1WRLA

Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 25
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wrlA00
3I5HB 3NSOA 1TNXA 1QASA 4GNKB 1S36A 1QVIY 2G9BA 2IS9A 1TNWA 4DS7A 1PSRA 4PALA 1ZUZA 1DJIA 2BECA 1UHKA 1G8IA 2JRFA 2LM5A 1ZMZA 2LE9B 2JU0A 3HX4A 3BXKA 1OSAA 2ZRTA 1CLLA 4GGNA 1IJ5A 2CBLA 2PASA 5HKYA 4R1EA 1KQMC 1PALA 4N5XA 4ORBB 1TN4A 2L4HA 2KYFA 1YX7A 1SPYA 3K21A 1KK8B 1BR1B 1X02A 2L4IA 3BUMB 4UPGA 1LKJA 1XFWO 4DCKA 1IG5A 1M45A 5ER5A 2BBNA 1SYMA 2JTZA 2LVJA 2ZKMX 3PM8A 2FCEA 1PRWA 1J7RA 1QVIZ 4HREE 3EVUA 2SCPA 3AAJA 2EC6C 3D0YA 3FIAA 1DF0B 3NSIA 1DJWA 1A75A 4QJ5B 3KPXA 3SG3A 2KI4B 1XFVO 2LVKA 1AUIB 1KK8C 1ALVA 2I18A 1KFUS 1HQVA 3TDZA 4A4CA 4QJ3B 3TS5B 3WXAA 1GJYA 2H61C 3RM1A 1DJHA 4TNCA 1MUXA 1IKUA 1RROA 1M31A 1KCYA 1AJ5A 2MLEC 5I2LA 1WRLA 1F8HA 5AFPA 4IL1A 1B47A 4MZKA 3CWGA 3DVMA 4L9MA 1A4PA 3OB1B 1SCVA 3BUXB 2R2IA 2PMYA 1R2UA 3TS5C 2JNXA 3WHUB 1NX0A 1CB1A 1QV0A 2OPOA 3SIAA 1SRAA 2WCEA 2ZN8A 3PATA 5KSZA 2BKIB 2KQYA 2KDHA 1F70A 2WCFA 1F71A 3WHTB 1OZOA 1BODA 4N1GA 1BR4B 3LLEA 1CM1A 2F2OA 5D69A 3JTDB 1S6JA 4Q04A 3MSEB 2F2PA 1RFJA 4XJKA 4MSPA 2JULA 3PSRA 5D7FA 2LNKA 2SASA 5DKRA 2I94A 1DT7B 3RLZA 3I5FC 3ICBA 4FTGA 4ICBA 1IJ6A 1NX1A 1CDMA 3LK0A 1TCFA 2F3YA 2Y4QA 4ZCUA 5HYDA 2CCMA 1SL8A 5DKQA 1Q80A 1WDCB 4PHKA 3JTDC 3JVTB 3FWCA 3VGOA 1G4YR 1ODBA 2JXLA 3DF0B 1FF1A 2L0PA 1YUSA 4YGBB 3SIBA 1W7IB 1WY9A 2L98A 1S3PA 3CR2A 1G33A 5J3XA 4WQ3A 1FPWA 1SR6C 4OR9B 1DMOA 1DVIA 4E68A 4PHJA 1JSAA 2O60A 1B8LA 2L2EA 2KFGA 4MZLA 4PE4A 1FI5A 3JVTC 1GGWA 1IWQA 2EHBA 2A4JA 1M63B 3DD4A 2OS8B 2Q91A 1Y0VH 2M0RA 1BMOA 1BF5A 1TTXA 3KHEA 3NXAA 2KQ6A 4GPLB 2G2BA 3LCPC 1NX3A 3GK1A 5HKWA 2JZIA 1EL4A 1OQPA 2K61A 1UHNA 4I5LB 1NCXA 1S5GY 2BBMA 1PVBA 2LLUA 3SG6A 1CFFA 5AERA 1TIZA 4PE1A 1CMFA 2L51A 4D1EA 1ZACA 2OS8C 2PVBA 2JXCA 2RGIA 2KGBC 3DVKA 3TZ1A 4U8DA 1J55A 2I2RE 4CFQA 1SMGA 1SCMC 3EK4A 4I5KA 4DIRA 1AK8A 1A03A 1AVSA 3FWBA 1YVLA 3VRQA 1LXFC 2FOTA 2BCBA 5ER4X 1PVAA 3EK8A 2L50A 4OVNF 2HQ8A 5CPVA 1DF0A 2BKHB 2KBMA 3BUNB 2LVIA 2LMUA 1S5GZ 2EC6B 2M9GA 5TNCA 1MXEA 1W7JB 2NCPA 1K9PA 1V1FA 4GGFA 5F6TA 3TUYC 1EXRA 2ZNDA 3VROA 3EVVA 4MLWA 5AXIA 3SG5A 4JWQA 2O5GA 3BUOB 4GAOA 5HLOA 5B8IB 4A4BA 4OKHA 1XFXO 2NLNA 5GQQC 2V53A 1TNQA 2JT8A 1TRFA 2JWWA 3NSKA 1K94A 1IQ3A 1SKTA 1RK9A 1L2OB 1NCZA 2GGMA 2Y1NA 1QIVA 2Y1MA 2NXQA 4M2QA 4YRUA 5IBWA 1J7QA 3VRNA 2KOTA 3I5IB 2LANA 4YGCB 4HRGA 3SG4A 1KFUL 3ZNIA 5CSNA 1K8UA 2E30A 4AQIA 2LHIA 4HSZA 1U5IB 2M49B 4MVFA 5AEQA 5HKZA 4NQGA 4F0ZB 1NSHA 2WOSA 3LK1A 5CSIA 2OTGB 2LMTA 5AANA 1C7WA 2NCOA 1L2OC 2Y5IA 3AAKA 1FBVA 3I5IC 1DJZA 1B9AA 4CFRA 1PULA 2PRUA 3TDIA 1LA3A 1KSMA 5I8NA 1GQMA 1F4OA 2CT9A 2HQWA 3CLNA 2M7NA 4I5NB 1B1GA 1MXLC 5I2OA 3I5FB 3CR5X 1N0YA 2OTGC 4CLNA 3O6BA 4BY5A 1ZFSA 3SJSA 1OZSA 1IRJA 2WORA 1KSOA 1K95A 1IGVA 1M39A 2CNPA 2MJWB 3DF0A 3OX6A 1EJ3A 1UWOA 1CTRA 1RTP1 2K0JA 3AKAA 1K9UA 1M46A 1QX7A 5G08A 2JC2A 1UHHA 4NDCA 1H8BA 2E6WA 3CTNA 1XYDA 1QIWA 3EKHA 3IF7A 2CTNA 3PFVA 1F54A 1SR6B 3KO0A 1J1EA 2KSPA 1OMRA 1S26D 4GFTA 1PSBA 2PALA 4HRHA 1Y6WA 2LC5A 2P6BB 3OB2B 1VRKA 4M2OA 4OCIA 1WRKA 2LUXA 1XFUO 1QX5B 2WCBA 1CKKA 2TN4A 4MZJA 1CDPA 2BL0C 3AKBA 1TCOB 4C0LA 2KGRA 1XA5A 4WRIA 1AP4A 2MBXA 3GK2A 3F45A 1SW8A 1CFPA 3H4SE 1WLZA 1JWDA 1QLSA 1TOPA 2ISDA 2F33A 3QRXA 1YX8A 4PHMA 1BJFA 1B8RA 1SCMB 1CMGA 2BE6A 2K7OA 2QACA 1SBJA 2JQ6A 3CZTX 4I5JA 1MQ1A 2FJUB 2HF5A 1KK7Y 2GGZA 1N2DA 4PCWA 1B4CA 3PALA 1BOCA 2KNEA 1YTZC 1UUSA 1XK4C 2MHHA 2ZNEA 2COLB 2HPSA 1YR5A 2H61A 2LHLA 2BCAA 2MAZA 2ZFDA 3TUYB 3WNXB 3C1VA 3HCMA 1YUUA 3BYAA 1NP8A 4MRYA 2K7BA 2KAXA 1QTXA 1WLMA 4PHNA 1Y1UA 1K93D 4YGEB 4YBHB 3EVRA 3KF9A 1K9KA 3EK7A 1NWDA 1KFXS 1YRTB 5I2QA 3CGAA 1N65A 5PALA 1CM4A 1H4BA 1B8CA 1U5IA 2ZN9A 4MEWA 3OHMB 1FW4A 2MA2A 4MN0A 4P5OE 2LLSA 1S6CA 1MR8A 2QPTA 5FYXA 3O78A 2JPTA 2LV7A 2M29A 2M97A 1F4QA 2M8UA 1L7ZA 1QJTA 2DOQA 3A8RA 1SY9A 1JC2A 2KFHA 4ZCVA 2JNFA 4ORAB 3PLFB 1UP5A 1QX2A 1GGZA 3FS7A 3BOWA 3SG7A 2K2AA 5DKNA 1RWYA 1SL7A 1YURA 4PE0A 2AAOA 3I5HC 2LP3A 3KEVA 1CLBA 1J7PA 1CDLA 4MRXA 1XFYO 1UURA 4FQOA 1NCYA 3IQQA 2K8MB 3O2PA 2B1UA 1OE9B 1Y1XA 2KFFA 2D8NA 4PDZA 4WQ2A 1J7OA 1YVHA 4YGDB 5K89A 4NDBA 4PE7A 3GOFA 1DGUA 2BE4A 1AHRA 4M2PA 1LVCD 3D10A 2LMVA 3BUWB 3NSLA 1MHOA 3BOWB 4GUKA 1EG4A 1SNLA 2KHNA 2Q4UA 1CFDA 3E3RA 1RECA 2NZ0A 2I7AA 1K2HA 2M3WA 4P2YB 3ZWHA 1QV1A 1Y1AA 4BY4A 1CFCA 1CLMA 1J1DA 1PK0D 3VRRA 1UHJA 1S1EA 2F8PA 3OP0A 2MLFC 4JQ0D 5CSJA 2KI4C 2FCDA 1BG1A 3D0YB 5JJGA 2KBIA 1YRUB 2JTTA 1A75B 1DGVA 1MF8B 2LUCA 1F55A 2K7CA 1JF2A 1NPQA 1DJYA 2GV5A 4GGFC 2LCPA 1EH2A 5HLVA 1BU3A 2BL0B 2LP2A 2VRGA 1NIWA 2CXJA 3SG2A 2K7DA 1XK4A 2LLTA 1R6PA 2KYCA 1S6IA 2F3ZA 2EGDA 1FI6A 4MBEA 1SK6D 3DVJA 4NDDA 1V1GA 2H2KA 1BLQA 5KTYA 5JOLA 4JPZB 4CPVA 2PSRA 3GK4X 4YGAA 1JF0A 1JFKA 2K2FA 2M1UA 5KU1A 3EKJA 4ETOA 3PN7B 3OX5A 1QLKA 4QJ4B 1A2XA 1IQ5A 1EG3A 2ZRSA 1HT9A 2JT0A 1TNPA 1ZOTB 2WNDA 1CDNA 5CSFA 2MRDA 1SL9A 3I5GB 4DRWA 1NUBA 1YUTA 4CIDA 3M0WA 2KI6C 2LVVA 1XVJA 1QS7A 3A4UB 3DVEA 2KAVA 1BT6A 4OV2A 4DUQA 1DJGA 1IH0A 2L5XB 3PN7C 1JBAA 4XJKB 4C0KA 2JOJA 2KI6D 2LAPA 3LL8B 4YI8A 1MWNA 1C07A 3BQ3A 2KAYA 1WDCC 4ORCB 1B7TY 3VRPA 1LINA 1UHIA 3I5GC 3TDUA 1XO5A 2AUCA 1WRZA 1OMVA 1AJ4A 1KWOB 1NYAA 1K96A 2AMIA 4USLA 4AOMA 1QATA 1XFZO 2JT3A 3O4YA 1CNPA 1DTLA 1KQVA 1JUOA 3CR4X 1JFJA 4XYNA 4C0JA 1ALWA 1DJXA 1OOJA 1OMDA 1LA0A 1QXPA 2M1KB 1KFXL 1RJVA 1D1OA 4AQJA 1A29A 2HETA 4N1FA 3CS1A 1KK7Z 1KWOC 1K90D 2BCXA 3IQOA 4YI9A 5BPJA 4GBAA 1B7TZ 1NX2A 2M7LA 1KQMB 2WC8A 1E8AA 1C7VA
