4M2QA

Crystal structure of non-myristoylated recoverin with cysteine-39 oxidized to sulfenic acid
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
188
structure length
187
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKEPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title A Highly Conserved Cysteine of Neuronal Calcium-sensing Proteins Controls Cooperative Binding of Ca2+ to Recoverin.
pubmed doi rcsb
source organism Bos taurus
total genus 78
structure length 187
sequence length 188
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4m2qA01
2BECA 3ICBA 2CTNA 1IRJA 2BL0B 1MQ1A 2M7NA 1TTXA 2LHIA 2NZ0A 3I5GC 5DKNA 3BUMB 4C0KA 1ALVA 2BE4A 2K61A 3O4YA 1DJYA 1NSHA 1AHRA 3QRXA 1FF1A 1SY9A 1KK7Z 2ZFDA 3CGAA 1BF5A 1LXFC 1XFZO 2JT8A 3CTNA 2CT9A 1TNXA 4PDZA 1MHOA 1CTRA 4YGCB 2AAOA 2JZIA 4PE7A 1K95A 4UPGA 1J7QA 1YVLA 1FI5A 1S6CA 2K7OA 2M97A 5I2OA 3DVEA 2E6WA 3TS5B 5B8IB 2LLUA 1F4OA 3SG4A 4MLWA 4CIDA 1LVCD 2JPTA 4JWQA 3A4UB 1CM1A 3A8RA 2Y1MA 1KK8B 1RECA 3JVTB 4Q04A 2HETA 3OB2B 2FJUB 2LP2A 4AQJA 2FOTA 1DF0B 5HKWA 1G4YR 2SCPA 3PN7B 5AFPA 2JTTA 3TUYB 1MXEA 1PRWA 1BG1A 1RK9A 1R2UA 2MA2A 2MLFC 2LVVA 3DD4A 1NWDA 2M9GA 2BBMA 2K2FA 3SG3A 1UP5A 2BCBA 2M3WA 1IQ3A 1F55A 1F8HA 1TN4A 1N2DA 1XFXO 2WORA 4GBAA 1ALWA 3M0WA 2JXLA 2M7LA 1NCZA 1JC2A 1TNWA 1A75B 1K93D 2M1KB 3I5IB 1CKKA 1A2XA 1SK6D 2OTGB 2ZN9A 1RTP1 5AXIA 4YRUA 2NLNA 2KAXA 4NDDA 1SMGA 4YI9A 2CNPA 2FCDA 4P2YB 2BKIB 1A4PA 1QX7A 2VRGA 3AAJA 3SG6A 1CMGA 3KHEA 4PHNA 2ZRSA 4M2OA 1CFCA 3I5HB 2KFGA 4OCIA 4ORAB 2QACA 1HQVA 2ZNDA 1GJYA 1B8CA 4NQGA 2F33A 4HRHA 1SKTA 2K8MB 2Q91A 1AUIB 2BCAA 1JF0A 1EL4A 1UHKA 5CSJA 4C0JA 5DKQA 1EG4A 1OMDA 2F8PA 2LANA 4ORBB 1TRFA 2KOTA 5HLOA 1XFVO 1NCYA 4U8DA 4C0LA 2EC6B 1KFUL 1KK7Y 1NX0A 1YX7A 4N1GA 4YI8A 3GK2A 3O6BA 1JFKA 2JT3A 2MHHA 3VRPA 2AMIA 1PALA 4DIRA 2K2AA 2ZRTA 4MRYA 5HKYA 2M8UA 2JC2A 3EKJA 1SCMB 2L5XB 2ZNEA 2JNXA 3EVVA 1J55A 3CR4X 4GPLB 5AANA 5IBWA 3CZTX 4WRIA 4XJKB 1AJ5A 3EK8A 3CR2A 3SJSA 2JU0A 1TNQA 1Y6WA 4PE4A 1RWYA 3IQOA 1SNLA 1X02A 1YVHA 3VRRA 1EJ3A 1LKJA 3I5FB 1FBVA 2KI6C 4MVFA 1IJ6A 2CBLA 3WHTB 3FWBA 2KFHA 2PRUA 1WRLA 1DF0A 3JTDB 3O2PA 4BY4A 5JJGA 4DS7A 1B7TY 1BOCA 1CMFA 2Y5IA 3SIBA 1H4BA 3PM8A 3H4SE 1QV1A 1CNPA 1RFJA 1GGWA 1QX5B 3EVUA 1V1GA 1JWDA 3PFVA 1SCVA 3D0YB 2HPSA 1KWOC 1K2HA 5BPJA 1G8IA 1W7JB 1OMRA 5I2LA 1OSAA 4I5LB 1BU3A 3GK4X 3RM1A 1DGUA 1A75A 1K90D 2WCEA 2KGBC 3OB1B 3D10A 1S6IA 3ZWHA 1RJVA 1SL8A 4GNKB 1NYAA 1OZOA 1SW8A 2JT0A 3KPXA 2HF5A 2O60A 1M63B 2LUCA 1J1DA 3LLEA 1K9UA 1Y1AA 4OKHA 4CPVA 1YX8A 3BUOB 3F45A 3IF7A 1QLSA 2KYFA 3WXAA 1KCYA 1XVJA 1LA3A 1NX1A 1Y0VH 1U5IB 2Q4UA 1UHIA 3SIAA 3MSEB 3TDZA 1AP4A 4F0ZB 1BODA 2JWWA 4OV2A 4DCKA 4HSZA 4CLNA 1BLQA 1OMVA 2KBMA 3DVJA 2F2OA 2L4HA 1DJHA 3VRQA 2ZKMX 5AERA 1XFWO 1B7TZ 1QV0A 1F54A 1C7VA 2NXQA 4E68A 1SRAA 1WDCC 1MWNA 1CLLA 2E30A 1A29A 3OP0A 1IH0A 4P5OE 2L2EA 4ZCVA 1SL9A 1IG5A 2GGMA 1J1EA 4CFRA 1FW4A 4YGAA 2BL0C 2KI4B 2DOQA 1N0YA 1ZACA 1UHNA 1BMOA 4NDCA 1IWQA 1KSMA 2KQYA 1EH2A 1WY9A 4PALA 3IQQA 3FIAA 2BE6A 1QX2A 2LM5A 2MRDA 3K21A 2M0RA 4JPZB 5GQQC 4XJKA 3FS7A 3NSOA 4N1FA 1GQMA 1QTXA 1DTLA 1H8BA 1MUXA 2Y1NA 1AVSA 1PULA 1CFFA 4ETOA 2LE9B 1QXPA 2KGRA 2R2IA 2LP3A 2G9BA 1QIVA 1L2OC 2H2KA 1M46A 1KSOA 3TS5C 5K89A 5JOLA 1W7IB 4MZLA 1ZUZA 2KDHA 4PHKA 1Y1XA 5ER5A 2P6BB 1TOPA 1BT6A 1XK4A 2Y4QA 4PE0A 4YGDB 2L50A 3EKHA 4MZKA 1KK8C 2KNEA 4ORCB 2WCBA 5D69A 4DRWA 3OX5A 3LK0A 1S1EA 2LMUA 3D0YA 1B47A 1DGVA 3CS1A 3PN7C 4HREE 2LMTA 1B4CA 2KYCA 1DJWA 1VRKA 3TUYC 3DVKA 2B1UA 1DJXA 1CDNA 2KBIA 1CB1A 2GV5A 4BY5A 2OS8B 3BQ3A 1K96A 1YUSA 1ZFSA 2PALA 2PMYA 1KQMB 4CFQA 1BR4B 2F2PA 2LNKA 1LA0A 4WQ2A 5D7FA 4A4CA 5HLVA 1DMOA 1IJ5A 4USLA 2RGIA 1S5GZ 4M2PA 3I5GB 3PSRA 2H61A 3GK1A 4R1EA 1M31A 3I5IC 2CCMA 4D1EA 1CFPA 1SR6C 3NXAA 2HQ8A 2OTGC 5CSNA 1YUUA 3ZNIA 2I7AA 2V53A 1B1GA 2WCFA 3WNXB 1IQ5A 1N65A 3EK7A 2JOJA 2M29A 4ICBA 2EHBA 4XYNA 1U5IA 3DF0B 1A03A 5HYDA 1UURA 1R6PA 2LVIA 2JNFA 1QVIY 3I5HC 3NSKA 1KFXS 2K7DA 1S3PA 2KAVA 2O5GA 5TNCA 1NX3A 2A4JA 2KSPA 4IL1A 2GGZA 1CDLA 1BR1B 2FCEA 3PATA 5I2QA 2WOSA 2LVJA 2LC5A 3LL8B 4WQ3A 3SG5A 3BOWB 1PVAA 4M2QA 3KEVA 1D1OA 1S36A 3AAKA 1TCOB 5J3XA 5DKRA 1WLMA 2F3YA 1CLMA 1OQPA 4YBHB 2G2BA 1NP8A 1WDCB 2I2RE 3TDUA 1CM4A 1NUBA 1NX2A 1YTZC 2LLTA 5ER4X 4QJ3B 1NCXA 1YRUB 4YGBB 2JXCA 1J7PA 1NIWA 2JRFA 2KI6D 1SCMC 2MJWB 4I5KA 1AK8A 4AQIA 2JQ6A 4MZJA 2LHLA 3GOFA 1WRKA 3O78A 4GGFA 3PLFB 1S26D 4MBEA 1FI6A 1IGVA 4PHJA 1KQVA 2M49B 1Q80A 2NCOA 3AKBA 2L4IA 2KFFA 1CDPA 1QIWA 2ZN8A 1EG3A 4TNCA 5HKZA 1PK0D 2BKHB 3I5FC 1QVIZ 1JSAA 4MRXA 4DUQA 1DJIA 3JTDC 1M39A 2LAPA 1L2OB 1QS7A 3OX6A 1JUOA 4N5XA 5KSZA 4GUKA 5F6TA 1UHHA 1XK4C 4I5NB 1BJFA 2M1UA 4ZCUA 4GGNA 1L7ZA 3WHUB 4I5JA 1EXRA 3OHMB 2K7CA 1K8UA 2IS9A 2TN4A 1MF8B 1SBJA 1YUTA 1NPQA 1QASA 1S5GY 3VGOA 4QJ5B 1GGZA 2L51A 5PALA 2EGDA 4OR9B 4GFTA 4NDBA 3LK1A 1WRZA 1K9KA 5AEQA 4AOMA 1WLZA 3BYAA 2JULA 1TNPA 2LCPA 1QLKA 3VRNA 1PSRA 3PALA 3DF0A 2H61C 3VROA 1DT7B 3HX4A 3HCMA 4MEWA 3BUWB 2COLB 2MLEC 1MR8A 1DVIA 1SR6B 3BXKA 3RLZA 1XFUO 2KAYA 3JVTC 2PVBA 3TDIA 1J7OA 2MAZA 5CSIA 2QPTA 5KU1A 3BUXB 2HQWA 3BOWA 4PE1A 4HRGA 1PVBA 2LLSA 4QJ4B 1DJGA 1CLBA 1OE9B 3C1VA 1E8AA 2OPOA 2KQ6A 1M45A 3CLNA 1Y1UA 1KFUS 4A4BA 2LV7A 4PHMA 1PSBA 1KWOB 3EVRA 2WNDA 3KF9A 2BCXA 2KI4C 1YR5A 2PASA 4OVNF 2BBNA 1SPYA 1YURA 4MN0A 1DJZA 2K7BA 1SL7A 2SASA 3KO0A 1F71A 1CFDA 2AUCA 3FWCA 1K9PA 3CR5X 1UUSA 1QJTA 1HT9A 3SG7A 3NSLA 1UHJA 2L98A 1FPWA 4YGEB 3DVMA 1CDMA 1YRTB 2NCPA 4PCWA 2LVKA 2L0PA 4MSPA 3BUNB 5FYXA 5KTYA 1XO5A 2LUXA 4GGFC 1XYDA 1MXLC 3CWGA 1OOJA 1ZOTB 2F3ZA 2I94A 4FTGA 1B8LA 2MBXA 1JBAA 1V1FA 2K0JA 1RROA 4FQOA 5CSFA 1QATA 1OZSA 4GAOA 4L9MA 1LINA 1TCFA 1AJ4A 1F70A 5CPVA 5I8NA 1ZMZA 3SG2A 1TIZA 1IKUA 1F4QA 1K94A 3TZ1A 1JF2A 1C07A 1KFXL 1XA5A 1C7WA 1J7RA 2CXJA 2PSRA 2I18A 1UWOA 3EK4A 5G08A 1JFJA 2EC6C 3E3RA 2D8NA 3AKAA 2OS8C 1B8RA 3NSIA 1S6JA 2WC8A 1XFYO 1ODBA 1KQMC 1SYMA 2KHNA 2LMVA 2ISDA 4JQ0D 2JTZA 1B9AA 1G33A 3LCPC
