4M2QA

Crystal structure of non-myristoylated recoverin with cysteine-39 oxidized to sulfenic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
188
structure length
187
Chain Sequence
b'GALSKEILEELQLNTKFTEEELSSWYQSFLKEPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 187
sequence length 188
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA01
4NDCA 1NSHA 1WLZA 2CTNA 1QVIZ 2M7NA 3AKAA 4IL1A 5I2LA 1CFDA 1ZOTB 4OV2A 2LM5A 4PALA 1AHRA 3A4UB 2HQ8A 2JT8A 2M97A 1F70A 4XJKA 4OKHA 1QVIY 3PN7C 3VROA 1B47A 4MLWA 2K0JA 1SL9A 3BUXB 4ZCUA 1BR1B 1G4YR 2MBXA 1AJ4A 2JU0A 2MLEC 4DUQA 2M8UA 4CLNA 3HX4A 1CB1A 4PE4A 2R2IA 1AJ5A 3GOFA 2K2FA 1FF1A 4MN0A 1YUSA 3OP0A 3JTDB 1KWOB 4L9MA 4HSZA 2JT3A 5F6TA 1IGVA 2JPTA 4PHMA 2LVJA 3PSRA 4Q04A 1EH2A 1XFZO 5HKZA 5IBWA 5CSNA 1QX5B 2OS8C 2BL0B 1CDNA 1AVSA 4GUKA 1NIWA 2PALA 1AUIB 4HREE 1M63B 2H61C 1WRLA 2EC6B 2KI4C 3PLFB 3EK8A 3KPXA 2KFFA 2L5XB 3BUNB 2JXLA 5KTYA 1XFYO 2HQWA 1BODA 2BKHB 2JRFA 2K7BA 3C1VA 1SPYA 3PFVA 3CS1A 2F8PA 3LL8B 2M1UA 5HLOA 3I5FC 1EG3A 3VRPA 3FWCA 4MEWA 1J7OA 2L51A 3K21A 5DKQA 1SBJA 4FQOA 1DJIA 1GGZA 3SIAA 2JOJA 2NCOA 2CNPA 1KQMB 3OB2B 5DKRA 1SY9A 1NCZA 1OOJA 4MZLA 2JULA 1YVLA 1ZMZA 1K2HA 2HETA 1KFXL 1YUTA 2KAXA 1YURA 1IWQA 2L50A 1MR8A 4CPVA 3AKBA 2M1KB 3I5GC 1J55A 2M0RA 1B1GA 2BBNA 4PE0A 3CR4X 3I5IC 4QJ3B 1F55A 1UURA 1E8AA 1DJYA 2F3YA 3BUWB 3NSOA 1LKJA 1KSMA 2L4HA 1SCVA 3DVJA 1XVJA 1A75B 2K7CA 3D10A 4MSPA 4C0LA 1CTRA 3HCMA 4PCWA 1BLQA 2AMIA 2P6BB 2MAZA 1A03A 3BQ3A 3DVMA 2Y4QA 1W7IB 2F2OA 4YI8A 4YGBB 4USLA 3OX5A 4CFRA 5CSJA 5I2QA 1Y1UA 1UHIA 1GJYA 2KBMA 1PRWA 1CLLA 2QPTA 3CZTX 2WCEA 1Q80A 1QIWA 3IQOA 1XYDA 1A75A 1CFFA 3I5HB 1JFKA 4I5LB 4ORBB 3TUYC 4ORCB 1XK4A 5I8NA 1CDPA 3BUMB 3FWBA 1UHHA 1QLSA 1XFWO 5AERA 5CSFA 3TS5C 1N2DA 1OZOA 1SCMB 1GGWA 1F8HA 4PE7A 1KK8B 2CBLA 2NXQA 1M39A 3NXAA 4GGFA 1ALVA 1R6PA 1BG1A 5D7FA 4NDDA 4QJ5B 1L7ZA 4JWQA 1DJXA 1LA3A 5GQQC 3EK4A 1V1GA 2FJUB 2JQ6A 1DJGA 1IG5A 2KSPA 3O6BA 4CFQA 2G2BA 2LVKA 1DGUA 1DVIA 2LHIA 1SMGA 1K94A 1MUXA 1TIZA 1MHOA 2DOQA 2F2PA 3BYAA 3CTNA 3DVEA 1EXRA 3E3RA 5K89A 2PMYA 2M9GA 5KU1A 2KBIA 4JPZB 3PN7B 4AQJA 2ZFDA 5CSIA 1BU3A 1SL7A 4OR9B 4MRYA 1OZSA 3CWGA 1WLMA 4E68A 1OMVA 2WOSA 4ORAB 1B4CA 2LHLA 1PK0D 1SR6C 1NYAA 1RROA 3TDIA 3DVKA 1SK6D 5JJGA 5HKWA 4M2QA 2KGBC 4OVNF 4N5XA 3SIBA 1WDCC 1CM1A 2LLTA 2ZNDA 4DCKA 2MHHA 3FS7A 1OMRA 4YRUA 1CFPA 2SCPA 4BY5A 4BY4A 3NSIA 1LVCD 5HLVA 1J7RA 2G9BA 1KK7Z 3GK2A 5HKYA 1CMFA 2KYCA 1RJVA 1J1DA 3VRNA 1DMOA 1CFCA 2M49B 2D8NA 3OHMB 2KI4B 2ZKMX 4M2OA 4TNCA 4C0JA 1KK7Y 3KEVA 4UPGA 4YGDB 2KQ6A 1XFUO 2NLNA 1F71A 3EVRA 1J7PA 1JUOA 3IF7A 5TNCA 2BCBA 2LMUA 2M7LA 2MRDA 1J7QA 2A4JA 1RTP1 2O5GA 3I5FB 3EK7A 3KHEA 3WHTB 1UHNA 2EHBA 3CR5X 3JTDC 1DJZA 1CKKA 4M2PA 1Y6WA 1EL4A 4ZCVA 1QXPA 2H61A 4PDZA 3LCPC 5AEQA 1YVHA 1RWYA 1CLBA 1JBAA 3IQQA 4OCIA 3CR2A 1IQ5A 1QJTA 3OB1B 1ALWA 4GAOA 3QRXA 4AQIA 3EVUA 4A4CA 1PULA 3ZWHA 3CGAA 1ZACA 2LLSA 3DD4A 2F3ZA 2KHNA 4HRGA 2Y1MA 2Y1NA 3A8RA 1ZUZA 2K61A 4YBHB 2LCPA 2PRUA 4YGAA 1HT9A 1HQVA 2Q4UA 3I5GB 5JOLA 3AAJA 3SG2A 1BJFA 3TDZA 1TCOB 1N0YA 1H8BA 2ZNEA 1JWDA 2QACA 4PE1A 2Y5IA 2KAYA 1YRTB 5DKNA 1KQMC 1QTXA 1R2UA 2KFHA 2KI6C 4PHNA 2BCAA 2I18A 2IS9A 2BCXA 1BT6A 2VRGA 2LANA 4R1EA 1EG4A 4DIRA 2LC5A 1L2OB 2KFGA 1OE9B 1TRFA 2SASA 4F0ZB 3SG4A 2FCDA 1M46A 2PSRA 1IQ3A 1YR5A 1ODBA 1YX8A 3TZ1A 4D1EA 1WRZA 2LV7A 5AANA 1DGVA 2JXCA 2V53A 2O60A 4N1GA 3TUYB 1D1OA 2BKIB 1NCXA 1YX7A 1K8UA 4DS7A 1A2XA 3TS5B 3WHUB 3JVTB 5HYDA 4XYNA 1FW4A 1ZFSA 2RGIA 3SG3A 1JFJA 2MA2A 1KFUL 1PSRA 4ETOA 1S1EA 1F4OA 1X02A 4GNKB 1IJ5A 1K95A 5CPVA 4CIDA 4AOMA 3NSLA 1C7VA 3ZNIA 2BE4A 5KSZA 1IH0A 1NX2A 5D69A 3H4SE 1NWDA 3OX6A 3BUOB 2LP3A 3EKJA 3FIAA 1BF5A 1IKUA 2JZIA 1DTLA 1Y1AA 1Y1XA 2WORA 3DF0A 4I5KA 4P5OE 4P2YB 1Y0VH 2LNKA 1F4QA 1J1EA 5ER5A 2EGDA 2FCEA 4NQGA 1QX2A 4DRWA 2ZRSA 1QX7A 1MXEA 2LVIA 2AAOA 4FTGA 2K2AA 1K9UA 1SCMC 1IRJA 3LLEA 3PATA 1SR6B 1SYMA 1QIVA 1NX3A 4MVFA 4PHKA 1TNQA 1CNPA 1LXFC 2OPOA 1S5GZ 2FOTA 2BE6A 1G8IA 3RM1A 4HRHA 1N65A 2JNXA 1KCYA 3VRQA 4YI9A 1JSAA 1DJWA 3F45A 2WC8A 2KAVA 2JC2A 2NCPA 1S5GY 1G33A 1OSAA 3NSKA 5FYXA 2TN4A 1TNWA 1XA5A 2JWWA 5AFPA 2JTZA 2KDHA 1S6CA 1SRAA 2K8MB 1TN4A 2OTGC 4JQ0D 1PALA 4GFTA 1JC2A 2OS8B 2LVVA 2NZ0A 1MXLC 3M0WA 1UP5A 2H2KA 1TOPA 1S6JA 1B8CA 2LUXA 1UWOA 1KSOA 1NPQA 2ZN8A 1K9KA 2KNEA 2PASA 1FBVA 1TNPA 1NX0A 1TTXA 3SG6A 3WXAA 3BOWB 1XFXO 1UUSA 2I2RE 2WCFA 3TDUA 3O4YA 1NCYA 4QJ4B 1KWOC 1M31A 1RECA 1U5IB 2JT0A 1A4PA 1LA0A 1BR4B 4A4BA 2L2EA 4N1FA 1TNXA 1K96A 2ISDA 2K7DA 1LINA 2KQYA 2B1UA 2BBMA 2LP2A 5I2OA 1KFXS 1YTZC 1MQ1A 2BL0C 3PALA 1C7WA 1IJ6A 4YGEB 3BOWA 2GGZA 1JF0A 4GPLB 2JTTA 1WRKA 4MRXA 1CLMA 2HPSA 4ICBA 5AXIA 1JF2A 1V1FA 2I94A 2EC6C 1CM4A 3KO0A 3MSEB 1QV0A 1U5IA 5ER4X 3O78A 3LK1A 3PM8A 5PALA 1A29A 2CCMA 3BXKA 4WRIA 4WQ3A 3I5IB 3GK4X 1BMOA 3O2PA 1QV1A 1S3PA 4U8DA 1AP4A 2MLFC 1DF0B 4WQ2A 2F33A 2HF5A 1AK8A 1PVAA 1SW8A 2KYFA 2AUCA 1YRUB 2JNFA 3SJSA 1SL8A 2L98A 1NP8A 1NUBA 2M29A 2ZN9A 3SG5A 1UHJA 1UHKA 2LLUA 1F54A 2LMVA 2Q91A 2E30A 1PVBA 2LAPA 1B9AA 2ZRTA 1DF0A 1PSBA 4MBEA 1SNLA 2L4IA 1QLKA 4GGNA 2MJWB 5J3XA 1S26D 1B7TZ 4GBAA 1QASA 1CMGA 2KGRA 5B8IB 4MZJA 3CLNA 2I7AA 4I5NB 1BOCA 1H4BA 1B7TY 1QATA 1CDMA 1S36A 2CXJA 2L0PA 4NDBA 1DJHA 2GV5A 3KF9A 1C07A 1KFUS 1WY9A 1VRKA 2E6WA 3DF0B 2BECA 1L2OC 1NX1A 2WCBA 1K90D 1FI5A 1XK4C 3EKHA 1M45A 1S6IA 3EVVA 2LMTA 5G08A 3ICBA 4YGCB 1B8LA 3AAKA 1KQVA 2LUCA 2PVBA 1RK9A 3SG7A 4C0KA 3VRRA 3WNXB 3VGOA 4MZKA 4GGFC 2CT9A 2WNDA 1EJ3A 3GK1A 3I5HC 3D0YB 1B8RA 4PHJA 3JVTC 2LE9B 2M3WA 1XFVO 4I5JA 1YUUA 1CDLA 2K7OA 1K93D 1KK8C 1W7JB 2KI6D 3LK0A 1MF8B 1SKTA 2COLB 3RLZA 1FPWA 1K9PA 4XJKB 1OMDA 2GGMA 1WDCB 1GQMA 1MWNA 1QS7A 1XO5A 1TCFA 2KOTA 1OQPA 1RFJA 3D0YA 1DT7B 1FI6A 5BPJA 2OTGB
