWA 3CS1A 1C7VA 1S5GZ 2CXJA 2JTZA 2ZNDA 1UURA 5BPJA 2O5GA 1TTXA 2JTTA 1SL9A 1DTLA 3O78A 2K7OA 4AOMA 4YRUA 1MR8A 1GJYA 3EKJA 2KI4C 1Y1XA 5JOLA 2HQWA 4E68A 3RLZA 1QIVA 1A03A 1C7WA 1QV0A 2KSPA 2EC6B 3EKHA 3CR2A 3NSKA 5G08A 2PASA 2R2IA 2L2EA 4WQ2A 3LK0A 4HSZA 4BY4A 2I94A 2V53A 1XA5A 2WCEA 4HREE 1FI6A 5JJGA 2P6BB 3KEVA 2JC2A 3PSRA 1BJFA 3NSLA 1KQMB 2AUCA 2KHNA 2LM5A 1ZFSA 3CZTX 3TUYC 2K2FA 1YRUB 2Q4UA 5I2QA 3ZNIA 1J7QA 1QX5B 2KYCA 1RROA 2LCPA 4NDBA 1W7IB 1CTRA 1JF0A 1LA0A 2K2AA 2JNXA 1TOPA 2HQ8A 2CTNA 5HKZA 1C07A 1J1EA 1PK0D 3QRXA 1MWNA 1KK8C 1BT6A 1KK7Z 1PRWA 4PHKA 1DJIA 4YGDB 2GGZA 3SG4A 3PM8A 3ZWHA 1OOJA 1MQ1A 4PHNA 5HLOA 3SG2A 4M2OA 5J3XA 2K0JA 3CGAA 2LLUA 2BKHB 1KFXL 1X02A 2F33A 1MXEA 2AMIA 4CLNA 1BMOA 1Y1AA 3HCMA 3JVTC 1KFUL 1W7JB 4PE1A 1EH2A 2I2RE 2L4HA 1A4PA 3PFVA 1Y0VH 5AANA 3EK8A 2LLTA 4N1FA 3LK1A 1OMVA 1LA3A 5FYXA 1S1EA 2OTGB 1B8CA 1D1OA 1F8HA 4WRIA 1S36A 1R2UA 4OKHA 1N65A 1IRJA 4MZJA 1QS7A 1ZMZA 3BYAA 4DRWA 1JC2A 2NCPA 4AQIA 2KQ6A 3O6BA 3TDIA 1LINA 2M7LA 4GPLB 2F8PA 2QPTA 2ZNEA 1Y1UA 3H4SE 4DIRA 2KGBC 3WXAA 4GGFA 2OS8B 1DMOA 1JFJA 3WHTB 2EC6C 1PALA 1EG3A 3WHUB 3DD4A 1RTP1 1TIZA 1S3PA 2Y1MA 2NCOA 1CDNA 2EGDA 1FF1A 3VGOA 4ORCB 1FBVA 3DVMA 2CT9A 2M9GA 5I2LA 2M1UA 3A4UB 2COLB 4BY5A 4CFQA 2BKIB 2B1UA 2M0RA 1KQMC 1SKTA 1SNLA 2JU0A 2BCBA 2VRGA 1CLMA 4JWQA 1KQVA 2CCMA 2GGMA 3AKBA 1F54A 3BQ3A 4OCIA 4MEWA 1SBJA 2GV5A 1B8RA 1CDMA 1G8IA 1K9UA 1N2DA 1YVHA 2DOQA 5ER5A 1A29A 3VRNA 1WRKA 3FWCA 1K90D 1SW8A 1QLSA 4DS7A 2KAYA 4D1EA 1CLLA 1IQ3A 4OVNF 2JWWA 5CSIA 1UP5A 1SL7A 2QACA 1SMGA 2A4JA 2K7CA 2JXLA 3IQOA 2JPTA 4CFRA 4PE7A 1SCMB 1PSBA 2JRFA 2OTGC 1ZOTB 2LVIA 4QJ4B 1JUOA 1IGVA 2Y1NA 3PALA 4YI8A 1NX1A 2KNEA 1J7RA 3VRRA 1NX2A 2LVJA 5HLVA 1JSAA 2LUCA 2TN4A 1CFPA 2FJUB 2MAZA 1GQMA 5HYDA 1BU3A 4OR9B 2D8NA 1IJ6A 2BL0B 3K21A 1S6JA 4PDZA 4ORAB 4ORBB 4Q04A 4YGEB 1OMRA 2I7AA 1XFWO 2OS8C 1K9PA 1SRAA 1L2OB 1OMDA 3NSOA 1K96A 4WQ3A 3RM1A 5AFPA 1K8UA 1ZUZA 1FPWA 2KQYA 3O4YA 1YUUA 2KOTA 1QLKA 1EJ3A 1CDPA 3EVVA 3SG3A 1XFUO 1YURA 1SPYA 1IG5A 2NLNA 1IKUA 5AERA 4C0JA 1WDCB 3E3RA 2LMVA 1NX0A 4YGBB 4QJ5B 3OB2B 1CFCA 2KYFA 5B8IB 3D0YB 1QVIY 1SYMA 4XYNA 2KI6C 1NWDA 2K7DA 2LE9B 4MSPA 2KGRA 1RK9A 2MRDA 2I18A 3PATA 1BR1B 2LP3A 3GOFA 2L4IA 3BOWB 1FI5A 2ZN8A 1SCVA 1WRZA 4GAOA 3TZ1A 4L9MA 4PE0A 1DJZA 3BUWB 3LLEA 4P5OE 2LAPA 1KFXS 1CDLA 2EHBA 3JTDB 3TS5B 5ER4X 3CLNA 1KFUS 3EK7A 1KWOB 1KSOA 2Q91A 2PSRA 2LMUA 3IQQA 4I5LB 5AEQA 2PMYA 1UHIA 1DT7B 2ZRTA 1AP4A 2HETA 1GGZA 2BBMA 4C0KA 1B1GA 1SCMC 1CFFA 2O60A 2PRUA 1QV1A 4GGFC 1NCYA 4FQOA 1DGVA 2SCPA 1XVJA 1G4YR 1N0YA 2M7NA 3BUOB 2LC5A 1AHRA 1QJTA 2BCXA 4P2YB 2F3YA 2L50A 1NCXA 2FCDA 5KSZA 1PSRA 3EVUA 3FS7A 1JF2A 3EVRA 3OHMB 4M2PA 2BL0C 3CWGA 2WOSA 1ZACA 3IF7A 3I5HB 4YGAA 1BODA 3BXKA 1L7ZA 2M29A 1HT9A 4PE4A 1TNXA 5CSFA 1L2OC 1BLQA 4I5JA 1B7TY 1A75B 2L98A 4YI9A 3OX6A 3I5FB 4MVFA 2KAVA 1PVBA 3I5IB 1Y6WA 2E6WA 1BOCA 2G2BA 2BE4A 1QIWA 1DJWA 1YRTB 2G9BA 1ALWA 1AVSA 1RECA 1AK8A 1EG4A 1TCOB 1JFKA 4MZKA 1SY9A 1YX7A 4ETOA 1WDCC 2AAOA 2JQ6A 1TN4A 3KPXA 1KSMA 5TNCA 1TNQA 4IL1A 2H2KA 2JOJA 2F3ZA 1NCZA 2BCAA 1RWYA 1UHHA 1WY9A 2K7BA 3BUNB 4MRXA 2JXCA 2SASA 1IWQA 4GBAA 2WC8A 1CNPA 1NPQA 1YUSA 2ZRSA 2MHHA 3D0YA 1K95A 4GUKA 4TNCA 1BF5A 3GK1A 1NX3A 1CFDA 2ZKMX 1S5GY 3D10A 1F70A 1S26D 3JTDC 4FTGA 3TS5C 2MLFC 1DJYA 1J55A 2LVVA 1NIWA 1SL8A 2KFFA 3BOWA 1YTZC 1UWOA 1QXPA 5CPVA 1BG1A 1KWOC 2LUXA 1F4OA 1QX7A 1MXLC 1OQPA 2F2OA 2HF5A 1U5IB 1OSAA 1B4CA 2WCBA 4GGNA 4GNKB 3FWBA 4I5KA 2PALA 3EK4A 2M97A 1DJHA 1QX2A 2KFGA 1J7OA 3DF0A 3ICBA 5F6TA 4MLWA 1A2XA 1M45A 3SG7A 1V1FA 3OX5A 2JT8A 1NP8A 2LLSA 1SK6D 1M39A 1H4BA 2Y4QA 3NSIA 1SR6B 1AJ5A 1TNWA 1F55A 1OE9B 1K9KA 1XK4A 4GFTA 1S6IA 1WLZA 2BBNA 5D7FA 1UHJA 1XFYO 1XFXO 3I5HC 1TCFA 1DVIA 1UHKA 2JT0A 3LCPC 1B8LA 5D69A 4XJKB 1KK7Y 2KBMA 3M0WA 1ALVA 2M49B 2M8UA 5HKYA 3I5FC 3I5IC 1JBAA 3SJSA 3CTNA 3HX4A 4NDCA 1EXRA 1PULA 2MBXA 3BUXB 3DVEA 1RJVA 2LVKA 1YUTA 2JNFA 4YGCB 1NYAA 1B9AA 4ZCVA 1DGUA 4PHMA 1A75A 4ZCUA 2OPOA 2MA2A 4MRYA 1CMFA 3VROA 3PN7B 1S6CA 2KDHA 5IBWA 2ZFDA 4R1EA 1RFJA 1IH0A 3AKAA 1BR4B 4PCWA 1WLMA 3CR4X 1FW4A 2NXQA 2MJWB 2JZIA 4CPVA 4USLA 2L51A 4U8DA 3WNXB 4QJ3B 3SIBA 1XO5A 2MLEC 3GK4X 1E8AA 4A4CA 2L5XB 1F4QA 1NUBA 3O2PA 1XFVO 2JULA 1YVLA 3DF0B 5DKNA 1DF0B 3VRQA 4UPGA 4PHJA 2K8MB 1F71A 4JQ0D 2IS9A 1IQ5A 2LV7A 1NSHA 5GQQC 1QVIZ 2HPSA 2LANA 3A8RA 3KO0A 1EL4A 3OB1B 1B47A 3SG5A 2K61A 3I5GB 4NQGA 3AAKA 1JWDA 4N5XA 2E30A 4MN0A 5CSNA 1KCYA 3FIAA 2ISDA 1K2HA 1QATA 1QASA 4MBEA 4AQJA 5KU1A 1CM1A 2KFHA 2F2PA 5KTYA 1U5IA 2LNKA 1M31A 1OZSA 2KAXA 3F45A 5I8NA 4JPZB 1M46A 2PVBA 4OV2A 1DJGA 1OZOA 1J7PA 1CLBA 2KI4B 1M63B 1YR5A 2KI6D 2WORA 3KF9A 1G33A 3MSEB 2LHLA 1H8BA 1YX8A 5DKQA 1K94A 5K89A 4HRHA 4DCKA 2CBLA 3VRPA 2FOTA 1SR6C 1TNPA 3TDUA 2BECA 2KBIA 3DVKA 1CB1A 1IJ5A 1LKJA 4HRGA 1QTXA 2LMTA 2FCEA 3KHEA 4PALA 1HQVA 5CSJA 3C1VA 3LL8B 1MUXA 2Y5IA 1MF8B 4YBHB 1LVCD 5DKRA 3TUYB 1CKKA 1UUSA 1AUIB 2ZN9A 3SIAA 2LP2A 1TRFA 4NDDA 3BUMB 4XJKA 4M2QA 1V1GA 1DJXA 1ODBA 3OP0A 5PALA 4N1GA 3PN7C 1AJ4A 2LHIA 3AAJA 1UHNA 1KK8B 1B7TZ 1MHOA 2CNPA 1VRKA 3TDZA 4MZLA 5AXIA 2WNDA 2M3WA 2M1KB 4ICBA 1CM4A 4DUQA
chains in the Genus database with same CATH superfamily
