1WRLA

Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
b'IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 25
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wrlA00
5GQQC 3BUMB 1IKUA 1M31A 3LK1A 1K90D 2KAVA 2LP3A 1B4CA 1EJ3A 3TDIA 3O2PA 1PSRA 3EK8A 1NWDA 4QJ5B 2L5XB 1KQVA 3CZTX 2CNPA 4I5JA 1ALVA 3EVRA 1M46A 2BKIB 2O60A 4ORCB 2L2EA 2KAXA 3NSLA 4PHNA 3KPXA 1EL4A 5HLVA 3SG3A 1QLSA 3E3RA 3I5HC 2KGRA 1UHNA 3OP0A 2JPTA 1N65A 1WRZA 1DJYA 3VRQA 3BUWB 4GGFC 1PRWA 2JXLA 1RK9A 2JOJA 4CLNA 1SKTA 1F8HA 3AAJA 1KK7Z 1TCFA 2LP2A 1OZOA 2NCOA 3EVUA 3I5GC 2KFGA 2L51A 2KI4C 2KYCA 5KSZA 1A2XA 1LVCD 1SNLA 1J7OA 2SASA 2OTGB 2LC5A 2JTZA 2EC6C 1WLMA 2V53A 3GK2A 3HX4A 3LLEA 2L4HA 3PALA 1UURA 1MXEA 5DKRA 5JJGA 3KF9A 1OE9B 1XFVO 1CB1A 3GOFA 3I5IC 2JC2A 1CNPA 2JXCA 1NX1A 5I2OA 3O6BA 3PN7B 3RLZA 1A75B 1NUBA 2F2OA 1LKJA 3K21A 2F2PA 3LL8B 1VRKA 1CMFA 1V1GA 4C0LA 2M8UA 2NZ0A 3IF7A 1ALWA 1S6CA 3C1VA 2HPSA 3DD4A 2KBMA 1BF5A 1LA0A 1R2UA 1QIVA 4FTGA 2F3ZA 4MZKA 3WHTB 1WDCC 1NYAA 1NPQA 1KK8C 1AJ5A 2BE6A 1BR1B 1SRAA 1SBJA 1Y1AA 1A4PA 5DKNA 1KK7Y 4GAOA 2HF5A 2JNFA 4U8DA 5ER5A 1MXLC 1YRUB 1RROA 3EKHA 1JF0A 1YRTB 4YGEB 4MZLA 1DJIA 4PE1A 2KGBC 1M45A 1CMGA 2E6WA 2JULA 2L0PA 2KHNA 1QLKA 2WOSA 1CDMA 5B8IB 5F6TA 2L4IA 1MHOA 2MLFC 4YGBB 3OB1B 5HLOA 3TDUA 3DVMA 4UPGA 2JT3A 2KQYA 1AHRA 1JF2A 2PRUA 4C0JA 2OPOA 3O4YA 1L7ZA 1R6PA 3F45A 1EG4A 2LHLA 1QV1A 1M39A 1FI6A 2QPTA 1RTP1 3D0YB 1G8IA 2OS8B 1XFWO 3I5FB 3SG4A 3PATA 3ZNIA 4P2YB 2MLEC 2CCMA 2I94A 4JWQA 2GGZA 3EK4A 3SG7A 1TN4A 3TS5C 4YGAA 1KFXL 4CFRA 4N1FA 3VGOA 2ZN8A 1TOPA 1N2DA 3NXAA 1KQMB 1CDPA 2E30A 1Y6WA 1QTXA 1BMOA 1UHHA 5PALA 1AVSA 2WC8A 1QASA 1K94A 4GNKB 1ODBA 4PALA 2ZNEA 5HKZA 3NSIA 1UHIA 1LINA 4PE0A 1BLQA 1KFUL 2I18A 1SMGA 1JBAA 3EVVA 1SYMA 1JWDA 2I7AA 1OSAA 1SCMC 4M2OA 1IG5A 2K2FA 1PSBA 2JNXA 1B8LA 2BL0C 2COLB 2PSRA 1JFKA 4PCWA 5JOLA 2K7OA 2LM5A 1CKKA 1QJTA 2FCDA 5D7FA 4BY4A 4R1EA 1G33A 2ZKMX 2NCPA 2JU0A 3QRXA 4NDCA 1L2OC 1IH0A 3AKAA 5DKQA 1DGVA 1B7TZ 2AUCA 2CBLA 3OB2B 2M3WA 4YRUA 1KWOB 1UWOA 2PVBA 1F70A 1Q80A 3ICBA 1GQMA 5D69A 3PFVA 2M97A 1SY9A 3RM1A 1FBVA 3KO0A 3H4SE 5AXIA 3D10A 1CDNA 1DJWA 3CGAA 1IQ5A 1S26D 3CLNA 3GK1A 3NSOA 2R2IA 4I5LB 2IS9A 1YX7A 3BUNB 4WQ2A 3DF0A 1QX5B 1OQPA 5K89A 1OMDA 1IJ5A 2ZRTA 5I2QA 1BR4B 1SCVA 3A4UB 2PALA 3CS1A 3DVJA 4OCIA 2MAZA 2FOTA 2BCBA 1G4YR 1D1OA 2K61A 1ZOTB 2K7CA 2M1KB 4CPVA 1TTXA 1J7QA 1CM1A 4L9MA 5G08A 1ZMZA 1XYDA 4MEWA 1PVBA 1MF8B 2JQ6A 2TN4A 4GBAA 1ZFSA 1RJVA 2Y1NA 2Y1MA 1QXPA 4XJKA 2H2KA 2O5GA 3SG6A 1SR6B 1J7RA 1DTLA 2LUCA 2LLUA 2QACA 4ZCVA 5IBWA 1S6IA 2OTGC 3AAKA 4BY5A 