chains in the Genus database with same CATH superfamily
2BECA 3ICBA 2CTNA 1IRJA 2QEHA 2BL0B 1MQ1A 2M7NA 5I94A 1TTXA 2LHIA 2NZ0A 3I5GC 5DKNA 3BUMB 4C0KA 1ALVA 2BE4A 2K61A 3O4YA 1DJYA 1NSHA 1AHRA 3CZ0A 3QRXA 2WCHA 1FF1A 1SY9A 1KK7Z 2ZFDA 3CGAA 1BF5A 1LXFC 1XFZO 2JT8A 3CTNA 2CT9A 1TNXA 4PDZA 1MHOA 1CTRA 4YGCB 3BFAA 2AAOA 2JZIA 4PE7A 1K95A 4UPGA 1J7QA 1YVLA 1FI5A 1S6CA 2K7OA 2M97A 5I2OA 3DVEA 3V2LA 2E6WA 3TS5B 5B8IB 2LLUA 1F4OA 3SG4A 4MLWA 4CIDA 3R72A 3D77A 1LVCD 2JPTA 4JWQA 3A4UB 1CM1A 1P28A 3A8RA 2Y1MA 1KK8B 1RECA 3JVTB 4Q04A 2HETA 1TUZA 3B88A 2FJUB 2LP2A 3OB2B 4AQJA 2FOTA 1DF0B 5HKWA 1G4YR 2SCPA 3PN7B 3SS4A 5AFPA 2JTTA 3TUYB 1MXEA 1PRWA 1BG1A 1RK9A 1R2UA 2MA2A 2MLFC 2LVVA 3DD4A 4IJ7A 1NWDA 2M9GA 2BBMA 2K2FA 3SG3A 1W9ZA 2K60A 1UP5A 2BCBA 2GTEA 2M3WA 1IQ3A 1F55A 1F8HA 1TN4A 1N2DA 1XFXO 3BFBA 2WORA 4GBAA 1ALWA 3M0WA 2JXLA 2M7LA 1NCZA 3R1OA 1JC2A 1TNWA 3DXLA 1A75B 1K93D 2M1KB 3I5IB 1CKKA 3D74A 2FJYA 1A2XA 1SK6D 2OTGB 2ZN9A 1RTP1 5AXIA 4YRUA 2NLNA 2KAXA 4NDDA 1SMGA 4YI9A 2CNPA 2FCDA 4P2YB 3K1EA 2BKIB 1A4PA 1QX7A 2VRGA 3AAJA 3SG6A 4OZDA 3KHEA 4PHNA 5KSZA 1CMGA 2ZRSA 4M2OA 1CFCA 3I5HB 2KFGA 4OCIA 4ORAB 2QACA 1HQVA 2ZNDA 1GJYA 1B8CA 4NQGA 2F33A 4HRHA 1SKTA 2K8MB 2Q91A 1AUIB 2BCAA 1JF0A 1EL4A 1UHKA 5CSJA 4C0JA 5DKQA 1EG4A 1OMDA 2F8PA 2LANA 4ORBB 1TRFA 1OOHA 3RZSA 2KOTA 5HLOA 1XFVO 1NCYA 3CABA 4U8DA 4C0LA 2EC6B 3S0EA 1KFUL 1KK7Y 1NX0A 1YX7A 3L47A 4N1GA 4YI8A 3GK2A 3O6BA 1JFKA 2JT3A 2MHHA 2JPOA 2AMIA 1PALA 3VRPA 2K2AA 2ZRTA 4MRYA 4DIRA 5HKYA 2M8UA 3S0DA 2JC2A 3EKJA 1SCMB 2L5XB 2ZNEA 2PQLA 2JNXA 3EVVA 1J55A 3CR4X 4GPLB 4JD9A 5FI2A 5AANA 5IBWA 3CZTX 4WRIA 4XJKB 1AJ5A 3EK8A 3CR2A 3SJSA 2JU0A 3CDNA 1TNQA 1Y6WA 4PE4A 3S0FA 1RWYA 3IQOA 1SNLA 1X02A 1YVHA 3VRRA 1EJ3A 1LKJA 3I5FB 1FBVA 3N7HA 2KI6C 4MVFA 1IJ6A 2CBLA 3WHTB 3FWBA 2KFHA 2PRUA 3CZ2A 1WRLA 1DF0A 3JTDB 3O2PA 4BY4A 5JJGA 4DS7A 1B7TY 1BOCA 1CMFA 4INXA 2Y5IA 3SIBA 1H4BA 3S0BA 3PM8A 3H4SE 1QV1A 1CNPA 1RFJA 1GGWA 1QX5B 3R1VA 3EVUA 1V1GA 3NHIA 1JWDA 3PFVA 1SCVA 3D0YB 2HPSA 1KWOC 1K2HA 5BPJA 1G8IA 3NHTA 3QMEA 1W7JB 1OMRA 3DYEA 1OSAA 4I5LB 1BU3A 3GK4X 5I2LA 3RM1A 1DGUA 1A75A 1K90D 2WCEA 2KGBC 3OB1B 3D10A 1OOGA 1S6IA 3B6XA 3ZWHA 1RJVA 1SL8A 3NGVA 4GNKB 1NYAA 1OZOA 1SW8A 2JT0A 2P71A 3KPXA 3CZ1A 2HF5A 2O60A 1M63B 2LUCA 1J1DA 3LLEA 1K9UA 1TWOA 1Y1AA 4OKHA 4CPVA 1YX8A 3BUOB 3F45A 3IF7A 1QLSA 2KYFA 3WXAA 1KCYA 1XVJA 1LA3A 3PJIA 1NX1A 1Y0VH 1U5IB 2Q4UA 1ORGA 1UHIA 3MSEB 3SIAA 3TDZA 1AP4A 4F0ZB 1BODA 2JWWA 3S0GA 4OV2A 3B86A 4HSZA 5EL2A 4CLNA 4DCKA 1BLQA 1OMVA 2ERBA 2KBMA 3DVJA 2F2OA 2L4HA 1DJHA 2KLDA 2WC5A 3VRQA 2ZKMX 5AERA 1XFWO 1B7TZ 1QV0A 1F54A 3TDUA 1C7VA 2NXQA 4E68A 2QEBA 1SRAA 1WDCC 1MWNA 1CLLA 3B87A 2E30A 1A29A 1OOIX 3OP0A 1IH0A 4P5OE 2L2EA 4ZCVA 2WCLA 3SS5A 1SL9A 1IG5A 2GGMA 1J1EA 4CFRA 1FW4A 1Z4HA 1XFRA 4YGAA 2BL0C 2WCJA 2KI4B 2DOQA 1N0YA 1ZACA 1UHNA 1BMOA 4NDCA 1IWQA 1KSMA 2KQYA 1EH2A 1WY9A 4PALA 3IQQA 3FIAA 2BE6A 1QX2A 2LM5A 2MRDA 3K21A 2M0RA 4JPZB 5GQQC 4XJKA 3FS7A 3NSOA 4N1FA 1GQMA 1QTXA 1DTLA 3UNWA 1H8BA 2L2CA 1MUXA 2Y1NA 1AVSA 1PULA 3BJHA 1CFFA 4ETOA 2LE9B 1QXPA 2KGRA 2R2IA 2LP3A 2G9BA 1QIVA 1L2OC 2H2KA 5D3OA 1M46A 1KSOA 3TS5C 5K89A 5JOLA 1W7IB 4MZLA 1ZUZA 2KDHA 4PHKA 1Y1XA 5ER5A 2P6BB 1TOPA 1BT6A 1XK4A 2Y4QA 4PE0A 4YGDB 2L50A 3EKHA 4MZKA 1KK8C 2KNEA 4ORCB 2PYQA 1OW4A 2WCBA 5D69A 4DRWA 3OX5A 3D78A 3LK0A 1S1EA 3DZTA 2LMUA 3D0YA 1B47A 1DGVA 3CS1A 3PN7C 4HREE 2LMTA 1B4CA 2KYCA 1DJWA 1VRKA 3TUYC 3DVKA 2B1UA 1DJXA 1CDNA 2KBIA 3O4XA 2GV5A 4BY5A 3D73A 1CB1A 2OS8B 3BQ3A 1K96A 1YUSA 1ZFSA 2PALA 2PMYA 1KQMB 4CFQA 1BR4B 2F2PA 2LNKA 1LA0A 4WQ2A 2KLEA 5D7FA 4A4CA 5HLVA 1DMOA 1IJ5A 4USLA 2RGIA 1S5GZ 4M2PA 3I5GB 3PSRA 2H61A 3GK1A 3S0AA 3FE6A 4R1EA 1C3YA 1M31A 3I5IC 2CCMA 4D1EA 1CFPA 1SR6C 3NXAA 2HQ8A 2OTGC 3R1PA 5CSNA 1YUUA 3ZNIA 3UO9A 2I7AA 4INWA 2V53A 1B1GA 2WCFA 3WNXB 1IQ5A 2QEOA 1N65A 3EK7A 2JOJA 2M29A 3D76A 4ICBA 2EHBA 4XYNA 3IVTA 1U5IA 3DF0B 5HL1A 5HYDA 1A03A 1UURA 1R6PA 2LVIA 2JNFA 1QVIY 3I5HC 3NSKA 2YGUA 1KFXS 2K7DA 1DC1A 2QDIA 1S3PA 2KAVA 2O5GA 5TNCA 1NX3A 2A4JA 2KSPA 4IL1A 2GGZA 1CDLA 1BR1B 2FCEA 3PATA 5FI6A 5I2QA 2WOSA 2LVJA 2LC5A 3LL8B 4WQ3A 3SG5A 3BOWB 1PVAA 2WCMA 4M2QA 3KEVA 2L5YA 1D1OA 1S36A 3AAKA 4KYNA 1TCOB 3OGNA 5DKRA 5J3XA 1WLMA 2F3YA 1CLMA 1OQPA 4YBHB 2G2BA 1NP8A 1WDCB 2I2RE 2KPHA 1CM4A 1NUBA 1NX2A 1YTZC 2LLTA 3L4LA 5ER4X 4QJ3B 1NCXA 1YRUB 4YGBB 2JXCA 1J7PA 1NIWA 2JRFA 3FE9A 3SS3A 2KI6D 1SCMC 2MJWB 4I5KA 1AK8A 4AQIA 2JQ6A 4MZJA 2LHLA 3GOFA 1WRKA 3O78A 4GGFA 3OBVA 3PM2A 3PLFB 3B7AA 1S26D 4MBEA 1FI6A 2P70A 1IGVA 4PHJA 1KQVA 2M49B 1Q80A 2NCOA 3AKBA 4JKTA 2L4IA 4FQTA 2KFFA 1CDPA 1QIWA 2ZN8A 1EG3A 4TNCA 5HKZA 1PK0D 1TUJA 2BKHB 1QVIZ 1T14A 3I5FC 1JSAA 4MRXA 4DUQA 1DJIA 3JTDC 1M39A 2LAPA 1L2OB 1QS7A 3OX6A 1JUOA 3Q8IA 4N5XA 4GUKA 5F6TA 1UHHA 1XK4C 4I5NB 1BJFA 2M1UA 4ZCUA 4GGNA 1L7ZA 3WHUB 4I5JA 1EXRA 