3DVJA 2BE6A 1LXFC 1J1DA 4INXA 2H61C 1K93D 3CR5X 3D75A 2JT3A 3JVTB 1R6PA 4A4BA 3GK2A 3VB1A 2QDIA 1CMGA 2RGIA 4C0LA 1XFZO 2WCFA 3SG6A 1WRLA 2H61A 4F0ZB 2PQLA 1DF0A 3I5GC 1GGWA 1Q80A 3FE6A 3PLFB 3NXAA 4CIDA 1XYDA 5I2OA 1XK4C 2NZ0A 4I5NB 2L0PA 1PVAA 5HKWA 3CS1A 3FE8A 1C7VA 1S5GZ 2CXJA 2JTZA 2ZNDA 1UURA 5BPJA 2O5GA 1TTXA 2JTTA 1SL9A 1DTLA 3O78A 2K7OA 4AOMA 4YRUA 1MR8A 1GJYA 3EKJA 3SS4A 2KI4C 1Y1XA 5JOLA 2HQWA 3L47A 4E68A 3D78A 3RLZA 1QIVA 3BFAA 1A03A 1C7WA 1QV0A 2KSPA 2EC6B 3EKHA 3CR2A 3NSKA 5G08A 2PASA 2R2IA 3BFHA 2L2EA 4WQ2A 3LK0A 4HSZA 4BY4A 2I94A 2V53A 1XA5A 2WCEA 3CZ1A 4HREE 1FI6A 5JJGA 2P6BB 3K1EA 3KEVA 2JC2A 5DICA 3PSRA 1BJFA 3NSLA 1KQMB 2AUCA 2QEVA 2KHNA 2LM5A 1ZFSA 3CZTX 3TUYC 2K2FA 1YRUB 2Q4UA 3S0BA 5I2QA 3NGVA 3ZNIA 1J7QA 1QX5B 2KYCA 1RROA 2LCPA 4NDBA 1W7IB 1CTRA 1JF0A 1LA0A 2K2AA 5HL1A 2JNXA 1TOPA 2HQ8A 2CTNA 1OOGA 5HKZA 1C07A 1J1EA 1PK0D 3QRXA 1MWNA 1KK8C 1BT6A 1KK7Z 3D74A 1PRWA 4PHKA 1DJIA 4YGDB 2GGZA 3SG4A 3O4XA 3PM8A 2WCJA 3ZWHA 1OOJA 1MQ1A 4PHNA 5HLOA 3SG2A 4M2OA 5J3XA 1P28A 2K0JA 3CDNA 3CGAA 2LLUA 1OW4A 1KFXL 2BKHB 1X02A 2F33A 1MXEA 2AMIA 4CLNA 1BMOA 1Y1AA 3HCMA 3S0FA 3JVTC 1KFUL 1W7JB 4PE1A 1EH2A 4OZDA 2I2RE 2L4HA 1A4PA 3PFVA 1Y0VH 5AANA 3EK8A 2LLTA 4N1FA 3LK1A 1OOIX 1LA3A 1OMVA 1S1EA 2OTGB 5FYXA 1B8CA 4F7FA 1D1OA 1F8HA 4WRIA 1S36A 1R2UA 4OKHA 1TUZA 2PYQA 1N65A 1IRJA 4MZJA 1QS7A 1ZMZA 3BYAA 4DRWA 1JC2A 2NCPA 4AQIA 2KQ6A 3CABA 3O6BA 5FI7A 3TDIA 1LINA 3N7HA 2M7LA 4GPLB 2F8PA 2QPTA 2ZNEA 1Y1UA 3H4SE 4DIRA 2FJYA 2KGBC 3DYEA 3WXAA 4GGFA 2OS8B 1DMOA 1JFJA 3WHTB 2EC6C 1PALA 3NHTA 1EG3A 3WHUB 3DD4A 1RTP1 1OOFA 1TIZA 1S3PA 2Y1MA 2NCOA 1CDNA 1QWVA 2EGDA 1FF1A 3VGOA 4ORCB 1FBVA 5D3OA 2WCLA 3DVMA 2CT9A 2M9GA 5I2LA 2M1UA 3A4UB 2COLB 4BY5A 4CFQA 2BKIB 2B1UA 2M0RA 1KQMC 3CZ2A 3BJHA 3SS5A 1SKTA 1SNLA 2JU0A 2BCBA 2VRGA 1CLMA 4JWQA 1KQVA 2CCMA 2GGMA 3AKBA 1F54A 2KPHA 3BQ3A 4OCIA 4MEWA 2BAPA 1SBJA 2GV5A 1B8RA 1CDMA 1G8IA 1K9UA 1N2DA 1YVHA 2DOQA 5ER5A 1A29A 3RZSA 3VRNA 1WRKA 3FWCA 1K90D 1SW8A 1QLSA 4DS7A 2KAYA 4D1EA 1CLLA 1IQ3A 4OVNF 2JWWA 5CSIA 1UP5A 1SL7A 2QACA 3S0EA 3V2LA 1SMGA 2A4JA 2K7CA 2JXLA 3IQOA 2JPTA 3R1OA 4CFRA 4PE7A 1SCMB 1PSBA 2JRFA 2OTGC 3IVTA 1ZOTB 2LVIA 4QJ4B 1JUOA 1IGVA 2Y1NA 3PALA 4YI8A 1NX1A 2KNEA 1J7RA 1Z4HA 1NX2A 3VRRA 2LVJA 5HLVA 1JSAA 2LUCA 2TN4A 1CFPA 2FJUB 2MAZA 1GQMA 5HYDA 2QEOA 1BU3A 4OR9B 2D8NA 1IJ6A 2BL0B 3K21A 1DQEA 1S6JA 4PDZA 4ORAB 4ORBB 4Q04A 4YGEB 1OMRA 5EL2A 2I7AA 1XFWO 2OS8C 1K9PA 1SRAA 3UO9A 1L2OB 1OMDA 3NSOA 1K96A 4WQ3A 3RM1A 5AFPA 1K8UA 1ZUZA 1FPWA 3D73A 2KQYA 3B86A 3O4YA 1YUUA 2KOTA 1QLKA 1EJ3A 1CDPA 2QEBA 3EVVA 1XFUO 3SG3A 1YURA 1SPYA 1IG5A 5I94A 2NLNA 1IKUA 5AERA 4C0JA 2WCMA 1WDCB 3E3RA 3FE9A 2LMVA 1NX0A 4YGBB 4QJ5B 3OB2B 1CFCA 2KYFA 5B8IB 3D0YB 1QVIY 1SYMA 4XYNA 2KI6C 1NWDA 2K7DA 2LE9B 4MSPA 2KGRA 1RK9A 2MRDA 2I18A 3PATA 1BR1B 2LP3A 3GOFA 2L4IA 1TWOA 3BOWB 2ZN8A 1FI5A 1SCVA 1WRZA 4GAOA 3TZ1A 4L9MA 4PE0A 1DJZA 3BUWB 3B87A 3LLEA 4P5OE 2LAPA 1KFXS 1XFRA 1CDLA 2EHBA 3JTDB 3TS5B 5ER4X 3CLNA 1KFUS 3D77A 3DZTA 3EK7A 1KWOB 1KSOA 2Q91A 3S0DA 2PSRA 2LMUA 3IQQA 4I5LB 5AEQA 2PMYA 1UHIA 4JD9A 1DT7B 2ZRTA 3S0GA 1AP4A 2QEHA 2HETA 1GGZA 2BBMA 4C0KA 1B1GA 1SCMC 1CFFA 2O60A 2PRUA 1QV1A 2L2CA 4GGFC 1NCYA 4FQOA 1DGVA 2SCPA 1XVJA 1G4YR 3QMEA 1N0YA 3OGNA 2M7NA 3BUOB 2LC5A 1AHRA 1QJTA 2BCXA 4P2YB 1DELA 2F3YA 2L50A 1NCXA 2FCDA 5KSZA 1PSRA 3EVUA 3FS7A 1JF2A 3EVRA 3OHMB 4M2PA 2BL0C 3CWGA 2WOSA 1ZACA 3IF7A 1OOHA 1Z2CB 3I5HB 4YGAA 1BODA 3BXKA 1L7ZA 3DXLA 2M29A 3L4AA 2JPOA 1HT9A 3CZ0A 4PE4A 1TNXA 5CSFA 1L2OC 1BLQA 4I5JA 1B7TY 1A75B 2L98A 4YI9A 3OX6A 3I5FB 4MVFA 2KAVA 1PVBA 3I5IB 2WCKA 3Q8IA 1DEKA 1DC1A 1Y6WA 2E6WA 2GTEA 2L5YA 1LS8A 3OBVA 2KLDA 1BOCA 2G2BA 2BE4A 1QIWA 1DJWA 1YRTB 2G9BA 1ALWA 1AVSA 1RECA 1AK8A 1EG4A 1TCOB 1JFKA 4MZKA 1SY9A 1YX7A 4ETOA 1WDCC 2AAOA 2JQ6A 1TN4A 3KPXA 3S0AA 1KSMA 5TNCA 1TNQA 4IL1A 2H2KA 2JOJA 2F3ZA 1NCZA 2BCAA 1RWYA 1UHHA 1WY9A 2K7BA 3BUNB 2WCHA 2K60A 4MRXA 2JXCA 2SASA 1IWQA 4GBAA 2WC8A 1CNPA 1NPQA 1YUSA 2ZRSA 2MHHA 3D0YA 1K95A 4GUKA 2YGUA 4IJ7A 4KYNA 4TNCA 1BF5A 3GK1A 1NX3A 1CFDA 1SSEB 1S5GY 2ZKMX 3D10A 1F70A 1S26D 3JTDC 4FTGA 4INWA 2MLFC 3TS5C 1DJYA 1J55A 2LVVA 1NIWA 1SL8A 2KFFA 3BOWA 1YTZC 1UWOA 1QXPA 5CPVA 1BG1A 1KWOC 2LUXA 1F4OA 1QX7A 1MXLC 1OQPA 2F2OA 2P71A 2HF5A 1U5IB 4PT1A 1OSAA 1B4CA 2WCBA 4GGNA 4GNKB 3FWBA 4I5KA 3PM2A 2PALA 5FI2A 3EK4A 2M97A 2H8VA 1DJHA 1QX2A 2KFGA 3DY9A 1J7OA 3DF0A 3ICBA 5F6TA 4MLWA 1TUJA 3SS3A 1C3YA 1A2XA 1M45A 3SG7A 1V1FA 3OX5A 2JT8A 1NP8A 2LLSA 1SK6D 1M39A 1H4BA 5FI6A 2Y4QA 3NSIA 1SR6B 1AJ5A 1TNWA 1F55A 1OE9B 1K9KA 1XK4A 4GFTA 1S6IA 1WLZA 2BBNA 5D7FA 1UHJA 1XFYO 1XFXO 3I5HC 1TCFA 1DVIA 1UHKA 2JT0A 3LCPC 1B8LA 3EG5B 5D69A 4XJKB 1KK7Y 2KBMA 3M0WA 1ALVA 2M49B 2M8UA 5HKYA 3CYZA 3I5FC 3I5IC 1JBAA 3SJSA 3CTNA 3HX4A 4NDCA 1EXRA 1PULA 2MBXA 3BUXB 3DVEA 1RJVA 2LVKA 1YUTA 2JNFA 4YGCB 1NYAA 1B9AA 4ZCVA 1DGUA 4PHMA 1A75A 4ZCUA 2OPOA 2MA2A 4FQTA 4MRYA 1CMFA 3BFBA 3VROA 3PN7B 1S6CA 2KDHA 1ORGA 5IBWA 2ZFDA 4R1EA 1RFJA 1IH0A 3AKAA 1BR4B 4PCWA 1WLMA 3CR4X 1FW4A 2NXQA 2MJWB 2JZIA 4CPVA 4USLA 2L51A 4U8DA 3WNXB 4QJ3B 3B88A 1XO5A 2MLEC 3NHIA 3GK4X 4JKTA 3SIBA 1E8AA 4A4CA 2L5XB 1F4QA 1NUBA 1W9ZA 3O2PA 1XFVO 2JULA 1YVLA 3DF0B 5DKNA 1DF0B 3VRQA 4UPGA 4PHJA 2K8MB 1F71A 4JQ0D 2IS9A 1IQ5A 2LV7A 1NSHA 5GQQC 1QVIZ 2HPSA 2LANA 3A8RA 3KO0A 1EL4A 3OB1B 1B47A 3SG5A 2K61A 3I5GB 4NQGA 3AAKA 1JWDA 3B7AA 4N5XA 2E30A 4MN0A 5CSNA 