chains in the Genus database with same CATH superfamily
3I5HB 3NSOA 1TNXA 1QASA 4GNKB 1S36A 1QVIY 2G9BA 2IS9A 1TNWA 4DS7A 1PSRA 4PALA 1ZUZA 1DJIA 2BECA 2FJYA 5HL1A 1UHKA 3S0GA 1G8IA 2JRFA 2LM5A 1ZMZA 2LE9B 2JU0A 3HX4A 3BXKA 1OSAA 1XFRA 1CLLA 2ZRTA 1IJ5A 4GGNA 2CBLA 2PASA 5HKYA 4R1EA 1KQMC 1PALA 4N5XA 4ORBB 1TN4A 2L4HA 2KYFA 1YX7A 1SPYA 3K21A 1KK8B 1BR1B 1X02A 2L4IA 3DZTA 3BUMB 4UPGA 1LKJA 1XFWO 4DCKA 3NGVA 1IG5A 1M45A 5ER5A 2BBNA 1C3YA 1SYMA 2JTZA 2LVJA 2ZKMX 3PM8A 2FCEA 1PRWA 1J7RA 1QVIZ 4HREE 3EVUA 2SCPA 3AAJA 2EC6C 3D0YA 3FIAA 1DF0B 3NSIA 1DJWA 1A75A 4QJ5B 3KPXA 3CABA 3SG3A 2KI4B 1XFVO 2LVKA 1AUIB 1KK8C 2P70A 3CZ1A 1ALVA 2I18A 1KFUS 1HQVA 3TDZA 1DEKA 4QJ3B 3TS5B 3WXAA 1GJYA 1TWOA 2H61C 3RM1A 1GM0A 1DJHA 4TNCA 1MUXA 1IKUA 1RROA 1M31A 3SS5A 1KCYA 1AJ5A 2MLEC 3BFAA 5I2LA 1WRLA 1F8HA 3R1OA 5AFPA 2QEOA 4IL1A 1B47A 4MZKA 3CWGA 3DVMA 4L9MA 1A4PA 3OB1B 1SCVA 3K1EA 3BUXB 2R2IA 5EL2A 2PMYA 1R2UA 3TS5C 2JNXA 2QEHA 1NX0A 3WHUB 1CB1A 1QV0A 2OPOA 2QDIA 3SIAA 1SRAA 2WCEA 2ZN8A 3PATA 5KSZA 2BKIB 2KQYA 2KDHA 1F70A 3PM2A 2WCFA 3UNWA 1F71A 3SS3A 3WHTB 1OZOA 1BODA 4N1GA 1BR4B 3LLEA 1CM1A 2F2OA 5D69A 3JTDB 1S6JA 4Q04A 3MSEB 2F2PA 1RFJA 4XJKA 4MSPA 2JULA 3PSRA 5D7FA 2LNKA 2SASA 3B86A 2I94A 5DKRA 1DT7B 3RLZA 3UO9A 3I5FC 3ICBA 4FTGA 4ICBA 1IJ6A 1NX1A 1CDMA 1TUZA 3LK0A 1TCFA 2F3YA 2WCKA 2Y4QA 3QMEA 2CCMA 1SL8A 5DKQA 4ZCUA 5HYDA 3BFHA 1Q80A 1WDCB 4PHKA 3JTDC 3JVTB 2PYQA 3FWCA 3VGOA 1G4YR 1ODBA 2JXLA 3DF0B 3S0AA 1FF1A 2L0PA 1YUSA 2GTEA 4YGBB 3SIBA 1W7IB 1WY9A 2L98A 1S3PA 3CR2A 1G33A 5J3XA 4WQ3A 1FPWA 1SR6C 4OR9B 1DMOA 1DVIA 4E68A 4PHJA 1JSAA 2O60A 1B8LA 2L2EA 2KFGA 4MZLA 1ORGA 4PE4A 1FI5A 3JVTC 3NHIA 1GGWA 3NHTA 1OOGA 1IWQA 2EHBA 2A4JA 1M63B 3DD4A 2OS8B 2Q91A 2P71A 1Y0VH 2M0RA 1BMOA 1BF5A 3L4LA 1TTXA 3KHEA 3NXAA 1T14A 2KQ6A 2G2BA 3LCPC 4GPLB 1NX3A 3GK1A 5HKWA 3D73A 2JZIA 1EL4A 1OQPA 2K61A 1UHNA 4I5LB 1NCXA 1S5GY 2BBMA 1PVBA 2LLUA 3SG6A 1CFFA 5AERA 1TIZA 4PE1A 2BAPA 1CMFA 2L51A 4D1EA 1ZACA 3IVTA 3BFBA 2OS8C 2PVBA 2JXCA 2RGIA 2KGBC 3DVKA 3TZ1A 4U8DA 1J55A 2I2RE 4CFQA 1SMGA 1SCMC 3EK4A 4I5KA 4DIRA 1AK8A 1A03A 1AVSA 3FWBA 1YVLA 3VRQA 1LXFC 2FOTA 2BCBA 5ER4X 1PVAA 2K60A 3EK8A 1DELA 2L50A 3D74A 4OVNF 2HQ8A 5CPVA 1DF0A 2BKHB 2KBMA 3BUNB 2LVIA 2LMUA 3L47A 2H8VA 1S5GZ 2EC6B 2WC6A 2M9GA 5TNCA 1MXEA 1W7JB 2NCPA 1K9PA 1V1FA 4GGFA 5F6TA 3TUYC 1EXRA 2ZNDA 4INWA 3VROA 3EVVA 4MLWA 5AXIA 3SG5A 4JWQA 2O5GA 3BUOB 4GAOA 5HLOA 5B8IB 4A4BA 4OKHA 1XFXO 2NLNA 5GQQC 2V53A 1TNQA 2JT8A 3FE8A 1TRFA 2JWWA 3NSKA 1K94A 1IQ3A 1SKTA 1RK9A 1L2OB 1NCZA 2GGMA 2Y1NA 1QIVA 2Y1MA 2NXQA 4M2QA 4YRUA 5IBWA 1J7QA 3VRNA 2KOTA 3I5IB 2LANA 4YGCB 4HRGA 3SG4A 1KFUL 3ZNIA 5CSNA 1K8UA 2E30A 4AQIA 2LHIA 4HSZA 1U5IB 2M49B 4MVFA 5AEQA 5HKZA 3DYEA 4NQGA 4F0ZB 5I94A 1NSHA 2WOSA 3LK1A 5CSIA 2OTGB 2LMTA 5AANA 1C7WA 2NCOA 1L2OC 2Y5IA 3AAKA 1FBVA 3I5IC 1DJZA 3EG5B 1B9AA 4CFRA 1PULA 2PRUA 2WC5A 3TDIA 1LA3A 1KSMA 1Z4HA 5I8NA 1GQMA 1F4OA 2CT9A 2HQWA 3CLNA 2M7NA 4I5NB 1B1GA 1MXLC 5I2OA 3I5FB 3CR5X 1N0YA 2OTGC 4CLNA 3O6BA 4BY5A 1ZFSA 4IJ7A 3SJSA 1OZSA 1IRJA 1OOHA 2WORA 1KSOA 1K95A 1IGVA 1M39A 3CDNA 4PT1A 2CNPA 2MJWB 3DF0A 3OX6A 3D78A 3VB1A 1EJ3A 1UWOA 1CTRA 1RTP1 2K0JA 3AKAA 1K9UA 1M46A 1QX7A 5G08A 2JC2A 1UHHA 3B88A 4NDCA 1H8BA 2E6WA 4JKTA 3CTNA 1XYDA 1QIWA 3EKHA 3IF7A 2CTNA 3PFVA 1F54A 1SR6B 2WCLA 3KO0A 1J1EA 2KSPA 2WCMA 1DC1A 1OMRA 1S26D 4GFTA 1PSBA 2PALA 4HRHA 4FQTA 1Y6WA 2LC5A 2ERBA 2P6BB 3CZ2A 3OB2B 1VRKA 4M2OA 4OCIA 1WRKA 2LUXA 1XFUO 1QX5B 2WCBA 1CKKA 2TN4A 4MZJA 1CDPA 2BL0C 3AKBA 1TCOB 1W9ZA 2KGRA 4C0LA 1XA5A 4WRIA 1OOFA 3FE9A 3D75A 1AP4A 2MBXA 3GK2A 3F45A 1SW8A 5D3OA 1CFPA 3H4SE 1WLZA 1JWDA 1QLSA 5DICA 1TOPA 2ISDA 2F33A 3QRXA 1YX8A 4PHMA 1BJFA 1B8RA 1SCMB 1CMGA 3S0FA 2BE6A 2K7OA 2QACA 1SBJA 2JQ6A 3CZTX 4I5JA 1MQ1A 2FJUB 2HF5A 1KK7Y 2GGZA 1N2DA 4PCWA 1B4CA 3PALA 1BOCA 2KNEA 1YTZC 1UUSA 1XK4C 2MHHA 2ZNEA 2COLB 2HPSA 1YR5A 2H61A 2LHLA 2BCAA 2MAZA 2ZFDA 3TUYB 3WNXB 3C1VA 3HCMA 1YUUA 2PQLA 3BYAA 1NP8A 4MRYA 3OGNA 2K7BA 2KAXA 1QTXA 1WLMA 4PHNA 1Y1UA 1K93D 4YGEB 4YBHB 4A4CA 3EVRA 3KF9A 1K9KA 3EK7A 3BJHA 1NWDA 2KLEA 1KFXS 1YRTB 2JPOA 5I2QA 3SS4A 3B6XA 2WCHA 3CGAA 1N65A 5PALA 1CM4A 2KPHA 1B8CA 1U5IA 2ZN9A 4MEWA 1H4BA 3OHMB 3S0DA 1FW4A 2KLDA 2MA2A 3B87A 2LLSA 1S6CA 1MR8A 2QPTA 3DY9A 4MN0A 4P5OE 5FYXA 3O78A 2JPTA 2LV7A 2M29A 3L4AA 2M97A 1C3ZA 1F4QA 2M8UA 1L7ZA 2L5YA 1QJTA 2DOQA 3RZSA 3A8RA 1SY9A 1JC2A 2KFHA 4ZCVA 2JNFA 4ORAB 3PLFB 1UP5A 1QX2A 1GGZA 3FS7A 3BOWA 3D76A 2WCJA 3SG7A 2K2AA 3B7AA 5DKNA 2YGUA 1RWYA 1SL7A 1YURA 4PE0A 2AAOA 3I5HC 2LP3A 3KEVA 1CLBA 1J7PA 1CDLA 4MRXA 1XFYO 1UURA 4FQOA 1NCYA 1P28A 3IQQA 2K8MB 3O2PA 2B1UA 1OE9B 1Y1XA 2KFFA 2D8NA 4PDZA 4WQ2A 1J7OA 1YVHA 4YGDB 3V2LA 5K89A 4NDBA 4PE7A 3GOFA 1DGUA 2BE4A 1AHRA 4M2PA 1LVCD 3D10A 2LMVA 3BUWB 3NSLA 1MHOA 3BOWB 4GUKA 3R1VA 1EG4A 4INXA 1SNLA 2KHNA 2Q4UA 1CFDA 3E3RA 1RECA 2NZ0A 2I7AA 2QEVA 1K2HA 2M3WA 4P2YB 3R72A 2L2CA 3ZWHA 1QV1A 3CZ0A 1Y1AA 4BY4A 1CFCA 4OZDA 1CLMA 1J1DA 1PK0D 3VRRA 1QWVA 1UHJA 1S1EA 2F8PA 3OP0A 2MLFC 4JQ0D 5CSJA 2QEBA 2KI4C 2FCDA 3S0BA 1BG1A 3D0YB 3O4XA 2KBIA 5JJGA 1YRUB 2JTTA 1A75B 1DGVA 1MF8B 2LUCA 1F55A 2K7CA 1JF2A 1NPQA 1DJYA 2GV5A 3FE6A 2LCPA 4GGFC 5HLVA 1EH2A 1BU3A 2BL0B 