2L50A 1B7TY 2H61C 1YTZC 4QJ3B 1JC2A 1LA3A 1J1EA 1XK4C 3NSKA 1BODA 2CT9A 4GGFA 1FW4A 1PK0D 2GGMA 1WY9A 3WXAA 1GJYA 2K7BA 2BECA 4DS7A 1CLBA 4Q04A 1YVLA 2KAYA 1XVJA 2L98A 2HQWA 3BOWB 4ETOA 5CSNA 1K2HA 1QIWA 4CFQA 2LVJA 1GGZA 1KK8B 1NCZA 3WNXB 1MQ1A 3JTDB 3M0WA 5HKWA 1CFCA 1XO5A 1CFPA 2Q91A 1OZSA 4F0ZB 3SIBA 1EXRA 2D8NA 1TRFA 1TCOB 4D1EA 1J1DA 2M0RA 4NQGA 1F54A 2MA2A 3CR5X 1SW8A 4DIRA 1XFYO 1KFXS 4OV2A 1KSMA 3OX6A 4GFTA 1UHJA 2ZRSA 4MSPA 2ISDA 1C07A 1IJ6A 4I5KA 1XK4A 1QX7A 5FYXA 2HETA 2M7NA 2WCBA 3FWCA 4M2QA 5HYDA 1DJHA 4MRYA 1IQ3A 2BBNA 5AFPA 5KTYA 2KBIA 1KFUS 4E68A 5CSIA 1H8BA 1A75A 1BT6A 2MBXA 2NXQA 1MUXA 1CFDA 2KFHA 1DF0A 1IGVA 3JVTB 4YI9A 1B8CA 2AMIA 4HRGA 5HKYA 3PM8A 4NDBA 2WCEA 2OS8C 3I5FC 1BU3A 4IL1A 1K9KA 4PHMA 1AK8A 1SL9A 2LVVA 3EKJA 2KQ6A 4JPZB 4YI8A 2DOQA 1S5GZ 4OR9B 1PALA 2LUXA 2JRFA 2EGDA 1E8AA 2ZNDA 4DCKA 2F3YA 3TUYB 4HSZA 1DJGA 1NX3A 2Y4QA 3OX5A 2LLTA 1XFXO 1KQMC 3CWGA 2F33A 1OOJA 2LNKA 1DJZA 1WRKA 4XYNA 1BOCA 2AAOA 1NCXA 1KCYA 4AQJA 1DJXA 1U5IA 1YX8A 2KOTA 2LV7A 1CFFA 2EHBA 1S1EA 1BJFA 1K9PA 1YUUA 1S3PA 1ZUZA 2LHIA 3CTNA 4MN0A 2BE4A 1DMOA 2HQ8A 1TNQA 3FIAA 1XFZO 4YBHB 4MLWA 4MRXA 3D0YA 4ORAB 4MZJA 1S6JA 2G9BA 2MHHA 1NSHA 4MBEA 4DUQA 3IQOA 1SK6D 2LMTA 3WHUB 1QS7A 3I5HB 1RECA 2LLSA 2ZN9A 1V1FA 3BQ3A 1HQVA 2LAPA 4OKHA 1F4QA 5CPVA 4HREE 1KWOC 1CLLA 4YGCB 1HT9A 1S5GY 2Y5IA 1JUOA 3VRRA 2KFFA 2VRGA 3I5GB 3ZWHA 1W7JB 2KI4B 1CDLA 1YUTA 4WRIA 1B47A 3BUOB 1ZACA 2GV5A 5CSJA 2M29A 1GGWA 1TNPA 2K2AA 1NCYA 3A8RA 2ZFDA 1DT7B 2LANA 5ER4X 3DVKA 2WCFA 2K8MB 2LMUA 3TDZA 2EC6B 1Y1UA 2FCEA 2M9GA 2BCXA 4OVNF 4MVFA 5AANA 3EK7A 1QATA 3HCMA 2A4JA 1UHKA 3I5IB 1DVIA 2P6BB 3CR4X 2LE9B 4FQOA 4C0KA 4P5OE 4AOMA 2SCPA 1B8RA 1SL8A 1MR8A 2LMVA 3VROA 2KDHA 1QX2A 1UUSA 2I2RE 4TNCA 1WLZA 3PN7C 4WQ3A 1SR6C 2KNEA 2LVKA 3O78A 3BYAA 1KSOA 1NX2A 1FF1A 1WDCB 3KEVA 1C7VA 4I5NB 4DRWA 1K9UA 1SPYA 1TIZA 2F8PA 1XA5A 1F4OA 2PMYA 3VRNA 4JQ0D 2JT0A 2CTNA 3TZ1A 1J7PA 1DF0B 3CR2A 4PE4A 1NX0A 1B9AA 1MWNA 3KHEA 1QVIZ 3MSEB 2JZIA 1A29A 1AUIB 1EH2A 2G2BA 2KI6C 2FJUB 2NLNA 3BUXB 2LCPA 1NIWA 1YR5A 1K96A 1JFJA 2KYFA 1K93D 2H61A 3JTDC 1K8UA 4M2PA 1FPWA 2CXJA 1RWYA 4A4BA 5KU1A 1TNXA 3FS7A 1NP8A 1QV0A 1IWQA 1CTRA 3PSRA 2M49B 1PULA 1YURA 4USLA 2K7DA 1Y1XA 3LCPC 2KSPA 1OMVA 1PVAA 1X02A 4CIDA 1Y0VH 4NDDA 1A03A 1OMRA 1U5IB 1F71A 2B1UA 3SJSA 3LK0A 2RGIA 4GPLB 4N1GA 4PHKA 4PE7A 3FWBA 3AKBA 1AP4A 2K0JA 3PLFB 1M63B 5J3XA 5I2LA 3TS5B 1YVHA 2MRDA 2BBMA 1F55A 1RFJA 4ICBA 3BOWA 3SG5A 1H4BA 1YUSA 4PDZA 2Q4UA 5AEQA 1K95A 1XFUO 2M1UA 2WORA 5AERA 1JSAA 3IQQA 5BPJA 1QVIY 3JVTC 2M7LA 2JTTA 2JWWA 4HRHA 5CSFA 3VRPA 3DVEA 1N0YA 1BG1A 3DF0B 4AQIA 1CM4A 1SCMB 2PASA 2BL0B 2JT8A 1CLMA 3GK4X 1W7IB 1EG3A 1LXFC 1TNWA 3OHMB 4GGNA 4A4CA 3TUYC 1B1GA 1UP5A 4PHJA 4ZCUA 5TNCA 1IRJA 3BXKA 4QJ4B 5I8NA 4YGDB 1C7WA 1L2OB 1DGUA 4ORBB 2BCAA 2BKHB 1SL7A 1S36A 2WNDA 4GUKA 1AJ4A 2MJWB 4XJKB 1J55A 2LVIA 1WRLA 3SG2A 4N5XA 1FI5A 2KI6D 3SIAA