1KCYA 3FIAA 2BNXA 2ISDA 1K2HA 1QATA 1QASA 2WC5A 4MBEA 4AQJA 1CM1A 2KFHA 2F2PA 3D76A 5KU1A 5KTYA 1U5IA 2LNKA 1M31A 1OZSA 2KAXA 2ERBA 3F45A 5I8NA 4JPZB 1M46A 2PVBA 4OV2A 1DJGA 1OZOA 1J7PA 1CLBA 2KI4B 1M63B 1YR5A 2KI6D 2WORA 3KF9A 1G33A 3MSEB 2LHLA 1GM0A 1H8BA 1YX8A 5DKQA 1K94A 5K89A 4HRHA 4DCKA 2CBLA 3VRPA 2FOTA 1SR6C 1TNPA 3TDUA 2WC6A 1C3ZA 2BECA 2KBIA 3DVKA 1CB1A 1IJ5A 1LKJA 2KLEA 4HRGA 1QTXA 1IIOA 2LMTA 2FCEA 3KHEA 4PALA 1HQVA 5CSJA 3C1VA 3PJIA 3LL8B 1MUXA 2Y5IA 1MF8B 3R72A 4YBHB 1LVCD 5DKRA 3TUYB 3UNWA 1CKKA 1UUSA 1AUIB 2ZN9A 3L4LA 3SIAA 2LP2A 1TRFA 4NDDA 3R1PA 1T14A 3BUMB 4XJKA 4M2QA 1V1GA 3B6XA 1DJXA 2P70A 1ODBA 3OP0A 3R1VA 5PALA 4N1GA 3PN7C 1AJ4A 2LHIA 3AAJA 1UHNA 1KK8B 1B7TZ 1MHOA 2CNPA 1VRKA 3TDZA 4MZLA 5AXIA 2WNDA 2M3WA 2M1KB 4ICBA 1CM4A 4DUQA
chains in the Genus database with same CATH topology
3DVJA 2BE6A 1LXFC 1J1DA 2H61C 1K93D 3CR5X 2JT3A 3JVTB 1R6PA 4A4BA 3GK2A 1CMGA 2RGIA 4C0LA 1XFZO 2WCFA 3SG6A 1WRLA 2H61A 4F0ZB 1DF0A 3I5GC 1GGWA 1Q80A 3PLFB 3NXAA 4CIDA 1XYDA 5I2OA 1XK4C 2NZ0A 4I5NB 2L0PA 1PVAA 5HKWA 3CS1A 1C7VA 1S5GZ 2CXJA 2JTZA 2ZNDA 1UURA 5BPJA 2O5GA 1TTXA 2JTTA 1SL9A 1DTLA 3O78A 2K7OA 4AOMA 4YRUA 1MR8A 1GJYA 3EKJA 2KI4C 1Y1XA 5JOLA 2HQWA 4E68A 3RLZA 1QIVA 1A03A 1C7WA 1QV0A 2KSPA 2EC6B 3EKHA 3CR2A 3NSKA 5G08A 2PASA 2R2IA 2L2EA 4WQ2A 3LK0A 4HSZA 4BY4A 2I94A 2V53A 1XA5A 2WCEA 4HREE 1FI6A 5JJGA 2P6BB 3KEVA 2JC2A 3PSRA 1BJFA 3NSLA 1KQMB 2AUCA 2KHNA 2LM5A 1ZFSA 3CZTX 3TUYC 2K2FA 1YRUB 2Q4UA 5I2QA 3ZNIA 1J7QA 1QX5B 2KYCA 1RROA 2LCPA 4NDBA 1W7IB 1CTRA 1JF0A 1LA0A 2K2AA 2JNXA 1TOPA 2HQ8A 2CTNA 5HKZA 1C07A 1J1EA 1PK0D 3QRXA 1MWNA 1KK8C 1BT6A 1KK7Z 1PRWA 4PHKA 1DJIA 4YGDB 2GGZA 3SG4A 3PM8A 3ZWHA 1OOJA 1MQ1A 4PHNA 5HLOA 3SG2A 4M2OA 5J3XA 2K0JA 3CGAA 2LLUA 2BKHB 1KFXL 1X02A 2F33A 1MXEA 2AMIA 4CLNA 1BMOA 1Y1AA 3HCMA 3JVTC 1KFUL 1W7JB 4PE1A 1EH2A 2I2RE 2L4HA 1A4PA 3PFVA 1Y0VH 5AANA 3EK8A 2LLTA 4N1FA 3LK1A 1OMVA 1LA3A 5FYXA 1S1EA 2OTGB 1B8CA 1D1OA 1F8HA 4WRIA 1S36A 1R2UA 4OKHA 1N65A 1IRJA 4MZJA 1QS7A 1ZMZA 3BYAA 4DRWA 1JC2A 2NCPA 4AQIA 2KQ6A 3O6BA 3TDIA 1LINA 2M7LA 4GPLB 2F8PA 2QPTA 2ZNEA 1Y1UA 3H4SE 4DIRA 2KGBC 3WXAA 4GGFA 2OS8B 1DMOA 1JFJA 3WHTB 2EC6C 1PALA 1EG3A 3WHUB 3DD4A 1RTP1 1TIZA 1S3PA 2Y1MA 2NCOA 1CDNA 2EGDA 1FF1A 3VGOA 4ORCB 1FBVA 3DVMA 2CT9A 2M9GA 5I2LA 2M1UA 3A4UB 2COLB 4BY5A 4CFQA 2BKIB 2B1UA 2M0RA 1KQMC 1SKTA 1SNLA 2JU0A 2BCBA 2VRGA 1CLMA 4JWQA 1KQVA 2CCMA 2GGMA 3AKBA 1F54A 3BQ3A 4OCIA 4MEWA 1SBJA 2GV5A 1B8RA 1CDMA 1G8IA 1K9UA 1N2DA 1YVHA 2DOQA 5ER5A 1A29A 3VRNA 1WRKA 3FWCA 1K90D 1SW8A 1QLSA 4DS7A 2KAYA 4D1EA 1CLLA 1IQ3A 4OVNF 2JWWA 5CSIA 1UP5A 1SL7A 2QACA 1SMGA 2A4JA 2K7CA 2JXLA 3IQOA 2JPTA 4CFRA 4PE7A 1SCMB 1PSBA 2JRFA 2OTGC 1ZOTB 2LVIA 4QJ4B 1JUOA 1IGVA 2Y1NA 3PALA 4YI8A 1NX1A 2KNEA 1J7RA 3VRRA 1NX2A 2LVJA 5HLVA 1JSAA 2LUCA 2TN4A 1CFPA 2FJUB 2MAZA 1GQMA 5HYDA 1BU3A 4OR9B 2D8NA 1IJ6A 2BL0B 3K21A 1S6JA 4PDZA 4ORAB 4ORBB 4Q04A 4YGEB 1OMRA 2I7AA 1XFWO 2OS8C 1K9PA 1SRAA 1L2OB 1OMDA 3NSOA 1K96A 4WQ3A 3RM1A 5AFPA 1K8UA 1ZUZA 1FPWA 2KQYA 3O4YA 1YUUA 2KOTA 1QLKA 1EJ3A 1CDPA 3EVVA 3SG3A 1XFUO 1YURA 1SPYA 1IG5A 2NLNA 1IKUA 5AERA 4C0JA 1WDCB 3E3RA 2LMVA 1NX0A 4YGBB 4QJ5B 3OB2B 1CFCA 2KYFA 5B8IB 3D0YB 1QVIY 1SYMA 4XYNA 2KI6C 1NWDA 2K7DA 2LE9B 4MSPA 2KGRA 1RK9A 2MRDA 2I18A 3PATA 1BR1B 2LP3A 3GOFA 2L4IA 3BOWB 1FI5A 2ZN8A 1SCVA 1WRZA 4GAOA 3TZ1A 4L9MA 4PE0A 1DJZA 3BUWB 3LLEA 4P5OE 2LAPA 1KFXS 1CDLA 2EHBA 3JTDB 3TS5B 5ER4X 3CLNA 1KFUS 3EK7A 1KWOB 1KSOA 2Q91A 2PSRA 2LMUA 3IQQA 4I5LB 5AEQA 2PMYA 1UHIA 1DT7B 2ZRTA 1AP4A 2HETA 1GGZA 2BBMA 4C0KA 1B1GA 1SCMC 1CFFA 2O60A 2PRUA 1QV1A 4GGFC 1NCYA 4FQOA 1DGVA 2SCPA 1XVJA 1G4YR 1N0YA 2M7NA 3BUOB 2LC5A 1AHRA 1QJTA 2BCXA 4P2YB 2F3YA 2L50A 1NCXA 2FCDA 5KSZA 1PSRA 3EVUA 3FS7A 1JF2A 3EVRA 3OHMB 4M2PA 2BL0C 3CWGA 2WOSA 1ZACA 3IF7A 3I5HB 4YGAA 1BODA 3BXKA 1L7ZA 2M29A 1HT9A 4PE4A 1TNXA 5CSFA 1L2OC 1BLQA 4I5JA 1B7TY 1A75B 2L98A 4YI9A 3OX6A 3I5FB 4MVFA 2KAVA 1PVBA 3I5IB 1Y6WA 2E6WA 1BOCA 2G2BA 2BE4A 1QIWA 1DJWA 1YRTB 2G9BA 1ALWA 1AVSA 1RECA 1AK8A 1EG4A 1TCOB 1JFKA 4MZKA 1SY9A 1YX7A 4ETOA 1WDCC 2AAOA 2JQ6A 1TN4A 3KPXA 1KSMA 5TNCA 1TNQA 4IL1A 2H2KA 2JOJA 2F3ZA 1NCZA 2BCAA 1RWYA 1UHHA 1WY9A 2K7BA 3BUNB 4MRXA 2JXCA 2SASA 1IWQA 4GBAA 2WC8A 1CNPA 1NPQA 1YUSA 2ZRSA 2MHHA 3D0YA 1K95A 4GUKA 4TNCA 1BF5A 3GK1A 1NX3A 1CFDA 2ZKMX 1S5GY 3D10A 1F70A 1S26D 3JTDC 4FTGA 3TS5C 2MLFC 1DJYA 1J55A 2LVVA 1NIWA 1SL8A 2KFFA 3BOWA 1YTZC 1UWOA 1QXPA 5CPVA 1BG1A 1KWOC 2LUXA 1F4OA 1QX7A 1MXLC 1OQPA 2F2OA 2HF5A 1U5IB 1OSAA 1B4CA 2WCBA 4GGNA 4GNKB 3FWBA 4I5KA 2PALA 3EK4A 2M97A 1DJHA 1QX2A 2KFGA 1J7OA 3DF0A 3ICBA 5F6TA 4MLWA 1A2XA 1M45A 3SG7A 1V1FA 3OX5A 2JT8A 1NP8A 2LLSA 1SK6D 1M39A 1H4BA 2Y4QA 3NSIA 1SR6B 1AJ5A 1TNWA 1F55A 1OE9B 1K9KA 1XK4A 4GFTA 1S6IA 1WLZA 2BBNA 5D7FA 1UHJA 1XFYO 1XFXO 3I5HC 1TCFA 1DVIA 1UHKA 2JT0A 3LCPC 1B8LA 5D69A 4XJKB 1KK7Y 2KBMA 3M0WA 1ALVA 2M49B 2M8UA 5HKYA 3I5FC 3I5IC 1JBAA 3SJSA 3CTNA 3HX4A 4NDCA 1EXRA 1PULA 2MBXA 3BUXB 3DVEA 1RJVA 2LVKA 1YUTA 2JNFA 4YGCB 1NYAA 1B9AA 4ZCVA 1DGUA 4PHMA 1A75A 4ZCUA 2OPOA 2MA2A 4MRYA 1CMFA 3VROA 3PN7B 1S6CA 2KDHA 5IBWA 2ZFDA 4R1EA 1RFJA 1IH0A 3AKAA 1BR4B 4PCWA 1WLMA 3CR4X 1FW4A 2NXQA 2MJWB 2JZIA 4CPVA 4USLA 2L51A 4U8DA 3WNXB 4QJ3B 3SIBA 1XO5A 2MLEC 3GK4X 1E8AA 4A4CA 2L5XB 1F4QA 1NUBA 3O2PA 