2LP2A 2VRGA 1NIWA 2CXJA 3SG2A 2K7DA 1XK4A 2LLTA 1R6PA 2KYCA 1S6IA 2F3ZA 2EGDA 1FI6A 4MBEA 1SK6D 3DVJA 4NDDA 1V1GA 2H2KA 1BLQA 1TUJA 5KTYA 3PJIA 5JOLA 4JPZB 4CPVA 2PSRA 3GK4X 4YGAA 1JF0A 1JFKA 2K2FA 2M1UA 5KU1A 1SSEB 3EKJA 4ETOA 1OW4A 3D77A 1OOIX 3PN7B 3OX5A 1QLKA 4QJ4B 1A2XA 1IQ5A 1EG3A 2ZRSA 1HT9A 2JT0A 3CYZA 1TNPA 1ZOTB 2WNDA 1CDNA 5CSFA 2MRDA 1Z2CB 1SL9A 3I5GB 4DRWA 1NUBA 1YUTA 4KYNA 4CIDA 3M0WA 2KI6C 2LVVA 1XVJA 1QS7A 3A4UB 3DVEA 2KAVA 1BT6A 4OV2A 4DUQA 1DJGA 1IH0A 3R1PA 2L5XB 3PN7C 1JBAA 4XJKB 4C0KA 2JOJA 2KI6D 2LAPA 3LL8B 4YI8A 5FI7A 1MWNA 1C07A 3BQ3A 2KAYA 1WDCC 4ORCB 1B7TY 3VRPA 1LINA 1UHIA 3I5GC 3DXLA 3TDUA 1XO5A 2AUCA 1WRZA 2BNXA 1OMVA 1AJ4A 1KWOB 1NYAA 1K96A 2AMIA 5FI6A 4JD9A 4USLA 4AOMA 1QATA 1XFZO 2JT3A 3O4YA 1CNPA 1DQEA 5FI2A 1DTLA 4F7FA 1KQVA 1JUOA 1IIOA 3CR4X 1JFJA 4XYNA 4C0JA 3S0EA 1ALWA 1DJXA 1OOJA 1OMDA 1QXPA 1LA0A 2M1KB 1KFXL 1LS8A 1RJVA 1D1OA 4AQJA 1A29A 2HETA 4N1FA 3CS1A 1KK7Z 1KWOC 1K90D 2BCXA 3IQOA 4YI9A 5BPJA 4GBAA 1B7TZ 1NX2A 2M7LA 1KQMB 2WC8A 3Q8IA 1E8AA 3N7HA 3OBVA 1C7VA
chains in the Genus database with same CATH topology
3I5HB 3NSOA 1TNXA 1QASA 4GNKB 1S36A 1QVIY 2G9BA 2IS9A 1TNWA 4DS7A 1PSRA 4PALA 1ZUZA 1DJIA 2BECA 1UHKA 1G8IA 2JRFA 2LM5A 1ZMZA 2LE9B 2JU0A 3HX4A 3BXKA 1OSAA 2ZRTA 1CLLA 4GGNA 1IJ5A 2CBLA 2PASA 5HKYA 4R1EA 1KQMC 1PALA 4N5XA 4ORBB 1TN4A 2L4HA 2KYFA 1YX7A 1SPYA 3K21A 1KK8B 1BR1B 1X02A 2L4IA 3BUMB 4UPGA 1LKJA 1XFWO 4DCKA 1IG5A 1M45A 5ER5A 2BBNA 1SYMA 2JTZA 2LVJA 2ZKMX 3PM8A 2FCEA 1PRWA 1J7RA 1QVIZ 4HREE 3EVUA 2SCPA 3AAJA 2EC6C 3D0YA 3FIAA 1DF0B 3NSIA 1DJWA 1A75A 4QJ5B 3KPXA 3SG3A 2KI4B 1XFVO 2LVKA 1AUIB 1KK8C 1ALVA 2I18A 1KFUS 1HQVA 3TDZA 4A4CA 4QJ3B 3TS5B 3WXAA 1GJYA 2H61C 3RM1A 1DJHA 4TNCA 1MUXA 1IKUA 1RROA 1M31A 1KCYA 1AJ5A 2MLEC 5I2LA 1WRLA 1F8HA 5AFPA 4IL1A 1B47A 4MZKA 3CWGA 3DVMA 4L9MA 1A4PA 3OB1B 1SCVA 3BUXB 2R2IA 2PMYA 1R2UA 3TS5C 2JNXA 3WHUB 1NX0A 1CB1A 1QV0A 2OPOA 3SIAA 1SRAA 2WCEA 2ZN8A 3PATA 5KSZA 2BKIB 2KQYA 2KDHA 1F70A 2WCFA 1F71A 3WHTB 1OZOA 1BODA 4N1GA 1BR4B 3LLEA 1CM1A 2F2OA 5D69A 3JTDB 1S6JA 4Q04A 3MSEB 2F2PA 1RFJA 4XJKA 4MSPA 2JULA 3PSRA 5D7FA 2LNKA 2SASA 5DKRA 2I94A 1DT7B 3RLZA 3I5FC 3ICBA 4FTGA 4ICBA 1IJ6A 1NX1A 1CDMA 3LK0A 1TCFA 2F3YA 2Y4QA 4ZCUA 5HYDA 2CCMA 1SL8A 5DKQA 1Q80A 1WDCB 4PHKA 3JTDC 3JVTB 3FWCA 3VGOA 1G4YR 1ODBA 2JXLA 3DF0B 1FF1A 2L0PA 1YUSA 4YGBB 3SIBA 1W7IB 1WY9A 2L98A 1S3PA 3CR2A 1G33A 5J3XA 4WQ3A 1FPWA 1SR6C 4OR9B 1DMOA 1DVIA 4E68A 4PHJA 1JSAA 2O60A 1B8LA 2L2EA 2KFGA 4MZLA 4PE4A 1FI5A 3JVTC 1GGWA 1IWQA 2EHBA 2A4JA 1M63B 3DD4A 2OS8B 2Q91A 1Y0VH 2M0RA 1BMOA 1BF5A 1TTXA 3KHEA 3NXAA 2KQ6A 4GPLB 2G2BA 3LCPC 1NX3A 3GK1A 5HKWA 2JZIA 1EL4A 1OQPA 2K61A 1UHNA 4I5LB 1NCXA 1S5GY 2BBMA 1PVBA 2LLUA 3SG6A 1CFFA 5AERA 1TIZA 4PE1A 1CMFA 2L51A 4D1EA 1ZACA 2OS8C 2PVBA 2JXCA 2RGIA 2KGBC 3DVKA 3TZ1A 4U8DA 1J55A 2I2RE 4CFQA 1SMGA 1SCMC 3EK4A 4I5KA 4DIRA 1AK8A 1A03A 1AVSA 3FWBA 1YVLA 3VRQA 1LXFC 2FOTA 2BCBA 5ER4X 1PVAA 3EK8A 2L50A 4OVNF 2HQ8A 5CPVA 1DF0A 2BKHB 2KBMA 3BUNB 2LVIA 2LMUA 1S5GZ 2EC6B 2M9GA 5TNCA 1MXEA 1W7JB 2NCPA 1K9PA 1V1FA 4GGFA 5F6TA 3TUYC 1EXRA 2ZNDA 3VROA 3EVVA 4MLWA 5AXIA 3SG5A 4JWQA 2O5GA 3BUOB 4GAOA 5HLOA 5B8IB 4A4BA 4OKHA 1XFXO 2NLNA 5GQQC 2V53A 1TNQA 2JT8A 1TRFA 2JWWA 3NSKA 1K94A 1IQ3A 1SKTA 1RK9A 1L2OB 1NCZA 2GGMA 2Y1NA 1QIVA 2Y1MA 2NXQA 4M2QA 4YRUA 5IBWA 1J7QA 3VRNA 2KOTA 3I5IB 2LANA 4YGCB 4HRGA 3SG4A 1KFUL 3ZNIA 5CSNA 1K8UA 2E30A 4AQIA 2LHIA 4HSZA 1U5IB 2M49B 4MVFA 5AEQA 5HKZA 4NQGA 4F0ZB 1NSHA 2WOSA 3LK1A 5CSIA 2OTGB 2LMTA 5AANA 1C7WA 2NCOA 1L2OC 2Y5IA 3AAKA 1FBVA 3I5IC 1DJZA 1B9AA 4CFRA 1PULA 2PRUA 3TDIA 1LA3A 1KSMA 5I8NA 1GQMA 1F4OA 2CT9A 2HQWA 3CLNA 2M7NA 4I5NB 1B1GA 1MXLC 5I2OA 3I5FB 3CR5X 1N0YA 2OTGC 4CLNA 3O6BA 4BY5A 1ZFSA 3SJSA 1OZSA 1IRJA 2WORA 1KSOA 1K95A 1IGVA 1M39A 2CNPA 2MJWB 3DF0A 3OX6A 1EJ3A 1UWOA 1CTRA 1RTP1 2K0JA 3AKAA 1K9UA 1M46A 1QX7A 5G08A 2JC2A 1UHHA 4NDCA 1H8BA 2E6WA 3CTNA 1XYDA 1QIWA 3EKHA 3IF7A 2CTNA 3PFVA 1F54A 1SR6B 3KO0A 1J1EA 2KSPA 1OMRA 1S26D 4GFTA 1PSBA 2PALA 4HRHA 1Y6WA 2LC5A 2P6BB 3OB2B 1VRKA 4M2OA 4OCIA 1WRKA 2LUXA 1XFUO 1QX5B 2WCBA 1CKKA 2TN4A 4MZJA 1CDPA 2BL0C 3AKBA 1TCOB 4C0LA 2KGRA 1XA5A 4WRIA 1AP4A 2MBXA 3GK2A 3F45A 1SW8A 1CFPA 3H4SE 1WLZA 1JWDA 1QLSA 1TOPA 2ISDA 2F33A 3QRXA 1YX8A 4PHMA 1BJFA 1B8RA 1SCMB 1CMGA 2BE6A 2K7OA 2QACA 1SBJA 2JQ6A 3CZTX 4I5JA 1MQ1A 2FJUB 2HF5A 1KK7Y 2GGZA 1N2DA 4PCWA 1B4CA 3PALA 1BOCA 2KNEA 1YTZC 1UUSA 1XK4C 2MHHA 2ZNEA 2COLB 2HPSA 1YR5A 2H61A 2LHLA 2BCAA 2MAZA 2ZFDA 3TUYB 3WNXB 3C1VA 3HCMA 1YUUA 3BYAA 1NP8A 4MRYA 2K7BA 2KAXA 1QTXA 1WLMA 4PHNA 1Y1UA 1K93D 4YGEB 4YBHB 3EVRA 3KF9A 1K9KA 3EK7A 1NWDA 1KFXS 1YRTB 5I2QA 3CGAA 1N65A 5PALA 1CM4A 1H4BA 1B8CA 1U5IA 2ZN9A 4MEWA 3OHMB 1FW4A 2MA2A 4MN0A 4P5OE 2LLSA 1S6CA 1MR8A 2QPTA 5FYXA 3O78A 2JPTA 2LV7A 2M29A 2M97A 1F4QA 2M8UA 1L7ZA 1QJTA 2DOQA 3A8RA 1SY9A 1JC2A 2KFHA 4ZCVA 2JNFA 4ORAB 3PLFB 1UP5A 1QX2A 1GGZA 3FS7A 3BOWA 3SG7A 2K2AA 5DKNA 1RWYA 1SL7A 1YURA 4PE0A 2AAOA 3I5HC 2LP3A 3KEVA 1CLBA 1J7PA 1CDLA 4MRXA 1XFYO 1UURA 4FQOA 1NCYA 3IQQA 2K8MB 3O2PA 2B1UA 1OE9B 1Y1XA 2KFFA 2D8NA 4PDZA 4WQ2A 1J7OA 1YVHA 4YGDB 5K89A 4NDBA 4PE7A 3GOFA 1DGUA 2BE4A 1AHRA 4M2PA 1LVCD 3D10A 2LMVA 3BUWB 3NSLA 1MHOA 3BOWB 4GUKA 1EG4A 1SNLA 2KHNA 2Q4UA 1CFDA 3E3RA 1RECA 2NZ0A 2I7AA 1K2HA 2M3WA 4P2YB 3ZWHA 1QV1A 1Y1AA 4BY4A 1CFCA 1CLMA 