3OHMB 2K7CA 1K8UA 2IS9A 2TN4A 1MF8B 1SBJA 1YUTA 1NPQA 1QASA 1S5GY 2QEVA 3VGOA 4QJ5B 1GGZA 4PT1A 5DICA 2L51A 5PALA 2EGDA 4OR9B 4GFTA 4NDBA 3LK1A 1C3ZA 1WRZA 1K9KA 1GM0A 5AEQA 2H8VA 4AOMA 1WLZA 3BYAA 2JULA 1TNPA 2LCPA 1QLKA 3VRNA 1PSRA 3PALA 3DF0A 2WC6A 2H61C 3VROA 1DT7B 3HX4A 3EG5B 3HCMA 4MEWA 2BNXA 3BUWB 3D75A 2COLB 2MLEC 1MR8A 1DVIA 1SR6B 3BXKA 3RLZA 1XFUO 2KAYA 3L4AA 3JVTC 2PVBA 3TDIA 1J7OA 2MAZA 1SSEB 5CSIA 2QPTA 5KU1A 3BUXB 2HQWA 3BOWA 4PE1A 4HRGA 1OOFA 1PVBA 2LLSA 4QJ4B 1DJGA 1CLBA 1OE9B 3DY9A 3C1VA 1E8AA 2OPOA 2KQ6A 1M45A 3CLNA 3VB1A 1Y1UA 1DQEA 1KFUS 4A4BA 2LV7A 4PHMA 1PSBA 1QWVA 1KWOB 3EVRA 2WNDA 3KF9A 2BCXA 2KI4C 1YR5A 2PASA 4OVNF 2BBNA 1SPYA 1YURA 4MN0A 1DEKA 1DJZA 3FE8A 2K7BA 1SL7A 2SASA 3KO0A 1F71A 1CFDA 2AUCA 3FWCA 1K9PA 3CR5X 1UUSA 2WCKA 1QJTA 1HT9A 3SG7A 3NSLA 1UHJA 2L98A 1FPWA 4YGEB 3DVMA 1CDMA 1YRTB 2NCPA 4PCWA 2LVKA 2L0PA 4MSPA 3BUNB 5FYXA 5KTYA 1XO5A 2LUXA 4GGFC 1LS8A 1XYDA 1MXLC 3CWGA 1IIOA 1OOJA 1ZOTB 2F3ZA 2I94A 4FTGA 1B8LA 2MBXA 1JBAA 1V1FA 2K0JA 1RROA 4FQOA 5CSFA 1QATA 1OZSA 4GAOA 4L9MA 1LINA 1TCFA 1AJ4A 1F70A 3BFHA 5CPVA 5I8NA 1ZMZA 3SG2A 1TIZA 1IKUA 1F4QA 1K94A 3TZ1A 1DELA 1JF2A 1C07A 3CYZA 1KFXL 1XA5A 5FI7A 4F7FA 1C7WA 1J7RA 2CXJA 2PSRA 2I18A 1UWOA 1Z2CB 3EK4A 5G08A 2EC6C 1JFJA 3E3RA 2D8NA 3AKAA 2OS8C 1B8RA 3NSIA 1S6JA 2WC8A 1XFYO 1ODBA 1KQMC 1SYMA 2KHNA 2LMVA 2ISDA 2BAPA 4JQ0D 2JTZA 1B9AA 1G33A 3LCPC
chains in the Genus database with same CATH topology
2BECA 3ICBA 2CTNA 1IRJA 2BL0B 1MQ1A 2M7NA 1TTXA 2LHIA 2NZ0A 3I5GC 5DKNA 3BUMB 4C0KA 1ALVA 2BE4A 2K61A 3O4YA 1DJYA 1NSHA 1AHRA 3QRXA 1FF1A 1SY9A 1KK7Z 2ZFDA 3CGAA 1BF5A 1LXFC 1XFZO 2JT8A 3CTNA 2CT9A 1TNXA 4PDZA 1MHOA 1CTRA 4YGCB 2AAOA 2JZIA 4PE7A 1K95A 4UPGA 1J7QA 1YVLA 1FI5A 1S6CA 2K7OA 2M97A 5I2OA 3DVEA 2E6WA 3TS5B 5B8IB 2LLUA 1F4OA 3SG4A 4MLWA 4CIDA 1LVCD 2JPTA 4JWQA 3A4UB 1CM1A 3A8RA 2Y1MA 1KK8B 1RECA 3JVTB 4Q04A 2HETA 3OB2B 2FJUB 2LP2A 4AQJA 2FOTA 1DF0B 5HKWA 1G4YR 2SCPA 3PN7B 5AFPA 2JTTA 3TUYB 1MXEA 1PRWA 1BG1A 1RK9A 1R2UA 2MA2A 2MLFC 2LVVA 3DD4A 1NWDA 2M9GA 2BBMA 2K2FA 3SG3A 1UP5A 2BCBA 2M3WA 1IQ3A 1F55A 1F8HA 1TN4A 1N2DA 1XFXO 2WORA 4GBAA 1ALWA 3M0WA 2JXLA 2M7LA 1NCZA 1JC2A 1TNWA 1A75B 1K93D 2M1KB 3I5IB 1CKKA 1A2XA 1SK6D 2OTGB 2ZN9A 1RTP1 5AXIA 4YRUA 2NLNA 2KAXA 4NDDA 1SMGA 4YI9A 2CNPA 2FCDA 4P2YB 2BKIB 1A4PA 1QX7A 2VRGA 3AAJA 3SG6A 1CMGA 3KHEA 4PHNA 2ZRSA 4M2OA 1CFCA 3I5HB 2KFGA 4OCIA 4ORAB 2QACA 1HQVA 2ZNDA 1GJYA 1B8CA 4NQGA 2F33A 4HRHA 1SKTA 2K8MB 2Q91A 1AUIB 2BCAA 1JF0A 1EL4A 1UHKA 5CSJA 4C0JA 5DKQA 1EG4A 1OMDA 2F8PA 2LANA 4ORBB 1TRFA 2KOTA 5HLOA 1XFVO 1NCYA 4U8DA 4C0LA 2EC6B 1KFUL 1KK7Y 1NX0A 1YX7A 4N1GA 4YI8A 3GK2A 3O6BA 1JFKA 2JT3A 2MHHA 3VRPA 2AMIA 1PALA 4DIRA 2K2AA 2ZRTA 4MRYA 5HKYA 2M8UA 2JC2A 3EKJA 1SCMB 2L5XB 2ZNEA 2JNXA 3EVVA 1J55A 3CR4X 4GPLB 5AANA 5IBWA 3CZTX 4WRIA 4XJKB 1AJ5A 3EK8A 3CR2A 3SJSA 2JU0A 1TNQA 1Y6WA 4PE4A 1RWYA 3IQOA 1SNLA 1X02A 1YVHA 3VRRA 1EJ3A 1LKJA 3I5FB 1FBVA 2KI6C 4MVFA 1IJ6A 2CBLA 3WHTB 3FWBA 2KFHA 2PRUA 1WRLA 1DF0A 3JTDB 3O2PA 4BY4A 5JJGA 4DS7A 1B7TY 1BOCA 1CMFA 2Y5IA 3SIBA 1H4BA 3PM8A 3H4SE 1QV1A 1CNPA 1RFJA 1GGWA 1QX5B 3EVUA 1V1GA 1JWDA 3PFVA 1SCVA 3D0YB 2HPSA 1KWOC 1K2HA 5BPJA 1G8IA 1W7JB 1OMRA 5I2LA 1OSAA 4I5LB 1BU3A 3GK4X 3RM1A 1DGUA 1A75A 1K90D 2WCEA 2KGBC 3OB1B 3D10A 1S6IA 3ZWHA 1RJVA 1SL8A 4GNKB 1NYAA 1OZOA 1SW8A 2JT0A 3KPXA 2HF5A 2O60A 1M63B 2LUCA 1J1DA 3LLEA 1K9UA 1Y1AA 4OKHA 4CPVA 1YX8A 3BUOB 3F45A 3IF7A 1QLSA 2KYFA 3WXAA 1KCYA 1XVJA 1LA3A 1NX1A 1Y0VH 1U5IB 2Q4UA 1UHIA 3SIAA 3MSEB 3TDZA 1AP4A 4F0ZB 1BODA 2JWWA 4OV2A 4DCKA 4HSZA 4CLNA 1BLQA 1OMVA 2KBMA 3DVJA 2F2OA 2L4HA 1DJHA 3VRQA 2ZKMX 5AERA 1XFWO 1B7TZ 1QV0A 1F54A 1C7VA 2NXQA 4E68A 1SRAA 1WDCC 1MWNA 1CLLA 2E30A 1A29A 3OP0A 1IH0A 4P5OE 2L2EA 4ZCVA 1SL9A 1IG5A 2GGMA 1J1EA 4CFRA 1FW4A 4YGAA 2BL0C 2KI4B 2DOQA 1N0YA 1ZACA 1UHNA 1BMOA 4NDCA 1IWQA 1KSMA 2KQYA 1EH2A 1WY9A 4PALA 3IQQA 3FIAA 2BE6A 1QX2A 2LM5A 2MRDA 3K21A 2M0RA 4JPZB 5GQQC 4XJKA 3FS7A 3NSOA 4N1FA 1GQMA 1QTXA 1DTLA 1H8BA 1MUXA 2Y1NA 1AVSA 1PULA 1CFFA 4ETOA 2LE9B 1QXPA 2KGRA 2R2IA 2LP3A 2G9BA 1QIVA 1L2OC 2H2KA 1M46A 1KSOA 3TS5C 5K89A 5JOLA 1W7IB 4MZLA 1ZUZA 2KDHA 4PHKA 1Y1XA 5ER5A 2P6BB 1TOPA 1BT6A 1XK4A 2Y4QA 4PE0A 4YGDB 2L50A 3EKHA 4MZKA 1KK8C 2KNEA 4ORCB 2WCBA 5D69A 4DRWA 3OX5A 3LK0A 1S1EA 2LMUA 3D0YA 1B47A 1DGVA 3CS1A 3PN7C 4HREE 2LMTA 1B4CA 2KYCA 1DJWA 1VRKA 3TUYC 3DVKA 2B1UA 1DJXA 1CDNA 2KBIA 1CB1A 2GV5A 4BY5A 2OS8B 3BQ3A 1K96A 1YUSA 1ZFSA 2PALA 2PMYA 1KQMB 4CFQA 1BR4B 2F2PA 2LNKA 1LA0A 4WQ2A 5D7FA 4A4CA 5HLVA 1DMOA 1IJ5A 4USLA 2RGIA 1S5GZ 4M2PA 3I5GB 3PSRA 2H61A 3GK1A 4R1EA 1M31A 3I5IC 2CCMA 4D1EA 1CFPA 1SR6C 3NXAA 2HQ8A 2OTGC 5CSNA 1YUUA 3ZNIA 2I7AA 2V53A 1B1GA 2WCFA 3WNXB 1IQ5A 1N65A 3EK7A 2JOJA 2M29A 4ICBA 2EHBA 4XYNA 1U5IA 3DF0B 1A03A 5HYDA 1UURA 1R6PA 2LVIA 2JNFA 1QVIY 3I5HC 3NSKA 1KFXS 2K7DA 1S3PA 2KAVA 2O5GA 5TNCA 1NX3A 2A4JA 2KSPA 4IL1A 2GGZA 1CDLA 1BR1B 2FCEA 3PATA 5I2QA 2WOSA 2LVJA 2LC5A 3LL8B 4WQ3A 3SG5A 3BOWB 1PVAA 4M2QA 3KEVA 1D1OA 1S36A 3AAKA 1TCOB 5J3XA 5DKRA 1WLMA 2F3YA 1CLMA 1OQPA 4YBHB 2G2BA 1NP8A 1WDCB 2I2RE 3TDUA 1CM4A 1NUBA 1NX2A 1YTZC 2LLTA 5ER4X 4QJ3B 1NCXA 1YRUB 4YGBB 2JXCA 1J7PA 1NIWA 2JRFA 2KI6D 1SCMC 2MJWB 4I5KA 1AK8A 4AQIA 2JQ6A 4MZJA 2LHLA 3GOFA 1WRKA 3O78A 4GGFA 3PLFB 1S26D 4MBEA 1FI6A 1IGVA 4PHJA 1KQVA 2M49B 1Q80A 2NCOA 3AKBA 2L4IA 2KFFA 1CDPA 1QIWA 2ZN8A 1EG3A 4TNCA 5HKZA 1PK0D 