1XFVO 2JULA 1YVLA 3DF0B 5DKNA 1DF0B 3VRQA 4UPGA 4PHJA 2K8MB 1F71A 4JQ0D 2IS9A 1IQ5A 2LV7A 1NSHA 5GQQC 1QVIZ 2HPSA 2LANA 3A8RA 3KO0A 1EL4A 3OB1B 1B47A 3SG5A 2K61A 3I5GB 4NQGA 3AAKA 1JWDA 4N5XA 2E30A 4MN0A 5CSNA 1KCYA 3FIAA 2ISDA 1K2HA 1QATA 1QASA 4MBEA 4AQJA 5KU1A 1CM1A 2KFHA 2F2PA 5KTYA 1U5IA 2LNKA 1M31A 1OZSA 2KAXA 3F45A 5I8NA 4JPZB 1M46A 2PVBA 4OV2A 1DJGA 1OZOA 1J7PA 1CLBA 2KI4B 1M63B 1YR5A 2KI6D 2WORA 3KF9A 1G33A 3MSEB 2LHLA 1H8BA 1YX8A 5DKQA 1K94A 5K89A 4HRHA 4DCKA 2CBLA 3VRPA 2FOTA 1SR6C 1TNPA 3TDUA 2BECA 2KBIA 3DVKA 1CB1A 1IJ5A 1LKJA 4HRGA 1QTXA 2LMTA 2FCEA 3KHEA 4PALA 1HQVA 5CSJA 3C1VA 3LL8B 1MUXA 2Y5IA 1MF8B 4YBHB 1LVCD 5DKRA 3TUYB 1CKKA 1UUSA 1AUIB 2ZN9A 3SIAA 2LP2A 1TRFA 4NDDA 3BUMB 4XJKA 4M2QA 1V1GA 1DJXA 1ODBA 3OP0A 5PALA 4N1GA 3PN7C 1AJ4A 2LHIA 3AAJA 1UHNA 1KK8B 1B7TZ 1MHOA 2CNPA 1VRKA 3TDZA 4MZLA 5AXIA 2WNDA 2M3WA 2M1KB 4ICBA 1CM4A 4DUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVJ A;  2BE6 A;  1LXF C;  1J1D A;  2H61 C;  1K93 D;  3CR5 X;  2JT3 A;  3JVT B;  1R6P A;  4A4B A;  3GK2 A;  1CMG A;  2RGI A;  4C0L A;  1XFZ O;  2WCF A;  3SG6 A;  1WRL A;  2H61 A;  4F0Z B;  1DF0 A;  3I5G C;  1GGW A;  1Q80 A;  3PLF B;  3NXA A;  4CID A;  1XYD A;  5I2O A;  1XK4 C;  2NZ0 A;  4I5N B;  2L0P A;  1PVA A;  5HKW A;  3CS1 A;  1C7V A;  1S5G Z;  2CXJ A;  2JTZ A;  2ZND A;  1UUR A;  5BPJ A;  2O5G A;  1TTX A;  2JTT A;  1SL9 A;  1DTL A;  3O78 A;  2K7O A;  4AOM A;  4YRU A;  1MR8 A;  1GJY A;  3EKJ A;  2KI4 C;  1Y1X A;  5JOL A;  2HQW A;  4E68 A;  3RLZ A;  1QIV A;  1A03 A;  1C7W A;  1QV0 A;  2KSP A;  2EC6 B;  3EKH A;  3CR2 A;  3NSK A;  5G08 A;  2PAS A;  2R2I A;  2L2E A;  4WQ2 A;  3LK0 A;  4HSZ A;  4BY4 A;  2I94 A;  2V53 A;  1XA5 A;  2WCE A;  4HRE E;  1FI6 A;  5JJG A;  2P6B B;  3KEV A;  2JC2 A;  3PSR A;  1BJF A;  3NSL A;  1KQM B;  2AUC A;  2KHN A;  2LM5 A;  1ZFS A;  3CZT X;  3TUY C;  2K2F A;  1YRU B;  2Q4U A;  5I2Q A;  3ZNI A;  1J7Q A;  1QX5 B;  2KYC A;  1RRO A;  2LCP A;  4NDB A;  1W7I B;  1CTR A;  1JF0 A;  1LA0 A;  2K2A A;  2JNX A;  1TOP A;  2HQ8 A;  2CTN A;  5HKZ A;  1C07 A;  1J1E A;  1PK0 D;  3QRX A;  1MWN A;  1KK8 C;  1BT6 A;  1KK7 Z;  1PRW A;  4PHK A;  1DJI A;  4YGD B;  2GGZ A;  3SG4 A;  3PM8 A;  3ZWH A;  1OOJ A;  1MQ1 A;  4PHN A;  5HLO A;  3SG2 A;  4M2O A;  5J3X A;  2K0J A;  3CGA A;  2LLU A;  2BKH B;  1KFX L;  1X02 A;  2F33 A;  1MXE A;  2AMI A;  4CLN A;  1BMO A;  1Y1A A;  3HCM A;  3JVT C;  1KFU L;  1W7J B;  4PE1 A;  1EH2 A;  2I2R E;  2L4H A;  1A4P A;  3PFV A;  1Y0V H;  5AAN A;  3EK8 A;  2LLT A;  4N1F A;  3LK1 A;  1OMV A;  1LA3 A;  5FYX A;  1S1E A;  2OTG B;  1B8C A;  1D1O A;  1F8H A;  4WRI A;  1S36 A;  1R2U A;  4OKH A;  1N65 A;  1IRJ A;  4MZJ A;  1QS7 A;  1ZMZ A;  3BYA A;  4DRW A;  1JC2 A;  2NCP A;  4AQI A;  2KQ6 A;  3O6B A;  3TDI A;  1LIN A;  2M7L A;  4GPL B;  2F8P A;  2QPT A;  2ZNE A;  1Y1U A;  3H4S E;  4DIR A;  2KGB C;  3WXA A;  4GGF A;  2OS8 B;  1DMO A;  1JFJ A;  3WHT B;  2EC6 C;  1PAL A;  1EG3 A;  3WHU B;  3DD4 A;  1RTP 1;  1TIZ A;  1S3P A;  2Y1M A;  2NCO A;  1CDN A;  2EGD A;  1FF1 A;  3VGO A;  4ORC B;  1FBV A;  3DVM A;  2CT9 A;  2M9G A;  5I2L A;  2M1U A;  3A4U B;  2COL B;  4BY5 A;  4CFQ A;  2BKI B;  2B1U A;  2M0R A;  1KQM C;  1SKT A;  1SNL A;  2JU0 A;  2BCB A;  2VRG A;  1CLM A;  4JWQ A;  1KQV A;  2CCM A;  2GGM A;  3AKB A;  1F54 A;  3BQ3 A;  4OCI A;  4MEW A;  1SBJ A;  2GV5 A;  1B8R A;  1CDM A;  1G8I A;  1K9U A;  1N2D A;  1YVH A;  2DOQ A;  5ER5 A;  1A29 A;  3VRN A;  1WRK A;  3FWC A;  1K90 D;  1SW8 A;  1QLS A;  4DS7 A;  2KAY A;  4D1E A;  1CLL A;  1IQ3 A;  4OVN F;  2JWW A;  5CSI A;  1UP5 A;  1SL7 A;  2QAC A;  1SMG A;  2A4J A;  2K7C A;  2JXL A;  3IQO A;  2JPT A;  4CFR A;  4PE7 A;  1SCM B;  1PSB A;  2JRF A;  2OTG C;  1ZOT B;  2LVI A;  4QJ4 B;  1JUO A;  1IGV A;  2Y1N A;  3PAL A;  4YI8 A;  1NX1 A;  2KNE A;  1J7R A;  3VRR A;  1NX2 A;  2LVJ A;  5HLV A;  1JSA A;  2LUC A;  2TN4 A;  1CFP A;  2FJU B;  2MAZ A;  1GQM A;  5HYD A;  1BU3 A;  4OR9 B;  2D8N A;  1IJ6 A;  2BL0 B;  3K21 A;  1S6J A;  4PDZ A;  4ORA B;  4ORB B;  4Q04 A;  4YGE B;  1OMR A;  2I7A A;  1XFW O;  2OS8 C;  1K9P A;  1SRA A;  1L2O B;  1OMD A;  3NSO A;  1K96 A;  4WQ3 A;  3RM1 A;  5AFP A;  1K8U A;  1ZUZ A;  1FPW A;  2KQY A;  3O4Y A;  1YUU A;  2KOT A;  1QLK A;  1EJ3 A;  1CDP A;  3EVV A;  3SG3 A;  1XFU O;  1YUR A;  1SPY A;  1IG5 A;  2NLN A;  1IKU A;  5AER A;  4C0J A;  1WDC B;  3E3R A;  2LMV A;  1NX0 A;  4YGB B;  4QJ5 B;  3OB2 B;  1CFC A;  2KYF A;  5B8I B;  3D0Y B;  1QVI Y;  1SYM A;  4XYN A;  2KI6 C;  1NWD A;  2K7D A;  2LE9 B;  4MSP A;  2KGR A;  1RK9 A;  2MRD A;  2I18 A;  3PAT A;  1BR1 B;  2LP3 A;  3GOF A;  2L4I A;  3BOW B;  1FI5 A;  2ZN8 A;  1SCV A;  1WRZ A;  4GAO A;  3TZ1 A;  4L9M A;  4PE0 A;  1DJZ A;  3BUW B;  3LLE A;  4P5O E;  2LAP A;  1KFX S;  1CDL A;  2EHB A;  3JTD B;  3TS5 B;  5ER4 X;  3CLN A;  1KFU S;  3EK7 A;  1KWO B;  1KSO A;  2Q91 A;  2PSR A;  2LMU A;  3IQQ A;  4I5L B;  5AEQ A;  2PMY A;  1UHI A;  1DT7 B;  2ZRT A;  1AP4 A;  2HET A;  1GGZ A;  2BBM A;  4C0K A;  1B1G A;  1SCM C;  1CFF A;  2O60 A;  2PRU A;  1QV1 A;  4GGF C;  1NCY A;  4FQO A;  1DGV A;  2SCP A;  1XVJ A;  1G4Y R;  1N0Y A;  2M7N A;  3BUO B;  2LC5 A;  1AHR A;  1QJT A;  2BCX A;  4P2Y B;  2F3Y A;  2L50 A;  1NCX A;  2FCD A;  5KSZ A;  1PSR A;  3EVU