chains in the Genus database with same CATH superfamily
5GQQC 3BUMB 1IKUA 1M31A 3DZTA 3LK1A 1K90D 2KAVA 2LP3A 1B4CA 1EJ3A 3TDIA 3O2PA 1PSRA 3PJIA 3EK8A 1NWDA 4QJ5B 2L5XB 1KQVA 3CZTX 2CNPA 4I5JA 1ALVA 3EVRA 1M46A 2BKIB 2O60A 4ORCB 2L2EA 2KAXA 3NSLA 4PHNA 3KPXA 2KPHA 1EL4A 5HLVA 3SG3A 1QLSA 3E3RA 3I5HC 2KGRA 1UHNA 3B86A 3OP0A 2JPTA 1N65A 1WRZA 1DJYA 3VRQA 3BUWB 4GGFC 1PRWA 2JXLA 1RK9A 2JOJA 3CZ0A 4CLNA 1SKTA 1F8HA 3AAJA 1KK7Z 1TCFA 2LP2A 3CYZA 3VB1A 1OZOA 2NCOA 3EVUA 3I5GC 3PM2A 2KFGA 2L51A 2KI4C 2KYCA 3B88A 5I94A 5KSZA 1A2XA 3QMEA 1OOFA 1LVCD 1SNLA 1J7OA 2SASA 2OTGB 2LC5A 3R72A 1TUZA 2JTZA 2EC6C 1WLMA 2V53A 3GK2A 3HX4A 3LLEA 2L4HA 3PALA 1UURA 1MXEA 5DKRA 3UO9A 5JJGA 3KF9A 1OE9B 1XFVO 1CB1A 3GOFA 3I5IC 2JC2A 1CNPA 2JXCA 1NX1A 5I2OA 3O6BA 3SS3A 3PN7B 3RLZA 1A75B 1NUBA 2F2OA 1LKJA 3K21A 2F2PA 3LL8B 1VRKA 1CMFA 1V1GA 2H8VA 2M8UA 2NZ0A 4C0LA 3IF7A 1ALWA 1S6CA 3C1VA 2HPSA 3DD4A 2KBMA 1BF5A 2WC6A 1LA0A 1R2UA 1QIVA 4FTGA 2F3ZA 4MZKA 3WHTB 1WDCC 1NYAA 1NPQA 1KK8C 1AJ5A 2BE6A 4IJ7A 1BR1B 1SRAA 1SBJA 1Y1AA 1A4PA 5DKNA 1KK7Y 4GAOA 2HF5A 2JNFA 4U8DA 5ER5A 1MXLC 1YRUB 1RROA 3EKHA 1JF0A 1YRTB 4YGEB 4MZLA 1DJIA 3NHIA 4PE1A 2KGBC 1M45A 1CMGA 3UNWA 3D77A 2E6WA 2JULA 1XFRA 2KHNA 1QLKA 2L0PA 1CDMA 2WOSA 5B8IB 5F6TA 2L4IA 1MHOA 2MLFC 4YGBB 3OB1B 5HLOA 3TDUA 2JPOA 3DVMA 3L4LA 4UPGA 2JT3A 2KQYA 1AHRA 1JF2A 2PRUA 1OW4A 2OPOA 2WCHA 3O4YA 4C0JA 1L7ZA 1R6PA 3F45A 1EG4A 2LHLA 1QV1A 1M39A 1FI6A 3S0DA 2QPTA 1RTP1 3D0YB 1G8IA 2OS8B 1XFWO 3I5FB 3SG4A 3PATA 3ZNIA 4P2YB 2MLEC 2CCMA 2I94A 4JWQA 2GGZA 3EK4A 3SG7A 3FE6A 1TN4A 2GTEA 3TS5C 2L2CA 4YGAA 1KFXL 1SSEB 4CFRA 4N1FA 3VGOA 4OZDA 2WC5A 2ZN8A 1TOPA 1N2DA 3EG5B 1KQMB 3NXAA 1CDPA 2E30A 1Y6WA 3V2LA 1QTXA 1BMOA 1UHHA 5PALA 1AVSA 2WC8A 1QASA 1K94A 4GNKB 1ODBA 4PALA 2ZNEA 5HKZA 3NSIA 1UHIA 1LINA 4PE0A 1DC1A 1BLQA 1KFUL 2I18A 1SMGA 1JBAA 3EVVA 1SYMA 1JWDA 2I7AA 3OBVA 5FI7A 1OSAA 3R1PA 1SCMC 3DYEA 4M2OA 1IG5A 2K2FA 1PSBA 2JNXA 1B8LA 2BL0C 2COLB 2WCKA 3K1EA 1C3YA 2PSRA 1JFKA 4PCWA 5JOLA 2K7OA 2LM5A 1CKKA 1QJTA 2FCDA 5D7FA 4BY4A 4R1EA 1G33A 2ZKMX 1P28A 2NCPA 2JU0A 3QRXA 4NDCA 1L2OC 3TUYC 1IH0A 3CZ2A 3AKAA 5DKQA 1GM0A 1DGVA 1B7TZ 3IVTA 2AUCA 2CBLA 3OB2B 2M3WA 4YRUA 1KWOB 1UWOA 2PVBA 1F70A 1Q80A 3ICBA 1GQMA 4KYNA 5D69A 3PFVA 