chains in the Genus database with same CATH superfamily
4NDCA 1NSHA 1WLZA 2QEOA 3V2LA 2BAPA 2CTNA 2QDIA 3O4XA 1QVIZ 3SS3A 2M7NA 3S0GA 3AKAA 4IL1A 5I2LA 3B6XA 1CFDA 1ZOTB 4OV2A 2LM5A 3S0EA 4PALA 1AHRA 3PJIA 3UO9A 3A4UB 2HQ8A 2JT8A 2M97A 1F70A 4XJKA 4OKHA 1QVIY 3PN7C 3VROA 1B47A 4MLWA 3S0AA 2K0JA 1SL9A 3BUXB 4ZCUA 1BR1B 1G4YR 2MBXA 1AJ4A 2JU0A 2MLEC 4DUQA 3UNWA 1OW4A 2M8UA 4CLNA 3HX4A 1CB1A 4PE4A 5FI6A 2R2IA 1AJ5A 3GOFA 3SS5A 2K2FA 1FF1A 4MN0A 1YUSA 3OP0A 3CZ0A 3JTDB 1KWOB 4L9MA 3PM2A 4HSZA 2JT3A 5F6TA 1IGVA 2JPTA 1ORGA 4PHMA 2LVJA 3PSRA 4Q04A 1EH2A 1XFZO 5HKZA 5IBWA 5CSNA 1QX5B 2OS8C 3D78A 5I94A 2BL0B 1CDNA 1AVSA 4GUKA 1NIWA 2PALA 1AUIB 4HREE 1M63B 2H61C 1WRLA 2EC6B 2KI4C 3PLFB 3EK8A 3KPXA 2KFFA 2L5XB 3BUNB 5FI7A 2JXLA 5KTYA 1XFYO 2HQWA 1BODA 2BKHB 2JRFA 2K7BA 3C1VA 1SPYA 3PFVA 5DICA 3CS1A 3DY9A 2F8PA 3LL8B 2M1UA 5HLOA 3I5FC 1EG3A 3VRPA 3FWCA 4MEWA 1J7OA 2L51A 2L5YA 3K21A 5DKQA 1SBJA 4FQOA 1DJIA 1GGZA 3SIAA 2JOJA 2NCOA 2CNPA 1KQMB 3IVTA 3OB2B 5DKRA 3D73A 3CDNA 2QEBA 1SY9A 1NCZA 1OOJA 4MZLA 2JULA 1YVLA 1ZMZA 1K2HA 2HETA 1KFXL 1YUTA 1QWVA 2KAXA 1YURA 1IWQA 2L50A 1DEKA 1MR8A 3AKBA 2M1KB 4CPVA 3DYEA 3I5GC 1J55A 2M0RA 1OOGA 2BBNA 1B1GA 3K1EA 3CR4X 4PE0A 3I5IC 4QJ3B 1F55A 1UURA 1E8AA 1DJYA 2F3YA 3BUWB 3NSOA 1LKJA 1KSMA 2L4HA 1SCVA 4FQTA 3DVJA 1XVJA 1A75B 2K7CA 3D10A 5FI2A 4MSPA 4C0LA 1CTRA 3HCMA 4PCWA 1BLQA 2AMIA 2P6BB 2MAZA 1A03A 3BQ3A 3DVMA 2Y4QA 1W7IB 2F2OA 4YI8A 4YGBB 4USLA 3OX5A 4CFRA 5CSJA 5I2QA 1Y1UA 1UHIA 1GJYA 2KBMA 1PRWA 3FE8A 1CLLA 2QPTA 3CZTX 2WCEA 1Q80A 1QIWA 3IQOA 1XYDA 1A75A 1OOIX 3I5HB 1JFKA 4I5LB 4ORBB 3TUYC 1CFFA 4ORCB 1XK4A 5I8NA 1CDPA 3BUMB 3FWBA 1UHHA 1QLSA 1XFWO 5AERA 5CSFA 3TS5C 1N2DA 1OZOA 1SCMB 1GGWA 1F8HA 4PE7A 1KK8B 2CBLA 2NXQA 3DXLA 1M39A 3VB1A 2K60A 3NXAA 4GGFA 1ALVA 1R6PA 1BG1A 5D7FA 1DQEA 4NDDA 4QJ5B 1L7ZA 4JWQA 1DJXA 1LA3A 5GQQC 3EK4A 1V1GA 2FJUB 2JQ6A 1DJGA 1IG5A 2KSPA 3O6BA 4CFQA 2G2BA 2LVKA 1DGUA 1DVIA 2LHIA 1SMGA 5D3OA 1K94A 1MUXA 1TIZA 1MHOA 2DOQA 2F2PA 3BYAA 3CTNA 3DVEA 1EXRA 3E3RA 3D75A 2PMYA 2M9GA 5K89A 2KBIA 4JPZB 5KU1A 3PN7B 4AQJA 2ZFDA 2P71A 5CSIA 1BU3A 1SL7A 4OR9B 4MRYA 1OZSA 3CWGA 1WLMA 4E68A 1OMVA 2KLEA 2WOSA 4ORAB 1B4CA 2JPOA 2LHLA 1PK0D 1SR6C 1NYAA 1RROA 3TDIA 3DVKA 1SK6D 5JJGA 5HKWA 4M2QA 1TUZA 2KGBC 4OVNF 4N5XA 3SIBA 1WDCC 1CM1A 2LLTA 2ZNDA 4DCKA 2MHHA 3FS7A 1OMRA 4YRUA 1CFPA 2SCPA 2FJYA 4BY5A 4BY4A 3NSIA 1LVCD 5HLVA 3BFAA 1J7RA 2G9BA 1KK7Z 3D77A 3GK2A 5HKYA 1CMFA 2KYCA 2WC6A 4JKTA 1RJVA 1J1DA 3VRNA 1DMOA 1CFCA 2M49B 2D8NA 3OHMB 2KI4B 2ZKMX 4M2OA 4TNCA 4C0JA 1KK7Y 3KEVA 4UPGA 4YGDB 2KQ6A 1XFUO 2NLNA 1F71A 3EVRA 1J7PA 1JUOA 3IF7A 5TNCA 2BCBA 2LMUA 2M7LA 2MRDA 1J7QA 2A4JA 3FE9A 1RTP1 2O5GA 3I5FB 3EK7A 3KHEA 4IJ7A 1UHNA 2QEHA 2EHBA 3WHTB 3CR5X 3JTDC 2WCMA 1DJZA 1CKKA 4M2PA 1Y6WA 1EL4A 2ERBA 1QXPA 2H61A 2WCHA 4ZCVA 4PDZA 3LCPC 5AEQA 1YVHA 1RWYA 1CLBA 1JBAA 3IQQA 4OCIA 3CR2A 1IQ5A 1QJTA 2P70A 1ALWA 3OB1B 3QRXA 4GAOA 4AQIA 3EVUA 4A4CA 1PULA 3ZWHA 3CGAA 1ZACA 2LLSA 3DD4A 2F3ZA 2KHNA 4HRGA 2Y1MA 2Y1NA 3A8RA 1ZUZA 2K61A 4YBHB 4JD9A 2LCPA 2PRUA 4INWA 3NHTA 4YGAA 1C3ZA 1HT9A 1Z4HA 2PYQA 1HQVA 2Q4UA 3I5GB 5JOLA 3AAJA 3SG2A 1BJFA 3TDZA 1TCOB 5HL1A 3RZSA 3S0BA 1OOHA 1Z2CB 1N0YA 1H8BA 2ZNEA 1JWDA 2QACA 4PE1A 2Y5IA 2KAYA 3OBVA 4PT1A 1TWOA 1YRTB 1P28A 5DKNA 1KQMC 1QTXA 1R2UA 2KFHA 2KI6C 4PHNA 2BCAA 2I18A 2IS9A 2BCXA 1BT6A 2VRGA 2LANA 4R1EA 1EG4A 4DIRA 2LC5A 1L2OB 1W9ZA 2KFGA 1OE9B 1TRFA 2SASA 4F0ZB 3SG4A 2FCDA 1M46A 2PSRA 1IQ3A 1YR5A 1ODBA 1YX8A 3TZ1A 4D1EA 1WRZA 2LV7A 4KYNA 1T14A 2KPHA 5AANA 1DGVA 1XFRA 2JXCA 2O60A 2V53A 4N1GA 3TUYB 3CZ2A 2BKIB 1D1OA 3S0DA 1NCXA 1YX7A 1K8UA 2H8VA 4DS7A 1A2XA 3TS5B 3WHUB 3B88A 2GTEA 3JVTB 5HYDA 4XYNA 1FW4A 1ZFSA 2RGIA 3SG3A 1JFJA 2PQLA 2MA2A 1KFUL 1PSRA 1TUJA 4ETOA 1S1EA 1F4OA 1SSEB 1X02A 3L4LA 4GNKB 1IJ5A 1IIOA 1K95A 5CPVA 4CIDA 4AOMA 3NSLA 1C7VA 3ZNIA 2BE4A 5KSZA 1IH0A 1NX2A 5D69A 3H4SE 1NWDA 3OX6A 3BUOB 2LP3A 3CABA 3EKJA 3FIAA 1BF5A 1IKUA 2JZIA 1DTLA 1Y1AA 1Y1XA 1DELA 2WORA 3DF0A 4I5KA 4P5OE 4P2YB 1Y0VH 2LNKA 1F4QA 1J1EA 5ER5A 2EGDA 2FCEA 4NQGA 1QX2A 4DRWA 2ZRSA 1QX7A 1MXEA 2LVIA 2AAOA 4FTGA 2K2AA 1K9UA 1SCMC 1IRJA 3LLEA 3PATA 1SR6B 1SYMA 3R1OA 1QIVA 1NX3A 4MVFA 4PHKA 1TNQA 1CNPA 4INXA 1LXFC 2OPOA 1S5GZ 2FOTA 3B7AA 2BE6A 1G8IA 3RM1A 4HRHA 1N65A 2JNXA 1KCYA 3VRQA 4YI9A 1JSAA 1DJWA 3F45A 2WC8A 2KAVA 2JC2A 2NCPA 1S5GY 1G33A 1OSAA 3CYZA 3NSKA 5FYXA 2TN4A 1TNWA 1XA5A 2JWWA 5AFPA 2JTZA 2KDHA 1S6CA 1SRAA 2K8MB 1TN4A 2OTGC 4JQ0D 1PALA 4GFTA 1JC2A 2OS8B 2LVVA 3FE6A 3L4AA 2NZ0A 3OGNA 1MXLC 1OOFA 3M0WA 1UP5A 2H2KA 1TOPA 1S6JA 1B8CA 2LUXA 1UWOA 1KSOA 1NPQA 2QEVA 2YGUA 2ZN8A 1K9KA 2KNEA 2PASA 1FBVA 1TNPA 1NX0A 1TTXA 3SG6A 3WXAA 3D74A 3BOWB 1XFXO 1UUSA 2I2RE 2WCFA 3TDUA 3O4YA 1DC1A 1NCYA 4QJ4B 1KWOC 1M31A 1RECA 1U5IB 2JT0A 1A4PA 1LA0A 1BR4B 4A4BA 2L2EA 4N1FA 1TNXA 2WC5A 1K96A 2ISDA 2K7DA 1LINA 2KQYA 2B1UA 2BBMA 2LP2A 5I2OA 2WCJA 1KFXS 1YTZC 1MQ1A 2BL0C 3PALA 1C7WA 1IJ6A 3Q8IA 4YGEB 3BOWA 2GGZA 1JF0A 4GPLB 2JTTA 1WRKA 4MRXA 1CLMA 2HPSA 4ICBA 5AXIA 