A;  3FS7 A;  1JF2 A;  3EVR A;  3OHM B;  4M2P A;  2BL0 C;  3CWG A;  2WOS A;  1ZAC A;  3IF7 A;  3I5H B;  4YGA A;  1BOD A;  3BXK A;  1L7Z A;  2M29 A;  1HT9 A;  4PE4 A;  1TNX A;  5CSF A;  1L2O C;  1BLQ A;  4I5J A;  1B7T Y;  1A75 B;  2L98 A;  4YI9 A;  3OX6 A;  3I5F B;  4MVF A;  2KAV A;  1PVB A;  3I5I B;  1Y6W A;  2E6W A;  1BOC A;  2G2B A;  2BE4 A;  1QIW A;  1DJW A;  1YRT B;  2G9B A;  1ALW A;  1AVS A;  1REC A;  1AK8 A;  1EG4 A;  1TCO B;  1JFK A;  4MZK A;  1SY9 A;  1YX7 A;  4ETO A;  1WDC C;  2AAO A;  2JQ6 A;  1TN4 A;  3KPX A;  1KSM A;  5TNC A;  1TNQ A;  4IL1 A;  2H2K A;  2JOJ A;  2F3Z A;  1NCZ A;  2BCA A;  1RWY A;  1UHH A;  1WY9 A;  2K7B A;  3BUN B;  4MRX A;  2JXC A;  2SAS A;  1IWQ A;  4GBA A;  2WC8 A;  1CNP A;  1NPQ A;  1YUS A;  2ZRS A;  2MHH A;  3D0Y A;  1K95 A;  4GUK A;  4TNC A;  1BF5 A;  3GK1 A;  1NX3 A;  1CFD A;  2ZKM X;  1S5G Y;  3D10 A;  1F70 A;  1S26 D;  3JTD C;  4FTG A;  3TS5 C;  2MLF C;  1DJY A;  1J55 A;  2LVV A;  1NIW A;  1SL8 A;  2KFF A;  3BOW A;  1YTZ C;  1UWO A;  1QXP A;  5CPV A;  1BG1 A;  1KWO C;  2LUX A;  1F4O A;  1QX7 A;  1MXL C;  1OQP A;  2F2O A;  2HF5 A;  1U5I B;  1OSA A;  1B4C A;  2WCB A;  4GGN A;  4GNK B;  3FWB A;  4I5K A;  2PAL A;  3EK4 A;  2M97 A;  1DJH A;  1QX2 A;  2KFG A;  1J7O A;  3DF0 A;  3ICB A;  5F6T A;  4MLW A;  1A2X A;  1M45 A;  3SG7 A;  1V1F A;  3OX5 A;  2JT8 A;  1NP8 A;  2LLS A;  1SK6 D;  1M39 A;  1H4B A;  2Y4Q A;  3NSI A;  1SR6 B;  1AJ5 A;  1TNW A;  1F55 A;  1OE9 B;  1K9K A;  1XK4 A;  4GFT A;  1S6I A;  1WLZ A;  2BBN A;  5D7F A;  1UHJ A;  1XFY O;  1XFX O;  3I5H C;  1TCF A;  1DVI A;  1UHK A;  2JT0 A;  3LCP C;  1B8L A;  5D69 A;  4XJK B;  1KK7 Y;  2KBM A;  3M0W A;  1ALV A;  2M49 B;  2M8U A;  5HKY A;  3I5F C;  3I5I C;  1JBA A;  3SJS A;  3CTN A;  3HX4 A;  4NDC A;  1EXR A;  1PUL A;  2MBX A;  3BUX B;  3DVE A;  1RJV A;  2LVK A;  1YUT A;  2JNF A;  4YGC B;  1NYA A;  1B9A A;  4ZCV A;  1DGU A;  4PHM A;  1A75 A;  4ZCU A;  2OPO A;  2MA2 A;  4MRY A;  1CMF A;  3VRO A;  3PN7 B;  1S6C A;  2KDH A;  5IBW A;  2ZFD A;  4R1E A;  1RFJ A;  1IH0 A;  3AKA A;  1BR4 B;  4PCW A;  1WLM A;  3CR4 X;  1FW4 A;  2NXQ A;  2MJW B;  2JZI A;  4CPV A;  4USL A;  2L51 A;  4U8D A;  3WNX B;  4QJ3 B;  3SIB A;  1XO5 A;  2MLE C;  3GK4 X;  1E8A A;  4A4C A;  2L5X B;  1F4Q A;  1NUB A;  3O2P A;  1XFV O;  2JUL A;  1YVL A;  3DF0 B;  5DKN A;  1DF0 B;  3VRQ A;  4UPG A;  4PHJ A;  2K8M B;  1F71 A;  4JQ0 D;  2IS9 A;  1IQ5 A;  2LV7 A;  1NSH A;  5GQQ C;  1QVI Z;  2HPS A;  2LAN A;  3A8R A;  3KO0 A;  1EL4 A;  3OB1 B;  1B47 A;  3SG5 A;  2K61 A;  3I5G B;  4NQG A;  3AAK A;  1JWD A;  4N5X A;  2E30 A;  4MN0 A;  5CSN A;  1KCY A;  3FIA A;  2ISD A;  1K2H A;  1QAT A;  1QAS A;  4MBE A;  4AQJ A;  5KU1 A;  1CM1 A;  2KFH A;  2F2P A;  5KTY A;  1U5I A;  2LNK A;  1M31 A;  1OZS A;  2KAX A;  3F45 A;  5I8N A;  4JPZ B;  1M46 A;  2PVB A;  4OV2 A;  1DJG A;  1OZO A;  1J7P A;  1CLB A;  2KI4 B;  1M63 B;  1YR5 A;  2KI6 D;  2WOR A;  3KF9 A;  1G33 A;  3MSE B;  2LHL A;  1H8B A;  1YX8 A;  5DKQ A;  1K94 A;  5K89 A;  4HRH A;  4DCK A;  2CBL A;  3VRP A;  2FOT A;  1SR6 C;  1TNP A;  3TDU A;  2BEC A;  2KBI A;  3DVK A;  1CB1 A;  1IJ5 A;  1LKJ A;  4HRG A;  1QTX A;  2LMT A;  2FCE A;  3KHE A;  4PAL A;  1HQV A;  5CSJ A;  3C1V A;  3LL8 B;  1MUX A;  2Y5I A;  1MF8 B;  4YBH B;  1LVC D;  5DKR A;  3TUY B;  1CKK A;  1UUS A;  1AUI B;  2ZN9 A;  3SIA A;  2LP2 A;  1TRF A;  4NDD A;  3BUM B;  4XJK A;  4M2Q A;  1V1G A;  1DJX A;  1ODB A;  3OP0 A;  5PAL A;  4N1G A;  3PN7 C;  1AJ4 A;  2LHI A;  3AAJ A;  1UHN A;  1KK8 B;  1B7T Z;  1MHO A;  2CNP A;  1VRK A;  3TDZ A;  4MZL A;  5AXI A;  2WND A;  2M3W A;  2M1K B;  4ICB A;  1CM4 A;  4DUQ A; 
#chains in the Genus database with same CATH topology
 3DVJ A;  2BE6 A;  1LXF C;  1J1D A;  4INX A;  2H61 C;  1K93 D;  3CR5 X;  3D75 A;  2JT3 A;  3JVT B;  1R6P A;  4A4B A;  3GK2 A;  3VB1 A;  2QDI A;  1CMG A;  2RGI A;  4C0L A;  1XFZ O;  2WCF A;  3SG6 A;  1WRL A;  2H61 A;  4F0Z B;  2PQL A;  1DF0 A;  3I5G C;  1GGW A;  1Q80 A;  3FE6 A;  3PLF B;  3NXA A;  4CID A;  1XYD A;  5I2O A;  1XK4 C;  2NZ0 A;  4I5N B;  2L0P A;  1PVA A;  5HKW A;  3CS1 A;  3FE8 A;  1C7V A;  1S5G Z;  2CXJ A;  2JTZ A;  2ZND A;  1UUR A;  5BPJ A;  2O5G A;  1TTX A;  2JTT A;  1SL9 A;  1DTL A;  3O78 A;  2K7O A;  4AOM A;  4YRU A;  1MR8 A;  1GJY A;  3EKJ A;  3SS4 A;  2KI4 C;  1Y1X A;  5JOL A;  2HQW A;  3L47 A;  4E68 A;  3D78 A;  3RLZ A;  1QIV A;  3BFA A;  1A03 A;  1C7W A;  1QV0 A;  2KSP A;  2EC6 B;  3EKH A;  3CR2 A;  3NSK A;  5G08 A;  2PAS A;  2R2I A;  3BFH A;  2L2E A;  4WQ2 A;  3LK0 A;  4HSZ A;  4BY4 A;  2I94 A;  2V53 A;  1XA5 A;  2WCE A;  3CZ1 A;  4HRE E;  1FI6 A;  5JJG A;  2P6B B;  3K1E A;  3KEV A;  2JC2 A;  5DIC A;  3PSR A;  1BJF A;  3NSL A;  1KQM B;  2AUC A;  2QEV A;  2KHN A;  2LM5 A;  1ZFS A;  3CZT X;  3TUY C;  2K2F A;  1YRU B;  2Q4U A;  3S0B A;  5I2Q A;  3NGV A;  3ZNI A;  1J7Q A;  1QX5 B;  2KYC A;  1RRO A;  2LCP A;  4NDB A;  1W7I B;  1CTR A;  1JF0 A;  1LA0 A;  2K2A A;  5HL1 A;  2JNX A;  1TOP A;  2HQ8 A;  2CTN A;  1OOG A;  5HKZ A;  1C07 A;  1J1E A;  1PK0 D;  3QRX A;  1MWN A;  1KK8 C;  1BT6 A;  1KK7 Z;  3D74 A;  1PRW A;  4PHK A;  1DJI A;  4YGD B;  2GGZ A;  3SG4 A;  3O4X A;  3PM8 A;  2WCJ A;  3ZWH A;  1OOJ A;  1MQ1 A;  4PHN A;  5HLO A;  3SG2 A;  4M2O A;  