2M97A 1SY9A 3RM1A 1FBVA 3KO0A 5D3OA 3H4SE 5AXIA 3D10A 1CDNA 1DJWA 3CGAA 1IQ5A 1S26D 3CLNA 3GK1A 3NSOA 2R2IA 4I5LB 2IS9A 3NHTA 1YX7A 3BUNB 3S0GA 4WQ2A 4INWA 3DF0A 1QX5B 1OQPA 5K89A 1OMDA 1IJ5A 2ZRTA 5I2QA 1IIOA 1BR4B 1SCVA 3A4UB 2PALA 3CS1A 3DVJA 4OCIA 2MAZA 2FOTA 2BCBA 1G4YR 1D1OA 2K61A 1ZOTB 2K7CA 2M1KB 4CPVA 1TTXA 2BNXA 1J7QA 1CM1A 4L9MA 5G08A 1ZMZA 1XYDA 3D75A 4MEWA 3B87A 1PVBA 1MF8B 2JQ6A 2PQLA 2TN4A 4GBAA 3S0FA 1ZFSA 1RJVA 2Y1NA 3BJHA 2Y1MA 1QXPA 4XJKA 1Z2CB 2H2KA 2O5GA 3SG6A 1SR6B 1J7RA 1DTLA 2LUCA 2LLUA 2QACA 4ZCVA 5IBWA 1S6IA 2OTGC 3AAKA 3FE8A 4BY5A 2L50A 1B7TY 2H61C 1YTZC 4QJ3B 1JC2A 1LA3A 1J1EA 1XK4C 3NSKA 1BODA 2CT9A 4GGFA 1FW4A 1PK0D 2GGMA 1WY9A 3L4AA 3WXAA 1GJYA 2K7BA 2BECA 4DS7A 1CLBA 4Q04A 1YVLA 2KAYA 1XVJA 2L98A 2HQWA 3BOWB 4ETOA 5CSNA 1K2HA 1QIWA 4CFQA 2LVJA 1OOGA 2QEVA 3S0AA 1GGZA 1KK8B 4JKTA 1NCZA 3WNXB 1MQ1A 3JTDB 3M0WA 5HKWA 1CFCA 1XO5A 1CFPA 2Q91A 1OZSA 4F0ZB 3SIBA 1EXRA 2D8NA 1TRFA 2PYQA 1TCOB 4D1EA 1J1DA 2M0RA 4NQGA 1F54A 2MA2A 3CR5X 3D78A 1SW8A 4DIRA 1XFYO 1KFXS 4OV2A 1KSMA 3OX6A 4GFTA 1LS8A 1UHJA 2ZRSA 4MSPA 2ISDA 1C07A 1IJ6A 4I5KA 3S0BA 1XK4A 1QX7A 5FYXA 2HETA 2M7NA 2WCBA 3FWCA 4M2QA 5HYDA 1DJHA 4MRYA 2QEOA 1IQ3A 2BBNA 5AFPA 5KTYA 2KBIA 1KFUS 4E68A 5CSIA 1H8BA 1A75A 1BT6A 2MBXA 2NXQA 1MUXA 1CFDA 4FQTA 2KFHA 1DF0A 1IGVA 3JVTB 4YI9A 1B8CA 2AMIA 4HRGA 5HKYA 3D76A 3PM8A 3BFHA 4NDBA 2WCEA 2OS8C 3SS4A 3BFAA 3I5FC 1BU3A 4IL1A 1K9KA 4PHMA 1AK8A 4INXA 1SL9A 2LVVA 3EKJA 2KQ6A 4JPZB 4YI8A 2DOQA 1S5GZ 4OR9B 1PALA 2LUXA 2JRFA 2EGDA 1E8AA 2ZNDA 4DCKA 2F3YA 3CDNA 3TUYB 4HSZA 1DJGA 1NX3A 2Y4QA 3OX5A 2LLTA 1XFXO 1KQMC 3CWGA 3O4XA 3SS5A 5FI2A 2F33A 1OOJA 2LNKA 3DY9A 1DJZA 3D74A 1WRKA 4XYNA 1BOCA 2AAOA 1NCXA 1KCYA 4AQJA 1DJXA 1U5IA 1YX8A 2KOTA 2LV7A 1CFFA 2EHBA 1S1EA 1BJFA 1QWVA 1K9PA 1YUUA 1S3PA 1TUJA 1ZUZA 2LHIA 3CTNA 4MN0A 2BE4A 3B7AA 2BAPA 1DMOA 2HQ8A 1TNQA 3FIAA 1XFZO 4YBHB 4MLWA 3L47A 4MRXA 3D0YA 3DXLA 4ORAB 4MZJA 1S6JA 2G9BA 2MHHA 1NSHA 4MBEA 4DUQA 2KLDA 3IQOA 1SK6D 2LMTA 3WHUB 1QS7A 3D73A 3I5HB 1OOIX 1RECA 2LLSA 2ZN9A 1V1FA 3BQ3A 1HQVA 2LAPA 4OKHA 1F4QA 5CPVA 4HREE 1KWOC 2L5YA 1CLLA 4YGCB 1HT9A 1S5GY 2Y5IA 1JUOA 4JD9A 3VRRA 1DELA 2KFFA 2VRGA 3I5GB 3ZWHA 1W7JB 2KI4B 1CDLA 1YUTA 4WRIA 1B47A 3BUOB 1ZACA 2GV5A 3N7HA 5CSJA 2M29A 1GGWA 1TNPA 2K2AA 1NCYA 3A8RA 2ZFDA 1DT7B 2LANA 5ER4X 3DVKA 2WCFA 2FJYA 2K8MB 2LMUA 3TDZA 2EC6B 1Y1UA 2FCEA 2M9GA 2BCXA 4F7FA 4OVNF 4MVFA 5DICA 5AANA 3EK7A 1QATA 3HCMA 2A4JA 1UHKA 3I5IB 1Z4HA 1DEKA 1DVIA 1T14A 2P6BB 3CR4X 2LE9B 4FQOA 4C0KA 1TWOA 4P5OE 4AOMA 2SCPA 1B8RA 1SL8A 1MR8A 2LMVA 3B6XA 2KDHA 1QX2A 