1JF2A 1V1FA 2I94A 2EC6C 1CM4A 3BFBA 3KO0A 1QV0A 1U5IA 3MSEB 3O78A 3LK1A 3PM8A 5PALA 1FI6A 1A29A 2CCMA 3BFHA 3BXKA 4WRIA 4WQ3A 3I5IB 3GK4X 1BMOA 3O2PA 1QV1A 1S3PA 2L2CA 4U8DA 1AP4A 2MLFC 1DF0B 4WQ2A 2F33A 2HF5A 1AK8A 3SS4A 3R1PA 1PVAA 1SW8A 2KYFA 2AUCA 1YRUB 2JNFA 3SJSA 1SL8A 2L98A 1NP8A 1NUBA 2WCLA 2M29A 2ZN9A 3SG5A 1UHJA 1UHKA 2LLUA 1F54A 2LMVA 5EL2A 2Q91A 2E30A 1PVBA 2LAPA 1B9AA 2ZRTA 1DF0A 1PSBA 4MBEA 3NHIA 1SNLA 2L4IA 1QLKA 4GGNA 2MJWB 5J3XA 1S26D 1B7TZ 3L47A 4GBAA 1QASA 3D76A 1CMGA 2KGRA 3B87A 5B8IB 4MZJA 2BNXA 3CLNA 2I7AA 4F7FA 3DZTA 3QMEA 3BJHA 4I5NB 1BOCA 1H4BA 1B7TY 1QATA 1CDMA 3S0FA 1S36A 2CXJA 2L0PA 4NDBA 1DJHA 2GV5A 3CZ1A 3KF9A 1C07A 3B86A 1KFUS 1WY9A 1VRKA 2E6WA 3DF0B 2BECA 1L2OC 1NX1A 2WCBA 1K90D 1FI5A 1XK4C 3EKHA 1GM0A 1M45A 1S6IA 3EVVA 2LMTA 5G08A 2WCKA 3ICBA 3N7HA 4YGCB 1B8LA 3AAKA 1KQVA 3R72A 2LUCA 2PVBA 1RK9A 3SG7A 4C0KA 3VRRA 3WNXB 3VGOA 4MZKA 4GGFC 2CT9A 2WNDA 1EJ3A 3GK1A 3I5HC 3D0YB 1B8RA 4PHJA 3JVTC 2LE9B 2M3WA 1XFVO 4OZDA 4I5JA 1YUUA 1CDLA 2K7OA 1K93D 1KK8C 1W7JB 2KI6D 3LK0A 3NGVA 1MF8B 1SKTA 2COLB 2KLDA 3RLZA 1FPWA 1K9PA 3EG5B 4XJKB 3R1VA 1OMDA 2GGMA 1WDCB 1GQMA 1MWNA 1LS8A 1QS7A 1TCFA 1XO5A 1OQPA 1RFJA 2KOTA 3D0YA 1DT7B 1C3YA 5BPJA 2OTGB 5ER4X
chains in the Genus database with same CATH topology
4NDCA 1NSHA 1WLZA 2CTNA 1QVIZ 2M7NA 3AKAA 4IL1A 5I2LA 1CFDA 1ZOTB 4OV2A 2LM5A 4PALA 1AHRA 3A4UB 2HQ8A 2JT8A 2M97A 1F70A 4XJKA 4OKHA 1QVIY 3PN7C 3VROA 1B47A 4MLWA 2K0JA 1SL9A 3BUXB 4ZCUA 1BR1B 1G4YR 2MBXA 1AJ4A 2JU0A 2MLEC 4DUQA 2M8UA 4CLNA 3HX4A 1CB1A 4PE4A 2R2IA 1AJ5A 3GOFA 2K2FA 1FF1A 4MN0A 1YUSA 3OP0A 3JTDB 1KWOB 4L9MA 4HSZA 2JT3A 5F6TA 1IGVA 2JPTA 4PHMA 2LVJA 3PSRA 4Q04A 1EH2A 1XFZO 5HKZA 5IBWA 5CSNA 1QX5B 2OS8C 2BL0B 1CDNA 1AVSA 4GUKA 1NIWA 2PALA 1AUIB 4HREE 1M63B 2H61C 1WRLA 2EC6B 2KI4C 3PLFB 3EK8A 3KPXA 2KFFA 2L5XB 3BUNB 2JXLA 5KTYA 1XFYO 2HQWA 1BODA 2BKHB 2JRFA 2K7BA 3C1VA 1SPYA 3PFVA 3CS1A 2F8PA 3LL8B 2M1UA 5HLOA 3I5FC 1EG3A 3VRPA 3FWCA 4MEWA 1J7OA 2L51A 3K21A 5DKQA 1SBJA 4FQOA 1DJIA 1GGZA 3SIAA 2JOJA 2NCOA 2CNPA 1KQMB 3OB2B 5DKRA 1SY9A 1NCZA 1OOJA 4MZLA 2JULA 1YVLA 1ZMZA 1K2HA 2HETA 1KFXL 1YUTA 2KAXA 1YURA 1IWQA 2L50A 1MR8A 4CPVA 3AKBA 2M1KB 3I5GC 1J55A 2M0RA 1B1GA 2BBNA 4PE0A 3CR4X 3I5IC 4QJ3B 1F55A 1UURA 1E8AA 1DJYA 2F3YA 3BUWB 3NSOA 1LKJA 1KSMA 2L4HA 1SCVA 3DVJA 1XVJA 1A75B 2K7CA 3D10A 4MSPA 4C0LA 1CTRA 3HCMA 4PCWA 1BLQA 2AMIA 2P6BB 2MAZA 1A03A 3BQ3A 3DVMA 2Y4QA 1W7IB 2F2OA 4YI8A 4YGBB 4USLA 3OX5A 4CFRA 5CSJA 5I2QA 1Y1UA 1UHIA 1GJYA 2KBMA 1PRWA 1CLLA 2QPTA 3CZTX 2WCEA 1Q80A 1QIWA 3IQOA 1XYDA 1A75A 1CFFA 3I5HB 1JFKA 4I5LB 4ORBB 3TUYC 4ORCB 1XK4A 5I8NA 1CDPA 3BUMB 3FWBA 1UHHA 1QLSA 1XFWO 5AERA 5CSFA 3TS5C 1N2DA 1OZOA 1SCMB 1GGWA 1F8HA 4PE7A 1KK8B 2CBLA 2NXQA 1M39A 3NXAA 4GGFA 1ALVA 1R6PA 1BG1A 5D7FA 4NDDA 4QJ5B 1L7ZA 4JWQA 1DJXA 1LA3A 5GQQC 3EK4A 1V1GA 2FJUB 2JQ6A 1DJGA 1IG5A 2KSPA 3O6BA 4CFQA 2G2BA 2LVKA 1DGUA 1DVIA 2LHIA 1SMGA 1K94A 1MUXA 1TIZA 1MHOA 2DOQA 2F2PA 3BYAA 3CTNA 3DVEA 1EXRA 3E3RA 5K89A 2PMYA 2M9GA 5KU1A 2KBIA 4JPZB 3PN7B 4AQJA 2ZFDA 5CSIA 1BU3A 1SL7A 4OR9B 4MRYA 1OZSA 3CWGA 1WLMA 4E68A 1OMVA 2WOSA 4ORAB 1B4CA 2LHLA 1PK0D 1SR6C 1NYAA 1RROA 3TDIA 3DVKA 1SK6D 5JJGA 5HKWA 4M2QA 2KGBC 4OVNF 4N5XA 3SIBA 1WDCC 1CM1A 2LLTA 2ZNDA 4DCKA 2MHHA 3FS7A 1OMRA 4YRUA 1CFPA 2SCPA 4BY5A 4BY4A 3NSIA 1LVCD 5HLVA 1J7RA 2G9BA 1KK7Z 3GK2A 5HKYA 1CMFA 2KYCA 1RJVA 1J1DA 3VRNA 1DMOA 1CFCA 2M49B 2D8NA 3OHMB 2KI4B 2ZKMX 4M2OA 4TNCA 4C0JA 1KK7Y 3KEVA 4UPGA 4YGDB 2KQ6A 1XFUO 2NLNA 1F71A 3EVRA 1J7PA 1JUOA 3IF7A 5TNCA 2BCBA 2LMUA 2M7LA 2MRDA 1J7QA 2A4JA 1RTP1 2O5GA 3I5FB 3EK7A 3KHEA 3WHTB 1UHNA 2EHBA 3CR5X 3JTDC 1DJZA 1CKKA 4M2PA 1Y6WA 1EL4A 4ZCVA 1QXPA 2H61A 4PDZA 3LCPC 5AEQA 1YVHA 1RWYA 1CLBA 1JBAA 3IQQA 4OCIA 3CR2A 1IQ5A 1QJTA 3OB1B 1ALWA 4GAOA 3QRXA 4AQIA 3EVUA 4A4CA 1PULA 3ZWHA 3CGAA 1ZACA 2LLSA 3DD4A 2F3ZA 2KHNA 4HRGA 2Y1MA 2Y1NA 3A8RA 1ZUZA 2K61A 4YBHB 2LCPA 2PRUA 4YGAA 1HT9A 1HQVA 2Q4UA 3I5GB 5JOLA 3AAJA 3SG2A 1BJFA 3TDZA 1TCOB 1N0YA 1H8BA 2ZNEA 1JWDA 2QACA 4PE1A 2Y5IA 2KAYA 1YRTB 5DKNA 1KQMC 1QTXA 1R2UA 2KFHA 2KI6C 4PHNA 2BCAA 2I18A 2IS9A 2BCXA 1BT6A 2VRGA 2LANA 4R1EA 1EG4A 4DIRA 2LC5A 1L2OB 2KFGA 1OE9B 1TRFA 2SASA 4F0ZB 3SG4A 2FCDA 1M46A 2PSRA 1IQ3A 1YR5A 1ODBA 1YX8A 3TZ1A 4D1EA 1WRZA 2LV7A 5AANA 1DGVA 2JXCA 2V53A 2O60A 4N1GA 3TUYB 1D1OA 2BKIB 1NCXA 1YX7A 1K8UA 4DS7A 1A2XA 3TS5B 3WHUB 3JVTB 5HYDA 4XYNA 1FW4A 1ZFSA 2RGIA 3SG3A 1JFJA 2MA2A 1KFUL 1PSRA 4ETOA 1S1EA 1F4OA 1X02A 4GNKB 1IJ5A 1K95A 5CPVA 4CIDA 4AOMA 3NSLA 1C7VA 3ZNIA 2BE4A 5KSZA 1IH0A 1NX2A 5D69A 3H4SE 1NWDA 3OX6A 3BUOB 2LP3A 3EKJA 3FIAA 1BF5A 1IKUA 2JZIA 1DTLA 1Y1AA 1Y1XA 2WORA 3DF0A 4I5KA 4P5OE 4P2YB 1Y0VH 2LNKA 1F4QA 1J1EA 5ER5A 2EGDA 2FCEA 4NQGA 1QX2A 4DRWA 2ZRSA 1QX7A 1MXEA 2LVIA 2AAOA 4FTGA 2K2AA 1K9UA 1SCMC 1IRJA 3LLEA 3PATA 1SR6B 1SYMA 1QIVA 1NX3A 4MVFA 4PHKA 1TNQA 1CNPA 1LXFC 2OPOA 1S5GZ 2FOTA 2BE6A 1G8IA 3RM1A 4HRHA 1N65A 2JNXA 1KCYA 3VRQA 4YI9A 1JSAA 1DJWA 3F45A 2WC8A 2KAVA 2JC2A 2NCPA 1S5GY 1G33A 1OSAA 3NSKA 5FYXA 2TN4A 1TNWA 1XA5A 2JWWA 5AFPA 2JTZA 2KDHA 1S6CA 1SRAA 2K8MB 1TN4A 2OTGC 4JQ0D 1PALA 4GFTA 1JC2A 2OS8B 2LVVA 2NZ0A 1MXLC 3M0WA 1UP5A 2H2KA 1TOPA 1S6JA 1B8CA 2LUXA 1UWOA 1KSOA 1NPQA 2ZN8A 1K9KA 2KNEA 2PASA 1FBVA 1TNPA 1NX0A 1TTXA 3SG6A 3WXAA 3BOWB 1XFXO 1UUSA 2I2RE 2WCFA 3TDUA 3O4YA 1NCYA 4QJ4B 1KWOC 1M31A 1RECA 1U5IB 2JT0A 