5J3X A;  1P28 A;  2K0J A;  3CDN A;  3CGA A;  2LLU A;  1OW4 A;  1KFX L;  2BKH B;  1X02 A;  2F33 A;  1MXE A;  2AMI A;  4CLN A;  1BMO A;  1Y1A A;  3HCM A;  3S0F A;  3JVT C;  1KFU L;  1W7J B;  4PE1 A;  1EH2 A;  4OZD A;  2I2R E;  2L4H A;  1A4P A;  3PFV A;  1Y0V H;  5AAN A;  3EK8 A;  2LLT A;  4N1F A;  3LK1 A;  1OOI X;  1LA3 A;  1OMV A;  1S1E A;  2OTG B;  5FYX A;  1B8C A;  4F7F A;  1D1O A;  1F8H A;  4WRI A;  1S36 A;  1R2U A;  4OKH A;  1TUZ A;  2PYQ A;  1N65 A;  1IRJ A;  4MZJ A;  1QS7 A;  1ZMZ A;  3BYA A;  4DRW A;  1JC2 A;  2NCP A;  4AQI A;  2KQ6 A;  3CAB A;  3O6B A;  5FI7 A;  3TDI A;  1LIN A;  3N7H A;  2M7L A;  4GPL B;  2F8P A;  2QPT A;  2ZNE A;  1Y1U A;  3H4S E;  4DIR A;  2FJY A;  2KGB C;  3DYE A;  3WXA A;  4GGF A;  2OS8 B;  1DMO A;  1JFJ A;  3WHT B;  2EC6 C;  1PAL A;  3NHT A;  1EG3 A;  3WHU B;  3DD4 A;  1RTP 1;  1OOF A;  1TIZ A;  1S3P A;  2Y1M A;  2NCO A;  1CDN A;  1QWV A;  2EGD A;  1FF1 A;  3VGO A;  4ORC B;  1FBV A;  5D3O A;  2WCL A;  3DVM A;  2CT9 A;  2M9G A;  5I2L A;  2M1U A;  3A4U B;  2COL B;  4BY5 A;  4CFQ A;  2BKI B;  2B1U A;  2M0R A;  1KQM C;  3CZ2 A;  3BJH A;  3SS5 A;  1SKT A;  1SNL A;  2JU0 A;  2BCB A;  2VRG A;  1CLM A;  4JWQ A;  1KQV A;  2CCM A;  2GGM A;  3AKB A;  1F54 A;  2KPH A;  3BQ3 A;  4OCI A;  4MEW A;  2BAP A;  1SBJ A;  2GV5 A;  1B8R A;  1CDM A;  1G8I A;  1K9U A;  1N2D A;  1YVH A;  2DOQ A;  5ER5 A;  1A29 A;  3RZS A;  3VRN A;  1WRK A;  3FWC A;  1K90 D;  1SW8 A;  1QLS A;  4DS7 A;  2KAY A;  4D1E A;  1CLL A;  1IQ3 A;  4OVN F;  2JWW A;  5CSI A;  1UP5 A;  1SL7 A;  2QAC A;  3S0E A;  3V2L A;  1SMG A;  2A4J A;  2K7C A;  2JXL A;  3IQO A;  2JPT A;  3R1O A;  4CFR A;  4PE7 A;  1SCM B;  1PSB A;  2JRF A;  2OTG C;  3IVT A;  1ZOT B;  2LVI A;  4QJ4 B;  1JUO A;  1IGV A;  2Y1N A;  3PAL A;  4YI8 A;  1NX1 A;  2KNE A;  1J7R A;  1Z4H A;  1NX2 A;  3VRR A;  2LVJ A;  5HLV A;  1JSA A;  2LUC A;  2TN4 A;  1CFP A;  2FJU B;  2MAZ A;  1GQM A;  5HYD A;  2QEO A;  1BU3 A;  4OR9 B;  2D8N A;  1IJ6 A;  2BL0 B;  3K21 A;  1DQE A;  1S6J A;  4PDZ A;  4ORA B;  4ORB B;  4Q04 A;  4YGE B;  1OMR A;  5EL2 A;  2I7A A;  1XFW O;  2OS8 C;  1K9P A;  1SRA A;  3UO9 A;  1L2O B;  1OMD A;  3NSO A;  1K96 A;  4WQ3 A;  3RM1 A;  5AFP A;  1K8U A;  1ZUZ A;  1FPW A;  3D73 A;  2KQY A;  3B86 A;  3O4Y A;  1YUU A;  2KOT A;  1QLK A;  1EJ3 A;  1CDP A;  2QEB A;  3EVV A;  1XFU O;  3SG3 A;  1YUR A;  1SPY A;  1IG5 A;  5I94 A;  2NLN A;  1IKU A;  5AER A;  4C0J A;  2WCM A;  1WDC B;  3E3R A;  3FE9 A;  2LMV A;  1NX0 A;  4YGB B;  4QJ5 B;  3OB2 B;  1CFC A;  2KYF A;  5B8I B;  3D0Y B;  1QVI Y;  1SYM A;  4XYN A;  2KI6 C;  1NWD A;  2K7D A;  2LE9 B;  4MSP A;  2KGR A;  1RK9 A;  2MRD A;  2I18 A;  3PAT A;  1BR1 B;  2LP3 A;  3GOF A;  2L4I A;  1TWO A;  3BOW B;  2ZN8 A;  1FI5 A;  1SCV A;  1WRZ A;  4GAO A;  3TZ1 A;  4L9M A;  4PE0 A;  1DJZ A;  3BUW B;  3B87 A;  3LLE A;  4P5O E;  2LAP A;  1KFX S;  1XFR A;  1CDL A;  2EHB A;  3JTD B;  3TS5 B;  5ER4 X;  3CLN A;  1KFU S;  3D77 A;  3DZT A;  3EK7 A;  1KWO B;  1KSO A;  2Q91 A;  3S0D A;  2PSR A;  2LMU A;  3IQQ A;  4I5L B;  5AEQ A;  2PMY A;  1UHI A;  4JD9 A;  1DT7 B;  2ZRT A;  3S0G A;  1AP4 A;  2QEH A;  2HET A;  1GGZ A;  2BBM A;  4C0K A;  1B1G A;  1SCM C;  1CFF A;  2O60 A;  2PRU A;  1QV1 A;  2L2C A;  4GGF C;  1NCY A;  4FQO A;  1DGV A;  2SCP A;  1XVJ A;  1G4Y R;  3QME A;  1N0Y A;  3OGN A;  2M7N A;  3BUO B;  2LC5 A;  1AHR A;  1QJT A;  2BCX A;  4P2Y B;  1DEL A;  2F3Y A;  2L50 A;  1NCX A;  2FCD A;  5KSZ A;  1PSR A;  3EVU A;  3FS7 A;  1JF2 A;  3EVR A;  3OHM B;  4M2P A;  2BL0 C;  3CWG A;  2WOS A;  1ZAC A;  3IF7 A;  1OOH A;  1Z2C B;  3I5H B;  4YGA A;  1BOD A;  3BXK A;  1L7Z A;  3DXL A;  2M29 A;  3L4A A;  2JPO A;  1HT9 A;  3CZ0 A;  4PE4 A;  1TNX A;  5CSF A;  1L2O C;  1BLQ A;  4I5J A;  1B7T Y;  1A75 B;  2L98 A;  4YI9 A;  3OX6 A;  3I5F B;  4MVF A;  2KAV A;  1PVB A;  3I5I B;  2WCK A;  3Q8I A;  1DEK A;  1DC1 A;  1Y6W A;  2E6W A;  2GTE A;  2L5Y A;  1LS8 A;  3OBV A;  2KLD A;  1BOC A;  2G2B A;  2BE4 A;  1QIW A;  1DJW A;  1YRT B;  2G9B A;  1ALW A;  1AVS A;  1REC A;  1AK8 A;  1EG4 A;  1TCO B;  1JFK A;  4MZK A;  1SY9 A;  1YX7 A;  4ETO A;  1WDC C;  2AAO A;  2JQ6 A;  1TN4 A;  3KPX A;  3S0A A;  1KSM A;  5TNC A;  1TNQ A;  4IL1 A;  2H2K A;  2JOJ A;  2F3Z A;  1NCZ A;  2BCA A;  1RWY A;  1UHH A;  1WY9 A;  2K7B A;  3BUN B;  2WCH A;  2K60 A;  4MRX A;  2JXC A;  2SAS A;  1IWQ A;  4GBA A;  2WC8 A;  1CNP A;  1NPQ A;  1YUS A;  2ZRS A;  2MHH A;  3D0Y A;  1K95 A;  4GUK A;  2YGU A;  4IJ7 A;  4KYN A;  4TNC A;  1BF5 A;  3GK1 A;  1NX3 A;  1CFD A;  1SSE B;  1S5G Y;  2ZKM X;  3D10 A;  1F70 A;  1S26 D;  3JTD C;  4FTG A;  4INW A;  2MLF C;  3TS5 C;  1DJY A;  1J55 A;  2LVV A;  1NIW A;  1SL8 A;  2KFF A;  3BOW A;  1YTZ C;  1UWO A;  1QXP A;  5CPV A;  1BG1 A;  1KWO C;  2LUX A;  1F4O A;  1QX7 A;  1MXL C;  1OQP A;  2F2O A;  2P71 A;  2HF5 A;  1U5I B;  4PT1 A;  1OSA A;  1B4C A;  2WCB A;  4GGN A;  4GNK B;  3FWB A;  4I5K A;  3PM2 A;  2PAL A;  5FI2 A;  3EK4 A;  2M97 A;  2H8V A;  1DJH A;  1QX2 A;  2KFG A;  3DY9 A;  1J7O A;  3DF0 A;  3ICB A;  5F6T A;  4MLW A;  1TUJ A;  3SS3 A;  1C3Y A;  1A2X A;  1M45 A;  3SG7 A;  1V1F A;  3OX5 A;  2JT8 A;  1NP8 A;  2LLS A;  1SK6 D;  1M39 A;  1H4B A;  5FI6 A;  2Y4Q A;  3NSI A;  1SR6 B;  1AJ5 A;  1TNW A;  1F55 A;  1OE9 