2QDIA 3VROA 1UUSA 2I2RE 3FE9A 4TNCA 1WLZA 4PT1A 3PN7C 4WQ3A 1SR6C 2KNEA 3S0EA 2LVKA 3O78A 3BYAA 1KSOA 1NX2A 1FF1A 1WDCB 3KEVA 1C7VA 4I5NB 4DRWA 1K9UA 1SPYA 1TIZA 2F8PA 1XA5A 1F4OA 2PMYA 3VRNA 4JQ0D 2JT0A 2CTNA 3TZ1A 2KLEA 1DF0B 3CR2A 1J7PA 4PE4A 1NX0A 1B9AA 1MWNA 3KHEA 3CABA 1QVIZ 2YGUA 3MSEB 2JZIA 1A29A 1AUIB 2WCMA 1EH2A 2G2BA 2KI6C 2FJUB 2NLNA 3BUXB 2LCPA 1NIWA 1YR5A 1K96A 1JFJA 2KYFA 1K93D 2H61A 3JTDC 1K8UA 4M2PA 1FPWA 2CXJA 1RWYA 2K60A 4A4BA 5KU1A 1TNXA 3FS7A 3Q8IA 1NP8A 1QV0A 1IWQA 1CTRA 3R1OA 3PSRA 2M49B 1PULA 1YURA 2WCJA 4USLA 2K7DA 1Y1XA 3LCPC 3OGNA 2KSPA 1OMVA 2P71A 1PVAA 1X02A 4CIDA 1Y0VH 4NDDA 1A03A 1OMRA 1U5IB 1F71A 2B1UA 3SJSA 3LK0A 2RGIA 4GPLB 4N1GA 4PHKA 3R1VA 4PE7A 3FWBA 3AKBA 1AP4A 2K0JA 3PLFB 1DQEA 1M63B 5J3XA 5I2LA 3TS5B 1YVHA 2MRDA 2BBMA 2QEHA 1RFJA 3BFBA 1F55A 4ICBA 3BOWA 3SG5A 2P70A 1H4BA 1YUSA 4PDZA 2Q4UA 5AEQA 1K95A 1XFUO 2M1UA 2WORA 5HL1A 5AERA 1JSAA 3IQQA 5BPJA 1QVIY 2ERBA 3JVTC 2JTTA 2M7LA 2JWWA 2QEBA 4HRHA 5CSFA 3VRPA 3DVEA 1N0YA 1BG1A 3DF0B 4AQIA 1ORGA 3RZSA 1CM4A 1SCMB 3CZ1A 2PASA 2BL0B 2JT8A 1CLMA 3GK4X 1W7IB 1C3ZA 2WCLA 5EL2A 1EG3A 1LXFC 1TNWA 3OHMB 4GGNA 3NGVA 5FI6A 4A4CA 1UP5A 4PHJA 4ZCUA 5TNCA 1IRJA 3BXKA 4QJ4B 1B1GA 5I8NA 4YGDB 1C7WA 1L2OB 1DGUA 1W9ZA 4ORBB 2BCAA 2BKHB 1SL7A 1S36A 2WNDA 4GUKA 1AJ4A 2MJWB 4XJKB 1J55A 2LVIA 1WRLA 3SG2A 1OOHA 4N5XA 1FI5A 2KI6D 3SIAA
chains in the Genus database with same CATH topology
5GQQC 3BUMB 1IKUA 1M31A 3LK1A 1K90D 2KAVA 2LP3A 1B4CA 1EJ3A 3TDIA 3O2PA 1PSRA 3EK8A 1NWDA 4QJ5B 2L5XB 1KQVA 3CZTX 2CNPA 4I5JA 1ALVA 3EVRA 1M46A 2BKIB 2O60A 4ORCB 2L2EA 2KAXA 3NSLA 4PHNA 3KPXA 1EL4A 5HLVA 3SG3A 1QLSA 3E3RA 3I5HC 2KGRA 1UHNA 3OP0A 2JPTA 1N65A 1WRZA 1DJYA 3VRQA 3BUWB 4GGFC 1PRWA 2JXLA 1RK9A 2JOJA 4CLNA 1SKTA 1F8HA 3AAJA 1KK7Z 1TCFA 2LP2A 1OZOA 2NCOA 3EVUA 3I5GC 2KFGA 2L51A 2KI4C 2KYCA 5KSZA 1A2XA 1LVCD 1SNLA 1J7OA 2SASA 2OTGB 2LC5A 2JTZA 2EC6C 1WLMA 2V53A 3GK2A 3HX4A 3LLEA 2L4HA 3PALA 1UURA 1MXEA 5DKRA 5JJGA 3KF9A 1OE9B 1XFVO 1CB1A 3GOFA 3I5IC 2JC2A 1CNPA 2JXCA 1NX1A 5I2OA 3O6BA 3PN7B 3RLZA 1A75B 1NUBA 2F2OA 1LKJA 3K21A 2F2PA 3LL8B 1VRKA 1CMFA 1V1GA 4C0LA 2M8UA 2NZ0A 3IF7A 1ALWA 1S6CA 3C1VA 2HPSA 3DD4A 2KBMA 1BF5A 1LA0A 1R2UA 1QIVA 4FTGA 2F3ZA 4MZKA 3WHTB 1WDCC 1NYAA 1NPQA 1KK8C 1AJ5A 2BE6A 1BR1B 1SRAA 1SBJA 1Y1AA 1A4PA 5DKNA 1KK7Y 4GAOA 2HF5A 2JNFA 4U8DA 5ER5A 1MXLC 1YRUB 1RROA 3EKHA 1JF0A 1YRTB 4YGEB 4MZLA 1DJIA 4PE1A 2KGBC 1M45A 1CMGA 2E6WA 2JULA 2L0PA 2KHNA 1QLKA 2WOSA 1CDMA 5B8IB 5F6TA 2L4IA 1MHOA 2MLFC 4YGBB 3OB1B 5HLOA 3TDUA 3DVMA 4UPGA 2JT3A 2KQYA 1AHRA 1JF2A 2PRUA 4C0JA 