1A4PA 1LA0A 1BR4B 4A4BA 2L2EA 4N1FA 1TNXA 1K96A 2ISDA 2K7DA 1LINA 2KQYA 2B1UA 2BBMA 2LP2A 5I2OA 1KFXS 1YTZC 1MQ1A 2BL0C 3PALA 1C7WA 1IJ6A 4YGEB 3BOWA 2GGZA 1JF0A 4GPLB 2JTTA 1WRKA 4MRXA 1CLMA 2HPSA 4ICBA 5AXIA 1JF2A 1V1FA 2I94A 2EC6C 1CM4A 3KO0A 3MSEB 1QV0A 1U5IA 5ER4X 3O78A 3LK1A 3PM8A 5PALA 1A29A 2CCMA 3BXKA 4WRIA 4WQ3A 3I5IB 3GK4X 1BMOA 3O2PA 1QV1A 1S3PA 4U8DA 1AP4A 2MLFC 1DF0B 4WQ2A 2F33A 2HF5A 1AK8A 1PVAA 1SW8A 2KYFA 2AUCA 1YRUB 2JNFA 3SJSA 1SL8A 2L98A 1NP8A 1NUBA 2M29A 2ZN9A 3SG5A 1UHJA 1UHKA 2LLUA 1F54A 2LMVA 2Q91A 2E30A 1PVBA 2LAPA 1B9AA 2ZRTA 1DF0A 1PSBA 4MBEA 1SNLA 2L4IA 1QLKA 4GGNA 2MJWB 5J3XA 1S26D 1B7TZ 4GBAA 1QASA 1CMGA 2KGRA 5B8IB 4MZJA 3CLNA 2I7AA 4I5NB 1BOCA 1H4BA 1B7TY 1QATA 1CDMA 1S36A 2CXJA 2L0PA 4NDBA 1DJHA 2GV5A 3KF9A 1C07A 1KFUS 1WY9A 1VRKA 2E6WA 3DF0B 2BECA 1L2OC 1NX1A 2WCBA 1K90D 1FI5A 1XK4C 3EKHA 1M45A 1S6IA 3EVVA 2LMTA 5G08A 3ICBA 4YGCB 1B8LA 3AAKA 1KQVA 2LUCA 2PVBA 1RK9A 3SG7A 4C0KA 3VRRA 3WNXB 3VGOA 4MZKA 4GGFC 2CT9A 2WNDA 1EJ3A 3GK1A 3I5HC 3D0YB 1B8RA 4PHJA 3JVTC 2LE9B 2M3WA 1XFVO 4I5JA 1YUUA 1CDLA 2K7OA 1K93D 1KK8C 1W7JB 2KI6D 3LK0A 1MF8B 1SKTA 2COLB 3RLZA 1FPWA 1K9PA 4XJKB 1OMDA 2GGMA 1WDCB 1GQMA 1MWNA 1QS7A 1XO5A 1TCFA 2KOTA 1OQPA 1RFJA 3D0YA 1DT7B 1FI6A 5BPJA 2OTGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDC A;  1NSH A;  1WLZ A;  2CTN A;  1QVI Z;  2M7N A;  3AKA A;  4IL1 A;  5I2L A;  1CFD A;  1ZOT B;  4OV2 A;  2LM5 A;  4PAL A;  1AHR A;  3A4U B;  2HQ8 A;  2JT8 A;  2M97 A;  1F70 A;  4XJK A;  4OKH A;  1QVI Y;  3PN7 C;  3VRO A;  1B47 A;  4MLW A;  2K0J A;  1SL9 A;  3BUX B;  4ZCU A;  1BR1 B;  1G4Y R;  2MBX A;  1AJ4 A;  2JU0 A;  2MLE C;  4DUQ A;  2M8U A;  4CLN A;  3HX4 A;  1CB1 A;  4PE4 A;  2R2I A;  1AJ5 A;  3GOF A;  2K2F A;  1FF1 A;  4MN0 A;  1YUS A;  3OP0 A;  3JTD B;  1KWO B;  4L9M A;  4HSZ A;  2JT3 A;  5F6T A;  1IGV A;  2JPT A;  4PHM A;  2LVJ A;  3PSR A;  4Q04 A;  1EH2 A;  1XFZ O;  5HKZ A;  5IBW A;  5CSN A;  1QX5 B;  2OS8 C;  2BL0 B;  1CDN A;  1AVS A;  4GUK A;  1NIW A;  2PAL A;  1AUI B;  4HRE E;  1M63 B;  2H61 C;  1WRL A;  2EC6 B;  2KI4 C;  3PLF B;  3EK8 A;  3KPX A;  2KFF A;  2L5X B;  3BUN B;  2JXL A;  5KTY A;  1XFY O;  2HQW A;  1BOD A;  2BKH B;  2JRF A;  2K7B A;  3C1V A;  1SPY A;  3PFV A;  3CS1 A;  2F8P A;  3LL8 B;  2M1U A;  5HLO A;  3I5F C;  1EG3 A;  3VRP A;  3FWC A;  4MEW A;  1J7O A;  2L51 A;  3K21 A;  5DKQ A;  1SBJ A;  4FQO A;  1DJI A;  1GGZ A;  3SIA A;  2JOJ A;  2NCO A;  2CNP A;  1KQM B;  3OB2 B;  5DKR A;  1SY9 A;  1NCZ A;  1OOJ A;  4MZL A;  2JUL A;  1YVL A;  1ZMZ A;  1K2H A;  2HET A;  1KFX L;  1YUT A;  2KAX A;  1YUR A;  1IWQ A;  2L50 A;  1MR8 A;  4CPV A;  3AKB A;  2M1K B;  3I5G C;  1J55 A;  2M0R A;  1B1G A;  2BBN A;  4PE0 A;  3CR4 X;  3I5I C;  4QJ3 B;  1F55 A;  1UUR A;  1E8A A;  1DJY A;  2F3Y A;  3BUW B;  3NSO A;  1LKJ A;  1KSM A;  2L4H A;  1SCV A;  3DVJ A;  1XVJ A;  1A75 B;  2K7C A;  3D10 A;  4MSP A;  4C0L A;  1CTR A;  3HCM A;  4PCW A;  1BLQ A;  2AMI A;  2P6B B;  2MAZ A;  1A03 A;  3BQ3 A;  3DVM A;  2Y4Q A;  1W7I B;  2F2O A;  4YI8 A;  4YGB B;  4USL A;  3OX5 A;  4CFR A;  5CSJ A;  5I2Q A;  1Y1U A;  1UHI A;  1GJY A;  2KBM A;  1PRW A;  1CLL A;  2QPT A;  3CZT X;  2WCE A;  1Q80 A;  1QIW A;  3IQO A;  1XYD A;  1A75 A;  1CFF A;  3I5H B;  1JFK A;  4I5L B;  4ORB B;  3TUY C;  4ORC B;  1XK4 A;  5I8N A;  1CDP A;  3BUM B;  3FWB A;  1UHH A;  1QLS A;  1XFW O;  5AER A;  5CSF A;  3TS5 C;  1N2D A;  1OZO A;  1SCM B;  1GGW A;  1F8H A;  4PE7 A;  1KK8 B;  2CBL A;  2NXQ A;  1M39 A;  3NXA A;  4GGF A;  1ALV A;  1R6P A;  1BG1 A;  5D7F A;  4NDD A;  4QJ5 B;  1L7Z A;  4JWQ A;  1DJX A;  1LA3 A;  5GQQ C;  3EK4 A;  1V1G A;  2FJU B;  2JQ6 A;  1DJG A;  1IG5 A;  2KSP A;  3O6B A;  4CFQ A;  2G2B A;  2LVK A;  1DGU A;  1DVI A;  2LHI A;  1SMG A;  1K94 A;  1MUX A;  1TIZ A;  1MHO A;  2DOQ A;  2F2P A;  3BYA A;  3CTN A;  3DVE A;  1EXR A;  3E3R A;  5K89 A;  2PMY A;  2M9G A;  5KU1 A;  2KBI A;  4JPZ B;  3PN7 B;  4AQJ A;  2ZFD A;  5CSI A;  1BU3 A;  1SL7 A;  4OR9 B;  4MRY A;  1OZS A;  3CWG A;  1WLM A;  4E68 A;  1OMV A;  2WOS A;  4ORA B;  1B4C A;  2LHL A;  1PK0 D;  1SR6 C;  1NYA A;  1RRO A;  3TDI A;  3DVK A;  1SK6 D;  5JJG A;  5HKW A;  4M2Q A;  2KGB C;  4OVN F;  4N5X A;  3SIB A;  1WDC C;  1CM1 A;  2LLT A;  2ZND A;  4DCK A;  2MHH A;  3FS7 A;  1OMR A;  4YRU A;  1CFP A;  2SCP A;  4BY5 A;  4BY4 A;  3NSI A;  1LVC D;  5HLV A;  1J7R A;  2G9B A;  1KK7 Z;  3GK2 A;  5HKY A;  1CMF A;  2KYC A;  1RJV A;  1J1D A;  3VRN A;  1DMO A;  1CFC A;  2M49 B;  2D8N A;  3OHM B;  2KI4 B;  2ZKM X;  4M2O A;  4TNC A;  4C0J A;  1KK7 Y;  3KEV A;  4UPG A;  4YGD B;  2KQ6 A;  1XFU O;  2NLN A;  1F71 A;  3EVR A;  1J7P A;  1JUO A;  3IF7 A;  5TNC A;  2BCB A;  2LMU A;  2M7L A;  2MRD A;  1J7Q A;  2A4J A;  1RTP 1;  2O5G A;  3I5F B;  3EK7 A;  3KHE A;  3WHT B;  1UHN A;  2EHB A;  3CR5 X;  3JTD C;  1DJZ A;  1CKK A;  4M2P A;  1Y6W A;  1EL4 A;  4ZCV A;  1QXP A;  2H61 A;  4PDZ A;  3LCP C;  5AEQ A;  1YVH A;  1RWY A;  1CLB A;  1JBA A;  3IQQ A;  4OCI A;  3CR2 A;  1IQ5 A;  1QJT A;  3OB1 B;  1ALW A;  4GAO A;  3QRX A;  4AQI A;  3EVU A;  4A4C A;  1PUL A;  3ZWH A;  3CGA A;  1ZAC A;  2LLS A;  3DD4 A;  2F3Z A;  2KHN A;  4HRG A;  2Y1M A;  2Y1N A;  3A8R A;  1ZUZ A;  2K61 A;  4YBH B;  2LCP A;  2PRU A;  4YGA A;  1HT9 A;  1HQV A;  2Q4U A;  3I5G B;  5JOL A;  3AAJ A;  3SG2 A;  1BJF A;  3TDZ A;  1TCO B;  1N0Y A;  1H8B A;  2ZNE A;  1JWD A;  2QAC A;  4PE1 A;  2Y5I A;  2KAY A;  1YRT B;  5DKN A;  1KQM C;  1QTX A;  1R2U A;  2KFH A;  2KI6 C;  4PHN A;  2BCA A;  2I18 A;  2IS9 A;  2BCX A;  1BT6 A;  2VRG A;  2LAN A;  4R1E A;  1EG4 A;  4DIR A;  2LC5 A;  1L2O B;  2KFG A;  1OE9 B;  1TRF A;  2SAS A;  4F0Z B;  3SG4 A;  2FCD A;  1M46 A;  2PSR A;  1IQ3 A;  1YR5 A;  1ODB A;  1YX8 A;  3TZ1 A;  4D1E A;  1WRZ A;  2LV7 A;  5AAN A;  1DGV A;  2JXC A;  2V53 A;  2O60 A;  4N1G A;  3TUY B;  1D1O A;  2BKI B;  1NCX A;  1YX7 A;  1K8U A;  4DS7 A;  1A2X A;  3TS5 B;  3WHU B;  3JVT B;  5HYD A;  4XYN A;  1FW4 A;  1ZFS A;  2RGI A;  3SG3 A;  1JFJ A;  2MA2 A;  1KFU L;  1PSR A;  4ETO A;  1S1E A;  1F4O A;  1X02 A;  4GNK B;  1IJ5 A;  1K95 A;  5CPV A;  4CID A;  4AOM A;  3NSL A;  1C7V A;  3ZNI A;  2BE4 A;  5KSZ A;  1IH0 A;  1NX2 A;  5D69 A;  3H4S E;  1NWD A;  3OX6 A;  3BUO B;  2LP3 A;  3EKJ A;  3FIA A;  1BF5 A;  1IKU A;  2JZI A;  1DTL A;  1Y1A A;  1Y1X A;  2WOR A;  3DF0 A;  4I5K A;  4P5O E;  4P2Y B;  1Y0V H;  2LNK A;  1F4Q A;  1J1E A;  5ER5 A;  2EGD A;  2FCE A;  4NQG A;  1QX2 A;  4DRW A;  2ZRS A;  1QX7 A;  1MXE A;  2LVI A;  2AAO A;  4FTG A;  2K2A A;  1K9U A;  1SCM C;  1IRJ A;  3LLE A;  3PAT A;  1SR6 B;  1SYM A;  1QIV A;  1NX3 A;  4MVF A;  4PHK A;  1TNQ A;  1CNP A;  1LXF C;  2OPO A;  1S5G Z;  2FOT A;  2BE6 A;  1G8I A;  3RM1 A;  4HRH A;  1N65 A;  2JNX A;  1KCY A;  3VRQ A;  4YI9 A;  1JSA A;  1DJW A;  3F45 A;  2WC8 A;  2KAV A;  2JC2 A;  2NCP A;  1S5G Y;  1G33 A;  1OSA A;  3NSK A;  5FYX A;  2TN4 A;  1TNW A;  1XA5 A;  2JWW A;  5AFP A;  2JTZ A;  2KDH A;  1S6C A;  1SRA A;  2K8M B;  1TN4 A;  2OTG C;  4JQ0 D;  1PAL A;  4GFT A;  1JC2 A;  2OS8 B;  2LVV A;  2NZ0 A;  1MXL C;  3M0W A;  1UP5 A;  2H2K A;  1TOP A;  1S6J A;  1B8C A;  2LUX A;  1UWO A;  1KSO A;  1NPQ A;  2ZN8 A;  1K9K A;  2KNE A;  2PAS A;  1FBV A;  1TNP A;  1NX0 A;  1TTX A;  3SG6 A;  3WXA A;  3BOW B;  1XFX O;  1UUS A;  2I2R E;  2WCF A;  3TDU A;  3O4Y A;  1NCY A;  4QJ4 B;  1KWO C;  1M31 A;  1REC A;  1U5I B;  2JT0 A;  1A4P A;  1LA0 A;  1BR4 B;  4A4B A;  2L2E A;  4N1F A;  1TNX A;  1K96 A;  2ISD A;  2K7D A;  1LIN A;  2KQY A;  2B1U A;  2BBM A;  2LP2 A;  5I2O A;  1KFX S;  1YTZ C;  1MQ1 A;  2BL0 C;  3PAL A;  1C7W A;  1IJ6 A;  4YGE B;  3BOW A;  2GGZ A;  1JF0 A;  4GPL B;  2JTT A;  1WRK A;  4MRX A;  1CLM A;  2HPS A;  4ICB A;  5AXI A;  1JF2 A;  1V1F A;  2I94 A;  2EC6 C;  1CM4 A;  3KO0 A;  3MSE B;  1QV0 A;  1U5I A;  5ER4 X;  3O78 A;  3LK1 A;  3PM8 A;  5PAL A;  1A29 A;  2CCM A;  3BXK A;  4WRI A;  4WQ3 A;  3I5I B;  3GK4 X;  1BMO A;  3O2P A;  1QV1 A;  1S3P A;  4U8D A;  1AP4 A;  2MLF C;  1DF0 B;  4WQ2 A;  2F33 A;  2HF5 A;  1AK8 A;  1PVA A;  1SW8 A;  2KYF A;  2AUC A;  1YRU B;  2JNF A;  3SJS A;  1SL8 A;  2L98 A;  1NP8 A;  1NUB A;  2M29 A;  2ZN9 A;  3SG5 A;  1UHJ A;  1UHK A;  2LLU A;  1F54 A;  2LMV A;  2Q91 A;  2E30 A;  1PVB A;  2LAP A;  1B9A A;  2ZRT A;  1DF0 A;  1PSB A;  4MBE A;  1SNL A;  2L4I A;  1QLK A;  4GGN A;  2MJW B;  5J3X A;  1S26 D;  1B7T Z;  4GBA A;  1QAS A;  1CMG A;  2KGR A;  5B8I B;  4MZJ A;  3CLN A;  2I7A A;  4I5N B;  1BOC A;  1H4B A;  1B7T Y;  1QAT A;  1CDM A;  1S36 A;  2CXJ A;  2L0P A;  4NDB A;  1DJH A;  2GV5 A;  3KF9 A;  1C07 A;  1KFU S;  1WY9 A;  1VRK A;  2E6W A;  3DF0 B;  2BEC A;  1L2O C;  1NX1 A;  2WCB A;  1K90 D;  1FI5 A;  1XK4 C;  3EKH A;  1M45 A;  1S6I A;  3EVV A;  2LMT A;  5G08 A;  3ICB A;  4YGC B;  1B8L A;  3AAK A;  1KQV A;  2LUC A;  2PVB A;  1RK9 A;  3SG7 A;  4C0K A;  3VRR A;  3WNX B;  3VGO A;  4MZK A;  4GGF C;  2CT9 A;  2WND A;  1EJ3 A;  3GK1 A;  3I5H C;  3D0Y B;  1B8R A;  4PHJ A;  3JVT C;  2LE9 B;  2M3W A;  1XFV O;  4I5J A;  1YUU A;  1CDL A;  2K7O A;  1K93 D;  1KK8 C;  1W7J B;  2KI6 D;  3LK0 A;  1MF8 B;  1SKT A;  2COL B;  3RLZ A;  1FPW A;  1K9P A;  4XJK B;  1OMD A;  2GGM A;  1WDC B;  1GQM A;  1MWN A;  1QS7 A;  1XO5 A;  1TCF A;  2KOT A;  1OQP A;  1RFJ A;  3D0Y A;  1DT7 B;  1FI6 A;  5BPJ A;  2OTG B; 
#chains in the Genus database with same CATH topology
 4NDC A;  1NSH A;  1WLZ A;  2QEO A;  3V2L A;  2BAP A;  2CTN A;  2QDI A;  3O4X A;  1QVI Z;  3SS3 A;  2M7N A;  3S0G A;  3AKA A;  4IL1 A;  5I2L A;  3B6X A;  1CFD A;  1ZOT B;  4OV2 A;  2LM5 A;  3S0E A;  4PAL A;  1AHR A;  3PJI A;  3UO9 A;  3A4U B;  2HQ8 A;  2JT8 A;  2M97 A;  1F70 A;  4XJK A;  4OKH A;  1QVI Y;  3PN7 C;  3VRO A;  1B47 A;  4MLW A;  3S0A A;  2K0J A;  1SL9 A;  3BUX B;  4ZCU A;  1BR1 B;  1G4Y R;  2MBX A;  1AJ4 A;  2JU0 A;  2MLE C;  4DUQ A;  3UNW A;  1OW4 A;  2M8U A;  4CLN A;  3HX4 A;  1CB1 A;  4PE4 A;  5FI6 A;  2R2I A;  1AJ5 A;  3GOF A;  3SS5 A;  2K2F A;  1FF1 A;  4MN0 A;  1YUS A;  3OP0 A;  3CZ0 A;  3JTD B;  1KWO B;  4L9M A;  3PM2 A;  4HSZ A;  2JT3 A;  5F6T A;  1IGV A;  2JPT A;  1ORG A;  4PHM A;  2LVJ A;  3PSR A;  4Q04 A;  1EH2 A;  1XFZ O;  5HKZ A;  5IBW A;  5CSN A;  1QX5 B;  2OS8 C;  3D78 A;  5I94 A;  2BL0 B;  1CDN A;  1AVS A;  4GUK A;  1NIW A;  2PAL A;  1AUI B;  4HRE E;  1M63 B;  2H61 C;  1WRL A;  2EC6 B;  2KI4 C;  3PLF B;  3EK8 A;  3KPX A;  2KFF A;  2L5X B;  3BUN B;  5FI7 A;  2JXL A;  5KTY A;  1XFY O;  2HQW A;  1BOD A;  2BKH B;  2JRF A;  2K7B A;  3C1V A;  1SPY A;  3PFV A;  5DIC A;  3CS1 A;  3DY9 A;  2F8P A;  3LL8 B;  2M1U A;  5HLO A;  3I5F C;  1EG3 A;  3VRP A;  3FWC A;  4MEW A;  1J7O A;  2L51 A;  2L5Y A;  3K21 A;  5DKQ A;  1SBJ A;  4FQO A;  