1J1DA 1PK0D 3VRRA 1UHJA 1S1EA 2F8PA 3OP0A 2MLFC 4JQ0D 5CSJA 2KI4C 2FCDA 1BG1A 3D0YB 5JJGA 2KBIA 1YRUB 2JTTA 1A75B 1DGVA 1MF8B 2LUCA 1F55A 2K7CA 1JF2A 1NPQA 1DJYA 2GV5A 4GGFC 2LCPA 1EH2A 5HLVA 1BU3A 2BL0B 2LP2A 2VRGA 1NIWA 2CXJA 3SG2A 2K7DA 1XK4A 2LLTA 1R6PA 2KYCA 1S6IA 2F3ZA 2EGDA 1FI6A 4MBEA 1SK6D 3DVJA 4NDDA 1V1GA 2H2KA 1BLQA 5KTYA 5JOLA 4JPZB 4CPVA 2PSRA 3GK4X 4YGAA 1JF0A 1JFKA 2K2FA 2M1UA 5KU1A 3EKJA 4ETOA 3PN7B 3OX5A 1QLKA 4QJ4B 1A2XA 1IQ5A 1EG3A 2ZRSA 1HT9A 2JT0A 1TNPA 1ZOTB 2WNDA 1CDNA 5CSFA 2MRDA 1SL9A 3I5GB 4DRWA 1NUBA 1YUTA 4CIDA 3M0WA 2KI6C 2LVVA 1XVJA 1QS7A 3A4UB 3DVEA 2KAVA 1BT6A 4OV2A 4DUQA 1DJGA 1IH0A 2L5XB 3PN7C 1JBAA 4XJKB 4C0KA 2JOJA 2KI6D 2LAPA 3LL8B 4YI8A 1MWNA 1C07A 3BQ3A 2KAYA 1WDCC 4ORCB 1B7TY 3VRPA 1LINA 1UHIA 3I5GC 3TDUA 1XO5A 2AUCA 1WRZA 1OMVA 1AJ4A 1KWOB 1NYAA 1K96A 2AMIA 4USLA 4AOMA 1QATA 1XFZO 2JT3A 3O4YA 1CNPA 1DTLA 1KQVA 1JUOA 3CR4X 1JFJA 4XYNA 4C0JA 1ALWA 1DJXA 1OOJA 1OMDA 1LA0A 1QXPA 2M1KB 1KFXL 1RJVA 1D1OA 4AQJA 1A29A 2HETA 4N1FA 3CS1A 1KK7Z 1KWOC 1K90D 2BCXA 3IQOA 4YI9A 5BPJA 4GBAA 1B7TZ 1NX2A 2M7LA 1KQMB 2WC8A 1E8AA 1C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5H B;  3NSO A;  1TNX A;  1QAS A;  4GNK B;  1S36 A;  1QVI Y;  2G9B A;  2IS9 A;  1TNW A;  4DS7 A;  1PSR A;  4PAL A;  1ZUZ A;  1DJI A;  2BEC A;  1UHK A;  1G8I A;  2JRF A;  2LM5 A;  1ZMZ A;  2LE9 B;  2JU0 A;  3HX4 A;  3BXK A;  1OSA A;  2ZRT A;  1CLL A;  4GGN A;  1IJ5 A;  2CBL A;  2PAS A;  5HKY A;  4R1E A;  1KQM C;  1PAL A;  4N5X A;  4ORB B;  1TN4 A;  2L4H A;  2KYF A;  1YX7 A;  1SPY A;  3K21 A;  1KK8 B;  1BR1 B;  1X02 A;  2L4I A;  3BUM B;  4UPG A;  1LKJ A;  1XFW O;  4DCK A;  1IG5 A;  1M45 A;  5ER5 A;  2BBN A;  1SYM A;  2JTZ A;  2LVJ A;  2ZKM X;  3PM8 A;  2FCE A;  1PRW A;  1J7R A;  1QVI Z;  4HRE E;  3EVU A;  2SCP A;  3AAJ A;  2EC6 C;  3D0Y A;  3FIA A;  1DF0 B;  3NSI A;  1DJW A;  1A75 A;  4QJ5 B;  3KPX A;  3SG3 A;  2KI4 B;  1XFV O;  2LVK A;  1AUI B;  1KK8 C;  1ALV A;  2I18 A;  1KFU S;  1HQV A;  3TDZ A;  4A4C A;  4QJ3 B;  3TS5 B;  3WXA A;  1GJY A;  2H61 C;  3RM1 A;  1DJH A;  4TNC A;  1MUX A;  1IKU A;  1RRO A;  1M31 A;  1KCY A;  1AJ5 A;  2MLE C;  5I2L A;  1WRL A;  1F8H A;  5AFP A;  4IL1 A;  1B47 A;  4MZK A;  3CWG A;  3DVM A;  4L9M A;  1A4P A;  3OB1 B;  1SCV A;  3BUX B;  2R2I A;  2PMY A;  1R2U A;  3TS5 C;  2JNX A;  3WHU B;  1NX0 A;  1CB1 A;  1QV0 A;  2OPO A;  3SIA A;  1SRA A;  2WCE A;  2ZN8 A;  3PAT A;  5KSZ A;  2BKI B;  2KQY A;  2KDH A;  1F70 A;  2WCF A;  1F71 A;  3WHT B;  1OZO A;  1BOD A;  4N1G A;  1BR4 B;  3LLE A;  1CM1 A;  2F2O A;  5D69 A;  3JTD B;  1S6J A;  4Q04 A;  3MSE B;  2F2P A;  1RFJ A;  4XJK A;  4MSP A;  2JUL A;  3PSR A;  5D7F A;  2LNK A;  2SAS A;  5DKR A;  2I94 A;  1DT7 B;  3RLZ A;  3I5F C;  3ICB A;  4FTG A;  4ICB A;  1IJ6 A;  1NX1 A;  1CDM A;  3LK0 A;  1TCF A;  2F3Y A;  2Y4Q A;  4ZCU A;  5HYD A;  2CCM A;  1SL8 A;  5DKQ A;  1Q80 A;  1WDC B;  4PHK A;  3JTD C;  3JVT B;  3FWC A;  3VGO A;  1G4Y R;  1ODB A;  2JXL A;  3DF0 B;  1FF1 A;  2L0P A;  1YUS A;  4YGB B;  3SIB A;  1W7I B;  1WY9 A;  2L98 A;  1S3P A;  3CR2 A;  1G33 A;  5J3X A;  4WQ3 A;  1FPW A;  1SR6 C;  4OR9 B;  1DMO A;  1DVI A;  4E68 A;  4PHJ A;  1JSA A;  2O60 A;  1B8L A;  2L2E A;  2KFG A;  4MZL A;  4PE4 A;  1FI5 A;  3JVT C;  1GGW A;  1IWQ A;  2EHB A;  2A4J A;  1M63 B;  3DD4 A;  2OS8 B;  2Q91 A;  1Y0V H;  2M0R A;  1BMO A;  1BF5 A;  1TTX A;  3KHE A;  3NXA A;  2KQ6 A;  4GPL B;  2G2B A;  3LCP C;  1NX3 A;  3GK1 A;  5HKW A;  2JZI A;  1EL4 A;  1OQP A;  2K61 A;  1UHN A;  4I5L B;  1NCX A;  1S5G Y;  2BBM A;  1PVB A;  2LLU A;  3SG6 A;  1CFF A;  5AER A;  1TIZ A;  4PE1 A;  1CMF A;  2L51 A;  4D1E A;  1ZAC A;  2OS8 C;  2PVB A;  2JXC A;  2RGI A;  2KGB C;  3DVK A;  3TZ1 A;  4U8D A;  1J55 A;  2I2R E;  4CFQ A;  1SMG A;  1SCM C;  3EK4 A;  4I5K A;  4DIR A;  1AK8 A;  1A03 A;  1AVS A;  3FWB A;  1YVL A;  3VRQ A;  1LXF C;  2FOT A;  2BCB A;  5ER4 X;  1PVA A;  3EK8 A;  2L50 A;  4OVN F;  2HQ8 A;  5CPV A;  1DF0 A;  2BKH B;  2KBM A;  3BUN B;  2LVI A;  2LMU A;  1S5G Z;  2EC6 B;  2M9G A;  5TNC A;  1MXE A;  1W7J B;  2NCP A;  1K9P A;  1V1F A;  4GGF A;  5F6T A;  3TUY C;  1EXR A;  2ZND A;  3VRO A;  3EVV A;  4MLW A;  5AXI A;  3SG5 A;  4JWQ A;  2O5G A;  3BUO B;  4GAO A;  5HLO A;  5B8I B;  4A4B A;  4OKH A;  1XFX O;  2NLN A;  5GQQ C;  2V53 A;  1TNQ A;  2JT8 A;  1TRF A;  2JWW A;  3NSK A;  1K94 A;  1IQ3 A;  1SKT A;  1RK9 A;  1L2O B;  1NCZ A;  2GGM A;  2Y1N A;  1QIV A;  2Y1M A;  2NXQ A;  4M2Q A;  4YRU A;  5IBW A;  1J7Q A;  3VRN A;  2KOT A;  3I5I B;  2LAN A;  4YGC B;  4HRG A;  3SG4 A;  1KFU L;  3ZNI A;  5CSN A;  1K8U A;  2E30 A;  4AQI A;  2LHI A;  4HSZ A;  1U5I B;  2M49 B;  4MVF A;  5AEQ A;  5HKZ A;  4NQG A;  4F0Z B;  1NSH A;  2WOS A;  3LK1 A;  5CSI A;  2OTG B;  2LMT A;  5AAN A;  1C7W A;  2NCO A;  1L2O C;  2Y5I A;  3AAK A;  1FBV A;  3I5I C;  1DJZ A;  1B9A A;  4CFR A;  1PUL A;  2PRU A;  3TDI A;  1LA3 A;  1KSM A;  5I8N A;  1GQM A;  1F4O A;  2CT9 A;  2HQW A;  3CLN A;  2M7N A;  4I5N B;  1B1G A;  1MXL C;  5I2O A;  3I5F B;  3CR5 X;  1N0Y A;  2OTG C;  4CLN A;  3O6B A;  4BY5 A;  1ZFS A;  3SJS A;  1OZS A;  1IRJ A;  2WOR A;  1KSO A;  1K95 A;  1IGV A;  1M39 A;  2CNP A;  2MJW B;  3DF0 A;  3OX6 A;  1EJ3 A;  1UWO A;  1CTR A;  1RTP 1;  2K0J A;  3AKA A;  1K9U A;  1M46 A;  1QX7 A;  5G08 A;  2JC2 