2OPOA 3O4YA 1L7ZA 1R6PA 3F45A 1EG4A 2LHLA 1QV1A 1M39A 1FI6A 2QPTA 1RTP1 3D0YB 1G8IA 2OS8B 1XFWO 3I5FB 3SG4A 3PATA 3ZNIA 4P2YB 2MLEC 2CCMA 2I94A 4JWQA 2GGZA 3EK4A 3SG7A 1TN4A 3TS5C 4YGAA 1KFXL 4CFRA 4N1FA 3VGOA 2ZN8A 1TOPA 1N2DA 3NXAA 1KQMB 1CDPA 2E30A 1Y6WA 1QTXA 1BMOA 1UHHA 5PALA 1AVSA 2WC8A 1QASA 1K94A 4GNKB 1ODBA 4PALA 2ZNEA 5HKZA 3NSIA 1UHIA 1LINA 4PE0A 1BLQA 1KFUL 2I18A 1SMGA 1JBAA 3EVVA 1SYMA 1JWDA 2I7AA 1OSAA 1SCMC 4M2OA 1IG5A 2K2FA 1PSBA 2JNXA 1B8LA 2BL0C 2COLB 2PSRA 1JFKA 4PCWA 5JOLA 2K7OA 2LM5A 1CKKA 1QJTA 2FCDA 5D7FA 4BY4A 4R1EA 1G33A 2ZKMX 2NCPA 2JU0A 3QRXA 4NDCA 1L2OC 1IH0A 3AKAA 5DKQA 1DGVA 1B7TZ 2AUCA 2CBLA 3OB2B 2M3WA 4YRUA 1KWOB 1UWOA 2PVBA 1F70A 1Q80A 3ICBA 1GQMA 5D69A 3PFVA 2M97A 1SY9A 3RM1A 1FBVA 3KO0A 3H4SE 5AXIA 3D10A 1CDNA 1DJWA 3CGAA 1IQ5A 1S26D 3CLNA 3GK1A 3NSOA 2R2IA 4I5LB 2IS9A 1YX7A 3BUNB 4WQ2A 3DF0A 1QX5B 1OQPA 5K89A 1OMDA 1IJ5A 2ZRTA 5I2QA 1BR4B 1SCVA 3A4UB 2PALA 3CS1A 3DVJA 4OCIA 2MAZA 2FOTA 2BCBA 1G4YR 1D1OA 2K61A 1ZOTB 2K7CA 2M1KB 4CPVA 1TTXA 1J7QA 1CM1A 4L9MA 5G08A 1ZMZA 1XYDA 4MEWA 1PVBA 1MF8B 2JQ6A 2TN4A 4GBAA 1ZFSA 1RJVA 2Y1NA 2Y1MA 1QXPA 4XJKA 2H2KA 2O5GA 3SG6A 1SR6B 1J7RA 1DTLA 2LUCA 2LLUA 2QACA 4ZCVA 5IBWA 1S6IA 2OTGC 3AAKA 4BY5A 2L50A 1B7TY 2H61C 1YTZC 4QJ3B 1JC2A 1LA3A 1J1EA 1XK4C 3NSKA 1BODA 2CT9A 4GGFA 1FW4A 1PK0D 2GGMA 1WY9A 3WXAA 1GJYA 2K7BA 2BECA 4DS7A 1CLBA 4Q04A 1YVLA 2KAYA 1XVJA 2L98A 2HQWA 3BOWB 4ETOA 5CSNA 1K2HA 1QIWA 4CFQA 2LVJA 1GGZA 1KK8B 1NCZA 3WNXB 1MQ1A 3JTDB 3M0WA 5HKWA 1CFCA 1XO5A 1CFPA 2Q91A 1OZSA 4F0ZB 3SIBA 1EXRA 2D8NA 1TRFA 1TCOB 4D1EA 1J1DA 2M0RA 4NQGA 1F54A 2MA2A 3CR5X 1SW8A 4DIRA 1XFYO 1KFXS 4OV2A 1KSMA 3OX6A 4GFTA 1UHJA 2ZRSA 4MSPA 2ISDA 1C07A 1IJ6A 4I5KA 1XK4A 1QX7A 5FYXA 2HETA 2M7NA 2WCBA 3FWCA 4M2QA 5HYDA 1DJHA 4MRYA 1IQ3A 2BBNA 5AFPA 5KTYA 2KBIA 1KFUS 4E68A 5CSIA 1H8BA 1A75A 1BT6A 2MBXA 2NXQA 1MUXA 1CFDA 2KFHA 1DF0A 1IGVA 3JVTB 4YI9A 1B8CA 2AMIA 4HRGA 5HKYA 3PM8A 4NDBA 2WCEA 2OS8C 3I5FC 1BU3A 4IL1A 1K9KA 4PHMA 1AK8A 1SL9A 2LVVA 3EKJA 2KQ6A 4JPZB 4YI8A 2DOQA 1S5GZ 4OR9B 1PALA 2LUXA 2JRFA 2EGDA 1E8AA 2ZNDA 4DCKA 2F3YA 3TUYB 4HSZA 1DJGA 1NX3A 2Y4QA 3OX5A 2LLTA 1XFXO 1KQMC 3CWGA 2F33A 1OOJA 2LNKA 1DJZA 1WRKA 4XYNA 1BOCA 2AAOA 1NCXA 1KCYA 4AQJA 1DJXA 1U5IA 1YX8A 2KOTA 2LV7A 1CFFA 2EHBA 1S1EA 1BJFA 1K9PA 1YUUA 1S3PA 1ZUZA 2LHIA 3CTNA 4MN0A 2BE4A 1DMOA 2HQ8A 1TNQA 3FIAA 1XFZO 4YBHB 4MLWA 4MRXA 3D0YA 4ORAB 4MZJA 1S6JA 2G9BA 2MHHA 1NSHA 4MBEA 4DUQA 3IQOA 1SK6D 2LMTA 3WHUB 1QS7A 3I5HB 1RECA 2LLSA 2ZN9A 1V1FA 3BQ3A 1HQVA 2LAPA 4OKHA 1F4QA 5CPVA 4HREE 1KWOC 1CLLA 4YGCB 1HT9A 