1DJI A;  1GGZ A;  3SIA A;  2JOJ A;  2NCO A;  2CNP A;  1KQM B;  3IVT A;  3OB2 B;  5DKR A;  3D73 A;  3CDN A;  2QEB A;  1SY9 A;  1NCZ A;  1OOJ A;  4MZL A;  2JUL A;  1YVL A;  1ZMZ A;  1K2H A;  2HET A;  1KFX L;  1YUT A;  1QWV A;  2KAX A;  1YUR A;  1IWQ A;  2L50 A;  1DEK A;  1MR8 A;  3AKB A;  2M1K B;  4CPV A;  3DYE A;  3I5G C;  1J55 A;  2M0R A;  1OOG A;  2BBN A;  1B1G A;  3K1E A;  3CR4 X;  4PE0 A;  3I5I C;  4QJ3 B;  1F55 A;  1UUR A;  1E8A A;  1DJY A;  2F3Y A;  3BUW B;  3NSO A;  1LKJ A;  1KSM A;  2L4H A;  1SCV A;  4FQT A;  3DVJ A;  1XVJ A;  1A75 B;  2K7C A;  3D10 A;  5FI2 A;  4MSP A;  4C0L A;  1CTR A;  3HCM A;  4PCW A;  1BLQ A;  2AMI A;  2P6B B;  2MAZ A;  1A03 A;  3BQ3 A;  3DVM A;  2Y4Q A;  1W7I B;  2F2O A;  4YI8 A;  4YGB B;  4USL A;  3OX5 A;  4CFR A;  5CSJ A;  5I2Q A;  1Y1U A;  1UHI A;  1GJY A;  2KBM A;  1PRW A;  3FE8 A;  1CLL A;  2QPT A;  3CZT X;  2WCE A;  1Q80 A;  1QIW A;  3IQO A;  1XYD A;  1A75 A;  1OOI X;  3I5H B;  1JFK A;  4I5L B;  4ORB B;  3TUY C;  1CFF A;  4ORC B;  1XK4 A;  5I8N A;  1CDP A;  3BUM B;  3FWB A;  1UHH A;  1QLS A;  1XFW O;  5AER A;  5CSF A;  3TS5 C;  1N2D A;  1OZO A;  1SCM B;  1GGW A;  1F8H A;  4PE7 A;  1KK8 B;  2CBL A;  2NXQ A;  3DXL A;  1M39 A;  3VB1 A;  2K60 A;  3NXA A;  4GGF A;  1ALV A;  1R6P A;  1BG1 A;  5D7F A;  1DQE A;  4NDD A;  4QJ5 B;  1L7Z A;  4JWQ A;  1DJX A;  1LA3 A;  5GQQ C;  3EK4 A;  1V1G A;  2FJU B;  2JQ6 A;  1DJG A;  1IG5 A;  2KSP A;  3O6B A;  4CFQ A;  2G2B A;  2LVK A;  1DGU A;  1DVI A;  2LHI A;  1SMG A;  5D3O A;  1K94 A;  1MUX A;  1TIZ A;  1MHO A;  2DOQ A;  2F2P A;  3BYA A;  3CTN A;  3DVE A;  1EXR A;  3E3R A;  3D75 A;  2PMY A;  2M9G A;  5K89 A;  2KBI A;  4JPZ B;  5KU1 A;  3PN7 B;  4AQJ A;  2ZFD A;  2P71 A;  5CSI A;  1BU3 A;  1SL7 A;  4OR9 B;  4MRY A;  1OZS A;  3CWG A;  1WLM A;  4E68 A;  1OMV A;  2KLE A;  2WOS A;  4ORA B;  1B4C A;  2JPO A;  2LHL A;  1PK0 D;  1SR6 C;  1NYA A;  1RRO A;  3TDI A;  3DVK A;  1SK6 D;  5JJG A;  5HKW A;  4M2Q A;  1TUZ A;  2KGB C;  4OVN F;  4N5X A;  3SIB A;  1WDC C;  1CM1 A;  2LLT A;  2ZND A;  4DCK A;  2MHH A;  3FS7 A;  1OMR A;  4YRU A;  1CFP A;  2SCP A;  2FJY A;  4BY5 A;  4BY4 A;  3NSI A;  1LVC D;  5HLV A;  3BFA A;  1J7R A;  2G9B A;  1KK7 Z;  3D77 A;  3GK2 A;  5HKY A;  1CMF A;  2KYC A;  2WC6 A;  4JKT A;  1RJV A;  1J1D A;  3VRN A;  1DMO A;  1CFC A;  2M49 B;  2D8N A;  3OHM B;  2KI4 B;  2ZKM X;  4M2O A;  4TNC A;  4C0J A;  1KK7 Y;  3KEV A;  4UPG A;  4YGD B;  2KQ6 A;  1XFU O;  2NLN A;  1F71 A;  3EVR A;  1J7P A;  1JUO A;  3IF7 A;  5TNC A;  2BCB A;  2LMU A;  2M7L A;  2MRD A;  1J7Q A;  2A4J A;  3FE9 A;  1RTP 1;  2O5G A;  3I5F B;  3EK7 A;  3KHE A;  4IJ7 A;  1UHN A;  2QEH A;  2EHB A;  3WHT B;  3CR5 X;  3JTD C;  2WCM A;  1DJZ A;  1CKK A;  4M2P A;  1Y6W A;  1EL4 A;  2ERB A;  1QXP A;  2H61 A;  2WCH A;  4ZCV A;  4PDZ A;  3LCP C;  5AEQ A;  1YVH A;  1RWY A;  1CLB A;  1JBA A;  3IQQ A;  4OCI A;  3CR2 A;  1IQ5 A;  1QJT A;  2P70 A;  1ALW A;  3OB1 B;  3QRX A;  4GAO A;  4AQI A;  3EVU A;  4A4C A;  1PUL A;  3ZWH A;  3CGA A;  1ZAC A;  2LLS A;  3DD4 A;  2F3Z A;  2KHN A;  4HRG A;  2Y1M A;  2Y1N A;  3A8R A;  1ZUZ A;  2K61 A;  4YBH B;  4JD9 A;  2LCP A;  2PRU A;  4INW A;  3NHT A;  4YGA A;  1C3Z A;  1HT9 A;  1Z4H A;  2PYQ A;  1HQV A;  2Q4U A;  3I5G B;  5JOL A;  3AAJ A;  3SG2 A;  1BJF A;  3TDZ A;  1TCO B;  5HL1 A;  3RZS A;  3S0B A;  1OOH A;  1Z2C B;  1N0Y A;  1H8B A;  2ZNE A;  1JWD A;  2QAC A;  4PE1 A;  2Y5I A;  2KAY A;  3OBV A;  4PT1 A;  1TWO A;  1YRT B;  1P28 A;  5DKN A;  1KQM C;  1QTX A;  1R2U A;  2KFH A;  2KI6 C;  4PHN A;  2BCA A;  2I18 A;  2IS9 A;  2BCX A;  1BT6 A;  2VRG A;  2LAN A;  4R1E A;  1EG4 A;  4DIR A;  2LC5 A;  1L2O B;  1W9Z A;  2KFG A;  1OE9 B;  1TRF A;  2SAS A;  4F0Z B;  3SG4 A;  2FCD A;  1M46 A;  2PSR A;  1IQ3 A;  1YR5 A;  1ODB A;  1YX8 A;  3TZ1 A;  4D1E A;  1WRZ A;  2LV7 A;  4KYN A;  1T14 A;  2KPH A;  5AAN A;  1DGV A;  1XFR A;  2JXC A;  2O60 A;  2V53 A;  4N1G A;  3TUY B;  3CZ2 A;  2BKI B;  1D1O A;  3S0D A;  1NCX A;  1YX7 A;  1K8U A;  2H8V A;  4DS7 A;  1A2X A;  3TS5 B;  3WHU B;  3B88 A;  2GTE A;  3JVT B;  5HYD A;  4XYN A;  1FW4 A;  1ZFS A;  2RGI A;  3SG3 A;  1JFJ A;  2PQL A;  2MA2 A;  1KFU L;  1PSR A;  1TUJ A;  4ETO A;  1S1E A;  1F4O A;  1SSE B;  1X02 A;  3L4L A;  4GNK B;  1IJ5 A;  1IIO A;  1K95 A;  5CPV A;  4CID A;  4AOM A;  3NSL A;  1C7V A;  3ZNI A;  2BE4 A;  5KSZ A;  1IH0 A;  1NX2 A;  5D69 A;  3H4S E;  1NWD A;  3OX6 A;  3BUO B;  2LP3 A;  3CAB A;  3EKJ A;  3FIA A;  1BF5 A;  1IKU A;  2JZI A;  1DTL A;  1Y1A A;  1Y1X A;  1DEL A;  2WOR A;  3DF0 A;  4I5K A;  4P5O E;  4P2Y B;  1Y0V H;  2LNK A;  1F4Q A;  1J1E A;  5ER5 A;  2EGD A;  2FCE A;  4NQG A;  1QX2 A;  4DRW A;  2ZRS A;  1QX7 A;  1MXE A;  2LVI A;  2AAO A;  4FTG A;  2K2A A;  1K9U A;  1SCM C;  1IRJ A;  3LLE A;  3PAT A;  1SR6 B;  1SYM A;  3R1O A;  1QIV A;  1NX3 A;  4MVF A;  4PHK A;  1TNQ A;  1CNP A;  4INX A;  1LXF C;  2OPO A;  1S5G Z;  2FOT A;  3B7A A;  2BE6 A;  1G8I A;  3RM1 A;  4HRH A;  1N65 A;  2JNX A;  1KCY A;  3VRQ A;  4YI9 A;  1JSA A;  1DJW A;  3F45 A;  2WC8 A;  2KAV A;  2JC2 A;  2NCP A;  1S5G Y;  1G33 A;  1OSA A;  3CYZ A;  3NSK A;  5FYX A;  2TN4 A;  1TNW A;  1XA5 A;  2JWW A;  5AFP A;  2JTZ A;  2KDH A;  1S6C A;  1SRA A;  2K8M B;  1TN4 A;  2OTG C;  4JQ0 D;  1PAL A;  4GFT A;  1JC2 A;  2OS8 B;  2LVV A;  3FE6 A;  3L4A A;  2NZ0 A;  3OGN