4M2QA

Crystal structure of non-myristoylated recoverin with cysteine-39 oxidized to sulfenic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
188
structure length
187
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 187
sequence length 188
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA01
2KI6D 1C7VA 4YI8A 2B1UA 2CTNA 1NX0A 2BCBA 4PE1A 5KTYA 1CB1A 1TNXA 1KK8B 1TRFA 1XFVO 1DF0B 1K9UA 2EHBA 1JSAA 1ZACA 1QJTA 2EC6C 2ZFDA 4ORAB 1M31A 3K21A 1S1EA 4C0JA 5JOLA 1L7ZA 1B7TZ 4A4BA 2LMTA 1BU3A 3CGAA 1SKTA 1MUXA 1EG3A 2QPTA 1ODBA 4JQ0D 5HYDA 5K89A 1CM4A 2G9BA 1SCMC 2WNDA 2JULA 2K7BA 1K9PA 2MLFC 3FWBA 1K94A 2LMVA 5HLVA 3IQOA 1CDLA 2BCAA 4YI9A 2LLSA 1QV1A 1K96A 2LC5A 1KWOC 2EGDA 3CR2A 3PM8A 4YRUA 1XA5A 1ZFSA 2I7AA 1JFKA 3I5IC 1XVJA 4P2YB 2KAYA 3VRNA 3SG6A 3I5IB 1XFYO 2LE9B 2TN4A 2JPTA 1DTLA 1NUBA 1YX8A 1HT9A 2L98A 1BOCA 4GAOA 3VRPA 3KEVA 3CTNA 1QLSA 4YGCB 1OMRA 3CLNA 1BLQA 1AK8A 1YX7A 4NDCA 3PATA 1SR6C 5J3XA 1UHKA 1IQ3A 1NX2A 1GGWA 2KNEA 1U5IB 1SL9A 2Y1MA 2E6WA 3DVEA 1B47A 5KU1A 3E3RA 2HF5A 1KQMC 1K95A 2M0RA 1WRKA 5ER4X 1DMOA 1WLMA 1KFXL 1MQ1A 2PSRA 1S5GZ 2LVVA 4PE7A 2ZNEA 1D1OA 1J7QA 4USLA 2KFFA 3EKJA 2KHNA 1YVLA 1QVIY 1XFXO 3ZNIA 1DVIA 3H4SE 5HKZA 1W7IB 3DF0A 1ZMZA 2F8PA 4PE4A 2L51A 3IQQA 4YGEB 1KFUS 1UHHA 2M3WA 3EVRA 1CDMA 2M29A 1A03A 1M39A 2MBXA 1MWNA 2KFHA 5AEQA 2M1UA 2F3ZA 3GK1A 2OS8C 1SW8A 1WLZA 1AJ5A 2OS8B 1CLBA 1N0YA 4WQ3A 2KQYA 4XJKB 1OE9B 1PVBA 2M7LA 3VRQA 1CTRA 2M8UA 4Q04A 2P6BB 4A4CA 1EXRA 1UHJA 5CPVA 1DJGA 3TZ1A 1QIWA 1OZOA 2H61C 5CSIA 3JVTC 4ETOA 4D1EA 1JWDA 2KGRA 4AQJA 4NQGA 1W7JB 1S36A 2L2EA 3EVVA 3JVTB 5TNCA 5I8NA 1TIZA 3ZWHA 2FCDA 4GGFC 1N65A 1A2XA 2NZ0A 1DJIA 1LA3A 1R2UA 2K61A 1DJYA 1OQPA 1QX7A 1UURA 1B8LA 1NCYA 1NPQA 2HQWA 3KO0A 2JXCA 3OHMB 1J7OA 1MXEA 5G08A 2RGIA 2K7CA 1XK4C 1RWYA 2D8NA 2LLUA 2Y1NA 3D0YA 4I5NB 1J7RA 1IH0A 3RM1A 1UUSA 4C0KA 1CFPA 3TDUA 4GFTA 2JU0A 3I5FB 1CNPA 1PALA 2CT9A 2WCEA 1SL7A 3NSLA 4AQIA 1RK9A 3KHEA 1OMDA 1QX5B 1NYAA 1V1FA 1AJ4A 1IKUA 3I5HC 2LVJA 1KFUL 1QV0A 1AP4A 3D10A 4CIDA 3O78A 3I5HB 1KK7Y 2JT8A 2JOJA 2MLEC 4WRIA 2KBIA 1F8HA 2NCOA 4I5JA 2MRDA 2I94A 3OP0A 2EC6B 2JRFA 1Y1AA 1L2OC 2BKHB 3O6BA 1A4PA 2KQ6A 3EVUA 1DF0A 1JF0A 1L2OB 2L50A 4PHKA 3CR4X 1A29A 5D69A 1SCMB 3SIBA 3GK2A 1K8UA 1FBVA 2HQ8A 1KWOB 4BY4A 4MRYA 5HLOA 1MXLC 5CSJA 5AERA 1SYMA 4QJ3B 4JWQA 2OPOA 2AAOA 1JBAA 2COLB 1CDPA 4MZJA 2F33A 3I5GC 1DJXA 1IRJA 2JZIA 2BECA 1DGUA 2BBNA 2LUCA 4GNKB 1QLKA 3I5GB 1F4QA 2LVKA 1KSMA 2DOQA 1QASA 2LHIA 3EK4A 4I5LB 3SG4A 1BR1B 3F45A 4HRHA 4GGNA 1SR6B 1UHNA 1J1DA 5IBWA 1J7PA 1IG5A 4N1GA 4P5OE 3EK8A 3BOWA 1QX2A 1C7WA 3M0WA 5AFPA 1SCVA 1LINA 1XO5A 1KQMB 2HETA 4F0ZB 4PE0A 1SRAA 5KSZA 1UHIA 2MHHA 2MJWB 4N1FA 2LCPA 3HCMA 3IF7A 3BUNB 5AXIA 1PSRA 1SMGA 1MF8B 1CDNA 1M46A 4UPGA 4OCIA 3SJSA 2JNFA 1K9KA 5DKQA 1PSBA 1CFFA 2R2IA 1NX3A 2CBLA 1GJYA 4QJ4B 4ICBA 1F55A 4PHJA 3DF0B 3WNXB 1BT6A 2ZN8A 2F3YA 3SG3A 1SBJA 1JUOA 4C0LA 3RLZA 1S6IA 4FTGA 2AUCA 1ZUZA 1J55A 1NIWA 3AAJA 3PSRA 2I2RE 2KAXA 5I2LA 2A4JA 2KI4C 4HREE 1OZSA 2K2AA 2LVIA 4MBEA 2LHLA 1A75A 4MSPA 4PHMA 3NSKA 2KI4B 1ALWA 1TNQA 4MEWA 1QVIZ 1Q80A 2QACA 1XFWO 2PRUA 1YUSA 5I2OA 4MZKA 3WHTB 2M1KB 3SG2A 2K2FA 5CSFA 1SK6D 3CWGA 1B8RA 2PMYA 1K90D 2KAVA 1C07A 3OB1B 1CLLA 2JWWA 1FI6A 4MN0A 4YBHB 1B4CA 1CFCA 3LCPC 1BODA 1EH2A 2LMUA 4HSZA 1DGVA 1CLMA 1RECA 1IGVA 1TCOB 2JNXA 1RROA 3BUWB 1IJ5A 2JTTA 1DT7B 3QRXA 2LAPA 1LXFC 4N5XA 1NCZA 1G33A 1OMVA 1KCYA 2WOSA 1AVSA 1FI5A 1PK0D 2OTGC 1S3PA 3TDZA 3C1VA 1SY9A 3VGOA 3WXAA 2OTGB 2M9GA 4M2QA 2L4IA 3SG7A 1LVCD 1WRLA 3D0YB 4DRWA 3OB2B 1QIVA 1B7TY 2JC2A 1CM1A 3NSOA 2CNPA 5I2QA 2JXLA 3JTDC 1TN4A 2BL0C 2E30A 2KYFA 2SCPA 3FWCA 2NCPA 2MAZA 2K0JA 3JTDB 2JT3A 3CR5X 3FS7A 5PALA 2LV7A 4IL1A 1RJVA 1YR5A 2BKIB 4M2PA 1JC2A 3AKBA 4MRXA 1Y6WA 3PLFB 2Q4UA 3PFVA 4NDBA 1GQMA 2HPSA 1BG1A 1RTP1 2ZNDA 2AMIA 2WCBA 1WY9A 1MR8A 1EG4A 4CLNA 1KK8C 3DD4A 3NSIA 2K7DA 1B1GA 3LK0A 3AAKA 3FIAA 1F71A 1DJHA 2Y5IA 1SPYA 2PASA 2NLNA 3MSEB 4WQ2A 2O5GA 4ZCVA 2GGZA 2PVBA 1NWDA 4BY5A 1QTXA 5HKWA 1YVHA 1J1EA 1S6CA 1CFDA 1QATA 3CS1A 3OX6A 5HKYA 1YRTB 2H2KA 1OSAA 1KK7Z 1ZOTB 3CZTX 4U8DA 1H4BA 1YURA 4I5KA 2PALA 2BBMA 3VRRA 1R6PA 1NSHA 1F70A 4YGDB 1PRWA 1TNWA 3SG5A 1VRKA 5DKNA 1IWQA 1S5GY 5FYXA 3BUXB 1TNPA 3LLEA 1JF2A 1LKJA 1QXPA 3BYAA 3O4YA 4TNCA 1KSOA 2IS9A 3AKAA 1FPWA 4JPZB 1S26D 1U5IA 1XFUO 3A4UB 1JFJA 3OX5A 1AUIB 1F54A 1N2DA 3DVMA 4OKHA 1QS7A 3BOWB 3BUOB 2NXQA 1M63B 5B8IB 4E68A 1PULA 3TS5C 1B8CA 1YUTA 1CMFA 1DJZA 5F6TA 2KDHA 2V53A 1UP5A 5D7FA 1X02A 1LA0A 3A8RA 4MZLA 1TTXA 3TS5B 1EL4A 1S6JA 4XYNA 1NP8A 2LLTA 4CFQA 2Y4QA 2F2OA 4DS7A 1XYDA 3NXAA 1H8BA 2ZKMX 2M7NA 2FJUB 1Y1XA 2GV5A 2KYCA 1CMGA 1B9AA 4FQOA 2F2PA 4OVNF 1K2HA 2KGBC 2L0PA 5JJGA 3BXKA 2JQ6A 3EKHA 4CPVA 4DUQA 5BPJA 2KSPA 2BCXA 2ZN9A 4MLWA 1WDCC 1Y1UA 2JT0A 3PN7C 4YGBB 1TCFA 4XJKA 3WHUB 1WDCB 3BQ3A 4PDZA 2K7OA 2M97A 3PN7B 4NDDA 1NX1A 2O60A 1DJWA 1YRUB 2VRGA 2Q91A 4GUKA 4M2OA 3TDIA 1A75B 1M45A 2KOTA 1BMOA 2LUXA 3O2PA 1GGZA 4MVFA 3KF9A 2H61A 1YTZC 3EK7A 3GK4X 5CSNA 1OOJA 4OR9B 1FF1A 3DVJA 3BUMB 3TUYC 5DKRA 1XFZO 4GBAA 2SASA 3SIAA 4L9MA 1WRZA 5AANA 3VROA 2LP2A 2LP3A 4R1EA 3TUYB 1PVAA 4GGFA 1EJ3A 3LK1A 1IJ6A 1BJFA 2KBMA 2LNKA 2BE4A 2KI6C 2CCMA 2L5XB 3DVKA 4HRGA 4YGAA 1ALVA 1NCXA 1F4OA 2GGMA 1Y0VH 2FOTA 2G2BA 1YUUA 2WCFA 4ORBB 1XK4A 2WORA 4PCWA 2ZRTA 4PALA 1HQVA 2KFGA 1KQVA 1AHRA 1IQ5A 1FW4A 2K8MB 5ER5A 1K93D 1G4YR 1BR4B 1G8IA 2CXJA 2M49B 3GOFA 3PALA 4ORCB 1SNLA 1UWOA 4GPLB 1SL8A 4ZCUA 2I18A 4DCKA 4OV2A 2ZRSA 2LM5A 2BL0B 2JTZA 2WC8A 1MHOA 4PHNA 1E8AA 3I5FC 4AOMA 4QJ5B 1TOPA 2MA2A 3HX4A 1V1GA 4CFRA 1RFJA 2BE6A 2FCEA 2L4HA 3LL8B 4DIRA 1BF5A 5GQQC 1KFXS 3KPXA 2ISDA 1CKKA 2LANA 3ICBA