2BKHB 3I5FC 1QVIZ 1JSAA 4MRXA 4DUQA 1DJIA 3JTDC 1M39A 2LAPA 1L2OB 1QS7A 3OX6A 1JUOA 4N5XA 5KSZA 4GUKA 5F6TA 1UHHA 1XK4C 4I5NB 1BJFA 2M1UA 4ZCUA 4GGNA 1L7ZA 3WHUB 4I5JA 1EXRA 3OHMB 2K7CA 1K8UA 2IS9A 2TN4A 1MF8B 1SBJA 1YUTA 1NPQA 1QASA 1S5GY 3VGOA 4QJ5B 1GGZA 2L51A 5PALA 2EGDA 4OR9B 4GFTA 4NDBA 3LK1A 1WRZA 1K9KA 5AEQA 4AOMA 1WLZA 3BYAA 2JULA 1TNPA 2LCPA 1QLKA 3VRNA 1PSRA 3PALA 3DF0A 2H61C 3VROA 1DT7B 3HX4A 3HCMA 4MEWA 3BUWB 2COLB 2MLEC 1MR8A 1DVIA 1SR6B 3BXKA 3RLZA 1XFUO 2KAYA 3JVTC 2PVBA 3TDIA 1J7OA 2MAZA 5CSIA 2QPTA 5KU1A 3BUXB 2HQWA 3BOWA 4PE1A 4HRGA 1PVBA 2LLSA 4QJ4B 1DJGA 1CLBA 1OE9B 3C1VA 1E8AA 2OPOA 2KQ6A 1M45A 3CLNA 1Y1UA 1KFUS 4A4BA 2LV7A 4PHMA 1PSBA 1KWOB 3EVRA 2WNDA 3KF9A 2BCXA 2KI4C 1YR5A 2PASA 4OVNF 2BBNA 1SPYA 1YURA 4MN0A 1DJZA 2K7BA 1SL7A 2SASA 3KO0A 1F71A 1CFDA 2AUCA 3FWCA 1K9PA 3CR5X 1UUSA 1QJTA 1HT9A 3SG7A 3NSLA 1UHJA 2L98A 1FPWA 4YGEB 3DVMA 1CDMA 1YRTB 2NCPA 4PCWA 2LVKA 2L0PA 4MSPA 3BUNB 5FYXA 5KTYA 1XO5A 2LUXA 4GGFC 1XYDA 1MXLC 3CWGA 1OOJA 1ZOTB 2F3ZA 2I94A 4FTGA 1B8LA 2MBXA 1JBAA 1V1FA 2K0JA 1RROA 4FQOA 5CSFA 1QATA 1OZSA 4GAOA 4L9MA 1LINA 1TCFA 1AJ4A 1F70A 5CPVA 5I8NA 1ZMZA 3SG2A 1TIZA 1IKUA 1F4QA 1K94A 3TZ1A 1JF2A 1C07A 1KFXL 1XA5A 1C7WA 1J7RA 2CXJA 2PSRA 2I18A 1UWOA 3EK4A 5G08A 1JFJA 2EC6C 3E3RA 2D8NA 3AKAA 2OS8C 1B8RA 3NSIA 1S6JA 2WC8A 1XFYO 1ODBA 1KQMC 1SYMA 2KHNA 2LMVA 2ISDA 4JQ0D 2JTZA 1B9AA 1G33A 3LCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEC A;  3ICB A;  2CTN A;  1IRJ A;  2BL0 B;  1MQ1 A;  2M7N A;  1TTX A;  2LHI A;  2NZ0 A;  3I5G C;  5DKN A;  3BUM B;  4C0K A;  1ALV A;  2BE4 A;  2K61 A;  3O4Y A;  1DJY A;  1NSH A;  1AHR A;  3QRX A;  1FF1 A;  1SY9 A;  1KK7 Z;  2ZFD A;  3CGA A;  1BF5 A;  1LXF C;  1XFZ O;  2JT8 A;  3CTN A;  2CT9 A;  1TNX A;  4PDZ A;  1MHO A;  1CTR A;  4YGC B;  2AAO A;  2JZI A;  4PE7 A;  1K95 A;  4UPG A;  1J7Q A;  1YVL A;  1FI5 A;  1S6C A;  2K7O A;  2M97 A;  5I2O A;  3DVE A;  2E6W A;  3TS5 B;  5B8I B;  2LLU A;  1F4O A;  3SG4 A;  4MLW A;  4CID A;  1LVC D;  2JPT A;  4JWQ A;  3A4U B;  1CM1 A;  3A8R A;  2Y1M A;  1KK8 B;  1REC A;  3JVT B;  4Q04 A;  2HET A;  3OB2 B;  2FJU B;  2LP2 A;  4AQJ A;  2FOT A;  1DF0 B;  5HKW A;  1G4Y R;  2SCP A;  3PN7 B;  5AFP A;  2JTT A;  3TUY B;  1MXE A;  1PRW A;  1BG1 A;  1RK9 A;  1R2U A;  2MA2 A;  2MLF C;  2LVV A;  3DD4 A;  1NWD A;  2M9G A;  2BBM A;  2K2F A;  3SG3 A;  1UP5 A;  2BCB A;  2M3W A;  1IQ3 A;  1F55 A;  1F8H A;  1TN4 A;  1N2D A;  1XFX O;  2WOR A;  4GBA A;  1ALW A;  3M0W A;  2JXL A;  2M7L A;  1NCZ A;  1JC2 A;  1TNW A;  1A75 B;  1K93 D;  2M1K B;  3I5I B;  1CKK A;  1A2X A;  1SK6 D;  2OTG B;  2ZN9 A;  1RTP 1;  5AXI A;  4YRU A;  2NLN A;  2KAX A;  4NDD A;  1SMG A;  4YI9 A;  2CNP A;  2FCD A;  4P2Y B;  2BKI B;  1A4P A;  1QX7 A;  2VRG A;  3AAJ A;  3SG6 A;  1CMG A;  3KHE A;  4PHN A;  2ZRS A;  4M2O A;  1CFC A;  3I5H B;  2KFG A;  4OCI A;  4ORA B;  2QAC A;  1HQV A;  2ZND A;  1GJY A;  1B8C A;  4NQG A;  2F33 A;  4HRH A;  1SKT A;  2K8M B;  2Q91 A;  1AUI B;  2BCA A;  1JF0 A;  1EL4 A;  1UHK A;  5CSJ A;  4C0J A;  5DKQ A;  1EG4 A;  1OMD A;  2F8P A;  2LAN A;  4ORB B;  1TRF A;  2KOT A;  5HLO A;  1XFV O;  1NCY A;  4U8D A;  4C0L A;  2EC6 B;  1KFU L;  1KK7 Y;  1NX0 A;  1YX7 A;  4N1G A;  4YI8 A;  3GK2 A;  3O6B A;  1JFK A;  2JT3 A;  2MHH A;  3VRP A;  2AMI A;  1PAL A;  4DIR A;  2K2A A;  2ZRT A;  4MRY A;  5HKY A;  2M8U A;  2JC2 A;  3EKJ A;  1SCM B;  2L5X B;  2ZNE A;  2JNX A;  3EVV A;  1J55 A;  3CR4 X;  4GPL B;  5AAN A;  5IBW A;  3CZT X;  4WRI A;  4XJK B;  1AJ5 A;  3EK8 A;  3CR2 A;  3SJS A;  2JU0 A;  1TNQ A;  1Y6W A;  4PE4 A;  1RWY A;  3IQO A;  1SNL A;  1X02 A;  1YVH A;  3VRR A;  1EJ3 A;  1LKJ A;  3I5F B;  1FBV A;  2KI6 C;  4MVF A;  1IJ6 A;  2CBL A;  3WHT B;  3FWB A;  2KFH A;  2PRU A;  1WRL A;  1DF0 A;  3JTD B;  3O2P A;  4BY4 A;  5JJG A;  4DS7 A;  1B7T Y;  1BOC A;  1CMF A;  2Y5I A;  3SIB A;  1H4B A;  3PM8 A;  3H4S E;  1QV1 A;  1CNP A;  1RFJ A;  1GGW A;  1QX5 B;  3EVU A;  1V1G A;  1JWD A;  3PFV A;  1SCV A;  3D0Y B;  2HPS A;  1KWO C;  1K2H A;  5BPJ A;  1G8I A;  1W7J B;  1OMR A;  5I2L A;  1OSA A;  4I5L B;  1BU3 A;  3GK4 X;  3RM1 A;  1DGU A;  1A75 A;  1K90 D;  2WCE A;  2KGB C;  3OB1 B;  3D10 A;  1S6I A;  3ZWH A;  1RJV A;  1SL8 A;  4GNK B;  1NYA A;  1OZO A;  1SW8 A;  2JT0 A;  3KPX A;  2HF5 A;  2O60 A;  1M63 B;  2LUC A;  1J1D A;  3LLE A;  1K9U A;  1Y1A A;  4OKH A;  4CPV A;  1YX8 A;  3BUO B;  3F45 A;  3IF7 A;  1QLS A;  2KYF A;  3WXA A;  1KCY A;  1XVJ A;  1LA3 A;  1NX1 A;  1Y0V H;  1U5I B;  2Q4U A;  1UHI A;  3SIA A;  3MSE B;  3TDZ A;  1AP4 A;  4F0Z B;  1BOD A;  2JWW A;  4OV2 A;  4DCK A;  4HSZ A;  4CLN A;  1BLQ A;  1OMV A;  2KBM A;  3DVJ A;  2F2O A;  2L4H A;  1DJH A;  3VRQ A;  2ZKM X;  5AER A;  1XFW O;  1B7T Z;  1QV0 A;  1F54 A;  1C7V A;  2NXQ A;  4E68 A;  1SRA A;  1WDC C;  1MWN A;  1CLL A;  2E30 A;  1A29 A;  3OP0 A;  1IH0 A;  4P5O E;  2L2E A;  4ZCV A;  1SL9 A;  1IG5 A;  2GGM A;  1J1E A;  4CFR A;  1FW4 A;  4YGA A;  2BL0 C;  2KI4 B;  2DOQ A;  1N0Y A;  1ZAC A;  1UHN A;  1BMO A;  4NDC A;  1IWQ A;  1KSM A;  2KQY A;  1EH2 A;  1WY9 A;  4PAL A;  3IQQ A;  3FIA A;  2BE6 A;  1QX2 A;  2LM5 A;  2MRD A;  3K21 A;  2M0R A;  4JPZ B;  5GQQ C;  4XJK A;  3FS7 A;  3NSO A;  4N1F A;  1GQM A;  1QTX A;  1DTL A;  1H8B A;  1MUX A;  2Y1N A;  1AVS A;  1PUL A;  1CFF A;  4ETO A;  2LE9 B;  1QXP A;  2KGR A;  2R2I A;  2LP3 A;  2G9B A;  