A;  1MXL C;  1OOF A;  3M0W A;  1UP5 A;  2H2K A;  1TOP A;  1S6J A;  1B8C A;  2LUX A;  1UWO A;  1KSO A;  1NPQ A;  2QEV A;  2YGU A;  2ZN8 A;  1K9K A;  2KNE A;  2PAS A;  1FBV A;  1TNP A;  1NX0 A;  1TTX A;  3SG6 A;  3WXA A;  3D74 A;  3BOW B;  1XFX O;  1UUS A;  2I2R E;  2WCF A;  3TDU A;  3O4Y A;  1DC1 A;  1NCY A;  4QJ4 B;  1KWO C;  1M31 A;  1REC A;  1U5I B;  2JT0 A;  1A4P A;  1LA0 A;  1BR4 B;  4A4B A;  2L2E A;  4N1F A;  1TNX A;  2WC5 A;  1K96 A;  2ISD A;  2K7D A;  1LIN A;  2KQY A;  2B1U A;  2BBM A;  2LP2 A;  5I2O A;  2WCJ A;  1KFX S;  1YTZ C;  1MQ1 A;  2BL0 C;  3PAL A;  1C7W A;  1IJ6 A;  3Q8I A;  4YGE B;  3BOW A;  2GGZ A;  1JF0 A;  4GPL B;  2JTT A;  1WRK A;  4MRX A;  1CLM A;  2HPS A;  4ICB A;  5AXI A;  1JF2 A;  1V1F A;  2I94 A;  2EC6 C;  1CM4 A;  3BFB A;  3KO0 A;  1QV0 A;  1U5I A;  3MSE B;  3O78 A;  3LK1 A;  3PM8 A;  5PAL A;  1FI6 A;  1A29 A;  2CCM A;  3BFH A;  3BXK A;  4WRI A;  4WQ3 A;  3I5I B;  3GK4 X;  1BMO A;  3O2P A;  1QV1 A;  1S3P A;  2L2C A;  4U8D A;  1AP4 A;  2MLF C;  1DF0 B;  4WQ2 A;  2F33 A;  2HF5 A;  1AK8 A;  3SS4 A;  3R1P A;  1PVA A;  1SW8 A;  2KYF A;  2AUC A;  1YRU B;  2JNF A;  3SJS A;  1SL8 A;  2L98 A;  1NP8 A;  1NUB A;  2WCL A;  2M29 A;  2ZN9 A;  3SG5 A;  1UHJ A;  1UHK A;  2LLU A;  1F54 A;  2LMV A;  5EL2 A;  2Q91 A;  2E30 A;  1PVB A;  2LAP A;  1B9A A;  2ZRT A;  1DF0 A;  1PSB A;  4MBE A;  3NHI A;  1SNL A;  2L4I A;  1QLK A;  4GGN A;  2MJW B;  5J3X A;  1S26 D;  1B7T Z;  3L47 A;  4GBA A;  1QAS A;  3D76 A;  1CMG A;  2KGR A;  3B87 A;  5B8I B;  4MZJ A;  2BNX A;  3CLN A;  2I7A A;  4F7F A;  3DZT A;  3QME A;  3BJH A;  4I5N B;  1BOC A;  1H4B A;  1B7T Y;  1QAT A;  1CDM A;  3S0F A;  1S36 A;  2CXJ A;  2L0P A;  4NDB A;  1DJH A;  2GV5 A;  3CZ1 A;  3KF9 A;  1C07 A;  3B86 A;  1KFU S;  1WY9 A;  1VRK A;  2E6W A;  3DF0 B;  2BEC A;  1L2O C;  1NX1 A;  2WCB A;  1K90 D;  1FI5 A;  1XK4 C;  3EKH A;  1GM0 A;  1M45 A;  1S6I A;  3EVV A;  2LMT A;  5G08 A;  2WCK A;  3ICB A;  3N7H A;  4YGC B;  1B8L A;  3AAK A;  1KQV A;  3R72 A;  2LUC A;  2PVB A;  1RK9 A;  3SG7 A;  4C0K A;  3VRR A;  3WNX B;  3VGO A;  4MZK A;  4GGF C;  2CT9 A;  2WND A;  1EJ3 A;  3GK1 A;  3I5H C;  3D0Y B;  1B8R A;  4PHJ A;  3JVT C;  2LE9 B;  2M3W A;  1XFV O;  4OZD A;  4I5J A;  1YUU A;  1CDL A;  2K7O A;  1K93 D;  1KK8 C;  1W7J B;  2KI6 D;  3LK0 A;  3NGV A;  1MF8 B;  1SKT A;  2COL B;  2KLD A;  3RLZ A;  1FPW A;  1K9P A;  3EG5 B;  4XJK B;  3R1V A;  1OMD A;  2GGM A;  1WDC B;  1GQM A;  1MWN A;  1LS8 A;  1QS7 A;  1TCF A;  1XO5 A;  1OQP A;  1RFJ A;  2KOT A;  3D0Y A;  1DT7 B;  1C3Y A;  5BPJ A;  2OTG B;  5ER4 X; 
#chains in the Genus database with same CATH homology
 4NDC A;  1NSH A;  1WLZ A;  2CTN A;  1QVI Z;  2M7N A;  3AKA A;  4IL1 A;  5I2L A;  1CFD A;  1ZOT B;  4OV2 A;  2LM5 A;  4PAL A;  1AHR A;  3A4U B;  2HQ8 A;  2JT8 A;  2M97 A;  1F70 A;  4XJK A;  4OKH A;  1QVI Y;  3PN7 C;  3VRO A;  1B47 A;  4MLW A;  2K0J A;  1SL9 A;  3BUX B;  4ZCU A;  1BR1 B;  1G4Y R;  2MBX A;  1AJ4 A;  2JU0 A;  2MLE C;  4DUQ A;  2M8U A;  4CLN A;  3HX4 A;  1CB1 A;  4PE4 A;  2R2I A;  1AJ5 A;  3GOF A;  2K2F A;  1FF1 A;  4MN0 A;  1YUS A;  3OP0 A;  3JTD B;  1KWO B;  4L9M A;  4HSZ A;  2JT3 A;  5F6T A;  1IGV A;  2JPT A;  4PHM A;  2LVJ A;  3PSR A;  4Q04 A;  1EH2 A;  1XFZ O;  5HKZ A;  5IBW A;  5CSN A;  1QX5 B;  2OS8 C;  2BL0 B;  1CDN A;  1AVS A;  4GUK A;  1NIW A;  2PAL A;  1AUI B;  4HRE E;  1M63 B;  2H61 C;  1WRL A;  2EC6 B;  2KI4 C;  3PLF B;  3EK8 A;  3KPX A;  2KFF A;  2L5X B;  3BUN B;  2JXL A;  5KTY A;  1XFY O;  2HQW A;  1BOD A;  2BKH B;  2JRF A;  2K7B A;  3C1V A;  1SPY A;  3PFV A;  3CS1 A;  2F8P A;  3LL8 B;  2M1U A;  5HLO A;  3I5F C;  1EG3 A;  3VRP A;  3FWC A;  4MEW A;  1J7O A;  2L51 A;  3K21 A;  5DKQ A;  1SBJ A;  4FQO A;  1DJI A;  1GGZ A;  3SIA A;  2JOJ A;  2NCO A;  2CNP A;  1KQM B;  3OB2 B;  5DKR A;  1SY9 A;  1NCZ A;  1OOJ A;  4MZL A;  2JUL A;  1YVL A;  1ZMZ A;  1K2H A;  2HET A;  1KFX L;  1YUT A;  2KAX A;  1YUR A;  1IWQ A;  2L50 A;  1MR8 A;  4CPV A;  3AKB A;  2M1K B;  3I5G C;  1J55 A;  2M0R A;  1B1G A;  2BBN A;  4PE0 A;  3CR4 X;  3I5I C;  4QJ3 B;  1F55 A;  1UUR A;  1E8A A;  1DJY A;  2F3Y A;  3BUW B;  3NSO A;  1LKJ A;  1KSM A;  2L4H A;  1SCV A;  3DVJ A;  1XVJ A;  1A75 B;  2K7C A;  3D10 A;  4MSP A;  4C0L A;  1CTR A;  3HCM A;  4PCW A;  1BLQ A;  2AMI A;  2P6B B;  2MAZ A;  1A03 A;  3BQ3 A;  3DVM A;  2Y4Q A;  1W7I B;  2F2O A;  4YI8 A;  4YGB B;  4USL A;  3OX5 A;  4CFR A;  5CSJ A;  5I2Q A;  1Y1U A;  1UHI A;  1GJY A;  2KBM A;  1PRW A;  1CLL A;  2QPT A;  3CZT X;  2WCE A;  1Q80 A;  1QIW A;  3IQO A;  1XYD A;  1A75 A;  1CFF A;  3I5H B;  1JFK A;  4I5L B;  4ORB B;  3TUY C;  4ORC B;  1XK4 A;  5I8N A;  1CDP A;  3BUM B;  3FWB A;  1UHH A;  1QLS A;  1XFW O;  5AER A;  5CSF A;  3TS5 C;  1N2D A;  1OZO A;  1SCM B;  1GGW A;  1F8H A;  4PE7 A;  1KK8 B;  2CBL A;  2NXQ A;  1M39 A;  3NXA A;  4GGF A;  1ALV A;  1R6P A;  1BG1 A;  5D7F A;  4NDD A;  4QJ5 B;  1L7Z A;  4JWQ A;  1DJX A;  1LA3 A;  5GQQ C;  3EK4 A;  1V1G A;  2FJU B;  2JQ6 A;  1DJG A;  1IG5 A;  2KSP A;  3O6B A;  4CFQ A;  2G2B A;  2LVK A;  1DGU A;  1DVI A;  2LHI A;  1SMG A;  1K94 A;  1MUX A;  1TIZ A;  1MHO A;  2DOQ A;  2F2P A;  3BYA A;  3CTN A;  3DVE A;  1EXR A;  3E3R A;  5K89 A;  2PMY A;  2M9G A;  5KU1 A;  2KBI A;  4JPZ B;  3PN7 B;  4AQJ A;  2ZFD A;  5CSI A;  1BU3 A;  1SL7 A;  4OR9 B;  4MRY A;  