chains in the Genus database with same CATH superfamily
2KI6D 1C7VA 4YI8A 2B1UA 2CTNA 1NX0A 3L47A 2L5YA 2BCBA 3NHTA 1DELA 4PE1A 5KTYA 1CB1A 1TNXA 1KK8B 1TRFA 5FI2A 5D3OA 1XFVO 1DF0B 1K9UA 2EHBA 1JSAA 1ZACA 1QJTA 2EC6C 2ZFDA 4ORAB 1M31A 3K21A 1S1EA 3K1EA 3V2LA 5JOLA 1L7ZA 1B7TZ 4A4BA 4C0JA 2LMTA 1BU3A 3CGAA 1SKTA 1MUXA 1EG3A 2JPOA 2QPTA 1ODBA 4JQ0D 5HYDA 5K89A 1CM4A 2G9BA 1SCMC 2WNDA 2JULA 2K7BA 1K9PA 2MLFC 3B86A 1K94A 2LMVA 3D76A 3FWBA 3O4XA 3IQOA 1CDLA 3R1VA 2BCAA 4YI9A 2LLSA 1QV1A 1K96A 2LC5A 1KWOC 2EGDA 3CR2A 3PM8A 4YRUA 1XA5A 1ZFSA 2I7AA 1JFKA 3I5IC 1P28A 1XVJA 4P2YB 2KAYA 3VRNA 3SG6A 3I5IB 1XFYO 2LE9B 2TN4A 2JPTA 1DTLA 3BFBA 1NUBA 1YX8A 1HT9A 2L98A 3R72A 1BOCA 4GAOA 3VRPA 3KEVA 3CTNA 1QLSA 4YGCB 1OMRA 3CLNA 1BLQA 1AK8A 1YX7A 4NDCA 3PATA 1SR6C 4IJ7A 5J3XA 1UHKA 3SS4A 1IQ3A 1NX2A 1GGWA 2KNEA 1U5IB 1SL9A 1Z4HA 2E6WA 2Y1MA 3CYZA 3DVEA 1B47A 5KU1A 3E3RA 2KLDA 2HF5A 1KQMC 1K95A 2M0RA 1WRKA 5ER4X 5EL2A 1DMOA 2GTEA 1WLMA 1KFXL 1MQ1A 2PSRA 3DY9A 1S5GZ 2LVVA 4PE7A 2ZNEA 1D1OA 1J7QA 4USLA 2KFFA 3EKJA 2KHNA 1YVLA 1QVIY 1XFXO 3ZNIA 1DVIA 3H4SE 2PYQA 5HKZA 1W7IB 3DF0A 1ZMZA 2F8PA 3QMEA 3S0BA 4PE4A 2L51A 3IQQA 4YGEB 1KFUS 1UHHA 2M3WA 3EVRA 1CDMA 2M29A 1A03A 1M39A 2MBXA 1MWNA 2KFHA 2P70A 5AEQA 2M1UA 2F3ZA 3GK1A 2OS8C 1SW8A 1WLZA 1AJ5A 2OS8B 1CLBA 1N0YA 4WQ3A 2KQYA 4XJKB 1OE9B 1PVBA 2M7LA 3VRQA 1CTRA 2M8UA 4Q04A 2P6BB 4A4CA 3S0FA 4INWA 1EXRA 2P71A 1UHJA 5CPVA 1DJGA 3UO9A 3TZ1A 1OOGA 1QIWA 1OZOA 2H61C 1TUJA 5CSIA 3JVTC 4ETOA 4D1EA 1JWDA 2KGRA 4AQJA 3PJIA 4NQGA 1W7JB 1S36A 2L2EA 3EVVA 3JVTB 5TNCA 5I8NA 1TIZA 3ZWHA 2FCDA 4GGFC 1N65A 1A2XA 2NZ0A 1DJIA 1LA3A 1R2UA 2K61A 1DJYA 1OQPA 1QX7A 1UURA 1B8LA 1NCYA 1NPQA 2HQWA 3KO0A 2JXCA 3OHMB 1J7OA 1MXEA 5G08A 2RGIA 2K7CA 3D78A 1XK4C 1RWYA 2D8NA 2LLUA 2Y1NA 3D0YA 4I5NB 5I94A 1J7RA 1IH0A 3RM1A 1OW4A 1UUSA 4C0KA 1CFPA 3TDUA 1W9ZA 4GFTA 1IIOA 2JU0A 3I5FB 1CNPA 1PALA 2CT9A 5DICA 2WCEA 1SL7A 3NSLA 2ERBA 4AQIA 2L2CA 4INXA 1RK9A 3KHEA 1OMDA 1QX5B 1NYAA 1V1FA 1AJ4A 1IKUA 3I5HC 2LVJA 1KFUL 1QV0A 1AP4A 3D10A 4CIDA 3O78A 3I5HB 3RZSA 4FQTA 1KK7Y 2JT8A 2JOJA 2MLEC 4WRIA 2KBIA 1F8HA 2NCOA 4F7FA 4I5JA 2MRDA 2I94A 3OP0A 2EC6B 2JRFA 1Y1AA 1L2OC 2BKHB 3O6BA 1A4PA 2KQ6A 3EVUA 3VB1A 1DF0A 1JF0A 1L2OB 2WCHA 2L50A 4PHKA 3CR4X 1A29A 5D69A 1SCMB 3D75A 2QEBA 3SIBA 3SS3A 3GK2A 1K8UA 1CKKA 1FBVA 2HQ8A 1KWOB 1OOIX 2PQLA 3FE6A 4MRYA 5HLOA 4BY4A 1MXLC 3Q8IA 5CSJA 5AERA 1SYMA 3EG5B 4QJ3B 4JWQA 2OPOA 2AAOA 1JBAA 2COLB 1CDPA 4MZJA 1C3YA 2F33A 3I5GC 1DJXA 1IRJA 2JZIA 2BECA 1DGUA 2BBNA 2LUCA 3BFHA 3IVTA 1QLKA 4GNKB 3I5GB 1F4QA 3S0EA 3UNWA 2LVKA 2QEHA 1KSMA 2DOQA 1QASA 3B6XA 2LHIA 3EK4A 4I5LB 3SG4A 1BR1B 3F45A 4HRHA 4GGNA 1SR6B 1UHNA 1J1DA 5IBWA 1J7PA 1IG5A 4N1GA 4P5OE 1OOHA 3EK8A 3BOWA 1QX2A 1C7WA 3M0WA 5AFPA 1SCVA 1LINA 1XO5A 1KQMB 2HETA 4F0ZB 4PE0A 1SRAA 5KSZA 1UHIA 2MHHA 2MJWB 4N1FA 2LCPA 3HCMA 3IF7A 3BUNB 5AXIA 1XFRA 1GM0A 1PSRA 1SMGA 1MF8B 4KYNA 1CDNA 1M46A 4UPGA 4OCIA 3SJSA 2JNFA 2KLEA 1K9KA 3R1OA 5DKQA 1PSBA 3R1PA 1CFFA 5HLVA 2R2IA 1NX3A 2CBLA 1GJYA 4QJ4B 4ICBA 1F55A 2WCJA 4PHJA 3DF0B 3WNXB 2QEOA 1BT6A 2FJYA 2ZN8A 2F3YA 3SG3A 1SBJA 2K60A 1JUOA 4C0LA 3RLZA 1S6IA 4FTGA 2AUCA 1ZUZA 1J55A 1NIWA 3AAJA 3PSRA 2I2RE 2KAXA 5I2LA 2A4JA 3FE8A 2KI4C 4HREE 1OZSA 2K2AA 2LVIA 4MBEA 2LHLA 1A75A 4MSPA 4PHMA 1Z2CB 3NSKA 2KI4B 5HL1A 1ALWA 1TNQA 4MEWA 1QVIZ 1Q80A 2QACA 1XFWO 5FI6A 2PRUA 1YUSA 5I2OA 4MZKA 4PT1A 3DXLA 3WHTB 2BAPA 2M1KB 3SG2A 2K2FA 5CSFA 1SK6D 3CWGA 1B8RA 2PMYA 1K90D 2KAVA 1C07A 3OB1B 1CLLA 2JWWA 1FI6A 4MN0A 4YBHB 1B4CA 3OGNA 1CFCA 3LCPC 1BODA 1EH2A 2LMUA 4HSZA 1DGVA 1CLMA 1RECA 3CZ0A 1IGVA 1TCOB 2JNXA 1RROA 3BUWB 1IJ5A 2JTTA 1DT7B 3QRXA 2LAPA 1LXFC 4N5XA 1NCZA 1G33A 1OMVA 1KCYA 2WOSA 1AVSA 1FI5A 1PK0D 2OTGC 1S3PA 3TDZA 3C1VA 1SY9A 3VGOA 3WXAA 3BJHA 2OTGB 3CZ2A 2M9GA 4M2QA 2L4IA 3SG7A 1LVCD 1WRLA 3D0YB 4DRWA 3OB2B 1QIVA 1DC1A 1B7TY 2JC2A 1CM1A 3NSOA 2CNPA 5I2QA 2JXLA 1C3ZA 3JTDC 1TN4A 2BL0C 2E30A 2KYFA 2SCPA 3FWCA 2NCPA 2MAZA 2K0JA 3N7HA 3JTDB 1DQEA 2JT3A 3CR5X 3BFAA 3FS7A 5PALA 2KPHA 2LV7A 4IL1A 1RJVA 1YR5A 2BKIB 4M2PA 4PCWA 1JC2A 3AKBA 4MRXA 1Y6WA 3PLFB 2Q4UA 3PFVA 4NDBA 1GQMA 2HPSA 1BG1A 2QEVA 1ORGA 1RTP1 2ZNDA 2AMIA 2WCBA 1WY9A 3D73A 3SS5A 1MR8A 1EG4A 2QDIA 1KK8C 4CLNA 3DD4A 3S0AA 3NSIA 2K7DA 1B1GA 3LK0A 3AAKA 3FIAA 3L4LA 3B87A 1F71A 1DJHA 1QWVA 1SPYA 2PASA 2Y5IA 2NLNA 3MSEB 4WQ2A 2O5GA 4ZCVA 1LS8A 2GGZA 2PVBA 1NWDA 4BY5A 1QTXA 5HKWA 3DZTA 1YVHA 1J1EA 1S6CA 1CFDA 1QATA 3CS1A 3OX6A 5HKYA 1YRTB 2H2KA 1OSAA 1KK7Z 1ZOTB 3CZTX 4U8DA 1H4BA 1YURA 4I5KA 1OOFA 2WC5A 2PALA 2BBMA 3VRRA 1R6PA 1NSHA 1F70A 4YGDB 1PRWA 1TNWA 3SG5A 1VRKA 5DKNA 1IWQA 1S5GY 5FYXA 3BUXB 1TNPA 3LLEA 1JF2A 1LKJA 1QXPA 3BYAA 3O4YA 3B7AA 1SSEB 4TNCA 1KSOA 2IS9A 3AKAA 4OZDA 1FPWA 3D74A 4JPZB 1S26D 1U5IA 1XFUO 3A4UB 2WC6A 1TUZA 1JFJA 3OX5A 1AUIB 1F54A 1N2DA 3DVMA 4OKHA 1QS7A 3BOWB 3BUOB 2NXQA 1M63B 5B8IB 4E68A 1PULA 3TS5C 1B8CA 1YUTA 1CMFA 1DJZA 5F6TA 2KDHA 2V53A 1UP5A 3CZ1A 1X02A 1LA0A 3A8RA 4JD9A 1TTXA 4MZLA 1EL4A 5D7FA 1S6JA 3TS5B 4XYNA 1NP8A 3S0DA 2LLTA 3NGVA 4CFQA 2Y4QA 3L4AA 2F2OA 4DS7A 1XYDA 3NXAA 1DEKA 1H8BA 2ZKMX 3DYEA 2M7NA 2FJUB 1Y1XA 1TWOA 2GV5A 2KYCA 1CMGA 1B9AA 4FQOA 2F2PA 4OVNF 1K2HA 2KGBC 2L0PA 5JJGA 3BXKA 2JQ6A 3EKHA 4CPVA 4DUQA 5BPJA 2H8VA 2KSPA 2BCXA 2ZN9A 4MLWA 1WDCC 1Y1UA 2JT0A 3PN7C 4YGBB 1TCFA 4XJKA 3WHUB 1WDCB 3BQ3A 4PDZA 2K7OA 2M97A 3PN7B 4NDDA 3CDNA 1NX1A 2O60A 1DJWA 1YRUB 2VRGA 2Q91A 4GUKA 4M2OA 3TDIA 1A75B 1M45A 2KOTA 1BMOA 2LUXA 3O2PA 1GGZA 4MVFA 3KF9A 2H61A 1YTZC 3EK7A 3GK4X 5CSNA 1OOJA 4OR9B 1FF1A 2WCMA 3DVJA 3BUMB 3TUYC 5DKRA 1XFZO 4GBAA 2SASA 3SIAA 4L9MA 1WRZA 5AANA 3VROA 2LP2A 2LP3A 2WCKA 4R1EA 3TUYB 1PVAA 3D77A 4GGFA 1EJ3A 3LK1A 1IJ6A 3CABA 1BJFA 2KBMA 2LNKA 2BE4A 2KI6C 2CCMA 1T14A 2L5XB 3DVKA 4HRGA 4YGAA 1ALVA 4JKTA 1NCXA 1F4OA 2BNXA 1Y0VH 2FOTA 2G2BA 1YUUA 2GGMA 2WCFA 1XK4A 2WORA 4ORBB 2ZRTA 3B88A 3FE9A 4PALA 3OBVA 1HQVA 2KFGA 1KQVA 1AHRA 1IQ5A 1FW4A 2K8MB 5ER5A 1K93D 1G4YR 1BR4B 1G8IA 2CXJA 2M49B 2WCLA 3GOFA 3PALA 1SNLA 1UWOA 4GPLB 1SL8A 4ORCB 2I18A 5FI7A 4ZCUA 4OV2A 4DCKA 2ZRSA 2LM5A 2BL0B 2YGUA 3S0GA 2JTZA 2WC8A 1MHOA 4PHNA 1E8AA 3I5FC 4AOMA 4QJ5B 1TOPA 2MA2A 3HX4A 1V1GA 4CFRA 1RFJA 2BE6A 2FCEA 2L4HA 3LL8B 3NHIA 3PM2A 5GQQC 1KFXS 3KPXA 2ISDA 4DIRA 1BF5A 2LANA 3ICBA
chains in the Genus database with same CATH topology
2KI6D 1C7VA 4YI8A 2B1UA 2CTNA 1NX0A 2BCBA 4PE1A 5KTYA 1CB1A 1TNXA 1KK8B 1TRFA 1XFVO 1DF0B 1K9UA 2EHBA 1JSAA 1ZACA 1QJTA 2EC6C 2ZFDA 4ORAB 1M31A 3K21A 1S1EA 4C0JA 5JOLA 1L7ZA 1B7TZ 4A4BA 2LMTA 1BU3A 3CGAA 1SKTA 1MUXA 1EG3A 2QPTA 1ODBA 4JQ0D 5HYDA 5K89A 1CM4A 2G9BA 1SCMC 2WNDA 2JULA 2K7BA 1K9PA 2MLFC 3FWBA 1K94A 2LMVA 5HLVA 3IQOA 1CDLA 2BCAA 4YI9A 2LLSA 1QV1A 1K96A 2LC5A 1KWOC 2EGDA 3CR2A 3PM8A 4YRUA 1XA5A 1ZFSA 2I7AA 1JFKA 3I5IC 1XVJA 4P2YB 2KAYA 3VRNA 3SG6A 3I5IB 1XFYO 2LE9B 2TN4A 2JPTA 1DTLA 1NUBA 1YX8A 1HT9A 2L98A 1BOCA 4GAOA 3VRPA 3KEVA 3CTNA 1QLSA 4YGCB 1OMRA 3CLNA 1BLQA 1AK8A 1YX7A 4NDCA 3PATA 1SR6C 5J3XA 1UHKA 1IQ3A 1NX2A 1GGWA 2KNEA 1U5IB 1SL9A 2Y1MA 2E6WA 3DVEA 1B47A 5KU1A 3E3RA 2HF5A 1KQMC 1K95A 2M0RA 1WRKA 5ER4X 1DMOA 1WLMA 1KFXL 1MQ1A 2PSRA 1S5GZ 2LVVA 4PE7A 2ZNEA 1D1OA 1J7QA 4USLA 2KFFA 3EKJA 2KHNA 1YVLA 1QVIY 1XFXO 3ZNIA 1DVIA 3H4SE 5HKZA 1W7IB 3DF0A 1ZMZA 2F8PA 4PE4A 2L51A 3IQQA 4YGEB 1KFUS 1UHHA 2M3WA 3EVRA 1CDMA 2M29A 1A03A 1M39A 2MBXA 1MWNA 2KFHA 5AEQA 2M1UA 2F3ZA 3GK1A 2OS8C 1SW8A 1WLZA 1AJ5A 2OS8B 1CLBA 1N0YA 4WQ3A 2KQYA 4XJKB 1OE9B 1PVBA 2M7LA 3VRQA 1CTRA 2M8UA 4Q04A 2P6BB 4A4CA 1EXRA 1UHJA 5CPVA 1DJGA 3TZ1A 1QIWA 1OZOA 2H61C 5CSIA 3JVTC 4ETOA 4D1EA 1JWDA 2KGRA 4AQJA 4NQGA 1W7JB 1S36A 2L2EA 3EVVA 3JVTB 5TNCA 5I8NA 1TIZA 3ZWHA 2FCDA 4GGFC 1N65A 1A2XA 2NZ0A 1DJIA 1LA3A 1R2UA 2K61A 1DJYA 1OQPA 1QX7A 1UURA 1B8LA 1NCYA 1NPQA 2HQWA 3KO0A 2JXCA 3OHMB 1J7OA 1MXEA 5G08A 2RGIA 2K7CA 1XK4C 1RWYA 2D8NA 2LLUA 2Y1NA 3D0YA 4I5NB 1J7RA 1IH0A 3RM1A 1UUSA 4C0KA 1CFPA 3TDUA 4GFTA 2JU0A 3I5FB 1CNPA 1PALA 2CT9A 2WCEA 1SL7A 3NSLA 4AQIA 1RK9A 3KHEA 1OMDA 1QX5B 1NYAA 1V1FA 1AJ4A 1IKUA 3I5HC 2LVJA 1KFUL 1QV0A 1AP4A 3D10A 4CIDA 3O78A 3I5HB 1KK7Y 2JT8A 2JOJA 2MLEC 4WRIA 2KBIA 1F8HA 2NCOA 4I5JA 2MRDA 2I94A 3OP0A 2EC6B 2JRFA 1Y1AA 1L2OC 2BKHB 3O6BA 1A4PA 2KQ6A 3EVUA 1DF0A 1JF0A 1L2OB 2L50A 4PHKA 3CR4X 1A29A 5D69A 1SCMB 3SIBA 3GK2A 1K8UA 1FBVA 2HQ8A 1KWOB 4BY4A 4MRYA 5HLOA 1MXLC 5CSJA 5AERA 1SYMA 4QJ3B 4JWQA 2OPOA 2AAOA 1JBAA 2COLB 1CDPA 4MZJA 2F33A 3I5GC 1DJXA 1IRJA 2JZIA 2BECA 1DGUA 2BBNA 2LUCA 4GNKB 1QLKA 3I5GB 1F4QA 2LVKA 1KSMA 2DOQA 1QASA 2LHIA 3EK4A 4I5LB 3SG4A 1BR1B 3F45A 4HRHA 4GGNA 1SR6B 1UHNA 1J1DA 5IBWA 1J7PA 1IG5A 4N1GA 4P5OE 3EK8A 3BOWA 1QX2A 1C7WA 3M0WA 5AFPA 1SCVA 1LINA 1XO5A 1KQMB 2HETA 4F0ZB 4PE0A 1SRAA 5KSZA 1UHIA 2MHHA 2MJWB 4N1FA 2LCPA 3HCMA 3IF7A 3BUNB 5AXIA 1PSRA 1SMGA 1MF8B 1CDNA 1M46A 4UPGA 4OCIA 3SJSA 2JNFA 1K9KA 5DKQA 1PSBA 1CFFA 2R2IA 1NX3A 2CBLA 1GJYA 4QJ4B 4ICBA 1F55A 4PHJA 3DF0B 3WNXB 1BT6A 2ZN8A 2F3YA 3SG3A 1SBJA 1JUOA 4C0LA 3RLZA 1S6IA 4FTGA 2AUCA 1ZUZA 1J55A 1NIWA 3AAJA 3PSRA 2I2RE 2KAXA 5I2LA 2A4JA 2KI4C 4HREE 1OZSA 2K2AA 2LVIA 4MBEA 2LHLA 1A75A 4MSPA 4PHMA 3NSKA 2KI4B 1ALWA 1TNQA 4MEWA 1QVIZ 1Q80A 2QACA 1XFWO 2PRUA 1YUSA 5I2OA 4MZKA 3WHTB 2M1KB 3SG2A 2K2FA 5CSFA 1SK6D 3CWGA 1B8RA 2PMYA 1K90D 2KAVA 1C07A 3OB1B 1CLLA 2JWWA 1FI6A 4MN0A 4YBHB 1B4CA 1CFCA 3LCPC 1BODA 1EH2A 2LMUA 4HSZA 1DGVA 1CLMA 1RECA 1IGVA 1TCOB 2JNXA 1RROA 3BUWB 1IJ5A 2JTTA 1DT7B 3QRXA 2LAPA 1LXFC 4N5XA 1NCZA 1G33A 1OMVA 1KCYA 2WOSA 1AVSA 1FI5A 1PK0D 2OTGC 1S3PA 3TDZA 3C1VA 1SY9A 3VGOA 3WXAA 2OTGB 2M9GA 4M2QA 2L4IA 3SG7A 1LVCD 1WRLA 3D0YB 4DRWA 3OB2B 1QIVA 1B7TY 2JC2A 1CM1A 3NSOA 2CNPA 5I2QA 2JXLA 3JTDC 1TN4A 2BL0C 2E30A 2KYFA 2SCPA 3FWCA 2NCPA 2MAZA 2K0JA 3JTDB 2JT3A 3CR5X 3FS7A 5PALA 2LV7A 4IL1A 1RJVA 1YR5A 2BKIB 4M2PA 1JC2A 3AKBA 4MRXA 1Y6WA 3PLFB 2Q4UA 3PFVA 4NDBA 1GQMA 2HPSA 1BG1A 1RTP1 2ZNDA 2AMIA 2WCBA 1WY9A 1MR8A 1EG4A 4CLNA 1KK8C 3DD4A 3NSIA 2K7DA 1B1GA 3LK0A 3AAKA 3FIAA 1F71A 1DJHA 2Y5IA 1SPYA 2PASA 2NLNA 3MSEB 4WQ2A 2O5GA 4ZCVA 2GGZA 2PVBA 1NWDA 4BY5A 1QTXA 5HKWA 1YVHA 1J1EA 1S6CA 1CFDA 1QATA 3CS1A 3OX6A 5HKYA 1YRTB 2H2KA 1OSAA 1KK7Z 1ZOTB 3CZTX 4U8DA 1H4BA 1YURA 4I5KA 2PALA 2BBMA 3VRRA 1R6PA 1NSHA 1F70A 4YGDB 1PRWA 1TNWA 3SG5A 1VRKA 5DKNA 1IWQA 1S5GY 5FYXA 3BUXB 1TNPA 3LLEA 1JF2A 1LKJA 1QXPA 3BYAA 3O4YA 4TNCA 1KSOA 2IS9A 3AKAA 1FPWA 4JPZB 1S26D 1U5IA 1XFUO 3A4UB 1JFJA 3OX5A 1AUIB 1F54A 1N2DA 3DVMA 4OKHA 1QS7A 3BOWB 3BUOB 2NXQA 