A;  1UHH A;  4NDC A;  1H8B A;  2E6W A;  3CTN A;  1XYD A;  1QIW A;  3EKH A;  3IF7 A;  2CTN A;  3PFV A;  1F54 A;  1SR6 B;  3KO0 A;  1J1E A;  2KSP A;  1OMR A;  1S26 D;  4GFT A;  1PSB A;  2PAL A;  4HRH A;  1Y6W A;  2LC5 A;  2P6B B;  3OB2 B;  1VRK A;  4M2O A;  4OCI A;  1WRK A;  2LUX A;  1XFU O;  1QX5 B;  2WCB A;  1CKK A;  2TN4 A;  4MZJ A;  1CDP A;  2BL0 C;  3AKB A;  1TCO B;  4C0L A;  2KGR A;  1XA5 A;  4WRI A;  1AP4 A;  2MBX A;  3GK2 A;  3F45 A;  1SW8 A;  1CFP A;  3H4S E;  1WLZ A;  1JWD A;  1QLS A;  1TOP A;  2ISD A;  2F33 A;  3QRX A;  1YX8 A;  4PHM A;  1BJF A;  1B8R A;  1SCM B;  1CMG A;  2BE6 A;  2K7O A;  2QAC A;  1SBJ A;  2JQ6 A;  3CZT X;  4I5J A;  1MQ1 A;  2FJU B;  2HF5 A;  1KK7 Y;  2GGZ A;  1N2D A;  4PCW A;  1B4C A;  3PAL A;  1BOC A;  2KNE A;  1YTZ C;  1UUS A;  1XK4 C;  2MHH A;  2ZNE A;  2COL B;  2HPS A;  1YR5 A;  2H61 A;  2LHL A;  2BCA A;  2MAZ A;  2ZFD A;  3TUY B;  3WNX B;  3C1V A;  3HCM A;  1YUU A;  3BYA A;  1NP8 A;  4MRY A;  2K7B A;  2KAX A;  1QTX A;  1WLM A;  4PHN A;  1Y1U A;  1K93 D;  4YGE B;  4YBH B;  3EVR A;  3KF9 A;  1K9K A;  3EK7 A;  1NWD A;  1KFX S;  1YRT B;  5I2Q A;  3CGA A;  1N65 A;  5PAL A;  1CM4 A;  1H4B A;  1B8C A;  1U5I A;  2ZN9 A;  4MEW A;  3OHM B;  1FW4 A;  2MA2 A;  4MN0 A;  4P5O E;  2LLS A;  1S6C A;  1MR8 A;  2QPT A;  5FYX A;  3O78 A;  2JPT A;  2LV7 A;  2M29 A;  2M97 A;  1F4Q A;  2M8U A;  1L7Z A;  1QJT A;  2DOQ A;  3A8R A;  1SY9 A;  1JC2 A;  2KFH A;  4ZCV A;  2JNF A;  4ORA B;  3PLF B;  1UP5 A;  1QX2 A;  1GGZ A;  3FS7 A;  3BOW A;  3SG7 A;  2K2A A;  5DKN A;  1RWY A;  1SL7 A;  1YUR A;  4PE0 A;  2AAO A;  3I5H C;  2LP3 A;  3KEV A;  1CLB A;  1J7P A;  1CDL A;  4MRX A;  1XFY O;  1UUR A;  4FQO A;  1NCY A;  3IQQ A;  2K8M B;  3O2P A;  2B1U A;  1OE9 B;  1Y1X A;  2KFF A;  2D8N A;  4PDZ A;  4WQ2 A;  1J7O A;  1YVH A;  4YGD B;  5K89 A;  4NDB A;  4PE7 A;  3GOF A;  1DGU A;  2BE4 A;  1AHR A;  4M2P A;  1LVC D;  3D10 A;  2LMV A;  3BUW B;  3NSL A;  1MHO A;  3BOW B;  4GUK A;  1EG4 A;  1SNL A;  2KHN A;  2Q4U A;  1CFD A;  3E3R A;  1REC A;  2NZ0 A;  2I7A A;  1K2H A;  2M3W A;  4P2Y B;  3ZWH A;  1QV1 A;  1Y1A A;  4BY4 A;  1CFC A;  1CLM A;  1J1D A;  1PK0 D;  3VRR A;  1UHJ A;  1S1E A;  2F8P A;  3OP0 A;  2MLF C;  4JQ0 D;  5CSJ A;  2KI4 C;  2FCD A;  1BG1 A;  3D0Y B;  5JJG A;  2KBI A;  1YRU B;  2JTT A;  1A75 B;  1DGV A;  1MF8 B;  2LUC A;  1F55 A;  2K7C A;  1JF2 A;  1NPQ A;  1DJY A;  2GV5 A;  4GGF C;  2LCP A;  1EH2 A;  5HLV A;  1BU3 A;  2BL0 B;  2LP2 A;  2VRG A;  1NIW A;  2CXJ A;  3SG2 A;  2K7D A;  1XK4 A;  2LLT A;  1R6P A;  2KYC A;  1S6I A;  2F3Z A;  2EGD A;  1FI6 A;  4MBE A;  1SK6 D;  3DVJ A;  4NDD A;  1V1G A;  2H2K A;  1BLQ A;  5KTY A;  5JOL A;  4JPZ B;  4CPV A;  2PSR A;  3GK4 X;  4YGA A;  1JF0 A;  1JFK A;  2K2F A;  2M1U A;  5KU1 A;  3EKJ A;  4ETO A;  3PN7 B;  3OX5 A;  1QLK A;  4QJ4 B;  1A2X A;  1IQ5 A;  1EG3 A;  2ZRS A;  1HT9 A;  2JT0 A;  1TNP A;  1ZOT B;  2WND A;  1CDN A;  5CSF A;  2MRD A;  1SL9 A;  3I5G B;  4DRW A;  1NUB A;  1YUT A;  4CID A;  3M0W A;  2KI6 C;  2LVV A;  1XVJ A;  1QS7 A;  3A4U B;  3DVE A;  2KAV A;  1BT6 A;  4OV2 A;  4DUQ A;  1DJG A;  1IH0 A;  2L5X B;  3PN7 C;  1JBA A;  4XJK B;  4C0K A;  2JOJ A;  2KI6 D;  2LAP A;  3LL8 B;  4YI8 A;  1MWN A;  1C07 A;  3BQ3 A;  2KAY A;  1WDC C;  4ORC B;  1B7T Y;  3VRP A;  1LIN A;  1UHI A;  3I5G C;  3TDU A;  1XO5 A;  2AUC A;  1WRZ A;  1OMV A;  1AJ4 A;  1KWO B;  1NYA A;  1K96 A;  2AMI A;  4USL A;  4AOM A;  1QAT A;  1XFZ O;  2JT3 A;  3O4Y A;  1CNP A;  1DTL A;  1KQV A;  1JUO A;  3CR4 X;  1JFJ A;  4XYN A;  4C0J A;  1ALW A;  1DJX A;  1OOJ A;  1OMD A;  1LA0 A;  1QXP A;  2M1K B;  1KFX L;  1RJV A;  1D1O A;  4AQJ A;  1A29 A;  2HET A;  4N1F A;  3CS1 A;  1KK7 Z;  1KWO C;  1K90 D;  2BCX A;  3IQO A;  4YI9 A;  5BPJ A;  4GBA A;  1B7T Z;  1NX2 A;  2M7L A;  1KQM B;  2WC8 A;  1E8A A;  1C7V A; 
#chains in the Genus database with same CATH topology
 3I5H B;  3NSO A;  1TNX A;  1QAS A;  4GNK B;  1S36 A;  1QVI Y;  2G9B A;  2IS9 A;  1TNW A;  4DS7 A;  1PSR A;  4PAL A;  1ZUZ A;  1DJI A;  2BEC A;  2FJY A;  5HL1 A;  1UHK A;  3S0G A;  1G8I A;  2JRF A;  2LM5 A;  1ZMZ A;  2LE9 B;  2JU0 A;  3HX4 A;  3BXK A;  1OSA A;  1XFR A;  1CLL A;  2ZRT A;  1IJ5 A;  4GGN A;  2CBL A;  2PAS A;  5HKY A;  4R1E A;  1KQM C;  1PAL A;  4N5X A;  4ORB B;  1TN4 A;  2L4H A;  2KYF A;  1YX7 A;  1SPY A;  3K21 A;  1KK8 B;  1BR1 B;  1X02 A;  2L4I A;  3DZT A;  3BUM B;  4UPG A;  1LKJ A;  1XFW O;  4DCK A;  3NGV A;  1IG5 A;  1M45 A;  5ER5 A;  2BBN A;  1C3Y A;  1SYM A;  2JTZ A;  2LVJ A;  2ZKM X;  3PM8 A;  2FCE A;  1PRW A;  1J7R A;  1QVI Z;  4HRE E;  3EVU A;  2SCP A;  3AAJ A;  2EC6 C;  3D0Y A;  3FIA A;  1DF0 B;  3NSI A;  1DJW A;  1A75 A;  4QJ5 B;  3KPX A;  3CAB A;  3SG3 A;  2KI4 B;  1XFV O;  2LVK A;  1AUI B;  1KK8 C;  2P70 A;  3CZ1 A;  1ALV A;  2I18 A;  1KFU S;  1HQV A;  3TDZ A;  1DEK A;  4QJ3 B;  3TS5 B;  3WXA A;  1GJY A;  1TWO A;  2H61 C;  3RM1 A;  1GM0 A;  1DJH A;  4TNC A;  1MUX A;  1IKU A;  1RRO A;  1M31 A;  3SS5 A;  1KCY A;  1AJ5 A;  2MLE C;  3BFA A;  5I2L A;  1WRL A;  1F8H A;  3R1O A;  5AFP A;  2QEO A;  4IL1 A;  1B47 A;  4MZK A;  3CWG A;  3DVM A;  4L9M A;  1A4P A;  3OB1 B;  1SCV A;  3K1E A;  3BUX B;  2R2I A;  5EL2 A;  2PMY A;  1R2U A;  3TS5 C;  2JNX A;  2QEH A;  1NX0 A;  3WHU B;  1CB1 A;  1QV0 A;  2OPO A;  2QDI A;  3SIA