1S5GY 2Y5IA 1JUOA 3VRRA 2KFFA 2VRGA 3I5GB 3ZWHA 1W7JB 2KI4B 1CDLA 1YUTA 4WRIA 1B47A 3BUOB 1ZACA 2GV5A 5CSJA 2M29A 1GGWA 1TNPA 2K2AA 1NCYA 3A8RA 2ZFDA 1DT7B 2LANA 5ER4X 3DVKA 2WCFA 2K8MB 2LMUA 3TDZA 2EC6B 1Y1UA 2FCEA 2M9GA 2BCXA 4OVNF 4MVFA 5AANA 3EK7A 1QATA 3HCMA 2A4JA 1UHKA 3I5IB 1DVIA 2P6BB 3CR4X 2LE9B 4FQOA 4C0KA 4P5OE 4AOMA 2SCPA 1B8RA 1SL8A 1MR8A 2LMVA 3VROA 2KDHA 1QX2A 1UUSA 2I2RE 4TNCA 1WLZA 3PN7C 4WQ3A 1SR6C 2KNEA 2LVKA 3O78A 3BYAA 1KSOA 1NX2A 1FF1A 1WDCB 3KEVA 1C7VA 4I5NB 4DRWA 1K9UA 1SPYA 1TIZA 2F8PA 1XA5A 1F4OA 2PMYA 3VRNA 4JQ0D 2JT0A 2CTNA 3TZ1A 1J7PA 1DF0B 3CR2A 4PE4A 1NX0A 1B9AA 1MWNA 3KHEA 1QVIZ 3MSEB 2JZIA 1A29A 1AUIB 1EH2A 2G2BA 2KI6C 2FJUB 2NLNA 3BUXB 2LCPA 1NIWA 1YR5A 1K96A 1JFJA 2KYFA 1K93D 2H61A 3JTDC 1K8UA 4M2PA 1FPWA 2CXJA 1RWYA 4A4BA 5KU1A 1TNXA 3FS7A 1NP8A 1QV0A 1IWQA 1CTRA 3PSRA 2M49B 1PULA 1YURA 4USLA 2K7DA 1Y1XA 3LCPC 2KSPA 1OMVA 1PVAA 1X02A 4CIDA 1Y0VH 4NDDA 1A03A 1OMRA 1U5IB 1F71A 2B1UA 3SJSA 3LK0A 2RGIA 4GPLB 4N1GA 4PHKA 4PE7A 3FWBA 3AKBA 1AP4A 2K0JA 3PLFB 1M63B 5J3XA 5I2LA 3TS5B 1YVHA 2MRDA 2BBMA 1F55A 1RFJA 4ICBA 3BOWA 3SG5A 1H4BA 1YUSA 4PDZA 2Q4UA 5AEQA 1K95A 1XFUO 2M1UA 2WORA 5AERA 1JSAA 3IQQA 5BPJA 1QVIY 3JVTC 2M7LA 2JTTA 2JWWA 4HRHA 5CSFA 3VRPA 3DVEA 1N0YA 1BG1A 3DF0B 4AQIA 1CM4A 1SCMB 2PASA 2BL0B 2JT8A 1CLMA 3GK4X 1W7IB 1EG3A 1LXFC 1TNWA 3OHMB 4GGNA 4A4CA 3TUYC 1B1GA 1UP5A 4PHJA 4ZCUA 5TNCA 1IRJA 3BXKA 4QJ4B 5I8NA 4YGDB 1C7WA 1L2OB 1DGUA 4ORBB 2BCAA 2BKHB 1SL7A 1S36A 2WNDA 4GUKA 1AJ4A 2MJWB 4XJKB 1J55A 2LVIA 1WRLA 3SG2A 4N5XA 1FI5A 2KI6D 3SIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQQ C;  3BUM B;  1IKU A;  1M31 A;  3LK1 A;  1K90 D;  2KAV A;  2LP3 A;  1B4C A;  1EJ3 A;  3TDI A;  3O2P A;  1PSR A;  3EK8 A;  1NWD A;  4QJ5 B;  2L5X B;  1KQV A;  3CZT X;  2CNP A;  4I5J A;  1ALV A;  3EVR A;  1M46 A;  2BKI B;  2O60 A;  4ORC B;  2L2E A;  2KAX A;  3NSL A;  4PHN A;  3KPX A;  1EL4 A;  5HLV A;  3SG3 A;  1QLS A;  3E3R A;  3I5H C;  2KGR A;  1UHN A;  3OP0 A;  2JPT A;  1N65 A;  1WRZ A;  1DJY A;  3VRQ A;  3BUW B;  4GGF C;  1PRW A;  2JXL A;  1RK9 A;  2JOJ A;  4CLN A;  1SKT A;  1F8H A;  3AAJ A;  1KK7 Z;  1TCF A;  2LP2 A;  1OZO A;  2NCO A;  3EVU A;  3I5G C;  2KFG A;  2L51 A;  2KI4 C;  2KYC A;  5KSZ A;  1A2X A;  1LVC D;  1SNL A;  1J7O A;  2SAS A;  2OTG B;  2LC5 A;  2JTZ A;  2EC6 C;  1WLM A;  2V53 A;  3GK2 A;  3HX4 A;  3LLE A;  2L4H A;  3PAL A;  1UUR A;  1MXE A;  5DKR A;  5JJG A;  3KF9 A;  1OE9 B;  1XFV O;  1CB1 A;  3GOF A;  3I5I C;  2JC2 A;  1CNP A;  2JXC A;  1NX1 A;  5I2O A;  3O6B A;  3PN7 B;  3RLZ A;  1A75 B;  1NUB