1M63B 5B8IB 4E68A 1PULA 3TS5C 1B8CA 1YUTA 1CMFA 1DJZA 5F6TA 2KDHA 2V53A 1UP5A 5D7FA 1X02A 1LA0A 3A8RA 4MZLA 1TTXA 3TS5B 1EL4A 1S6JA 4XYNA 1NP8A 2LLTA 4CFQA 2Y4QA 2F2OA 4DS7A 1XYDA 3NXAA 1H8BA 2ZKMX 2M7NA 2FJUB 1Y1XA 2GV5A 2KYCA 1CMGA 1B9AA 4FQOA 2F2PA 4OVNF 1K2HA 2KGBC 2L0PA 5JJGA 3BXKA 2JQ6A 3EKHA 4CPVA 4DUQA 5BPJA 2KSPA 2BCXA 2ZN9A 4MLWA 1WDCC 1Y1UA 2JT0A 3PN7C 4YGBB 1TCFA 4XJKA 3WHUB 1WDCB 3BQ3A 4PDZA 2K7OA 2M97A 3PN7B 4NDDA 1NX1A 2O60A 1DJWA 1YRUB 2VRGA 2Q91A 4GUKA 4M2OA 3TDIA 1A75B 1M45A 2KOTA 1BMOA 2LUXA 3O2PA 1GGZA 4MVFA 3KF9A 2H61A 1YTZC 3EK7A 3GK4X 5CSNA 1OOJA 4OR9B 1FF1A 3DVJA 3BUMB 3TUYC 5DKRA 1XFZO 4GBAA 2SASA 3SIAA 4L9MA 1WRZA 5AANA 3VROA 2LP2A 2LP3A 4R1EA 3TUYB 1PVAA 4GGFA 1EJ3A 3LK1A 1IJ6A 1BJFA 2KBMA 2LNKA 2BE4A 2KI6C 2CCMA 2L5XB 3DVKA 4HRGA 4YGAA 1ALVA 1NCXA 1F4OA 2GGMA 1Y0VH 2FOTA 2G2BA 1YUUA 2WCFA 4ORBB 1XK4A 2WORA 4PCWA 2ZRTA 4PALA 1HQVA 2KFGA 1KQVA 1AHRA 1IQ5A 1FW4A 2K8MB 5ER5A 1K93D 1G4YR 1BR4B 1G8IA 2CXJA 2M49B 3GOFA 3PALA 4ORCB 1SNLA 1UWOA 4GPLB 1SL8A 4ZCUA 2I18A 4DCKA 4OV2A 2ZRSA 2LM5A 2BL0B 2JTZA 2WC8A 1MHOA 4PHNA 1E8AA 3I5FC 4AOMA 4QJ5B 1TOPA 2MA2A 3HX4A 1V1GA 4CFRA 1RFJA 2BE6A 2FCEA 2L4HA 3LL8B 4DIRA 1BF5A 5GQQC 1KFXS 3KPXA 2ISDA 1CKKA 2LANA 3ICBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  1C7V A;  4YI8 A;  2B1U A;  2CTN A;  1NX0 A;  2BCB A;  4PE1 A;  5KTY A;  1CB1 A;  1TNX A;  1KK8 B;  1TRF A;  1XFV O;  1DF0 B;  1K9U A;  2EHB A;  1JSA A;  1ZAC A;  1QJT A;  2EC6 C;  2ZFD A;  4ORA B;  1M31 A;  3K21 A;  1S1E A;  4C0J A;  5JOL A;  1L7Z A;  1B7T Z;  4A4B A;  2LMT A;  1BU3 A;  3CGA A;  1SKT A;  1MUX A;  1EG3 A;  2QPT A;  1ODB A;  4JQ0 D;  5HYD A;  5K89 A;  1CM4 A;  2G9B A;  1SCM C;  2WND A;  2JUL A;  2K7B A;  1K9P A;  2MLF C;  3FWB A;  1K94 A;  2LMV A;  5HLV A;  3IQO A;  1CDL A;  2BCA A;  4YI9 A;  2LLS A;  1QV1 A;  1K96 A;  2LC5 A;  1KWO C;  2EGD A;  3CR2 A;  3PM8 A;  4YRU A;  1XA5 A;  1ZFS A;  2I7A A;  1JFK A;  3I5I C;  1XVJ A;  4P2Y B;  2KAY A;  3VRN A;  3SG6 A;  3I5I B;  1XFY O;  2LE9 B;  2TN4 A;  2JPT A;  1DTL A;  1NUB A;  1YX8 A;  1HT9 A;  2L98 A;  1BOC A;  4GAO A;  3VRP A;  3KEV A;  3CTN A;  1QLS A;  4YGC B;  1OMR A;  3CLN A;  1BLQ A;  1AK8 A;  1YX7 A;  4NDC A;  3PAT A;  1SR6 C;  5J3X A;  1UHK A;  1IQ3 A;  1NX2 A;  1GGW A;  2KNE A;  1U5I B;  1SL9 A;  2Y1M A;  2E6W A;  3DVE A;  1B47 A;  5KU1 A;  3E3R A;  2HF5 A;  1KQM C;  1K95 A;  2M0R A;  1WRK A;  5ER4 X;  1DMO A;  1WLM A;  1KFX L;  1MQ1 A;  2PSR A;  1S5G Z;  2LVV A;  4PE7 A;  2ZNE A;  1D1O A;  1J7Q A;  4USL A;  2KFF A;  3EKJ A;  2KHN A;  1YVL A;  1QVI Y;  1XFX O;  3ZNI A;  1DVI A;  3H4S E;  5HKZ A;  1W7I B;  3DF0 A;  1ZMZ A;  2F8P A;  4PE4 A;  2L51 A;  3IQQ A;  4YGE B;  1KFU S;  1UHH A;  2M3W A;  3EVR A;  1CDM A;  2M29 A;  1A03 A;  1M39 A;  2MBX A;  1MWN A;  2KFH A;  5AEQ A;  2M1U A;  2F3Z A;  3GK1 A;  2OS8 C;  1SW8 A;  1WLZ A;  1AJ5 A;  2OS8 B;  1CLB A;  1N0Y A;  4WQ3 A;  2KQY A;  4XJK B;  1OE9 B;  1PVB A;  2M7L A;  3VRQ A;  1CTR A;  2M8U A;  4Q04 A;  2P6B B;  4A4C A;  1EXR A;  1UHJ A;  5CPV A;  1DJG A;  3TZ1 A;  1QIW A;  1OZO A;  2H61 C;  5CSI A;  3JVT C;  4ETO A;  4D1E A;  1JWD A;  2KGR A;  4AQJ A;  4NQG A;  1W7J B;  1S36 A;  2L2E A;  3EVV A;  3JVT B;  5TNC A;  5I8N A;  1TIZ A;  3ZWH A;  2FCD A;  4GGF C;  1N65 A;  1A2X A;  2NZ0 A;  1DJI A;  1LA3 A;  1R2U A;  2K61 A;  1DJY A;  1OQP A;  1QX7 A;  1UUR A;  1B8L A;  1NCY A;  1NPQ A;  2HQW A;  3KO0 A;  2JXC A;  3OHM B;  1J7O A;  1MXE A;  5G08 A;  2RGI A;  2K7C A;  1XK4 C;  1RWY A;  2D8N A;  2LLU A;  2Y1N A;  3D0Y A;  4I5N B;  1J7R A;  1IH0 A;  3RM1 A;  1UUS A;  4C0K A;  1CFP A;  3TDU A;  4GFT A;  2JU0 A;  3I5F B;  1CNP A;  1PAL A;  2CT9 A;  2WCE A;  1SL7 A;  3NSL A;  4AQI A;  1RK9 A;  3KHE A;  1OMD A;  1QX5 B;  1NYA A;  1V1F A;  1AJ4 A;  1IKU A;  3I5H C;  2LVJ A;  1KFU L;  1QV0 A;  1AP4 A;  3D10 A;  4CID A;  3O78 A;  3I5H B;  1KK7 Y;  2JT8 A;  2JOJ A;  2MLE C;  4WRI A;  2KBI A;  1F8H A;  2NCO A;  4I5J A;  2MRD A;  2I94 A;  3OP0 A;  2EC6 B;  2JRF A;  1Y1A A;  1L2O C;  2BKH B;  3O6B A;  1A4P A;  2KQ6 A;  3EVU A;  1DF0 A;  1JF0 A;  1L2O B;  2L50 A;  4PHK A;  3CR4 X;  1A29 A;  5D69 A;  1SCM B;  3SIB A;  3GK2 A;  1K8U A;  1FBV A;  2HQ8 A;  1KWO B;  4BY4 A;  4MRY A;  5HLO A;  1MXL C;  5CSJ A;  5AER A;  1SYM A;  4QJ3 B;  4JWQ A;  2OPO A;  2AAO A;  1JBA A;  2COL B;  1CDP A;  4MZJ A;  2F33 A;  3I5G C;  1DJX A;  1IRJ A;  2JZI A;  2BEC A;  1DGU A;  2BBN A;  2LUC A;  4GNK B;  1QLK A;  3I5G B;  1F4Q A;  2LVK A;  1KSM A;  2DOQ A;  1QAS A;  2LHI A;  3EK4 A;  4I5L B;  3SG4 A;  1BR1 B;  3F45 A;  4HRH A;  4GGN A;  1SR6 B;  1UHN A;  1J1D A;  5IBW A;  1J7P A;  1IG5 A;  4N1G A;  4P5O E;  3EK8 A;  3BOW A;  1QX2 A;  1C7W A;  3M0W A;  5AFP A;  1SCV A;  1LIN A;  1XO5 A;  1KQM B;  2HET A;  4F0Z B;  4PE0 A;  1SRA A;  5KSZ A;  1UHI A;  2MHH A;  2MJW B;  4N1F A;  2LCP A;  3HCM A;  3IF7 A;  3BUN B;  5AXI A;  1PSR A;  1SMG A;  1MF8 B;  1CDN A;  1M46 A;  4UPG A;  4OCI A;  3SJS A;  2JNF A;  1K9K A;  5DKQ A;  1PSB A;  1CFF A;  2R2I A;  1NX3 A;  2CBL A;  1GJY A;  4QJ4 B;  4ICB A;  1F55 A;  4PHJ A;  3DF0 B;  3WNX B;  1BT6 A;  2ZN8 A;  2F3Y A;  3SG3 A;  1SBJ A;  1JUO A;  4C0L A;  3RLZ A;  1S6I A;  4FTG A;  2AUC A;  1ZUZ A;  1J55 A;  1NIW A;  3AAJ A;  3PSR A;  2I2R E;  2KAX A;  5I2L A;  2A4J A;  2KI4 C;  4HRE E;  