1QIV A;  1L2O C;  2H2K A;  1M46 A;  1KSO A;  3TS5 C;  5K89 A;  5JOL A;  1W7I B;  4MZL A;  1ZUZ A;  2KDH A;  4PHK A;  1Y1X A;  5ER5 A;  2P6B B;  1TOP A;  1BT6 A;  1XK4 A;  2Y4Q A;  4PE0 A;  4YGD B;  2L50 A;  3EKH A;  4MZK A;  1KK8 C;  2KNE A;  4ORC B;  2WCB A;  5D69 A;  4DRW A;  3OX5 A;  3LK0 A;  1S1E A;  2LMU A;  3D0Y A;  1B47 A;  1DGV A;  3CS1 A;  3PN7 C;  4HRE E;  2LMT A;  1B4C A;  2KYC A;  1DJW A;  1VRK A;  3TUY C;  3DVK A;  2B1U A;  1DJX A;  1CDN A;  2KBI A;  1CB1 A;  2GV5 A;  4BY5 A;  2OS8 B;  3BQ3 A;  1K96 A;  1YUS A;  1ZFS A;  2PAL A;  2PMY A;  1KQM B;  4CFQ A;  1BR4 B;  2F2P A;  2LNK A;  1LA0 A;  4WQ2 A;  5D7F A;  4A4C A;  5HLV A;  1DMO A;  1IJ5 A;  4USL A;  2RGI A;  1S5G Z;  4M2P A;  3I5G B;  3PSR A;  2H61 A;  3GK1 A;  4R1E A;  1M31 A;  3I5I C;  2CCM A;  4D1E A;  1CFP A;  1SR6 C;  3NXA A;  2HQ8 A;  2OTG C;  5CSN A;  1YUU A;  3ZNI A;  2I7A A;  2V53 A;  1B1G A;  2WCF A;  3WNX B;  1IQ5 A;  1N65 A;  3EK7 A;  2JOJ A;  2M29 A;  4ICB A;  2EHB A;  4XYN A;  1U5I A;  3DF0 B;  1A03 A;  5HYD A;  1UUR A;  1R6P A;  2LVI A;  2JNF A;  1QVI Y;  3I5H C;  3NSK A;  1KFX S;  2K7D A;  1S3P A;  2KAV A;  2O5G A;  5TNC A;  1NX3 A;  2A4J A;  2KSP A;  4IL1 A;  2GGZ A;  1CDL A;  1BR1 B;  2FCE A;  3PAT A;  5I2Q A;  2WOS A;  2LVJ A;  2LC5 A;  3LL8 B;  4WQ3 A;  3SG5 A;  3BOW B;  1PVA A;  4M2Q A;  3KEV A;  1D1O A;  1S36 A;  3AAK A;  1TCO B;  5J3X A;  5DKR A;  1WLM A;  2F3Y A;  1CLM A;  1OQP A;  4YBH B;  2G2B A;  1NP8 A;  1WDC B;  2I2R E;  3TDU A;  1CM4 A;  1NUB A;  1NX2 A;  1YTZ C;  2LLT A;  5ER4 X;  4QJ3 B;  1NCX A;  1YRU B;  4YGB B;  2JXC A;  1J7P A;  1NIW A;  2JRF A;  2KI6 D;  1SCM C;  2MJW B;  4I5K A;  1AK8 A;  4AQI A;  2JQ6 A;  4MZJ A;  2LHL A;  3GOF A;  1WRK A;  3O78 A;  4GGF A;  3PLF B;  1S26 D;  4MBE A;  1FI6 A;  1IGV A;  4PHJ A;  1KQV A;  2M49 B;  1Q80 A;  2NCO A;  3AKB A;  2L4I A;  2KFF A;  1CDP A;  1QIW A;  2ZN8 A;  1EG3 A;  4TNC A;  5HKZ A;  1PK0 D;  2BKH B;  3I5F C;  1QVI Z;  1JSA A;  4MRX A;  4DUQ A;  1DJI A;  3JTD C;  1M39 A;  2LAP A;  1L2O B;  1QS7 A;  3OX6 A;  1JUO A;  4N5X A;  5KSZ A;  4GUK A;  5F6T A;  1UHH A;  1XK4 C;  4I5N B;  1BJF A;  2M1U A;  4ZCU A;  4GGN A;  1L7Z A;  3WHU B;  4I5J A;  1EXR A;  3OHM B;  2K7C A;  1K8U A;  2IS9 A;  2TN4 A;  1MF8 B;  1SBJ A;  1YUT A;  1NPQ A;  1QAS A;  1S5G Y;  3VGO A;  4QJ5 B;  1GGZ A;  2L51 A;  5PAL A;  2EGD A;  4OR9 B;  4GFT A;  4NDB A;  3LK1 A;  1WRZ A;  1K9K A;  5AEQ A;  4AOM A;  1WLZ A;  3BYA A;  2JUL A;  1TNP A;  2LCP A;  1QLK A;  3VRN A;  1PSR A;  3PAL A;  3DF0 A;  2H61 C;  3VRO A;  1DT7 B;  3HX4 A;  3HCM A;  4MEW A;  3BUW B;  2COL B;  2MLE C;  1MR8 A;  1DVI A;  1SR6 B;  3BXK A;  3RLZ A;  1XFU O;  2KAY A;  3JVT C;  2PVB A;  3TDI A;  1J7O A;  2MAZ A;  5CSI A;  2QPT A;  5KU1 A;  3BUX B;  2HQW A;  3BOW A;  4PE1 A;  4HRG A;  1PVB A;  2LLS A;  4QJ4 B;  1DJG A;  1CLB A;  1OE9 B;  3C1V A;  1E8A A;  2OPO A;  2KQ6 A;  1M45 A;  3CLN A;  1Y1U A;  1KFU S;  4A4B A;  2LV7 A;  4PHM A;  1PSB A;  1KWO B;  3EVR A;  2WND A;  3KF9 A;  2BCX A;  2KI4 C;  1YR5 A;  2PAS A;  4OVN F;  2BBN A;  1SPY A;  1YUR A;  4MN0 A;  1DJZ A;  2K7B A;  1SL7 A;  2SAS A;  3KO0 A;  1F71 A;  1CFD A;  2AUC A;  3FWC A;  1K9P A;  3CR5 X;  1UUS A;  1QJT A;  1HT9 A;  3SG7 A;  3NSL A;  1UHJ A;  2L98 A;  1FPW A;  4YGE B;  3DVM A;  1CDM A;  1YRT B;  2NCP A;  4PCW A;  2LVK A;  2L0P A;  4MSP A;  3BUN B;  5FYX A;  5KTY A;  1XO5 A;  2LUX A;  4GGF C;  1XYD A;  1MXL C;  3CWG A;  1OOJ A;  1ZOT B;  2F3Z A;  2I94 A;  4FTG A;  1B8L A;  2MBX A;  1JBA A;  1V1F A;  2K0J A;  1RRO A;  4FQO A;  5CSF A;  1QAT A;  1OZS A;  4GAO A;  4L9M A;  1LIN A;  1TCF A;  1AJ4 A;  1F70 A;  5CPV A;  5I8N A;  1ZMZ A;  3SG2 A;  1TIZ A;  1IKU A;  1F4Q A;  1K94 A;  3TZ1 A;  1JF2 A;  1C07 A;  1KFX L;  1XA5 A;  1C7W A;  1J7R A;  2CXJ A;  2PSR A;  2I18 A;  1UWO A;  3EK4 A;  5G08 A;  1JFJ A;  2EC6 C;  3E3R A;  2D8N A;  3AKA A;  2OS8 C;  1B8R A;  3NSI A;  1S6J A;  2WC8 A;  1XFY O;  1ODB A;  1KQM C;  1SYM A;  2KHN A;  2LMV A;  2ISD A;  4JQ0 D;  2JTZ A;  1B9A A;  1G33 A;  3LCP C; 
#chains in the Genus database with same CATH topology
 2BEC A;  3ICB A;  2CTN A;  1IRJ A;  2QEH A;  2BL0 B;  1MQ1 A;  2M7N A;  5I94 A;  1TTX A;  2LHI A;  2NZ0 A;  3I5G C;  5DKN A;  3BUM B;  4C0K A;  1ALV A;  2BE4 A;  2K61 A;  3O4Y A;  1DJY A;  1NSH A;  1AHR A;  3CZ0 A;  3QRX A;  2WCH A;  1FF1 A;  1SY9 A;  1KK7 Z;  2ZFD A;  3CGA A;  1BF5 A;  1LXF C;  1XFZ O;  2JT8 A;  3CTN A;  2CT9 A;  1TNX A;  4PDZ A;  1MHO A;  1CTR A;  4YGC B;  3BFA A;  2AAO A;  2JZI A;  4PE7 A;  1K95 A;  4UPG A;  1J7Q A;  1YVL A;  1FI5 A;  1S6C A;  2K7O A;  2M97 A;  5I2O A;  3DVE A;  3V2L A;  2E6W A;  3TS5 B;  5B8I B;  2LLU A;  1F4O A;  3SG4 A;  4MLW A;  4CID A;  3R72 A;  3D77 A;  1LVC D;  2JPT A;  4JWQ A;  3A4U B;  1CM1 A;  1P28 A;  3A8R A;  2Y1M A;  1KK8 B;  1REC A;  3JVT B;  4Q04 A;  2HET A;  1TUZ A;  3B88 A;  2FJU B;  2LP2 A;  3OB2 B;  4AQJ A;  2FOT A;  1DF0 B;  5HKW A;  1G4Y R;  2SCP A;  3PN7 B;  3SS4 A;  5AFP A;  2JTT A;  3TUY B;  1MXE A;  1PRW A;  1BG1 A;  1RK9 A;  1R2U A;  2MA2 A;  2MLF C;  2LVV A;  3DD4 A;  4IJ7 A;  1NWD A;  2M9G A;  2BBM A;  2K2F A;  3SG3 A;  1W9Z A;  2K60 A;  1UP5 A;  2BCB A;  2GTE A;  2M3W A;  1IQ3 A;  1F55 A;  1F8H A;  1TN4 A;  1N2D A;  1XFX O;  3BFB A;  2WOR A;  4GBA A;  1ALW A;  3M0W A;  2JXL A;  2M7L A;  1NCZ A;  3R1O A;  