B;  1K9K A;  1XK4 A;  4GFT A;  1S6I A;  1WLZ A;  2BBN A;  5D7F A;  1UHJ A;  1XFY O;  1XFX O;  3I5H C;  1TCF A;  1DVI A;  1UHK A;  2JT0 A;  3LCP C;  1B8L A;  3EG5 B;  5D69 A;  4XJK B;  1KK7 Y;  2KBM A;  3M0W A;  1ALV A;  2M49 B;  2M8U A;  5HKY A;  3CYZ A;  3I5F C;  3I5I C;  1JBA A;  3SJS A;  3CTN A;  3HX4 A;  4NDC A;  1EXR A;  1PUL A;  2MBX A;  3BUX B;  3DVE A;  1RJV A;  2LVK A;  1YUT A;  2JNF A;  4YGC B;  1NYA A;  1B9A A;  4ZCV A;  1DGU A;  4PHM A;  1A75 A;  4ZCU A;  2OPO A;  2MA2 A;  4FQT A;  4MRY A;  1CMF A;  3BFB A;  3VRO A;  3PN7 B;  1S6C A;  2KDH A;  1ORG A;  5IBW A;  2ZFD A;  4R1E A;  1RFJ A;  1IH0 A;  3AKA A;  1BR4 B;  4PCW A;  1WLM A;  3CR4 X;  1FW4 A;  2NXQ A;  2MJW B;  2JZI A;  4CPV A;  4USL A;  2L51 A;  4U8D A;  3WNX B;  4QJ3 B;  3B88 A;  1XO5 A;  2MLE C;  3NHI A;  3GK4 X;  4JKT A;  3SIB A;  1E8A A;  4A4C A;  2L5X B;  1F4Q A;  1NUB A;  1W9Z A;  3O2P A;  1XFV O;  2JUL A;  1YVL A;  3DF0 B;  5DKN A;  1DF0 B;  3VRQ A;  4UPG A;  4PHJ A;  2K8M B;  1F71 A;  4JQ0 D;  2IS9 A;  1IQ5 A;  2LV7 A;  1NSH A;  5GQQ C;  1QVI Z;  2HPS A;  2LAN A;  3A8R A;  3KO0 A;  1EL4 A;  3OB1 B;  1B47 A;  3SG5 A;  2K61 A;  3I5G B;  4NQG A;  3AAK A;  1JWD A;  3B7A A;  4N5X A;  2E30 A;  4MN0 A;  5CSN A;  1KCY A;  3FIA A;  2BNX A;  2ISD A;  1K2H A;  1QAT A;  1QAS A;  2WC5 A;  4MBE A;  4AQJ A;  1CM1 A;  2KFH A;  2F2P A;  3D76 A;  5KU1 A;  5KTY A;  1U5I A;  2LNK A;  1M31 A;  1OZS A;  2KAX A;  2ERB A;  3F45 A;  5I8N A;  4JPZ B;  1M46 A;  2PVB A;  4OV2 A;  1DJG A;  1OZO A;  1J7P A;  1CLB A;  2KI4 B;  1M63 B;  1YR5 A;  2KI6 D;  2WOR A;  3KF9 A;  1G33 A;  3MSE B;  2LHL A;  1GM0 A;  1H8B A;  1YX8 A;  5DKQ A;  1K94 A;  5K89 A;  4HRH A;  4DCK A;  2CBL A;  3VRP A;  2FOT A;  1SR6 C;  1TNP A;  3TDU A;  2WC6 A;  1C3Z A;  2BEC A;  2KBI A;  3DVK A;  1CB1 A;  1IJ5 A;  1LKJ A;  2KLE A;  4HRG A;  1QTX A;  1IIO A;  2LMT A;  2FCE A;  3KHE A;  4PAL A;  1HQV A;  5CSJ A;  3C1V A;  3PJI A;  3LL8 B;  1MUX A;  2Y5I A;  1MF8 B;  3R72 A;  4YBH B;  1LVC D;  5DKR A;  3TUY B;  3UNW A;  1CKK A;  1UUS A;  1AUI B;  2ZN9 A;  3L4L A;  3SIA A;  2LP2 A;  1TRF A;  4NDD A;  3R1P A;  1T14 A;  3BUM B;  4XJK A;  4M2Q A;  1V1G A;  3B6X A;  1DJX A;  2P70 A;  1ODB A;  3OP0 A;  3R1V A;  5PAL A;  4N1G A;  3PN7 C;  1AJ4 A;  2LHI A;  3AAJ A;  1UHN A;  1KK8 B;  1B7T Z;  1MHO A;  2CNP A;  1VRK A;  3TDZ A;  4MZL A;  5AXI A;  2WND A;  2M3W A;  2M1K B;  4ICB A;  1CM4 A;  4DUQ A; 
#chains in the Genus database with same CATH homology
 3DVJ A;  2BE6 A;  1LXF C;  1J1D A;  2H61 C;  1K93 D;  3CR5 X;  2JT3 A;  3JVT B;  1R6P A;  4A4B A;  3GK2 A;  1CMG A;  2RGI A;  4C0L A;  1XFZ O;  2WCF A;  3SG6 A;  1WRL A;  2H61 A;  4F0Z B;  1DF0 A;  3I5G C;  1GGW A;  1Q80 A;  3PLF B;  3NXA A;  4CID A;  1XYD A;  5I2O A;  1XK4 C;  2NZ0 A;  4I5N B;  2L0P A;  1PVA A;  5HKW A;  3CS1 A;  1C7V A;  1S5G Z;  2CXJ A;  2JTZ A;  2ZND A;  1UUR A;  5BPJ A;  2O5G A;  1TTX A;  2JTT A;  1SL9 A;  1DTL A;  3O78 A;  2K7O A;  4AOM A;  4YRU A;  1MR8 A;  1GJY A;  3EKJ A;  2KI4 C;  1Y1X A;  5JOL A;  2HQW A;  4E68 A;  3RLZ A;  1QIV A;  1A03 A;  1C7W A;  1QV0 A;  2KSP A;  2EC6 B;  3EKH A;  3CR2 A;  3NSK A;  5G08 A;  2PAS A;  2R2I A;  2L2E A;  4WQ2 A;  3LK0 A;  4HSZ A;  4BY4 A;  2I94 A;  2V53 A;  1XA5 A;  2WCE A;  4HRE E;  1FI6 A;  5JJG A;  2P6B B;  3KEV A;  2JC2 A;  3PSR A;  1BJF A;  3NSL A;  1KQM B;  2AUC A;  2KHN A;  2LM5 A;  1ZFS A;  3CZT X;  3TUY C;  2K2F A;  1YRU B;  2Q4U A;  5I2Q A;  3ZNI A;  1J7Q A;  1QX5 B;  2KYC A;  1RRO A;  2LCP A;  4NDB A;  1W7I B;  1CTR A;  1JF0 A;  1LA0 A;  2K2A A;  2JNX A;  1TOP A;  2HQ8 A;  2CTN A;  5HKZ A;  1C07 A;  1J1E A;  1PK0 D;  3QRX A;  1MWN A;  1KK8 C;  1BT6 A;  1KK7 Z;  1PRW A;  4PHK A;  1DJI A;  4YGD B;  2GGZ A;  3SG4 A;  3PM8 A;  3ZWH A;  1OOJ A;  1MQ1 A;  4PHN A;  5HLO A;  3SG2 A;  4M2O A;  5J3X A;  2K0J A;  3CGA A;  2LLU A;  2BKH B;  1KFX L;  1X02 A;  2F33 A;  1MXE A;  2AMI A;  4CLN A;  1BMO A;  1Y1A A;  3HCM A;  3JVT C;  1KFU L;  1W7J B;  4PE1 A;  1EH2 A;  2I2R E;  2L4H A;  1A4P A;  3PFV A;  1Y0V H;  5AAN A;  3EK8 A;  2LLT A;  4N1F A;  3LK1 A;  1OMV A;  1LA3 A;  5FYX A;  1S1E A;  2OTG B;  1B8C A;  1D1O A;  1F8H A;  4WRI A;  1S36 A;  1R2U A;  4OKH A;  1N65 A;  1IRJ A;  4MZJ A;  1QS7 A;  1ZMZ A;  3BYA A;  4DRW A;  1JC2 A;  2NCP A;  4AQI A;  2KQ6 A;  3O6B A;  3TDI A;  1LIN A;  2M7L A;  4GPL B;  2F8P A;  2QPT A;  2ZNE A;  1Y1U A;  3H4S E;  4DIR A;  2KGB C;  3WXA A;  4GGF A;  2OS8 B;  1DMO A;  1JFJ A;  3WHT B;  2EC6 C;  1PAL A;  1EG3 A;  3WHU B;  3DD4 A;  1RTP 1;  1TIZ A;  1S3P A;  2Y1M A;  2NCO A;  1CDN A;  2EGD A;  1FF1 A;  3VGO A;  4ORC B;  1FBV A;  3DVM A;  2CT9 A;  2M9G A;  5I2L A;  2M1U A;  3A4U B;  2COL B;  4BY5 A;  4CFQ A;  2BKI B;  2B1U A;  2M0R A;  1KQM C;  1SKT A;  1SNL A;  2JU0 A;  2BCB A;  2VRG A;  1CLM A;  4JWQ A;  1KQV A;  2CCM A;  2GGM A;  3AKB A;  1F54 A;  3BQ3 A;  4OCI A;  4MEW A;  1SBJ A;  2GV5 A;  1B8R A;  1CDM A;  1G8I A;  1K9U A;  1N2D A;  1YVH A;  2DOQ A;  5ER5 A;  1A29 A;  3VRN A;  1WRK A;  3FWC A;  1K90 D;  1SW8 A;  1QLS A;  4DS7 A;  2KAY A;  4D1E A;  1CLL A;  1IQ3 A;  4OVN F;  2JWW A;  5CSI A;  1UP5 A;  1SL7 A;  2QAC A;  1SMG A;  2A4J A;  2K7C A;  2JXL A;  3IQO A;  2JPT A;  4CFR A;  4PE7 A;  1SCM B;  1PSB A;  