1OZS A;  2K2A A;  2LVI A;  4MBE A;  2LHL A;  1A75 A;  4MSP A;  4PHM A;  3NSK A;  2KI4 B;  1ALW A;  1TNQ A;  4MEW A;  1QVI Z;  1Q80 A;  2QAC A;  1XFW O;  2PRU A;  1YUS A;  5I2O A;  4MZK A;  3WHT B;  2M1K B;  3SG2 A;  2K2F A;  5CSF A;  1SK6 D;  3CWG A;  1B8R A;  2PMY A;  1K90 D;  2KAV A;  1C07 A;  3OB1 B;  1CLL A;  2JWW A;  1FI6 A;  4MN0 A;  4YBH B;  1B4C A;  1CFC A;  3LCP C;  1BOD A;  1EH2 A;  2LMU A;  4HSZ A;  1DGV A;  1CLM A;  1REC A;  1IGV A;  1TCO B;  2JNX A;  1RRO A;  3BUW B;  1IJ5 A;  2JTT A;  1DT7 B;  3QRX A;  2LAP A;  1LXF C;  4N5X A;  1NCZ A;  1G33 A;  1OMV A;  1KCY A;  2WOS A;  1AVS A;  1FI5 A;  1PK0 D;  2OTG C;  1S3P A;  3TDZ A;  3C1V A;  1SY9 A;  3VGO A;  3WXA A;  2OTG B;  2M9G A;  4M2Q A;  2L4I A;  3SG7 A;  1LVC D;  1WRL A;  3D0Y B;  4DRW A;  3OB2 B;  1QIV A;  1B7T Y;  2JC2 A;  1CM1 A;  3NSO A;  2CNP A;  5I2Q A;  2JXL A;  3JTD C;  1TN4 A;  2BL0 C;  2E30 A;  2KYF A;  2SCP A;  3FWC A;  2NCP A;  2MAZ A;  2K0J A;  3JTD B;  2JT3 A;  3CR5 X;  3FS7 A;  5PAL A;  2LV7 A;  4IL1 A;  1RJV A;  1YR5 A;  2BKI B;  4M2P A;  1JC2 A;  3AKB A;  4MRX A;  1Y6W A;  3PLF B;  2Q4U A;  3PFV A;  4NDB A;  1GQM A;  2HPS A;  1BG1 A;  1RTP 1;  2ZND A;  2AMI A;  2WCB A;  1WY9 A;  1MR8 A;  1EG4 A;  4CLN A;  1KK8 C;  3DD4 A;  3NSI A;  2K7D A;  1B1G A;  3LK0 A;  3AAK A;  3FIA A;  1F71 A;  1DJH A;  2Y5I A;  1SPY A;  2PAS A;  2NLN A;  3MSE B;  4WQ2 A;  2O5G A;  4ZCV A;  2GGZ A;  2PVB A;  1NWD A;  4BY5 A;  1QTX A;  5HKW A;  1YVH A;  1J1E A;  1S6C A;  1CFD A;  1QAT A;  3CS1 A;  3OX6 A;  5HKY A;  1YRT B;  2H2K A;  1OSA A;  1KK7 Z;  1ZOT B;  3CZT X;  4U8D A;  1H4B A;  1YUR A;  4I5K A;  2PAL A;  2BBM A;  3VRR A;  1R6P A;  1NSH A;  1F70 A;  4YGD B;  1PRW A;  1TNW A;  3SG5 A;  1VRK A;  5DKN A;  1IWQ A;  1S5G Y;  5FYX A;  3BUX B;  1TNP A;  3LLE A;  1JF2 A;  1LKJ A;  1QXP A;  3BYA A;  3O4Y A;  4TNC A;  1KSO A;  2IS9 A;  3AKA A;  1FPW A;  4JPZ B;  1S26 D;  1U5I A;  1XFU O;  3A4U B;  1JFJ A;  3OX5 A;  1AUI B;  1F54 A;  1N2D A;  3DVM A;  4OKH A;  1QS7 A;  3BOW B;  3BUO B;  2NXQ A;  1M63 B;  5B8I B;  4E68 A;  1PUL A;  3TS5 C;  1B8C A;  1YUT A;  1CMF A;  1DJZ A;  5F6T A;  2KDH A;  2V53 A;  1UP5 A;  5D7F A;  1X02 A;  1LA0 A;  3A8R A;  4MZL A;  1TTX A;  3TS5 B;  1EL4 A;  1S6J A;  4XYN A;  1NP8 A;  2LLT A;  4CFQ A;  2Y4Q A;  2F2O A;  4DS7 A;  1XYD A;  3NXA A;  1H8B A;  2ZKM X;  2M7N A;  2FJU B;  1Y1X A;  2GV5 A;  2KYC A;  1CMG A;  1B9A A;  4FQO A;  2F2P A;  4OVN F;  1K2H A;  2KGB C;  2L0P A;  5JJG A;  3BXK A;  2JQ6 A;  3EKH A;  4CPV A;  4DUQ A;  5BPJ A;  2KSP A;  2BCX A;  2ZN9 A;  4MLW A;  1WDC C;  1Y1U A;  2JT0 A;  3PN7 C;  4YGB B;  1TCF A;  4XJK A;  3WHU B;  1WDC B;  3BQ3 A;  4PDZ A;  2K7O A;  2M97 A;  3PN7 B;  4NDD A;  1NX1 A;  2O60 A;  1DJW A;  1YRU B;  2VRG A;  2Q91 A;  4GUK A;  4M2O A;  3TDI A;  1A75 B;  1M45 A;  2KOT A;  1BMO A;  2LUX A;  3O2P A;  1GGZ A;  4MVF A;  3KF9 A;  2H61 A;  1YTZ C;  3EK7 A;  3GK4 X;  5CSN A;  1OOJ A;  4OR9 B;  1FF1 A;  3DVJ A;  3BUM B;  3TUY C;  5DKR A;  1XFZ O;  4GBA A;  2SAS A;  3SIA A;  4L9M A;  1WRZ A;  5AAN A;  3VRO A;  2LP2 A;  2LP3 A;  4R1E A;  3TUY B;  1PVA A;  4GGF A;  1EJ3 A;  3LK1 A;  1IJ6 A;  1BJF A;  2KBM A;  2LNK A;  2BE4 A;  2KI6 C;  2CCM A;  2L5X B;  3DVK A;  4HRG A;  4YGA A;  1ALV A;  1NCX A;  1F4O A;  2GGM A;  1Y0V H;  2FOT A;  2G2B A;  1YUU A;  2WCF A;  4ORB B;  1XK4 A;  2WOR A;  4PCW A;  2ZRT A;  4PAL A;  1HQV A;  2KFG A;  1KQV A;  1AHR A;  1IQ5 A;  1FW4 A;  2K8M B;  5ER5 A;  1K93 D;  1G4Y R;  1BR4 B;  1G8I A;  2CXJ A;  2M49 B;  3GOF A;  3PAL A;  4ORC B;  1SNL A;  1UWO A;  4GPL B;  1SL8 A;  4ZCU A;  2I18 A;  4DCK A;  4OV2 A;  2ZRS A;  2LM5 A;  2BL0 B;  2JTZ A;  2WC8 A;  1MHO A;  4PHN A;  1E8A A;  3I5F C;  4AOM A;  4QJ5 B;  1TOP A;  2MA2 A;  3HX4 A;  1V1G A;  4CFR A;  1RFJ A;  2BE6 A;  2FCE A;  2L4H A;  3LL8 B;  4DIR A;  1BF5 A;  5GQQ C;  1KFX S;  3KPX A;  2ISD A;  1CKK A;  2LAN A;  3ICB A; 
#chains in the Genus database with same CATH topology
 2KI6 D;  1C7V A;  4YI8 A;  2B1U A;  2CTN A;  1NX0 A;  3L47 A;  2L5Y A;  2BCB A;  3NHT A;  1DEL A;  4PE1 A;  5KTY A;  1CB1 A;  1TNX A;  1KK8 B;  1TRF A;  5FI2 A;  5D3O A;  1XFV O;  1DF0 B;  1K9U A;  2EHB A;  1JSA A;  1ZAC A;  1QJT A;  2EC6 C;  2ZFD A;  4ORA B;  1M31 A;  3K21 A;  1S1E A;  3K1E A;  3V2L A;  5JOL A;  1L7Z A;  1B7T Z;  4A4B A;  4C0J A;  2LMT A;  1BU3 A;  3CGA A;  1SKT A;  1MUX A;  1EG3 A;  2JPO A;  2QPT A;  1ODB A;  4JQ0 D;  5HYD A;  5K89 A;  1CM4 A;  2G9B A;  1SCM C;  2WND A;  2JUL A;  2K7B A;  1K9P A;  2MLF C;  3B86 A;  1K94 A;  2LMV A;  3D76 A;  3FWB A;  3O4X A;  3IQO A;  1CDL A;  3R1V A;  2BCA A;  4YI9 A;  2LLS A;  1QV1 A;  1K96 A;  2LC5 A;  1KWO C;  2EGD A;  3CR2 A;  3PM8 A;  4YRU A;  1XA5 A;  1ZFS A;  2I7A A;  1JFK A;  3I5I C;  1P28 A;  1XVJ A;  4P2Y B;  2KAY A;  3VRN A;  3SG6 A;  3I5I B;  1XFY O;  2LE9 B;  2TN4 A;  2JPT A;  1DTL A;  3BFB A;  1NUB A;  1YX8 A;  1HT9 A;  2L98 A;  3R72 A;  1BOC A;  4GAO A;  3VRP A;  3KEV A;  3CTN A;  1QLS A;  4YGC B;  1OMR A;  3CLN A;  1BLQ A;  1AK8 A;  1YX7 A;  4NDC A;  3PAT A;  1SR6 C;  4IJ7 A;  5J3X A;  1UHK A;  3SS4 A;  1IQ3 A;  1NX2 A;  1GGW A;  2KNE A;  1U5I B;  1SL9 A;  1Z4H A;  2E6W A;  2Y1M A;  3CYZ A;  3DVE A;  1B47 A;  5KU1 A;  3E3R A;  2KLD A;  2HF5 A;  1KQM C;  1K95 A;  2M0R A;  1WRK A;  5ER4 X;  5EL2 