1JC2 A;  1TNW A;  3DXL A;  1A75 B;  1K93 D;  2M1K B;  3I5I B;  1CKK A;  3D74 A;  2FJY A;  1A2X A;  1SK6 D;  2OTG B;  2ZN9 A;  1RTP 1;  5AXI A;  4YRU A;  2NLN A;  2KAX A;  4NDD A;  1SMG A;  4YI9 A;  2CNP A;  2FCD A;  4P2Y B;  3K1E A;  2BKI B;  1A4P A;  1QX7 A;  2VRG A;  3AAJ A;  3SG6 A;  4OZD A;  3KHE A;  4PHN A;  5KSZ A;  1CMG A;  2ZRS A;  4M2O A;  1CFC A;  3I5H B;  2KFG A;  4OCI A;  4ORA B;  2QAC A;  1HQV A;  2ZND A;  1GJY A;  1B8C A;  4NQG A;  2F33 A;  4HRH A;  1SKT A;  2K8M B;  2Q91 A;  1AUI B;  2BCA A;  1JF0 A;  1EL4 A;  1UHK A;  5CSJ A;  4C0J A;  5DKQ A;  1EG4 A;  1OMD A;  2F8P A;  2LAN A;  4ORB B;  1TRF A;  1OOH A;  3RZS A;  2KOT A;  5HLO A;  1XFV O;  1NCY A;  3CAB A;  4U8D A;  4C0L A;  2EC6 B;  3S0E A;  1KFU L;  1KK7 Y;  1NX0 A;  1YX7 A;  3L47 A;  4N1G A;  4YI8 A;  3GK2 A;  3O6B A;  1JFK A;  2JT3 A;  2MHH A;  2JPO A;  2AMI A;  1PAL A;  3VRP A;  2K2A A;  2ZRT A;  4MRY A;  4DIR A;  5HKY A;  2M8U A;  3S0D A;  2JC2 A;  3EKJ A;  1SCM B;  2L5X B;  2ZNE A;  2PQL A;  2JNX A;  3EVV A;  1J55 A;  3CR4 X;  4GPL B;  4JD9 A;  5FI2 A;  5AAN A;  5IBW A;  3CZT X;  4WRI A;  4XJK B;  1AJ5 A;  3EK8 A;  3CR2 A;  3SJS A;  2JU0 A;  3CDN A;  1TNQ A;  1Y6W A;  4PE4 A;  3S0F A;  1RWY A;  3IQO A;  1SNL A;  1X02 A;  1YVH A;  3VRR A;  1EJ3 A;  1LKJ A;  3I5F B;  1FBV A;  3N7H A;  2KI6 C;  4MVF A;  1IJ6 A;  2CBL A;  3WHT B;  3FWB A;  2KFH A;  2PRU A;  3CZ2 A;  1WRL A;  1DF0 A;  3JTD B;  3O2P A;  4BY4 A;  5JJG A;  4DS7 A;  1B7T Y;  1BOC A;  1CMF A;  4INX A;  2Y5I A;  3SIB A;  1H4B A;  3S0B A;  3PM8 A;  3H4S E;  1QV1 A;  1CNP A;  1RFJ A;  1GGW A;  1QX5 B;  3R1V A;  3EVU A;  1V1G A;  3NHI A;  1JWD A;  3PFV A;  1SCV A;  3D0Y B;  2HPS A;  1KWO C;  1K2H A;  5BPJ A;  1G8I A;  3NHT A;  3QME A;  1W7J B;  1OMR A;  3DYE A;  1OSA A;  4I5L B;  1BU3 A;  3GK4 X;  5I2L A;  3RM1 A;  1DGU A;  1A75 A;  1K90 D;  2WCE A;  2KGB C;  3OB1 B;  3D10 A;  1OOG A;  1S6I A;  3B6X A;  3ZWH A;  1RJV A;  1SL8 A;  3NGV A;  4GNK B;  1NYA A;  1OZO A;  1SW8 A;  2JT0 A;  2P71 A;  3KPX A;  3CZ1 A;  2HF5 A;  2O60 A;  1M63 B;  2LUC A;  1J1D A;  3LLE A;  1K9U A;  1TWO A;  1Y1A A;  4OKH A;  4CPV A;  1YX8 A;  3BUO B;  3F45 A;  3IF7 A;  1QLS A;  2KYF A;  3WXA A;  1KCY A;  1XVJ A;  1LA3 A;  3PJI A;  1NX1 A;  1Y0V H;  1U5I B;  2Q4U A;  1ORG A;  1UHI A;  3MSE B;  3SIA A;  3TDZ A;  1AP4 A;  4F0Z B;  1BOD A;  2JWW A;  3S0G A;  4OV2 A;  3B86 A;  4HSZ A;  5EL2 A;  4CLN A;  4DCK A;  1BLQ A;  1OMV A;  2ERB A;  2KBM A;  3DVJ A;  2F2O A;  2L4H A;  1DJH A;  2KLD A;  2WC5 A;  3VRQ A;  2ZKM X;  5AER A;  1XFW O;  1B7T Z;  1QV0 A;  1F54 A;  3TDU A;  1C7V A;  2NXQ A;  4E68 A;  2QEB A;  1SRA A;  1WDC C;  1MWN A;  1CLL A;  3B87 A;  2E30 A;  1A29 A;  1OOI X;  3OP0 A;  1IH0 A;  4P5O E;  2L2E A;  4ZCV A;  2WCL A;  3SS5 A;  1SL9 A;  1IG5 A;  2GGM A;  1J1E A;  4CFR A;  1FW4 A;  1Z4H A;  1XFR A;  4YGA A;  2BL0 C;  2WCJ A;  2KI4 B;  2DOQ A;  1N0Y A;  1ZAC A;  1UHN A;  1BMO A;  4NDC A;  1IWQ A;  1KSM A;  2KQY A;  1EH2 A;  1WY9 A;  4PAL A;  3IQQ A;  3FIA A;  2BE6 A;  1QX2 A;  2LM5 A;  2MRD A;  3K21 A;  2M0R A;  4JPZ B;  5GQQ C;  4XJK A;  3FS7 A;  3NSO A;  4N1F A;  1GQM A;  1QTX A;  1DTL A;  3UNW A;  1H8B A;  2L2C A;  1MUX A;  2Y1N A;  1AVS A;  1PUL A;  3BJH A;  1CFF A;  4ETO A;  2LE9 B;  1QXP A;  2KGR A;  2R2I A;  2LP3 A;  2G9B A;  1QIV A;  1L2O C;  2H2K A;  5D3O A;  1M46 A;  1KSO A;  3TS5 C;  5K89 A;  5JOL A;  1W7I B;  4MZL A;  1ZUZ A;  2KDH A;  4PHK A;  1Y1X A;  5ER5 A;  2P6B B;  1TOP A;  1BT6 A;  1XK4 A;  2Y4Q A;  4PE0 A;  4YGD B;  2L50 A;  3EKH A;  4MZK A;  1KK8 C;  2KNE A;  4ORC B;  2PYQ A;  1OW4 A;  2WCB A;  5D69 A;  4DRW A;  3OX5 A;  3D78 A;  3LK0 A;  1S1E A;  3DZT A;  2LMU A;  3D0Y A;  1B47 A;  1DGV A;  3CS1 A;  3PN7 C;  4HRE E;  2LMT A;  1B4C A;  2KYC A;  1DJW A;  1VRK A;  3TUY C;  3DVK A;  2B1U A;  1DJX A;  1CDN A;  2KBI A;  3O4X A;  2GV5 A;  4BY5 A;  3D73 A;  1CB1 A;  2OS8 B;  3BQ3 A;  1K96 A;  1YUS A;  1ZFS A;  2PAL A;  2PMY A;  1KQM B;  4CFQ A;  1BR4 B;  2F2P A;  2LNK A;  1LA0 A;  4WQ2 A;  2KLE A;  5D7F A;  4A4C A;  5HLV A;  1DMO A;  1IJ5 A;  4USL A;  2RGI A;  1S5G Z;  4M2P A;  3I5G B;  3PSR A;  2H61 A;  3GK1 A;  3S0A A;  3FE6 A;  4R1E A;  1C3Y A;  1M31 A;  3I5I C;  2CCM A;  4D1E A;  1CFP A;  1SR6 C;  3NXA A;  2HQ8 A;  2OTG C;  3R1P A;  5CSN A;  1YUU A;  3ZNI A;  3UO9 A;  2I7A A;  4INW A;  2V53 A;  1B1G A;  2WCF A;  3WNX B;  1IQ5 A;  2QEO A;  1N65 A;  3EK7 A;  2JOJ A;  2M29 A;  3D76 A;  4ICB A;  2EHB A;  4XYN A;  3IVT A;  1U5I A;  3DF0 B;  5HL1 A;  5HYD A;  1A03 A;  1UUR A;  1R6P A;  2LVI A;  2JNF A;  1QVI Y;  3I5H C;  3NSK A;  2YGU A;  1KFX S;  2K7D A;  1DC1 A;  2QDI A;  1S3P A;  2KAV A;  2O5G A;  5TNC A;  1NX3 A;  2A4J A;  2KSP A;  4IL1 A;  2GGZ A;  1CDL A;  1BR1 B;  2FCE A;  3PAT A;  5FI6 A;  5I2Q A;  2WOS A;  2LVJ A;  2LC5 A;  3LL8 B;  4WQ3 A;  3SG5 A;  3BOW B;  1PVA A;  2WCM A;  4M2Q A;  3KEV A;  2L5Y A;  1D1O A;  1S36 A;  3AAK A;  4KYN A;  1TCO B;  3OGN A;  5DKR A;  5J3X A;  1WLM A;  2F3Y A;  1CLM A;  1OQP A;  4YBH B;  2G2B A;  1NP8 A;  1WDC B;  2I2R E;  2KPH A;  1CM4 A;  1NUB A;  1NX2 A;  1YTZ C;  2LLT A;  3L4L A;  5ER4 X;  4QJ3 B;  1NCX A;  1YRU B;  4YGB B;  2JXC A;  1J7P A;  1NIW A;  2JRF A;  3FE9 A;  3SS3 A;  2KI6 D;  1SCM C;  2MJW B;  4I5K A;  1AK8 A;  4AQI A;  2JQ6 A;  4MZJ A;  2LHL A;  3GOF A;  1WRK A;  3O78 A;  4GGF