A;  1SRA A;  2WCE A;  2ZN8 A;  3PAT A;  5KSZ A;  2BKI B;  2KQY A;  2KDH A;  1F70 A;  3PM2 A;  2WCF A;  3UNW A;  1F71 A;  3SS3 A;  3WHT B;  1OZO A;  1BOD A;  4N1G A;  1BR4 B;  3LLE A;  1CM1 A;  2F2O A;  5D69 A;  3JTD B;  1S6J A;  4Q04 A;  3MSE B;  2F2P A;  1RFJ A;  4XJK A;  4MSP A;  2JUL A;  3PSR A;  5D7F A;  2LNK A;  2SAS A;  3B86 A;  2I94 A;  5DKR A;  1DT7 B;  3RLZ A;  3UO9 A;  3I5F C;  3ICB A;  4FTG A;  4ICB A;  1IJ6 A;  1NX1 A;  1CDM A;  1TUZ A;  3LK0 A;  1TCF A;  2F3Y A;  2WCK A;  2Y4Q A;  3QME A;  2CCM A;  1SL8 A;  5DKQ A;  4ZCU A;  5HYD A;  3BFH A;  1Q80 A;  1WDC B;  4PHK A;  3JTD C;  3JVT B;  2PYQ A;  3FWC A;  3VGO A;  1G4Y R;  1ODB A;  2JXL A;  3DF0 B;  3S0A A;  1FF1 A;  2L0P A;  1YUS A;  2GTE A;  4YGB B;  3SIB A;  1W7I B;  1WY9 A;  2L98 A;  1S3P A;  3CR2 A;  1G33 A;  5J3X A;  4WQ3 A;  1FPW A;  1SR6 C;  4OR9 B;  1DMO A;  1DVI A;  4E68 A;  4PHJ A;  1JSA A;  2O60 A;  1B8L A;  2L2E A;  2KFG A;  4MZL A;  1ORG A;  4PE4 A;  1FI5 A;  3JVT C;  3NHI A;  1GGW A;  3NHT A;  1OOG A;  1IWQ A;  2EHB A;  2A4J A;  1M63 B;  3DD4 A;  2OS8 B;  2Q91 A;  2P71 A;  1Y0V H;  2M0R A;  1BMO A;  1BF5 A;  3L4L A;  1TTX A;  3KHE A;  3NXA A;  1T14 A;  2KQ6 A;  2G2B A;  3LCP C;  4GPL B;  1NX3 A;  3GK1 A;  5HKW A;  3D73 A;  2JZI A;  1EL4 A;  1OQP A;  2K61 A;  1UHN A;  4I5L B;  1NCX A;  1S5G Y;  2BBM A;  1PVB A;  2LLU A;  3SG6 A;  1CFF A;  5AER A;  1TIZ A;  4PE1 A;  2BAP A;  1CMF A;  2L51 A;  4D1E A;  1ZAC A;  3IVT A;  3BFB A;  2OS8 C;  2PVB A;  2JXC A;  2RGI A;  2KGB C;  3DVK A;  3TZ1 A;  4U8D A;  1J55 A;  2I2R E;  4CFQ A;  1SMG A;  1SCM C;  3EK4 A;  4I5K A;  4DIR A;  1AK8 A;  1A03 A;  1AVS A;  3FWB A;  1YVL A;  3VRQ A;  1LXF C;  2FOT A;  2BCB A;  5ER4 X;  1PVA A;  2K60 A;  3EK8 A;  1DEL A;  2L50 A;  3D74 A;  4OVN F;  2HQ8 A;  5CPV A;  1DF0 A;  2BKH B;  2KBM A;  3BUN B;  2LVI A;  2LMU A;  3L47 A;  2H8V A;  1S5G Z;  2EC6 B;  2WC6 A;  2M9G A;  5TNC A;  1MXE A;  1W7J B;  2NCP A;  1K9P A;  1V1F A;  4GGF A;  5F6T A;  3TUY C;  1EXR A;  2ZND A;  4INW A;  3VRO A;  3EVV A;  4MLW A;  5AXI A;  3SG5 A;  4JWQ A;  2O5G A;  3BUO B;  4GAO A;  5HLO A;  5B8I B;  4A4B A;  4OKH A;  1XFX O;  2NLN A;  5GQQ C;  2V53 A;  1TNQ A;  2JT8 A;  3FE8 A;  1TRF A;  2JWW A;  3NSK A;  1K94 A;  1IQ3 A;  1SKT A;  1RK9 A;  1L2O B;  1NCZ A;  2GGM A;  2Y1N A;  1QIV A;  2Y1M A;  2NXQ A;  4M2Q A;  4YRU A;  5IBW A;  1J7Q A;  3VRN A;  2KOT A;  3I5I B;  2LAN A;  4YGC B;  4HRG A;  3SG4 A;  1KFU L;  3ZNI A;  5CSN A;  1K8U A;  2E30 A;  4AQI A;  2LHI A;  4HSZ A;  1U5I B;  2M49 B;  4MVF A;  5AEQ A;  5HKZ A;  3DYE A;  4NQG A;  4F0Z B;  5I94 A;  1NSH A;  2WOS A;  3LK1 A;  5CSI A;  2OTG B;  2LMT A;  5AAN A;  1C7W A;  2NCO A;  1L2O C;  2Y5I A;  3AAK A;  1FBV A;  3I5I C;  1DJZ A;  3EG5 B;  1B9A A;  4CFR A;  1PUL A;  2PRU A;  2WC5 A;  3TDI A;  1LA3 A;  1KSM A;  1Z4H A;  5I8N A;  1GQM A;  1F4O A;  2CT9 A;  2HQW A;  3CLN A;  2M7N A;  4I5N B;  1B1G A;  1MXL C;  5I2O A;  3I5F B;  3CR5 X;  1N0Y A;  2OTG C;  4CLN A;  3O6B A;  4BY5 A;  1ZFS A;  4IJ7 A;  3SJS A;  1OZS A;  1IRJ A;  1OOH A;  2WOR A;  1KSO A;  1K95 A;  1IGV A;  1M39 A;  3CDN A;  4PT1 A;  2CNP A;  2MJW B;  3DF0 A;  3OX6 A;  3D78 A;  3VB1 A;  1EJ3 A;  1UWO A;  1CTR A;  1RTP 1;  2K0J A;  3AKA A;  1K9U A;  1M46 A;  1QX7 A;  5G08 A;  2JC2 A;  1UHH A;  3B88 A;  4NDC A;  1H8B A;  2E6W A;  4JKT A;  3CTN A;  1XYD A;  1QIW A;  3EKH A;  3IF7 A;  2CTN A;  3PFV A;  1F54 A;  1SR6 B;  2WCL A;  3KO0 A;  1J1E A;  2KSP A;  2WCM A;  1DC1 A;  1OMR A;  1S26 D;  4GFT A;  1PSB A;  2PAL A;  4HRH A;  4FQT A;  1Y6W A;  2LC5 A;  2ERB A;  2P6B B;  3CZ2 A;  3OB2 B;  1VRK A;  4M2O A;  4OCI A;  1WRK A;  2LUX A;  1XFU O;  1QX5 B;  2WCB A;  1CKK A;  2TN4 A;  4MZJ A;  1CDP A;  2BL0 C;  3AKB A;  1TCO B;  1W9Z A;  2KGR A;  4C0L A;  1XA5 A;  4WRI A;  1OOF A;  3FE9 A;  3D75 A;  1AP4 A;  2MBX A;  3GK2 A;  3F45 A;  1SW8 A;  5D3O A;  1CFP A;  3H4S E;  1WLZ A;  1JWD A;  1QLS A;  5DIC A;  1TOP A;  2ISD A;  2F33 A;  3QRX A;  1YX8 A;  4PHM A;  1BJF A;  1B8R A;  1SCM B;  1CMG A;  3S0F A;  2BE6 A;  2K7O A;  2QAC A;  1SBJ A;  2JQ6 A;  3CZT X;  4I5J A;  1MQ1 A;  2FJU B;  2HF5 A;  1KK7 Y;  2GGZ A;  1N2D A;  4PCW A;  1B4C A;  3PAL A;  1BOC A;  2KNE A;  1YTZ C;  1UUS A;  1XK4 C;  2MHH A;  2ZNE A;  2COL B;  2HPS A;  1YR5 A;  2H61 A;  2LHL A;  2BCA A;  2MAZ A;  2ZFD A;  3TUY B;  3WNX B;  3C1V A;  3HCM A;  1YUU A;  2PQL A;  3BYA A;  1NP8 A;  4MRY A;  3OGN A;  2K7B A;  2KAX A;  1QTX A;  1WLM A;  4PHN A;  1Y1U A;  1K93 D;  4YGE B;  4YBH B;  4A4C A;  3EVR A;  3KF9 A;  1K9K A;  3EK7 A;  3BJH A;  1NWD A;  2KLE A;  1KFX S;  1YRT B;  2JPO A;  5I2Q A;  3SS4 A;  3B6X A;  2WCH A;  3CGA A;  1N65 A;  5PAL A;  1CM4 A;  2KPH A;  1B8C A;  1U5I A;  2ZN9 A;  4MEW A;  1H4B A;  3OHM B;  3S0D A;  1FW4 A;  2KLD A;  2MA2 A;  3B87 A;  2LLS A;  1S6C A;  1MR8 A;  2QPT A;  3DY9 A;  4MN0 A;  4P5O E;  5FYX A;  3O78 A;  2JPT A;  2LV7 A;  2M29 A;  3L4A A;  2M97 A;  1C3Z A;  1F4Q A;  2M8U A;  1L7Z A;  2L5Y A;  1QJT A;  2DOQ A;  3RZS A;  3A8R A;  1SY9 A;  1JC2 A;  2KFH A;  4ZCV A;  2JNF A;  4ORA B;  3PLF B;  1UP5 A;  1QX2 A;  1GGZ A;  3FS7 A;  3BOW A;  3D76 A;  2WCJ A;  3SG7 A;  2K2A A;  3B7A A;  5DKN A;  2YGU A;  1RWY A;  1SL7 A;  1YUR A;  4PE0 A;  2AAO A;  3I5H C;  2LP3 A;  3KEV A;  1CLB A;  1J7P A;  