A;  1DMO A;  2GTE A;  1WLM A;  1KFX L;  1MQ1 A;  2PSR A;  3DY9 A;  1S5G Z;  2LVV A;  4PE7 A;  2ZNE A;  1D1O A;  1J7Q A;  4USL A;  2KFF A;  3EKJ A;  2KHN A;  1YVL A;  1QVI Y;  1XFX O;  3ZNI A;  1DVI A;  3H4S E;  2PYQ A;  5HKZ A;  1W7I B;  3DF0 A;  1ZMZ A;  2F8P A;  3QME A;  3S0B A;  4PE4 A;  2L51 A;  3IQQ A;  4YGE B;  1KFU S;  1UHH A;  2M3W A;  3EVR A;  1CDM A;  2M29 A;  1A03 A;  1M39 A;  2MBX A;  1MWN A;  2KFH A;  2P70 A;  5AEQ A;  2M1U A;  2F3Z A;  3GK1 A;  2OS8 C;  1SW8 A;  1WLZ A;  1AJ5 A;  2OS8 B;  1CLB A;  1N0Y A;  4WQ3 A;  2KQY A;  4XJK B;  1OE9 B;  1PVB A;  2M7L A;  3VRQ A;  1CTR A;  2M8U A;  4Q04 A;  2P6B B;  4A4C A;  3S0F A;  4INW A;  1EXR A;  2P71 A;  1UHJ A;  5CPV A;  1DJG A;  3UO9 A;  3TZ1 A;  1OOG A;  1QIW A;  1OZO A;  2H61 C;  1TUJ A;  5CSI A;  3JVT C;  4ETO A;  4D1E A;  1JWD A;  2KGR A;  4AQJ A;  3PJI A;  4NQG A;  1W7J B;  1S36 A;  2L2E A;  3EVV A;  3JVT B;  5TNC A;  5I8N A;  1TIZ A;  3ZWH A;  2FCD A;  4GGF C;  1N65 A;  1A2X A;  2NZ0 A;  1DJI A;  1LA3 A;  1R2U A;  2K61 A;  1DJY A;  1OQP A;  1QX7 A;  1UUR A;  1B8L A;  1NCY A;  1NPQ A;  2HQW A;  3KO0 A;  2JXC A;  3OHM B;  1J7O A;  1MXE A;  5G08 A;  2RGI A;  2K7C A;  3D78 A;  1XK4 C;  1RWY A;  2D8N A;  2LLU A;  2Y1N A;  3D0Y A;  4I5N B;  5I94 A;  1J7R A;  1IH0 A;  3RM1 A;  1OW4 A;  1UUS A;  4C0K A;  1CFP A;  3TDU A;  1W9Z A;  4GFT A;  1IIO A;  2JU0 A;  3I5F B;  1CNP A;  1PAL A;  2CT9 A;  5DIC A;  2WCE A;  1SL7 A;  3NSL A;  2ERB A;  4AQI A;  2L2C A;  4INX A;  1RK9 A;  3KHE A;  1OMD A;  1QX5 B;  1NYA A;  1V1F A;  1AJ4 A;  1IKU A;  3I5H C;  2LVJ A;  1KFU L;  1QV0 A;  1AP4 A;  3D10 A;  4CID A;  3O78 A;  3I5H B;  3RZS A;  4FQT A;  1KK7 Y;  2JT8 A;  2JOJ A;  2MLE C;  4WRI A;  2KBI A;  1F8H A;  2NCO A;  4F7F A;  4I5J A;  2MRD A;  2I94 A;  3OP0 A;  2EC6 B;  2JRF A;  1Y1A A;  1L2O C;  2BKH B;  3O6B A;  1A4P A;  2KQ6 A;  3EVU A;  3VB1 A;  1DF0 A;  1JF0 A;  1L2O B;  2WCH A;  2L50 A;  4PHK A;  3CR4 X;  1A29 A;  5D69 A;  1SCM B;  3D75 A;  2QEB A;  3SIB A;  3SS3 A;  3GK2 A;  1K8U A;  1CKK A;  1FBV A;  2HQ8 A;  1KWO B;  1OOI X;  2PQL A;  3FE6 A;  4MRY A;  5HLO A;  4BY4 A;  1MXL C;  3Q8I A;  5CSJ A;  5AER A;  1SYM A;  3EG5 B;  4QJ3 B;  4JWQ A;  2OPO A;  2AAO A;  1JBA A;  2COL B;  1CDP A;  4MZJ A;  1C3Y A;  2F33 A;  3I5G C;  1DJX A;  1IRJ A;  2JZI A;  2BEC A;  1DGU A;  2BBN A;  2LUC A;  3BFH A;  3IVT A;  1QLK A;  4GNK B;  3I5G B;  1F4Q A;  3S0E A;  3UNW A;  2LVK A;  2QEH A;  1KSM A;  2DOQ A;  1QAS A;  3B6X A;  2LHI A;  3EK4 A;  4I5L B;  3SG4 A;  1BR1 B;  3F45 A;  4HRH A;  4GGN A;  1SR6 B;  1UHN A;  1J1D A;  5IBW A;  1J7P A;  1IG5 A;  4N1G A;  4P5O E;  1OOH A;  3EK8 A;  3BOW A;  1QX2 A;  1C7W A;  3M0W A;  5AFP A;  1SCV A;  1LIN A;  1XO5 A;  1KQM B;  2HET A;  4F0Z B;  4PE0 A;  1SRA A;  5KSZ A;  1UHI A;  2MHH A;  2MJW B;  4N1F A;  2LCP A;  3HCM A;  3IF7 A;  3BUN B;  5AXI A;  1XFR A;  1GM0 A;  1PSR A;  1SMG A;  1MF8 B;  4KYN A;  1CDN A;  1M46 A;  4UPG A;  4OCI A;  3SJS A;  2JNF A;  2KLE A;  1K9K A;  3R1O A;  5DKQ A;  1PSB A;  3R1P A;  1CFF A;  5HLV A;  2R2I A;  1NX3 A;  2CBL A;  1GJY A;  4QJ4 B;  4ICB A;  1F55 A;  2WCJ A;  4PHJ A;  3DF0 B;  3WNX B;  2QEO A;  1BT6 A;  2FJY A;  2ZN8 A;  2F3Y A;  3SG3 A;  1SBJ A;  2K60 A;  1JUO A;  4C0L A;  3RLZ A;  1S6I A;  4FTG A;  2AUC A;  1ZUZ A;  1J55 A;  1NIW A;  3AAJ A;  3PSR A;  2I2R E;  2KAX A;  5I2L A;  2A4J A;  3FE8 A;  2KI4 C;  4HRE E;  1OZS A;  2K2A A;  2LVI A;  4MBE A;  2LHL A;  1A75 A;  4MSP A;  4PHM A;  1Z2C B;  3NSK A;  2KI4 B;  5HL1 A;  1ALW A;  1TNQ A;  4MEW A;  1QVI Z;  1Q80 A;  2QAC A;  1XFW O;  5FI6 A;  2PRU A;  1YUS A;  5I2O A;  4MZK A;  4PT1 A;  3DXL A;  3WHT B;  2BAP A;  2M1K B;  3SG2 A;  2K2F A;  5CSF A;  1SK6 D;  3CWG A;  1B8R A;  2PMY A;  1K90 D;  2KAV A;  1C07 A;  3OB1 B;  1CLL A;  2JWW A;  1FI6 A;  4MN0 A;  4YBH B;  1B4C A;  3OGN A;  1CFC A;  3LCP C;  1BOD A;  1EH2 A;  2LMU A;  4HSZ A;  1DGV A;  1CLM A;  1REC A;  3CZ0 A;  1IGV A;  1TCO B;  2JNX A;  1RRO A;  3BUW B;  1IJ5 A;  2JTT A;  1DT7 B;  3QRX A;  2LAP A;  1LXF C;  4N5X A;  1NCZ A;  1G33 A;  1OMV A;  1KCY A;  2WOS A;  1AVS A;  1FI5 A;  1PK0 D;  2OTG C;  1S3P A;  3TDZ A;  3C1V A;  1SY9 A;  3VGO A;  3WXA A;  3BJH A;  2OTG B;  3CZ2 A;  2M9G A;  4M2Q A;  2L4I A;  3SG7 A;  1LVC D;  1WRL A;  3D0Y B;  4DRW A;  3OB2 B;  1QIV A;  1DC1 A;  1B7T Y;  2JC2 A;  1CM1 A;  3NSO A;  2CNP A;  5I2Q A;  2JXL A;  1C3Z A;  3JTD C;  1TN4 A;  2BL0 C;  2E30 A;  2KYF A;  2SCP A;  3FWC A;  2NCP A;  2MAZ A;  2K0J A;  3N7H A;  3JTD B;  1DQE A;  2JT3 A;  3CR5 X;  3BFA A;  3FS7 A;  5PAL A;  2KPH A;  2LV7 A;  4IL1 A;  1RJV A;  1YR5 A;  2BKI B;  4M2P A;  4PCW A;  1JC2 A;  3AKB A;  4MRX A;  1Y6W A;  3PLF B;  2Q4U A;  3PFV A;  4NDB A;  1GQM A;  2HPS A;  1BG1 A;  2QEV A;  1ORG A;  1RTP 1;  2ZND A;  2AMI A;  2WCB A;  1WY9 A;  3D73 A;  3SS5 A;  1MR8 A;  1EG4 A;  2QDI A;  1KK8 C;  4CLN A;  3DD4 A;  3S0A A;  3NSI A;  2K7D A;  1B1G A;  3LK0 A;  3AAK A;  3FIA A;  3L4L A;  3B87 A;  1F71 A;  1DJH A;  1QWV A;  1SPY A;  2PAS A;  2Y5I A;  2NLN A;  3MSE B;  4WQ2 A;  2O5G A;  4ZCV A;  1LS8 A;  2GGZ A;  2PVB A;  1NWD A;  4BY5 A;  1QTX A;  5HKW A;  3DZT A;  1YVH A;  1J1E A;  1S6C A;  1CFD A;  1QAT A;  3CS1 A;  3OX6 A;  5HKY A;  1YRT B;  2H2K A;  1OSA A;  1KK7 Z;  1ZOT B;  3CZT X;  4U8D A;  1H4B A;  1YUR A;  