2JRF A;  2OTG C;  1ZOT B;  2LVI A;  4QJ4 B;  1JUO A;  1IGV A;  2Y1N A;  3PAL A;  4YI8 A;  1NX1 A;  2KNE A;  1J7R A;  3VRR A;  1NX2 A;  2LVJ A;  5HLV A;  1JSA A;  2LUC A;  2TN4 A;  1CFP A;  2FJU B;  2MAZ A;  1GQM A;  5HYD A;  1BU3 A;  4OR9 B;  2D8N A;  1IJ6 A;  2BL0 B;  3K21 A;  1S6J A;  4PDZ A;  4ORA B;  4ORB B;  4Q04 A;  4YGE B;  1OMR A;  2I7A A;  1XFW O;  2OS8 C;  1K9P A;  1SRA A;  1L2O B;  1OMD A;  3NSO A;  1K96 A;  4WQ3 A;  3RM1 A;  5AFP A;  1K8U A;  1ZUZ A;  1FPW A;  2KQY A;  3O4Y A;  1YUU A;  2KOT A;  1QLK A;  1EJ3 A;  1CDP A;  3EVV A;  3SG3 A;  1XFU O;  1YUR A;  1SPY A;  1IG5 A;  2NLN A;  1IKU A;  5AER A;  4C0J A;  1WDC B;  3E3R A;  2LMV A;  1NX0 A;  4YGB B;  4QJ5 B;  3OB2 B;  1CFC A;  2KYF A;  5B8I B;  3D0Y B;  1QVI Y;  1SYM A;  4XYN A;  2KI6 C;  1NWD A;  2K7D A;  2LE9 B;  4MSP A;  2KGR A;  1RK9 A;  2MRD A;  2I18 A;  3PAT A;  1BR1 B;  2LP3 A;  3GOF A;  2L4I A;  3BOW B;  1FI5 A;  2ZN8 A;  1SCV A;  1WRZ A;  4GAO A;  3TZ1 A;  4L9M A;  4PE0 A;  1DJZ A;  3BUW B;  3LLE A;  4P5O E;  2LAP A;  1KFX S;  1CDL A;  2EHB A;  3JTD B;  3TS5 B;  5ER4 X;  3CLN A;  1KFU S;  3EK7 A;  1KWO B;  1KSO A;  2Q91 A;  2PSR A;  2LMU A;  3IQQ A;  4I5L B;  5AEQ A;  2PMY A;  1UHI A;  1DT7 B;  2ZRT A;  1AP4 A;  2HET A;  1GGZ A;  2BBM A;  4C0K A;  1B1G A;  1SCM C;  1CFF A;  2O60 A;  2PRU A;  1QV1 A;  4GGF C;  1NCY A;  4FQO A;  1DGV A;  2SCP A;  1XVJ A;  1G4Y R;  1N0Y A;  2M7N A;  3BUO B;  2LC5 A;  1AHR A;  1QJT A;  2BCX A;  4P2Y B;  2F3Y A;  2L50 A;  1NCX A;  2FCD A;  5KSZ A;  1PSR A;  3EVU A;  3FS7 A;  1JF2 A;  3EVR A;  3OHM B;  4M2P A;  2BL0 C;  3CWG A;  2WOS A;  1ZAC A;  3IF7 A;  3I5H B;  4YGA A;  1BOD A;  3BXK A;  1L7Z A;  2M29 A;  1HT9 A;  4PE4 A;  1TNX A;  5CSF A;  1L2O C;  1BLQ A;  4I5J A;  1B7T Y;  1A75 B;  2L98 A;  4YI9 A;  3OX6 A;  3I5F B;  4MVF A;  2KAV A;  1PVB A;  3I5I B;  1Y6W A;  2E6W A;  1BOC A;  2G2B A;  2BE4 A;  1QIW A;  1DJW A;  1YRT B;  2G9B A;  1ALW A;  1AVS A;  1REC A;  1AK8 A;  1EG4 A;  1TCO B;  1JFK A;  4MZK A;  1SY9 A;  1YX7 A;  4ETO A;  1WDC C;  2AAO A;  2JQ6 A;  1TN4 A;  3KPX A;  1KSM A;  5TNC A;  1TNQ A;  4IL1 A;  2H2K A;  2JOJ A;  2F3Z A;  1NCZ A;  2BCA A;  1RWY A;  1UHH A;  1WY9 A;  2K7B A;  3BUN B;  4MRX A;  2JXC A;  2SAS A;  1IWQ A;  4GBA A;  2WC8 A;  1CNP A;  1NPQ A;  1YUS A;  2ZRS A;  2MHH A;  3D0Y A;  1K95 A;  4GUK A;  4TNC A;  1BF5 A;  3GK1 A;  1NX3 A;  1CFD A;  2ZKM X;  1S5G Y;  3D10 A;  1F70 A;  1S26 D;  3JTD C;  4FTG A;  3TS5 C;  2MLF C;  1DJY A;  1J55 A;  2LVV A;  1NIW A;  1SL8 A;  2KFF A;  3BOW A;  1YTZ C;  1UWO A;  1QXP A;  5CPV A;  1BG1 A;  1KWO C;  2LUX A;  1F4O A;  1QX7 A;  1MXL C;  1OQP A;  2F2O A;  2HF5 A;  1U5I B;  1OSA A;  1B4C A;  2WCB A;  4GGN A;  4GNK B;  3FWB A;  4I5K A;  2PAL A;  3EK4 A;  2M97 A;  1DJH A;  1QX2 A;  2KFG A;  1J7O A;  3DF0 A;  3ICB A;  5F6T A;  4MLW A;  1A2X A;  1M45 A;  3SG7 A;  1V1F A;  3OX5 A;  2JT8 A;  1NP8 A;  2LLS A;  1SK6 D;  1M39 A;  1H4B A;  2Y4Q A;  3NSI A;  1SR6 B;  1AJ5 A;  1TNW A;  1F55 A;  1OE9 B;  1K9K A;  1XK4 A;  4GFT A;  1S6I A;  1WLZ A;  2BBN A;  5D7F A;  1UHJ A;  1XFY O;  1XFX O;  3I5H C;  1TCF A;  1DVI A;  1UHK A;  2JT0 A;  3LCP C;  1B8L A;  5D69 A;  4XJK B;  1KK7 Y;  2KBM A;  3M0W A;  1ALV A;  2M49 B;  2M8U A;  5HKY A;  3I5F C;  3I5I C;  1JBA A;  3SJS A;  3CTN A;  3HX4 A;  4NDC A;  1EXR A;  1PUL A;  2MBX A;  3BUX B;  3DVE A;  1RJV A;  2LVK A;  1YUT A;  2JNF A;  4YGC B;  1NYA A;  1B9A A;  4ZCV A;  1DGU A;  4PHM A;  1A75 A;  4ZCU A;  2OPO A;  2MA2 A;  4MRY A;  1CMF A;  3VRO A;  3PN7 B;  1S6C A;  2KDH A;  5IBW A;  2ZFD A;  4R1E A;  1RFJ A;  1IH0 A;  3AKA A;  1BR4 B;  4PCW A;  1WLM A;  3CR4 X;  1FW4 A;  2NXQ A;  2MJW B;  2JZI A;  4CPV A;  4USL A;  2L51 A;  4U8D A;  3WNX B;  4QJ3 B;  3SIB A;  1XO5 A;  2MLE C;  3GK4 X;  1E8A A;  4A4C A;  2L5X B;  1F4Q A;  1NUB A;  3O2P A;  1XFV O;  2JUL A;  1YVL A;  3DF0 B;  5DKN A;  1DF0 B;  3VRQ A;  4UPG A;  4PHJ A;  2K8M B;  1F71 A;  4JQ0 D;  2IS9 A;  1IQ5 A;  2LV7 A;  1NSH A;  5GQQ C;  1QVI Z;  2HPS A;  2LAN A;  3A8R A;  3KO0 A;  1EL4 A;  3OB1 B;  1B47 A;  3SG5 A;  2K61 A;  3I5G B;  4NQG A;  3AAK A;  1JWD A;  4N5X A;  2E30 A;  4MN0 A;  5CSN A;  1KCY A;  3FIA A;  2ISD A;  1K2H A;  1QAT A;  1QAS A;  4MBE A;  4AQJ A;  5KU1 A;  1CM1 A;  2KFH A;  2F2P A;  5KTY A;  1U5I A;  2LNK A;  1M31 A;  1OZS A;  2KAX A;  3F45 A;  5I8N A;  4JPZ B;  1M46 A;  2PVB A;  4OV2 A;  1DJG A;  1OZO A;  1J7P A;  1CLB A;  2KI4 B;  1M63 B;  1YR5 A;  2KI6 D;  2WOR A;  3KF9 A;  1G33 A;  3MSE B;  2LHL A;  1H8B A;  1YX8 A;  5DKQ A;  1K94 A;  5K89 A;  4HRH A;  4DCK A;  2CBL A;  3VRP A;  2FOT A;  1SR6 C;  1TNP A;  3TDU A;  2BEC A;  2KBI A;  3DVK A;  1CB1 A;  1IJ5 A;  1LKJ A;  4HRG A;  1QTX A;  2LMT A;  2FCE A;  3KHE A;  4PAL A;  1HQV A;  5CSJ A;  3C1V A;  3LL8 B;  1MUX A;  2Y5I A;  1MF8 B;  4YBH B;  1LVC D;  5DKR A;  3TUY B;  1CKK A;  1UUS A;  1AUI B;  2ZN9 A;  3SIA A;  2LP2 A;  1TRF A;  4NDD A;  3BUM B;  4XJK A;  4M2Q A;  1V1G A;  1DJX A;  1ODB A;  3OP0 A;  5PAL A;  4N1G A;  3PN7 C;  1AJ4 A;  2LHI A;  3AAJ A;  1UHN A;  1KK8 B;  1B7T Z;  1MHO A;  2CNP A;  1VRK A;  3TDZ A;  4MZL A;  5AXI A;  2WND A;  2M3W A;  2M1K B;  4ICB A;  1CM4 A;  4DUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...