1CDL A;  4MRX A;  1XFY O;  1UUR A;  4FQO A;  1NCY A;  1P28 A;  3IQQ A;  2K8M B;  3O2P A;  2B1U A;  1OE9 B;  1Y1X A;  2KFF A;  2D8N A;  4PDZ A;  4WQ2 A;  1J7O A;  1YVH A;  4YGD B;  3V2L A;  5K89 A;  4NDB A;  4PE7 A;  3GOF A;  1DGU A;  2BE4 A;  1AHR A;  4M2P A;  1LVC D;  3D10 A;  2LMV A;  3BUW B;  3NSL A;  1MHO A;  3BOW B;  4GUK A;  3R1V A;  1EG4 A;  4INX A;  1SNL A;  2KHN A;  2Q4U A;  1CFD A;  3E3R A;  1REC A;  2NZ0 A;  2I7A A;  2QEV A;  1K2H A;  2M3W A;  4P2Y B;  3R72 A;  2L2C A;  3ZWH A;  1QV1 A;  3CZ0 A;  1Y1A A;  4BY4 A;  1CFC A;  4OZD A;  1CLM A;  1J1D A;  1PK0 D;  3VRR A;  1QWV A;  1UHJ A;  1S1E A;  2F8P A;  3OP0 A;  2MLF C;  4JQ0 D;  5CSJ A;  2QEB A;  2KI4 C;  2FCD A;  3S0B A;  1BG1 A;  3D0Y B;  3O4X A;  2KBI A;  5JJG A;  1YRU B;  2JTT A;  1A75 B;  1DGV A;  1MF8 B;  2LUC A;  1F55 A;  2K7C A;  1JF2 A;  1NPQ A;  1DJY A;  2GV5 A;  3FE6 A;  2LCP A;  4GGF C;  5HLV A;  1EH2 A;  1BU3 A;  2BL0 B;  2LP2 A;  2VRG A;  1NIW A;  2CXJ A;  3SG2 A;  2K7D A;  1XK4 A;  2LLT A;  1R6P A;  2KYC A;  1S6I A;  2F3Z A;  2EGD A;  1FI6 A;  4MBE A;  1SK6 D;  3DVJ A;  4NDD A;  1V1G A;  2H2K A;  1BLQ A;  1TUJ A;  5KTY A;  3PJI A;  5JOL A;  4JPZ B;  4CPV A;  2PSR A;  3GK4 X;  4YGA A;  1JF0 A;  1JFK A;  2K2F A;  2M1U A;  5KU1 A;  1SSE B;  3EKJ A;  4ETO A;  1OW4 A;  3D77 A;  1OOI X;  3PN7 B;  3OX5 A;  1QLK A;  4QJ4 B;  1A2X A;  1IQ5 A;  1EG3 A;  2ZRS A;  1HT9 A;  2JT0 A;  3CYZ A;  1TNP A;  1ZOT B;  2WND A;  1CDN A;  5CSF A;  2MRD A;  1Z2C B;  1SL9 A;  3I5G B;  4DRW A;  1NUB A;  1YUT A;  4KYN A;  4CID A;  3M0W A;  2KI6 C;  2LVV A;  1XVJ A;  1QS7 A;  3A4U B;  3DVE A;  2KAV A;  1BT6 A;  4OV2 A;  4DUQ A;  1DJG A;  1IH0 A;  3R1P A;  2L5X B;  3PN7 C;  1JBA A;  4XJK B;  4C0K A;  2JOJ A;  2KI6 D;  2LAP A;  3LL8 B;  4YI8 A;  5FI7 A;  1MWN A;  1C07 A;  3BQ3 A;  2KAY A;  1WDC C;  4ORC B;  1B7T Y;  3VRP A;  1LIN A;  1UHI A;  3I5G C;  3DXL A;  3TDU A;  1XO5 A;  2AUC A;  1WRZ A;  2BNX A;  1OMV A;  1AJ4 A;  1KWO B;  1NYA A;  1K96 A;  2AMI A;  5FI6 A;  4JD9 A;  4USL A;  4AOM A;  1QAT A;  1XFZ O;  2JT3 A;  3O4Y A;  1CNP A;  1DQE A;  5FI2 A;  1DTL A;  4F7F A;  1KQV A;  1JUO A;  1IIO A;  3CR4 X;  1JFJ A;  4XYN A;  4C0J A;  3S0E A;  1ALW A;  1DJX A;  1OOJ A;  1OMD A;  1QXP A;  1LA0 A;  2M1K B;  1KFX L;  1LS8 A;  1RJV A;  1D1O A;  4AQJ A;  1A29 A;  2HET A;  4N1F A;  3CS1 A;  1KK7 Z;  1KWO C;  1K90 D;  2BCX A;  3IQO A;  4YI9 A;  5BPJ A;  4GBA A;  1B7T Z;  1NX2 A;  2M7L A;  1KQM B;  2WC8 A;  3Q8I A;  1E8A A;  3N7H A;  3OBV A;  1C7V A; 
#chains in the Genus database with same CATH homology
 3I5H B;  3NSO A;  1TNX A;  1QAS A;  4GNK B;  1S36 A;  1QVI Y;  2G9B A;  2IS9 A;  1TNW A;  4DS7 A;  1PSR A;  4PAL A;  1ZUZ A;  1DJI A;  2BEC A;  1UHK A;  1G8I A;  2JRF A;  2LM5 A;  1ZMZ A;  2LE9 B;  2JU0 A;  3HX4 A;  3BXK A;  1OSA A;  2ZRT A;  1CLL A;  4GGN A;  1IJ5 A;  2CBL A;  2PAS A;  5HKY A;  4R1E A;  1KQM C;  1PAL A;  4N5X A;  4ORB B;  1TN4 A;  2L4H A;  2KYF A;  1YX7 A;  1SPY A;  3K21 A;  1KK8 B;  1BR1 B;  1X02 A;  2L4I A;  3BUM B;  4UPG A;  1LKJ A;  1XFW O;  4DCK A;  1IG5 A;  1M45 A;  5ER5 A;  2BBN A;  1SYM A;  2JTZ A;  2LVJ A;  2ZKM X;  3PM8 A;  2FCE A;  1PRW A;  1J7R A;  1QVI Z;  4HRE E;  3EVU A;  2SCP A;  3AAJ A;  2EC6 C;  3D0Y A;  3FIA A;  1DF0 B;  3NSI A;  1DJW A;  1A75 A;  4QJ5 B;  3KPX A;  3SG3 A;  2KI4 B;  1XFV O;  2LVK A;  1AUI B;  1KK8 C;  1ALV A;  2I18 A;  1KFU S;  1HQV A;  3TDZ A;  4A4C A;  4QJ3 B;  3TS5 B;  3WXA A;  1GJY A;  2H61 C;  3RM1 A;  1DJH A;  4TNC A;  1MUX A;  1IKU A;  1RRO A;  1M31 A;  1KCY A;  1AJ5 A;  2MLE C;  5I2L A;  1WRL A;  1F8H A;  5AFP A;  4IL1 A;  1B47 A;  4MZK A;  3CWG A;  3DVM A;  4L9M A;  1A4P A;  3OB1 B;  1SCV A;  3BUX B;  2R2I A;  2PMY A;  1R2U A;  3TS5 C;  2JNX A;  3WHU B;  1NX0 A;  1CB1 A;  1QV0 A;  2OPO A;  3SIA A;  1SRA A;  2WCE A;  2ZN8 A;  3PAT A;  5KSZ A;  2BKI B;  2KQY A;  2KDH A;  1F70 A;  2WCF A;  1F71 A;  3WHT B;  1OZO A;  1BOD A;  4N1G A;  1BR4 B;  3LLE A;  1CM1 A;  2F2O A;  5D69 A;  3JTD B;  1S6J A;  4Q04 A;  3MSE B;  2F2P A;  1RFJ A;  4XJK A;  4MSP A;  2JUL A;  3PSR A;  5D7F A;  2LNK A;  2SAS A;  5DKR A;  2I94 A;  1DT7 B;  3RLZ A;  3I5F C;  3ICB A;  4FTG A;  4ICB A;  1IJ6 A;  1NX1 A;  1CDM A;  3LK0 A;  1TCF A;  2F3Y A;  2Y4Q A;  4ZCU A;  5HYD A;  2CCM A;  1SL8 A;  5DKQ A;  1Q80 A;  1WDC B;  4PHK A;  3JTD C;  3JVT B;  3FWC A;  3VGO A;  1G4Y R;  1ODB A;  2JXL A;  3DF0 B;  1FF1 A;  2L0P A;  1YUS A;  4YGB B;  3SIB A;  1W7I B;  1WY9 A;  2L98 A;  1S3P A;  3CR2 A;  1G33 A;  5J3X A;  4WQ3 A;  1FPW A;  1SR6 C;  4OR9 B;  1DMO A;  1DVI A;  4E68 A;  4PHJ A;  1JSA A;  2O60 A;  1B8L A;  2L2E A;  2KFG A;  4MZL A;  4PE4 A;  1FI5 A;  3JVT C;  1GGW A;  1IWQ A;  2EHB A;  2A4J A;  1M63 B;  3DD4 A;  2OS8 B;  2Q91 A;  1Y0V H;  2M0R A;  1BMO A;  1BF5 A;  1TTX A;  3KHE A;  3NXA A;  2KQ6 A;  4GPL B;  2G2B A;  3LCP C;  1NX3 A;  3GK1 A;  5HKW A;  2JZI A;  1EL4 A;  1OQP A;  2K61 A;  1UHN A;  4I5L B;  1NCX A;  1S5G Y;  2BBM A;  1PVB A;  2LLU A;  3SG6 A;  1CFF A;  5AER A;  1TIZ A;  4PE1 A;  1CMF A;  2L51 A;  4D1E A;  1ZAC A;  2OS8 C;  2PVB A;  2JXC A;  2RGI A;  2KGB C;  3DVK A;  3TZ1 A;  4U8D A;  1J55 A;  2I2R E;  4CFQ A;  1SMG A;  1SCM C;  3EK4 A;  4I5K A;  4DIR A;  1AK8 A;  1A03 A;  1AVS A;  3FWB A;  1YVL A;  3VRQ A;  1LXF C;  