4I5K A;  1OOF A;  2WC5 A;  2PAL A;  2BBM A;  3VRR A;  1R6P A;  1NSH A;  1F70 A;  4YGD B;  1PRW A;  1TNW A;  3SG5 A;  1VRK A;  5DKN A;  1IWQ A;  1S5G Y;  5FYX A;  3BUX B;  1TNP A;  3LLE A;  1JF2 A;  1LKJ A;  1QXP A;  3BYA A;  3O4Y A;  3B7A A;  1SSE B;  4TNC A;  1KSO A;  2IS9 A;  3AKA A;  4OZD A;  1FPW A;  3D74 A;  4JPZ B;  1S26 D;  1U5I A;  1XFU O;  3A4U B;  2WC6 A;  1TUZ A;  1JFJ A;  3OX5 A;  1AUI B;  1F54 A;  1N2D A;  3DVM A;  4OKH A;  1QS7 A;  3BOW B;  3BUO B;  2NXQ A;  1M63 B;  5B8I B;  4E68 A;  1PUL A;  3TS5 C;  1B8C A;  1YUT A;  1CMF A;  1DJZ A;  5F6T A;  2KDH A;  2V53 A;  1UP5 A;  3CZ1 A;  1X02 A;  1LA0 A;  3A8R A;  4JD9 A;  1TTX A;  4MZL A;  1EL4 A;  5D7F A;  1S6J A;  3TS5 B;  4XYN A;  1NP8 A;  3S0D A;  2LLT A;  3NGV A;  4CFQ A;  2Y4Q A;  3L4A A;  2F2O A;  4DS7 A;  1XYD A;  3NXA A;  1DEK A;  1H8B A;  2ZKM X;  3DYE A;  2M7N A;  2FJU B;  1Y1X A;  1TWO A;  2GV5 A;  2KYC A;  1CMG A;  1B9A A;  4FQO A;  2F2P A;  4OVN F;  1K2H A;  2KGB C;  2L0P A;  5JJG A;  3BXK A;  2JQ6 A;  3EKH A;  4CPV A;  4DUQ A;  5BPJ A;  2H8V A;  2KSP A;  2BCX A;  2ZN9 A;  4MLW A;  1WDC C;  1Y1U A;  2JT0 A;  3PN7 C;  4YGB B;  1TCF A;  4XJK A;  3WHU B;  1WDC B;  3BQ3 A;  4PDZ A;  2K7O A;  2M97 A;  3PN7 B;  4NDD A;  3CDN A;  1NX1 A;  2O60 A;  1DJW A;  1YRU B;  2VRG A;  2Q91 A;  4GUK A;  4M2O A;  3TDI A;  1A75 B;  1M45 A;  2KOT A;  1BMO A;  2LUX A;  3O2P A;  1GGZ A;  4MVF A;  3KF9 A;  2H61 A;  1YTZ C;  3EK7 A;  3GK4 X;  5CSN A;  1OOJ A;  4OR9 B;  1FF1 A;  2WCM A;  3DVJ A;  3BUM B;  3TUY C;  5DKR A;  1XFZ O;  4GBA A;  2SAS A;  3SIA A;  4L9M A;  1WRZ A;  5AAN A;  3VRO A;  2LP2 A;  2LP3 A;  2WCK A;  4R1E A;  3TUY B;  1PVA A;  3D77 A;  4GGF A;  1EJ3 A;  3LK1 A;  1IJ6 A;  3CAB A;  1BJF A;  2KBM A;  2LNK A;  2BE4 A;  2KI6 C;  2CCM A;  1T14 A;  2L5X B;  3DVK A;  4HRG A;  4YGA A;  1ALV A;  4JKT A;  1NCX A;  1F4O A;  2BNX A;  1Y0V H;  2FOT A;  2G2B A;  1YUU A;  2GGM A;  2WCF A;  1XK4 A;  2WOR A;  4ORB B;  2ZRT A;  3B88 A;  3FE9 A;  4PAL A;  3OBV A;  1HQV A;  2KFG A;  1KQV A;  1AHR A;  1IQ5 A;  1FW4 A;  2K8M B;  5ER5 A;  1K93 D;  1G4Y R;  1BR4 B;  1G8I A;  2CXJ A;  2M49 B;  2WCL A;  3GOF A;  3PAL A;  1SNL A;  1UWO A;  4GPL B;  1SL8 A;  4ORC B;  2I18 A;  5FI7 A;  4ZCU A;  4OV2 A;  4DCK A;  2ZRS A;  2LM5 A;  2BL0 B;  2YGU A;  3S0G A;  2JTZ A;  2WC8 A;  1MHO A;  4PHN A;  1E8A A;  3I5F C;  4AOM A;  4QJ5 B;  1TOP A;  2MA2 A;  3HX4 A;  1V1G A;  4CFR A;  1RFJ A;  2BE6 A;  2FCE A;  2L4H A;  3LL8 B;  3NHI A;  3PM2 A;  5GQQ C;  1KFX S;  3KPX A;  2ISD A;  4DIR A;  1BF5 A;  2LAN A;  3ICB A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  1C7V A;  4YI8 A;  2B1U A;  2CTN A;  1NX0 A;  2BCB A;  4PE1 A;  5KTY A;  1CB1 A;  1TNX A;  1KK8 B;  1TRF A;  1XFV O;  1DF0 B;  1K9U A;  2EHB A;  1JSA A;  1ZAC A;  1QJT A;  2EC6 C;  2ZFD A;  4ORA B;  1M31 A;  3K21 A;  1S1E A;  4C0J A;  5JOL A;  1L7Z A;  1B7T Z;  4A4B A;  2LMT A;  1BU3 A;  3CGA A;  1SKT A;  1MUX A;  1EG3 A;  2QPT A;  1ODB A;  4JQ0 D;  5HYD A;  5K89 A;  1CM4 A;  2G9B A;  1SCM C;  2WND A;  2JUL A;  2K7B A;  1K9P A;  2MLF C;  3FWB A;  1K94 A;  2LMV A;  5HLV A;  3IQO A;  1CDL A;  2BCA A;  4YI9 A;  2LLS A;  1QV1 A;  1K96 A;  2LC5 A;  1KWO C;  2EGD A;  3CR2 A;  3PM8 A;  4YRU A;  1XA5 A;  1ZFS A;  2I7A A;  1JFK A;  3I5I C;  1XVJ A;  4P2Y B;  2KAY A;  3VRN A;  3SG6 A;  3I5I B;  1XFY O;  2LE9 B;  2TN4 A;  2JPT A;  1DTL A;  1NUB A;  1YX8 A;  1HT9 A;  2L98 A;  1BOC A;  4GAO A;  3VRP A;  3KEV A;  3CTN A;  1QLS A;  4YGC B;  1OMR A;  3CLN A;  1BLQ A;  1AK8 A;  1YX7 A;  4NDC A;  3PAT A;  1SR6 C;  5J3X A;  1UHK A;  1IQ3 A;  1NX2 A;  1GGW A;  2KNE A;  1U5I B;  1SL9 A;  2Y1M A;  2E6W A;  3DVE A;  1B47 A;  5KU1 A;  3E3R A;  2HF5 A;  1KQM C;  1K95 A;  2M0R A;  1WRK A;  5ER4 X;  1DMO A;  1WLM A;  1KFX L;  1MQ1 A;  2PSR A;  1S5G Z;  2LVV A;  4PE7 A;  2ZNE A;  1D1O A;  1J7Q A;  4USL A;  2KFF A;  3EKJ A;  2KHN A;  1YVL A;  1QVI Y;  1XFX O;  3ZNI A;  1DVI A;  3H4S E;  5HKZ A;  1W7I B;  3DF0 A;  1ZMZ A;  2F8P A;  4PE4 A;  2L51 A;  3IQQ A;  4YGE B;  1KFU S;  1UHH A;  2M3W A;  3EVR A;  1CDM A;  2M29 A;  1A03 A;  1M39 A;  2MBX A;  1MWN A;  2KFH A;  5AEQ A;  2M1U A;  2F3Z A;  3GK1 A;  2OS8 C;  1SW8 A;  1WLZ A;  1AJ5 A;  2OS8 B;  1CLB A;  1N0Y A;  4WQ3 A;  2KQY A;  4XJK B;  1OE9 B;  1PVB A;  2M7L A;  3VRQ A;  1CTR A;  2M8U A;  4Q04 A;  2P6B B;  4A4C A;  1EXR A;  1UHJ A;  5CPV A;  1DJG A;  3TZ1 A;  1QIW A;  1OZO A;  2H61 C;  5CSI A;  3JVT C;  4ETO A;  4D1E A;  1JWD A;  2KGR A;  4AQJ A;  4NQG A;  1W7J B;  1S36 A;  2L2E A;  3EVV A;  3JVT B;  5TNC A;  5I8N A;  1TIZ A;  3ZWH A;  2FCD A;  4GGF C;  1N65 A;  1A2X A;  2NZ0 A;  1DJI A;  1LA3 A;  1R2U A;  2K61 A;  1DJY A;  1OQP A;  1QX7 A;  1UUR A;  1B8L A;  1NCY A;  1NPQ A;  2HQW A;  3KO0 A;  2JXC A;  3OHM B;  1J7O A;  1MXE A;  5G08 A;  2RGI A;  2K7C A;  1XK4 C;  1RWY A;  2D8N A;  2LLU A;  2Y1N A;  3D0Y A;  4I5N B;  1J7R A;  1IH0 A;  3RM1 A;  1UUS A;  4C0K A;  1CFP A;  3TDU A;  4GFT A;  2JU0 A;  3I5F B;  1CNP A;  1PAL A;  2CT9 A;  2WCE A;  1SL7 A;  3NSL A;  4AQI A;  1RK9 A;  3KHE A;  1OMD A;  1QX5 B;  1NYA A;  1V1F A;  1AJ4 A;  1IKU A;  3I5H C;  2LVJ A;  1KFU L;  1QV0 A;  1AP4 A;  3D10 A;  4CID A;  3O78 A;  3I5H B;  1KK7 Y;  2JT8 A;  2JOJ A;  2MLE C;  4WRI A;  2KBI A;  1F8H A;  2NCO A;  4I5J A;  2MRD A;  