1OZS A;  3CWG A;  1WLM A;  4E68 A;  1OMV A;  2WOS A;  4ORA B;  1B4C A;  2LHL A;  1PK0 D;  1SR6 C;  1NYA A;  1RRO A;  3TDI A;  3DVK A;  1SK6 D;  5JJG A;  5HKW A;  4M2Q A;  2KGB C;  4OVN F;  4N5X A;  3SIB A;  1WDC C;  1CM1 A;  2LLT A;  2ZND A;  4DCK A;  2MHH A;  3FS7 A;  1OMR A;  4YRU A;  1CFP A;  2SCP A;  4BY5 A;  4BY4 A;  3NSI A;  1LVC D;  5HLV A;  1J7R A;  2G9B A;  1KK7 Z;  3GK2 A;  5HKY A;  1CMF A;  2KYC A;  1RJV A;  1J1D A;  3VRN A;  1DMO A;  1CFC A;  2M49 B;  2D8N A;  3OHM B;  2KI4 B;  2ZKM X;  4M2O A;  4TNC A;  4C0J A;  1KK7 Y;  3KEV A;  4UPG A;  4YGD B;  2KQ6 A;  1XFU O;  2NLN A;  1F71 A;  3EVR A;  1J7P A;  1JUO A;  3IF7 A;  5TNC A;  2BCB A;  2LMU A;  2M7L A;  2MRD A;  1J7Q A;  2A4J A;  1RTP 1;  2O5G A;  3I5F B;  3EK7 A;  3KHE A;  3WHT B;  1UHN A;  2EHB A;  3CR5 X;  3JTD C;  1DJZ A;  1CKK A;  4M2P A;  1Y6W A;  1EL4 A;  4ZCV A;  1QXP A;  2H61 A;  4PDZ A;  3LCP C;  5AEQ A;  1YVH A;  1RWY A;  1CLB A;  1JBA A;  3IQQ A;  4OCI A;  3CR2 A;  1IQ5 A;  1QJT A;  3OB1 B;  1ALW A;  4GAO A;  3QRX A;  4AQI A;  3EVU A;  4A4C A;  1PUL A;  3ZWH A;  3CGA A;  1ZAC A;  2LLS A;  3DD4 A;  2F3Z A;  2KHN A;  4HRG A;  2Y1M A;  2Y1N A;  3A8R A;  1ZUZ A;  2K61 A;  4YBH B;  2LCP A;  2PRU A;  4YGA A;  1HT9 A;  1HQV A;  2Q4U A;  3I5G B;  5JOL A;  3AAJ A;  3SG2 A;  1BJF A;  3TDZ A;  1TCO B;  1N0Y A;  1H8B A;  2ZNE A;  1JWD A;  2QAC A;  4PE1 A;  2Y5I A;  2KAY A;  1YRT B;  5DKN A;  1KQM C;  1QTX A;  1R2U A;  2KFH A;  2KI6 C;  4PHN A;  2BCA A;  2I18 A;  2IS9 A;  2BCX A;  1BT6 A;  2VRG A;  2LAN A;  4R1E A;  1EG4 A;  4DIR A;  2LC5 A;  1L2O B;  2KFG A;  1OE9 B;  1TRF A;  2SAS A;  4F0Z B;  3SG4 A;  2FCD A;  1M46 A;  2PSR A;  1IQ3 A;  1YR5 A;  1ODB A;  1YX8 A;  3TZ1 A;  4D1E A;  1WRZ A;  2LV7 A;  5AAN A;  1DGV A;  2JXC A;  2V53 A;  2O60 A;  4N1G A;  3TUY B;  1D1O A;  2BKI B;  1NCX A;  1YX7 A;  1K8U A;  4DS7 A;  1A2X A;  3TS5 B;  3WHU B;  3JVT B;  5HYD A;  4XYN A;  1FW4 A;  1ZFS A;  2RGI A;  3SG3 A;  1JFJ A;  2MA2 A;  1KFU L;  1PSR A;  4ETO A;  1S1E A;  1F4O A;  1X02 A;  4GNK B;  1IJ5 A;  1K95 A;  5CPV A;  4CID A;  4AOM A;  3NSL A;  1C7V A;  3ZNI A;  2BE4 A;  5KSZ A;  1IH0 A;  1NX2 A;  5D69 A;  3H4S E;  1NWD A;  3OX6 A;  3BUO B;  2LP3 A;  3EKJ A;  3FIA A;  1BF5 A;  1IKU A;  2JZI A;  1DTL A;  1Y1A A;  1Y1X A;  2WOR A;  3DF0 A;  4I5K A;  4P5O E;  4P2Y B;  1Y0V H;  2LNK A;  1F4Q A;  1J1E A;  5ER5 A;  2EGD A;  2FCE A;  4NQG A;  1QX2 A;  4DRW A;  2ZRS A;  1QX7 A;  1MXE A;  2LVI A;  2AAO A;  4FTG A;  2K2A A;  1K9U A;  1SCM C;  1IRJ A;  3LLE A;  3PAT A;  1SR6 B;  1SYM A;  1QIV A;  1NX3 A;  4MVF A;  4PHK A;  1TNQ A;  1CNP A;  1LXF C;  2OPO A;  1S5G Z;  2FOT A;  2BE6 A;  1G8I A;  3RM1 A;  4HRH A;  1N65 A;  2JNX A;  1KCY A;  3VRQ A;  4YI9 A;  1JSA A;  1DJW A;  3F45 A;  2WC8 A;  2KAV A;  2JC2 A;  2NCP A;  1S5G Y;  1G33 A;  1OSA A;  3NSK A;  5FYX A;  2TN4 A;  1TNW A;  1XA5 A;  2JWW A;  5AFP A;  2JTZ A;  2KDH A;  1S6C A;  1SRA A;  2K8M B;  1TN4 A;  2OTG C;  4JQ0 D;  1PAL A;  4GFT A;  1JC2 A;  2OS8 B;  2LVV A;  2NZ0 A;  1MXL C;  3M0W A;  1UP5 A;  2H2K A;  1TOP A;  1S6J A;  1B8C A;  2LUX A;  1UWO A;  1KSO A;  1NPQ A;  2ZN8 A;  1K9K A;  2KNE A;  2PAS A;  1FBV A;  1TNP A;  1NX0 A;  1TTX A;  3SG6 A;  3WXA A;  3BOW B;  1XFX O;  1UUS A;  2I2R E;  2WCF A;  3TDU A;  3O4Y A;  1NCY A;  4QJ4 B;  1KWO C;  1M31 A;  1REC A;  1U5I B;  2JT0 A;  1A4P A;  1LA0 A;  1BR4 B;  4A4B A;  2L2E A;  4N1F A;  1TNX A;  1K96 A;  2ISD A;  2K7D A;  1LIN A;  2KQY A;  2B1U A;  2BBM A;  2LP2 A;  5I2O A;  1KFX S;  1YTZ C;  1MQ1 A;  2BL0 C;  3PAL A;  1C7W A;  1IJ6 A;  4YGE B;  3BOW A;  2GGZ A;  1JF0 A;  4GPL B;  2JTT A;  1WRK A;  4MRX A;  1CLM A;  2HPS A;  4ICB A;  5AXI A;  1JF2 A;  1V1F A;  2I94 A;  2EC6 C;  1CM4 A;  3KO0 A;  3MSE B;  1QV0 A;  1U5I A;  5ER4 X;  3O78 A;  3LK1 A;  3PM8 A;  5PAL A;  1A29 A;  2CCM A;  3BXK A;  4WRI A;  4WQ3 A;  3I5I B;  3GK4 X;  1BMO A;  3O2P A;  1QV1 A;  1S3P A;  4U8D A;  1AP4 A;  2MLF C;  1DF0 B;  4WQ2 A;  2F33 A;  2HF5 A;  1AK8 A;  1PVA A;  1SW8 A;  2KYF A;  2AUC A;  1YRU B;  2JNF A;  3SJS A;  1SL8 A;  2L98 A;  1NP8 A;  1NUB A;  2M29 A;  2ZN9 A;  3SG5 A;  1UHJ A;  1UHK A;  2LLU A;  1F54 A;  2LMV A;  2Q91 A;  2E30 A;  1PVB A;  2LAP A;  1B9A A;  2ZRT A;  1DF0 A;  1PSB A;  4MBE A;  1SNL A;  2L4I A;  1QLK A;  4GGN A;  2MJW B;  5J3X A;  1S26 D;  1B7T Z;  4GBA A;  1QAS A;  1CMG A;  2KGR A;  5B8I B;  4MZJ A;  3CLN A;  2I7A A;  4I5N B;  1BOC A;  1H4B A;  1B7T Y;  1QAT A;  1CDM A;  1S36 A;  2CXJ A;  2L0P A;  4NDB A;  1DJH A;  2GV5 A;  3KF9 A;  1C07 A;  1KFU S;  1WY9 A;  1VRK A;  2E6W A;  3DF0 B;  2BEC A;  1L2O C;  1NX1 A;  2WCB A;  1K90 D;  1FI5 A;  1XK4 C;  3EKH A;  1M45 A;  1S6I A;  3EVV A;  2LMT A;  5G08 A;  3ICB A;  4YGC B;  1B8L A;  3AAK A;  1KQV A;  2LUC A;  2PVB A;  1RK9 A;  3SG7 A;  4C0K A;  3VRR A;  3WNX B;  3VGO A;  4MZK A;  4GGF C;  2CT9 A;  2WND A;  1EJ3 A;  3GK1 A;  3I5H C;  3D0Y B;  1B8R A;  4PHJ A;  3JVT C;  2LE9 B;  2M3W A;  1XFV O;  4I5J A;  1YUU A;  1CDL A;  2K7O A;  1K93 D;  1KK8 C;  1W7J B;  2KI6 D;  3LK0 A;  1MF8 B;  1SKT A;  2COL B;  3RLZ A;  1FPW A;  1K9P A;  4XJK B;  1OMD A;  2GGM A;  1WDC B;  1GQM A;  1MWN A;  1QS7 A;  1XO5 A;  1TCF A;  2KOT A;  1OQP A;  1RFJ A;  3D0Y A;  1DT7 B;  1FI6 A;  5BPJ A;  2OTG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...