2FOT A;  2BCB A;  5ER4 X;  1PVA A;  3EK8 A;  2L50 A;  4OVN F;  2HQ8 A;  5CPV A;  1DF0 A;  2BKH B;  2KBM A;  3BUN B;  2LVI A;  2LMU A;  1S5G Z;  2EC6 B;  2M9G A;  5TNC A;  1MXE A;  1W7J B;  2NCP A;  1K9P A;  1V1F A;  4GGF A;  5F6T A;  3TUY C;  1EXR A;  2ZND A;  3VRO A;  3EVV A;  4MLW A;  5AXI A;  3SG5 A;  4JWQ A;  2O5G A;  3BUO B;  4GAO A;  5HLO A;  5B8I B;  4A4B A;  4OKH A;  1XFX O;  2NLN A;  5GQQ C;  2V53 A;  1TNQ A;  2JT8 A;  1TRF A;  2JWW A;  3NSK A;  1K94 A;  1IQ3 A;  1SKT A;  1RK9 A;  1L2O B;  1NCZ A;  2GGM A;  2Y1N A;  1QIV A;  2Y1M A;  2NXQ A;  4M2Q A;  4YRU A;  5IBW A;  1J7Q A;  3VRN A;  2KOT A;  3I5I B;  2LAN A;  4YGC B;  4HRG A;  3SG4 A;  1KFU L;  3ZNI A;  5CSN A;  1K8U A;  2E30 A;  4AQI A;  2LHI A;  4HSZ A;  1U5I B;  2M49 B;  4MVF A;  5AEQ A;  5HKZ A;  4NQG A;  4F0Z B;  1NSH A;  2WOS A;  3LK1 A;  5CSI A;  2OTG B;  2LMT A;  5AAN A;  1C7W A;  2NCO A;  1L2O C;  2Y5I A;  3AAK A;  1FBV A;  3I5I C;  1DJZ A;  1B9A A;  4CFR A;  1PUL A;  2PRU A;  3TDI A;  1LA3 A;  1KSM A;  5I8N A;  1GQM A;  1F4O A;  2CT9 A;  2HQW A;  3CLN A;  2M7N A;  4I5N B;  1B1G A;  1MXL C;  5I2O A;  3I5F B;  3CR5 X;  1N0Y A;  2OTG C;  4CLN A;  3O6B A;  4BY5 A;  1ZFS A;  3SJS A;  1OZS A;  1IRJ A;  2WOR A;  1KSO A;  1K95 A;  1IGV A;  1M39 A;  2CNP A;  2MJW B;  3DF0 A;  3OX6 A;  1EJ3 A;  1UWO A;  1CTR A;  1RTP 1;  2K0J A;  3AKA A;  1K9U A;  1M46 A;  1QX7 A;  5G08 A;  2JC2 A;  1UHH A;  4NDC A;  1H8B A;  2E6W A;  3CTN A;  1XYD A;  1QIW A;  3EKH A;  3IF7 A;  2CTN A;  3PFV A;  1F54 A;  1SR6 B;  3KO0 A;  1J1E A;  2KSP A;  1OMR A;  1S26 D;  4GFT A;  1PSB A;  2PAL A;  4HRH A;  1Y6W A;  2LC5 A;  2P6B B;  3OB2 B;  1VRK A;  4M2O A;  4OCI A;  1WRK A;  2LUX A;  1XFU O;  1QX5 B;  2WCB A;  1CKK A;  2TN4 A;  4MZJ A;  1CDP A;  2BL0 C;  3AKB A;  1TCO B;  4C0L A;  2KGR A;  1XA5 A;  4WRI A;  1AP4 A;  2MBX A;  3GK2 A;  3F45 A;  1SW8 A;  1CFP A;  3H4S E;  1WLZ A;  1JWD A;  1QLS A;  1TOP A;  2ISD A;  2F33 A;  3QRX A;  1YX8 A;  4PHM A;  1BJF A;  1B8R A;  1SCM B;  1CMG A;  2BE6 A;  2K7O A;  2QAC A;  1SBJ A;  2JQ6 A;  3CZT X;  4I5J A;  1MQ1 A;  2FJU B;  2HF5 A;  1KK7 Y;  2GGZ A;  1N2D A;  4PCW A;  1B4C A;  3PAL A;  1BOC A;  2KNE A;  1YTZ C;  1UUS A;  1XK4 C;  2MHH A;  2ZNE A;  2COL B;  2HPS A;  1YR5 A;  2H61 A;  2LHL A;  2BCA A;  2MAZ A;  2ZFD A;  3TUY B;  3WNX B;  3C1V A;  3HCM A;  1YUU A;  3BYA A;  1NP8 A;  4MRY A;  2K7B A;  2KAX A;  1QTX A;  1WLM A;  4PHN A;  1Y1U A;  1K93 D;  4YGE B;  4YBH B;  3EVR A;  3KF9 A;  1K9K A;  3EK7 A;  1NWD A;  1KFX S;  1YRT B;  5I2Q A;  3CGA A;  1N65 A;  5PAL A;  1CM4 A;  1H4B A;  1B8C A;  1U5I A;  2ZN9 A;  4MEW A;  3OHM B;  1FW4 A;  2MA2 A;  4MN0 A;  4P5O E;  2LLS A;  1S6C A;  1MR8 A;  2QPT A;  5FYX A;  3O78 A;  2JPT A;  2LV7 A;  2M29 A;  2M97 A;  1F4Q A;  2M8U A;  1L7Z A;  1QJT A;  2DOQ A;  3A8R A;  1SY9 A;  1JC2 A;  2KFH A;  4ZCV A;  2JNF A;  4ORA B;  3PLF B;  1UP5 A;  1QX2 A;  1GGZ A;  3FS7 A;  3BOW A;  3SG7 A;  2K2A A;  5DKN A;  1RWY A;  1SL7 A;  1YUR A;  4PE0 A;  2AAO A;  3I5H C;  2LP3 A;  3KEV A;  1CLB A;  1J7P A;  1CDL A;  4MRX A;  1XFY O;  1UUR A;  4FQO A;  1NCY A;  3IQQ A;  2K8M B;  3O2P A;  2B1U A;  1OE9 B;  1Y1X A;  2KFF A;  2D8N A;  4PDZ A;  4WQ2 A;  1J7O A;  1YVH A;  4YGD B;  5K89 A;  4NDB A;  4PE7 A;  3GOF A;  1DGU A;  2BE4 A;  1AHR A;  4M2P A;  1LVC D;  3D10 A;  2LMV A;  3BUW B;  3NSL A;  1MHO A;  3BOW B;  4GUK A;  1EG4 A;  1SNL A;  2KHN A;  2Q4U A;  1CFD A;  3E3R A;  1REC A;  2NZ0 A;  2I7A A;  1K2H A;  2M3W A;  4P2Y B;  3ZWH A;  1QV1 A;  1Y1A A;  4BY4 A;  1CFC A;  1CLM A;  1J1D A;  1PK0 D;  3VRR A;  1UHJ A;  1S1E A;  2F8P A;  3OP0 A;  2MLF C;  4JQ0 D;  5CSJ A;  2KI4 C;  2FCD A;  1BG1 A;  3D0Y B;  5JJG A;  2KBI A;  1YRU B;  2JTT A;  1A75 B;  1DGV A;  1MF8 B;  2LUC A;  1F55 A;  2K7C A;  1JF2 A;  1NPQ A;  1DJY A;  2GV5 A;  4GGF C;  2LCP A;  1EH2 A;  5HLV A;  1BU3 A;  2BL0 B;  2LP2 A;  2VRG A;  1NIW A;  2CXJ A;  3SG2 A;  2K7D A;  1XK4 A;  2LLT A;  1R6P A;  2KYC A;  1S6I A;  2F3Z A;  2EGD A;  1FI6 A;  4MBE A;  1SK6 D;  3DVJ A;  4NDD A;  1V1G A;  2H2K A;  1BLQ A;  5KTY A;  5JOL A;  4JPZ B;  4CPV A;  2PSR A;  3GK4 X;  4YGA A;  1JF0 A;  1JFK A;  2K2F A;  2M1U A;  5KU1 A;  3EKJ A;  4ETO A;  3PN7 B;  3OX5 A;  1QLK A;  4QJ4 B;  1A2X A;  1IQ5 A;  1EG3 A;  2ZRS A;  1HT9 A;  2JT0 A;  1TNP A;  1ZOT B;  2WND A;  1CDN A;  5CSF A;  2MRD A;  1SL9 A;  3I5G B;  4DRW A;  1NUB A;  1YUT A;  4CID A;  3M0W A;  2KI6 C;  2LVV A;  1XVJ A;  1QS7 A;  3A4U B;  3DVE A;  2KAV A;  1BT6 A;  4OV2 A;  4DUQ A;  1DJG A;  1IH0 A;  2L5X B;  3PN7 C;  1JBA A;  4XJK B;  4C0K A;  2JOJ A;  2KI6 D;  2LAP A;  3LL8 B;  4YI8 A;  1MWN A;  1C07 A;  3BQ3 A;  2KAY A;  1WDC C;  4ORC B;  1B7T Y;  3VRP A;  1LIN A;  1UHI A;  3I5G C;  3TDU A;  1XO5 A;  2AUC A;  1WRZ A;  1OMV A;  1AJ4 A;  1KWO B;  1NYA A;  1K96 A;  2AMI A;  4USL A;  4AOM A;  1QAT A;  1XFZ O;  2JT3 A;  3O4Y A;  1CNP A;  1DTL A;  1KQV A;  1JUO A;  3CR4 X;  1JFJ A;  4XYN A;  4C0J A;  1ALW A;  1DJX A;  1OOJ A;  1OMD A;  1LA0 A;  1QXP A;  2M1K B;  1KFX L;  1RJV A;  1D1O A;  4AQJ A;  1A29 A;  2HET A;  4N1F A;  3CS1 A;  1KK7 Z;  1KWO C;  1K90 D;  2BCX A;  3IQO A;  4YI9 A;  5BPJ A;  4GBA A;  1B7T Z;  1NX2 A;  2M7L A;  1KQM B;  2WC8 A;  1E8A A;  1C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...