2I94 A;  3OP0 A;  2EC6 B;  2JRF A;  1Y1A A;  1L2O C;  2BKH B;  3O6B A;  1A4P A;  2KQ6 A;  3EVU A;  1DF0 A;  1JF0 A;  1L2O B;  2L50 A;  4PHK A;  3CR4 X;  1A29 A;  5D69 A;  1SCM B;  3SIB A;  3GK2 A;  1K8U A;  1FBV A;  2HQ8 A;  1KWO B;  4BY4 A;  4MRY A;  5HLO A;  1MXL C;  5CSJ A;  5AER A;  1SYM A;  4QJ3 B;  4JWQ A;  2OPO A;  2AAO A;  1JBA A;  2COL B;  1CDP A;  4MZJ A;  2F33 A;  3I5G C;  1DJX A;  1IRJ A;  2JZI A;  2BEC A;  1DGU A;  2BBN A;  2LUC A;  4GNK B;  1QLK A;  3I5G B;  1F4Q A;  2LVK A;  1KSM A;  2DOQ A;  1QAS A;  2LHI A;  3EK4 A;  4I5L B;  3SG4 A;  1BR1 B;  3F45 A;  4HRH A;  4GGN A;  1SR6 B;  1UHN A;  1J1D A;  5IBW A;  1J7P A;  1IG5 A;  4N1G A;  4P5O E;  3EK8 A;  3BOW A;  1QX2 A;  1C7W A;  3M0W A;  5AFP A;  1SCV A;  1LIN A;  1XO5 A;  1KQM B;  2HET A;  4F0Z B;  4PE0 A;  1SRA A;  5KSZ A;  1UHI A;  2MHH A;  2MJW B;  4N1F A;  2LCP A;  3HCM A;  3IF7 A;  3BUN B;  5AXI A;  1PSR A;  1SMG A;  1MF8 B;  1CDN A;  1M46 A;  4UPG A;  4OCI A;  3SJS A;  2JNF A;  1K9K A;  5DKQ A;  1PSB A;  1CFF A;  2R2I A;  1NX3 A;  2CBL A;  1GJY A;  4QJ4 B;  4ICB A;  1F55 A;  4PHJ A;  3DF0 B;  3WNX B;  1BT6 A;  2ZN8 A;  2F3Y A;  3SG3 A;  1SBJ A;  1JUO A;  4C0L A;  3RLZ A;  1S6I A;  4FTG A;  2AUC A;  1ZUZ A;  1J55 A;  1NIW A;  3AAJ A;  3PSR A;  2I2R E;  2KAX A;  5I2L A;  2A4J A;  2KI4 C;  4HRE E;  1OZS A;  2K2A A;  2LVI A;  4MBE A;  2LHL A;  1A75 A;  4MSP A;  4PHM A;  3NSK A;  2KI4 B;  1ALW A;  1TNQ A;  4MEW A;  1QVI Z;  1Q80 A;  2QAC A;  1XFW O;  2PRU A;  1YUS A;  5I2O A;  4MZK A;  3WHT B;  2M1K B;  3SG2 A;  2K2F A;  5CSF A;  1SK6 D;  3CWG A;  1B8R A;  2PMY A;  1K90 D;  2KAV A;  1C07 A;  3OB1 B;  1CLL A;  2JWW A;  1FI6 A;  4MN0 A;  4YBH B;  1B4C A;  1CFC A;  3LCP C;  1BOD A;  1EH2 A;  2LMU A;  4HSZ A;  1DGV A;  1CLM A;  1REC A;  1IGV A;  1TCO B;  2JNX A;  1RRO A;  3BUW B;  1IJ5 A;  2JTT A;  1DT7 B;  3QRX A;  2LAP A;  1LXF C;  4N5X A;  1NCZ A;  1G33 A;  1OMV A;  1KCY A;  2WOS A;  1AVS A;  1FI5 A;  1PK0 D;  2OTG C;  1S3P A;  3TDZ A;  3C1V A;  1SY9 A;  3VGO A;  3WXA A;  2OTG B;  2M9G A;  4M2Q A;  2L4I A;  3SG7 A;  1LVC D;  1WRL A;  3D0Y B;  4DRW A;  3OB2 B;  1QIV A;  1B7T Y;  2JC2 A;  1CM1 A;  3NSO A;  2CNP A;  5I2Q A;  2JXL A;  3JTD C;  1TN4 A;  2BL0 C;  2E30 A;  2KYF A;  2SCP A;  3FWC A;  2NCP A;  2MAZ A;  2K0J A;  3JTD B;  2JT3 A;  3CR5 X;  3FS7 A;  5PAL A;  2LV7 A;  4IL1 A;  1RJV A;  1YR5 A;  2BKI B;  4M2P A;  1JC2 A;  3AKB A;  4MRX A;  1Y6W A;  3PLF B;  2Q4U A;  3PFV A;  4NDB A;  1GQM A;  2HPS A;  1BG1 A;  1RTP 1;  2ZND A;  2AMI A;  2WCB A;  1WY9 A;  1MR8 A;  1EG4 A;  4CLN A;  1KK8 C;  3DD4 A;  3NSI A;  2K7D A;  1B1G A;  3LK0 A;  3AAK A;  3FIA A;  1F71 A;  1DJH A;  2Y5I A;  1SPY A;  2PAS A;  2NLN A;  3MSE B;  4WQ2 A;  2O5G A;  4ZCV A;  2GGZ A;  2PVB A;  1NWD A;  4BY5 A;  1QTX A;  5HKW A;  1YVH A;  1J1E A;  1S6C A;  1CFD A;  1QAT A;  3CS1 A;  3OX6 A;  5HKY A;  1YRT B;  2H2K A;  1OSA A;  1KK7 Z;  1ZOT B;  3CZT X;  4U8D A;  1H4B A;  1YUR A;  4I5K A;  2PAL A;  2BBM A;  3VRR A;  1R6P A;  1NSH A;  1F70 A;  4YGD B;  1PRW A;  1TNW A;  3SG5 A;  1VRK A;  5DKN A;  1IWQ A;  1S5G Y;  5FYX A;  3BUX B;  1TNP A;  3LLE A;  1JF2 A;  1LKJ A;  1QXP A;  3BYA A;  3O4Y A;  4TNC A;  1KSO A;  2IS9 A;  3AKA A;  1FPW A;  4JPZ B;  1S26 D;  1U5I A;  1XFU O;  3A4U B;  1JFJ A;  3OX5 A;  1AUI B;  1F54 A;  1N2D A;  3DVM A;  4OKH A;  1QS7 A;  3BOW B;  3BUO B;  2NXQ A;  1M63 B;  5B8I B;  4E68 A;  1PUL A;  3TS5 C;  1B8C A;  1YUT A;  1CMF A;  1DJZ A;  5F6T A;  2KDH A;  2V53 A;  1UP5 A;  5D7F A;  1X02 A;  1LA0 A;  3A8R A;  4MZL A;  1TTX A;  3TS5 B;  1EL4 A;  1S6J A;  4XYN A;  1NP8 A;  2LLT A;  4CFQ A;  2Y4Q A;  2F2O A;  4DS7 A;  1XYD A;  3NXA A;  1H8B A;  2ZKM X;  2M7N A;  2FJU B;  1Y1X A;  2GV5 A;  2KYC A;  1CMG A;  1B9A A;  4FQO A;  2F2P A;  4OVN F;  1K2H A;  2KGB C;  2L0P A;  5JJG A;  3BXK A;  2JQ6 A;  3EKH A;  4CPV A;  4DUQ A;  5BPJ A;  2KSP A;  2BCX A;  2ZN9 A;  4MLW A;  1WDC C;  1Y1U A;  2JT0 A;  3PN7 C;  4YGB B;  1TCF A;  4XJK A;  3WHU B;  1WDC B;  3BQ3 A;  4PDZ A;  2K7O A;  2M97 A;  3PN7 B;  4NDD A;  1NX1 A;  2O60 A;  1DJW A;  1YRU B;  2VRG A;  2Q91 A;  4GUK A;  4M2O A;  3TDI A;  1A75 B;  1M45 A;  2KOT A;  1BMO A;  2LUX A;  3O2P A;  1GGZ A;  4MVF A;  3KF9 A;  2H61 A;  1YTZ C;  3EK7 A;  3GK4 X;  5CSN A;  1OOJ A;  4OR9 B;  1FF1 A;  3DVJ A;  3BUM B;  3TUY C;  5DKR A;  1XFZ O;  4GBA A;  2SAS A;  3SIA A;  4L9M A;  1WRZ A;  5AAN A;  3VRO A;  2LP2 A;  2LP3 A;  4R1E A;  3TUY B;  1PVA A;  4GGF A;  1EJ3 A;  3LK1 A;  1IJ6 A;  1BJF A;  2KBM A;  2LNK A;  2BE4 A;  2KI6 C;  2CCM A;  2L5X B;  3DVK A;  4HRG A;  4YGA A;  1ALV A;  1NCX A;  1F4O A;  2GGM A;  1Y0V H;  2FOT A;  2G2B A;  1YUU A;  2WCF A;  4ORB B;  1XK4 A;  2WOR A;  4PCW A;  2ZRT A;  4PAL A;  1HQV A;  2KFG A;  1KQV A;  1AHR A;  1IQ5 A;  1FW4 A;  2K8M B;  5ER5 A;  1K93 D;  1G4Y R;  1BR4 B;  1G8I A;  2CXJ A;  2M49 B;  3GOF A;  3PAL A;  4ORC B;  1SNL A;  1UWO A;  4GPL B;  1SL8 A;  4ZCU A;  2I18 A;  4DCK A;  4OV2 A;  2ZRS A;  2LM5 A;  2BL0 B;  2JTZ A;  2WC8 A;  1MHO A;  4PHN A;  1E8A A;  3I5F C;  4AOM A;  4QJ5 B;  1TOP A;  2MA2 A;  3HX4 A;  1V1G A;  4CFR A;  1RFJ A;  2BE6 A;  2FCE A;  2L4H A;  3LL8 B;  4DIR A;  1BF5 A;  5GQQ C;  1KFX S;  3KPX A;  2ISD A;  1CKK A;  2LAN A;  3ICB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...