A;  3OBV A;  3PM2 A;  3PLF B;  3B7A A;  1S26 D;  4MBE A;  1FI6 A;  2P70 A;  1IGV A;  4PHJ A;  1KQV A;  2M49 B;  1Q80 A;  2NCO A;  3AKB A;  4JKT A;  2L4I A;  4FQT A;  2KFF A;  1CDP A;  1QIW A;  2ZN8 A;  1EG3 A;  4TNC A;  5HKZ A;  1PK0 D;  1TUJ A;  2BKH B;  1QVI Z;  1T14 A;  3I5F C;  1JSA A;  4MRX A;  4DUQ A;  1DJI A;  3JTD C;  1M39 A;  2LAP A;  1L2O B;  1QS7 A;  3OX6 A;  1JUO A;  3Q8I A;  4N5X A;  4GUK A;  5F6T A;  1UHH A;  1XK4 C;  4I5N B;  1BJF A;  2M1U A;  4ZCU A;  4GGN A;  1L7Z A;  3WHU B;  4I5J A;  1EXR A;  3OHM B;  2K7C A;  1K8U A;  2IS9 A;  2TN4 A;  1MF8 B;  1SBJ A;  1YUT A;  1NPQ A;  1QAS A;  1S5G Y;  2QEV A;  3VGO A;  4QJ5 B;  1GGZ A;  4PT1 A;  5DIC A;  2L51 A;  5PAL A;  2EGD A;  4OR9 B;  4GFT A;  4NDB A;  3LK1 A;  1C3Z A;  1WRZ A;  1K9K A;  1GM0 A;  5AEQ A;  2H8V A;  4AOM A;  1WLZ A;  3BYA A;  2JUL A;  1TNP A;  2LCP A;  1QLK A;  3VRN A;  1PSR A;  3PAL A;  3DF0 A;  2WC6 A;  2H61 C;  3VRO A;  1DT7 B;  3HX4 A;  3EG5 B;  3HCM A;  4MEW A;  2BNX A;  3BUW B;  3D75 A;  2COL B;  2MLE C;  1MR8 A;  1DVI A;  1SR6 B;  3BXK A;  3RLZ A;  1XFU O;  2KAY A;  3L4A A;  3JVT C;  2PVB A;  3TDI A;  1J7O A;  2MAZ A;  1SSE B;  5CSI A;  2QPT A;  5KU1 A;  3BUX B;  2HQW A;  3BOW A;  4PE1 A;  4HRG A;  1OOF A;  1PVB A;  2LLS A;  4QJ4 B;  1DJG A;  1CLB A;  1OE9 B;  3DY9 A;  3C1V A;  1E8A A;  2OPO A;  2KQ6 A;  1M45 A;  3CLN A;  3VB1 A;  1Y1U A;  1DQE A;  1KFU S;  4A4B A;  2LV7 A;  4PHM A;  1PSB A;  1QWV A;  1KWO B;  3EVR A;  2WND A;  3KF9 A;  2BCX A;  2KI4 C;  1YR5 A;  2PAS A;  4OVN F;  2BBN A;  1SPY A;  1YUR A;  4MN0 A;  1DEK A;  1DJZ A;  3FE8 A;  2K7B A;  1SL7 A;  2SAS A;  3KO0 A;  1F71 A;  1CFD A;  2AUC A;  3FWC A;  1K9P A;  3CR5 X;  1UUS A;  2WCK A;  1QJT A;  1HT9 A;  3SG7 A;  3NSL A;  1UHJ A;  2L98 A;  1FPW A;  4YGE B;  3DVM A;  1CDM A;  1YRT B;  2NCP A;  4PCW A;  2LVK A;  2L0P A;  4MSP A;  3BUN B;  5FYX A;  5KTY A;  1XO5 A;  2LUX A;  4GGF C;  1LS8 A;  1XYD A;  1MXL C;  3CWG A;  1IIO A;  1OOJ A;  1ZOT B;  2F3Z A;  2I94 A;  4FTG A;  1B8L A;  2MBX A;  1JBA A;  1V1F A;  2K0J A;  1RRO A;  4FQO A;  5CSF A;  1QAT A;  1OZS A;  4GAO A;  4L9M A;  1LIN A;  1TCF A;  1AJ4 A;  1F70 A;  3BFH A;  5CPV A;  5I8N A;  1ZMZ A;  3SG2 A;  1TIZ A;  1IKU A;  1F4Q A;  1K94 A;  3TZ1 A;  1DEL A;  1JF2 A;  1C07 A;  3CYZ A;  1KFX L;  1XA5 A;  5FI7 A;  4F7F A;  1C7W A;  1J7R A;  2CXJ A;  2PSR A;  2I18 A;  1UWO A;  1Z2C B;  3EK4 A;  5G08 A;  2EC6 C;  1JFJ A;  3E3R A;  2D8N A;  3AKA A;  2OS8 C;  1B8R A;  3NSI A;  1S6J A;  2WC8 A;  1XFY O;  1ODB A;  1KQM C;  1SYM A;  2KHN A;  2LMV A;  2ISD A;  2BAP A;  4JQ0 D;  2JTZ A;  1B9A A;  1G33 A;  3LCP C; 
#chains in the Genus database with same CATH homology
 2BEC A;  3ICB A;  2CTN A;  1IRJ A;  2BL0 B;  1MQ1 A;  2M7N A;  1TTX A;  2LHI A;  2NZ0 A;  3I5G C;  5DKN A;  3BUM B;  4C0K A;  1ALV A;  2BE4 A;  2K61 A;  3O4Y A;  1DJY A;  1NSH A;  1AHR A;  3QRX A;  1FF1 A;  1SY9 A;  1KK7 Z;  2ZFD A;  3CGA A;  1BF5 A;  1LXF C;  1XFZ O;  2JT8 A;  3CTN A;  2CT9 A;  1TNX A;  4PDZ A;  1MHO A;  1CTR A;  4YGC B;  2AAO A;  2JZI A;  4PE7 A;  1K95 A;  4UPG A;  1J7Q A;  1YVL A;  1FI5 A;  1S6C A;  2K7O A;  2M97 A;  5I2O A;  3DVE A;  2E6W A;  3TS5 B;  5B8I B;  2LLU A;  1F4O A;  3SG4 A;  4MLW A;  4CID A;  1LVC D;  2JPT A;  4JWQ A;  3A4U B;  1CM1 A;  3A8R A;  2Y1M A;  1KK8 B;  1REC A;  3JVT B;  4Q04 A;  2HET A;  3OB2 B;  2FJU B;  2LP2 A;  4AQJ A;  2FOT A;  1DF0 B;  5HKW A;  1G4Y R;  2SCP A;  3PN7 B;  5AFP A;  2JTT A;  3TUY B;  1MXE A;  1PRW A;  1BG1 A;  1RK9 A;  1R2U A;  2MA2 A;  2MLF C;  2LVV A;  3DD4 A;  1NWD A;  2M9G A;  2BBM A;  2K2F A;  3SG3 A;  1UP5 A;  2BCB A;  2M3W A;  1IQ3 A;  1F55 A;  1F8H A;  1TN4 A;  1N2D A;  1XFX O;  2WOR A;  4GBA A;  1ALW A;  3M0W A;  2JXL A;  2M7L A;  1NCZ A;  1JC2 A;  1TNW A;  1A75 B;  1K93 D;  2M1K B;  3I5I B;  1CKK A;  1A2X A;  1SK6 D;  2OTG B;  2ZN9 A;  1RTP 1;  5AXI A;  4YRU A;  2NLN A;  2KAX A;  4NDD A;  1SMG A;  4YI9 A;  2CNP A;  2FCD A;  4P2Y B;  2BKI B;  1A4P A;  1QX7 A;  2VRG A;  3AAJ A;  3SG6 A;  1CMG A;  3KHE A;  4PHN A;  2ZRS A;  4M2O A;  1CFC A;  3I5H B;  2KFG A;  4OCI A;  4ORA B;  2QAC A;  1HQV A;  2ZND A;  1GJY A;  1B8C A;  4NQG A;  2F33 A;  4HRH A;  1SKT A;  2K8M B;  2Q91 A;  1AUI B;  2BCA A;  1JF0 A;  1EL4 A;  1UHK A;  5CSJ A;  4C0J A;  5DKQ A;  1EG4 A;  1OMD A;  2F8P A;  2LAN A;  4ORB B;  1TRF A;  2KOT A;  5HLO A;  1XFV O;  1NCY A;  4U8D A;  4C0L A;  2EC6 B;  1KFU L;  1KK7 Y;  1NX0 A;  1YX7 A;  4N1G A;  4YI8 A;  3GK2 A;  3O6B A;  1JFK A;  2JT3 A;  2MHH A;  3VRP A;  2AMI A;  1PAL A;  4DIR A;  2K2A A;  2ZRT A;  4MRY A;  5HKY A;  2M8U A;  2JC2 A;  3EKJ A;  1SCM B;  2L5X B;  2ZNE A;  2JNX A;  3EVV A;  1J55 A;  3CR4 X;  4GPL B;  5AAN A;  5IBW A;  3CZT X;  4WRI A;  4XJK B;  1AJ5 A;  3EK8 A;  3CR2 A;  3SJS A;  2JU0 A;  1TNQ A;  1Y6W A;  4PE4 A;  1RWY A;  3IQO A;  1SNL A;  1X02 A;  1YVH A;  3VRR A;  1EJ3 A;  1LKJ A;  3I5F B;  1FBV A;  2KI6 C;  4MVF A;  1IJ6 A;  2CBL A;  3WHT B;  3FWB A;  2KFH A;  2PRU A;  1WRL A;  1DF0 A;  3JTD B;  3O2P A;  4BY4 A;  5JJG A;  4DS7 A;  1B7T Y;  1BOC A;  1CMF A;  2Y5I A;  3SIB A;  1H4B A;  3PM8 A;  3H4S E;  1QV1 A;  1CNP A;  1RFJ A;  1GGW A;  1QX5 B;  3EVU A;  1V1G A;  1JWD A;  3PFV A;  1SCV A;  3D0Y B;  2HPS A;  1KWO C;  1K2H A;  5BPJ A;  1G8I A;  1W7J B;  1OMR A;  5I2L A;  1OSA A;  4I5L B;  1BU3 A;  3GK4 X;  3RM1 A;  1DGU A;  1A75 A;  1K90 D;  2WCE A;  2KGB C;  3OB1 B;  3D10 A;  1S6I A;  3ZWH A;  1RJV A;  1SL8 A;  4GNK B;  1NYA A;  1OZO A;  1SW8 A;  2JT0 A;  3KPX A;  2HF5 A;  2O60 A;  1M63 B;  2LUC A;  1J1D A;  3LLE A;  1K9U A;  1Y1A A;  4OKH A;  4CPV A;  1YX8 A;  3BUO B;  3F45 A;  3IF7 A;  1QLS A;  2KYF A;  3WXA A;  1KCY A;  1XVJ A;  1LA3 A;  1NX1 A;  1Y0V H;  1U5I B;  2Q4U A;  1UHI A;  3SIA A;  3MSE B;  3TDZ A;  1AP4 A;  4F0Z B;  1BOD A;  2JWW A;  4OV2 A;  4DCK A;  4HSZ A;  4CLN A;  1BLQ A;  1OMV A;  2KBM A;  3DVJ A;  2F2O A;  2L4H A;  1DJH A;  3VRQ A;  2ZKM X;  5AER A;  1XFW O;  1B7T Z;  1QV0 A;  1F54 A;  1C7V A;  2NXQ A;  4E68 A;  1SRA A;  1WDC C;  1MWN A;  1CLL A;  2E30 A;  1A29 A;  3OP0 A;  1IH0 A;  4P5O E;  2L2E A;  4ZCV A;  1SL9 A;  1IG5 A;  2GGM A;  1J1E A;  4CFR A;  1FW4 A;  4YGA A;  2BL0 C;  2KI4 B;  2DOQ A;  1N0Y A;  1ZAC A;  1UHN A;  1BMO A;  4NDC A;  1IWQ A;  1KSM A;  2KQY A;  1EH2 A;  1WY9 A;  4PAL A;  3IQQ A;  3FIA A;  2BE6 A;  1QX2 A;  2LM5 A;  2MRD A;  3K21 A;  2M0R A;  4JPZ B;  5GQQ C;  4XJK A;  3FS7 A;  3NSO A;  4N1F A;  1GQM A;  1QTX A;  1DTL A;  1H8B A;  1MUX A;  2Y1N A;  1AVS A;  1PUL A;  1CFF A;  4ETO A;  2LE9 B;  1QXP A;  2KGR A;  2R2I A;  2LP3 A;  2G9B A;  1QIV A;  1L2O C;  2H2K A;  1M46 A;  1KSO A;  3TS5 C;  5K89 A;  5JOL A;  1W7I B;  4MZL A;  1ZUZ A;  2KDH A;  4PHK A;  1Y1X A;  5ER5 A;  2P6B B;  1TOP A;  1BT6 A;  1XK4 A;  2Y4Q A;  4PE0 A;  4YGD B;  2L50 A;  3EKH A;  4MZK A;  1KK8 C;  2KNE A;  4ORC B;  2WCB A;  5D69 A;  4DRW A;  3OX5 A;  3LK0 A;  1S1E A;  2LMU A;  3D0Y A;  1B47 A;  1DGV A;  3CS1 A;  3PN7 C;  4HRE E;  2LMT A;  1B4C A;  2KYC A;  1DJW A;  1VRK A;  3TUY C;  3DVK A;  2B1U A;  1DJX A;  1CDN A;  2KBI A;  1CB1 A;  2GV5 A;  4BY5 A;  2OS8 B;  3BQ3 A;  1K96 A;  1YUS A;  1ZFS A;  2PAL A;  2PMY A;  1KQM B;  4CFQ A;  1BR4 B;  2F2P A;  2LNK A;  1LA0 A;  4WQ2 A;  5D7F A;  4A4C A;  5HLV A;  1DMO A;  1IJ5 A;  4USL A;  2RGI A;  1S5G Z;  4M2P A;  3I5G B;  3PSR A;  2H61 A;  3GK1 A;  4R1E A;  1M31 A;  3I5I C;  2CCM A;  4D1E A;  1CFP A;  1SR6 C;  3NXA A;  2HQ8 A;  2OTG C;  5CSN A;  1YUU A;  3ZNI A;  2I7A A;  2V53 A;  1B1G A;  2WCF A;  3WNX B;  1IQ5 A;  1N65 A;  3EK7 A;  2JOJ A;  2M29 A;  4ICB A;  2EHB A;  4XYN A;  1U5I A;  3DF0 B;  1A03 A;  5HYD A;  1UUR A;  1R6P A;  2LVI A;  2JNF A;  1QVI Y;  3I5H C;  3NSK A;  1KFX S;  2K7D A;  1S3P A;  2KAV A;  2O5G A;  5TNC A;  1NX3 A;  2A4J A;  2KSP A;  4IL1 A;  2GGZ A;  1CDL A;  1BR1 B;  2FCE A;  3PAT A;  5I2Q A;  2WOS A;  2LVJ A;  2LC5 A;  3LL8 B;  4WQ3 A;  3SG5 A;  3BOW B;  1PVA A;  4M2Q A;  3KEV A;  1D1O A;  1S36 A;  3AAK A;  1TCO B;  5J3X A;  5DKR A;  1WLM A;  2F3Y A;  1CLM A;  1OQP A;  4YBH B;  2G2B A;  1NP8 A;  1WDC B;  2I2R E;  3TDU A;  1CM4 A;  1NUB A;  1NX2 A;  1YTZ C;  2LLT A;  5ER4 X;  4QJ3 B;  1NCX A;  1YRU B;  4YGB B;  2JXC A;  1J7P A;  1NIW A;  2JRF A;  2KI6 D;  1SCM C;  2MJW B;  4I5K A;  1AK8 A;  4AQI A;  2JQ6 A;  4MZJ A;  2LHL A;  3GOF A;  1WRK A;  3O78 A;  4GGF A;  3PLF B;  1S26 D;  4MBE A;  1FI6 A;  1IGV A;  4PHJ A;  1KQV A;  2M49 B;  1Q80 A;  2NCO A;  3AKB A;  2L4I A;  2KFF A;  1CDP A;  1QIW A;  2ZN8 A;  1EG3 A;  4TNC A;  5HKZ A;  1PK0 D;  2BKH B;  3I5F C;  1QVI Z;  1JSA A;  4MRX A;  4DUQ A;  1DJI A;  3JTD C;  1M39 A;  2LAP A;  1L2O B;  1QS7 A;  3OX6 A;  1JUO A;  4N5X A;  5KSZ A;  4GUK A;  5F6T A;  1UHH A;  1XK4 C;  4I5N B;  1BJF A;  2M1U A;  4ZCU A;  4GGN A;  1L7Z A;  3WHU B;  4I5J A;  1EXR A;  3OHM B;  2K7C A;  1K8U A;  2IS9 A;  2TN4 A;  1MF8 B;  1SBJ A;  1YUT A;  1NPQ A;  1QAS A;  1S5G Y;  3VGO A;  4QJ5 B;  1GGZ A;  2L51 A;  5PAL A;  2EGD A;  4OR9 B;  4GFT A;  4NDB A;  3LK1 A;  1WRZ A;  1K9K A;  5AEQ A;  4AOM A;  1WLZ A;  3BYA A;  2JUL A;  1TNP A;  2LCP A;  1QLK A;  3VRN A;  1PSR A;  3PAL A;  3DF0 A;  2H61 C;  3VRO A;  1DT7 B;  3HX4 A;  3HCM A;  4MEW A;  3BUW B;  2COL B;  2MLE C;  1MR8 A;  1DVI A;  1SR6 B;  3BXK A;  3RLZ A;  1XFU O;  2KAY A;  3JVT C;  2PVB A;  3TDI A;  1J7O A;  2MAZ A;  5CSI A;  2QPT A;  5KU1 A;  3BUX B;  2HQW A;  3BOW A;  4PE1 A;  4HRG A;  1PVB A;  2LLS A;  4QJ4 B;  1DJG A;  1CLB A;  1OE9 B;  3C1V A;  1E8A A;  2OPO A;  2KQ6 A;  1M45 A;  3CLN A;  1Y1U A;  1KFU S;  4A4B A;  2LV7 A;  4PHM A;  1PSB A;  1KWO B;  3EVR A;  2WND A;  3KF9 A;  2BCX A;  2KI4 C;  1YR5 A;  2PAS A;  4OVN F;  2BBN A;  1SPY A;  1YUR A;  4MN0 A;  1DJZ A;  2K7B A;  1SL7 A;  2SAS A;  3KO0 A;  1F71 A;  1CFD A;  2AUC A;  3FWC A;  1K9P A;  3CR5 X;  1UUS A;  1QJT A;  1HT9 A;  3SG7 A;  3NSL A;  1UHJ A;  2L98 A;  1FPW A;  4YGE B;  3DVM A;  1CDM A;  1YRT B;  2NCP A;  4PCW A;  2LVK A;  2L0P A;  4MSP A;  3BUN B;  5FYX A;  5KTY A;  1XO5 A;  2LUX A;  4GGF C;  1XYD A;  1MXL C;  3CWG A;  1OOJ A;  1ZOT B;  2F3Z A;  2I94 A;  4FTG A;  1B8L A;  2MBX A;  1JBA A;  1V1F A;  2K0J A;  1RRO A;  4FQO A;  5CSF A;  1QAT A;  1OZS A;  4GAO A;  4L9M A;  1LIN A;  1TCF A;  1AJ4 A;  1F70 A;  5CPV A;  5I8N A;  1ZMZ A;  3SG2 A;  1TIZ A;  1IKU A;  1F4Q A;  1K94 A;  3TZ1 A;  1JF2 A;  1C07 A;  1KFX L;  1XA5 A;  1C7W A;  1J7R A;  2CXJ A;  2PSR A;  2I18 A;  1UWO A;  3EK4 A;  5G08 A;  1JFJ A;  2EC6 C;  3E3R A;  2D8N A;  3AKA A;  2OS8 C;  1B8R A;  3NSI A;  1S6J A;  2WC8 A;  1XFY O;  1ODB A;  1KQM C;  1SYM A;  2KHN A;  2LMV A;  2ISD A;  4JQ0 D;  2JTZ A;  1B9A A;  1G33 A;  3LCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...