A;  2F2O A;  1LKJ A;  3K21 A;  2F2P A;  3LL8 B;  1VRK A;  1CMF A;  1V1G A;  4C0L A;  2M8U A;  2NZ0 A;  3IF7 A;  1ALW A;  1S6C A;  3C1V A;  2HPS A;  3DD4 A;  2KBM A;  1BF5 A;  1LA0 A;  1R2U A;  1QIV A;  4FTG A;  2F3Z A;  4MZK A;  3WHT B;  1WDC C;  1NYA A;  1NPQ A;  1KK8 C;  1AJ5 A;  2BE6 A;  1BR1 B;  1SRA A;  1SBJ A;  1Y1A A;  1A4P A;  5DKN A;  1KK7 Y;  4GAO A;  2HF5 A;  2JNF A;  4U8D A;  5ER5 A;  1MXL C;  1YRU B;  1RRO A;  3EKH A;  1JF0 A;  1YRT B;  4YGE B;  4MZL A;  1DJI A;  4PE1 A;  2KGB C;  1M45 A;  1CMG A;  2E6W A;  2JUL A;  2L0P A;  2KHN A;  1QLK A;  2WOS A;  1CDM A;  5B8I B;  5F6T A;  2L4I A;  1MHO A;  2MLF C;  4YGB B;  3OB1 B;  5HLO A;  3TDU A;  3DVM A;  4UPG A;  2JT3 A;  2KQY A;  1AHR A;  1JF2 A;  2PRU A;  4C0J A;  2OPO A;  3O4Y A;  1L7Z A;  1R6P A;  3F45 A;  1EG4 A;  2LHL A;  1QV1 A;  1M39 A;  1FI6 A;  2QPT A;  1RTP 1;  3D0Y B;  1G8I A;  2OS8 B;  1XFW O;  3I5F B;  3SG4 A;  3PAT A;  3ZNI A;  4P2Y B;  2MLE C;  2CCM A;  2I94 A;  4JWQ A;  2GGZ A;  3EK4 A;  3SG7 A;  1TN4 A;  3TS5 C;  4YGA A;  1KFX L;  4CFR A;  4N1F A;  3VGO A;  2ZN8 A;  1TOP A;  1N2D A;  3NXA A;  1KQM B;  1CDP A;  2E30 A;  1Y6W A;  1QTX A;  1BMO A;  1UHH A;  5PAL A;  1AVS A;  2WC8 A;  1QAS A;  1K94 A;  4GNK B;  1ODB A;  4PAL A;  2ZNE A;  5HKZ A;  3NSI A;  1UHI A;  1LIN A;  4PE0 A;  1BLQ A;  1KFU L;  2I18 A;  1SMG A;  1JBA A;  3EVV A;  1SYM A;  1JWD A;  2I7A A;  1OSA A;  1SCM C;  4M2O A;  1IG5 A;  2K2F A;  1PSB A;  2JNX A;  1B8L A;  2BL0 C;  2COL B;  2PSR A;  1JFK A;  4PCW A;  5JOL A;  2K7O A;  2LM5 A;  1CKK A;  1QJT A;  2FCD A;  5D7F A;  4BY4 A;  4R1E A;  1G33 A;  2ZKM X;  2NCP A;  2JU0 A;  3QRX A;  4NDC A;  1L2O C;  1IH0 A;  3AKA A;  5DKQ A;  1DGV A;  1B7T Z;  2AUC A;  2CBL A;  3OB2 B;  2M3W A;  4YRU A;  1KWO B;  1UWO A;  2PVB A;  1F70 A;  1Q80 A;  3ICB A;  1GQM A;  5D69 A;  3PFV A;  2M97 A;  1SY9 A;  3RM1 A;  1FBV A;  3KO0 A;  3H4S E;  5AXI A;  3D10 A;  1CDN A;  1DJW A;  3CGA A;  1IQ5 A;  1S26 D;  3CLN A;  3GK1 A;  3NSO A;  2R2I A;  4I5L B;  2IS9 A;  1YX7 A;  3BUN B;  4WQ2 A;  3DF0 A;  1QX5 B;  1OQP A;  5K89 A;  1OMD A;  1IJ5 A;  2ZRT A;  5I2Q A;  1BR4 B;  1SCV A;  3A4U B;  2PAL A;  3CS1 A;  3DVJ A;  4OCI A;  2MAZ A;  2FOT A;  2BCB A;  1G4Y R;  1D1O A;  2K61 A;  1ZOT B;  2K7C A;  2M1K B;  4CPV A;  1TTX A;  1J7Q A;  1CM1 A;  4L9M A;  5G08 A;  1ZMZ A;  1XYD A;  4MEW A;  1PVB A;  1MF8 B;  2JQ6 A;  2TN4 A;  4GBA A;  1ZFS A;  1RJV A;  2Y1N A;  2Y1M A;  1QXP A;  4XJK A;  2H2K A;  2O5G A;  3SG6 A;  1SR6 B;  1J7R A;  1DTL A;  2LUC A;  2LLU A;  2QAC A;  4ZCV A;  5IBW A;  1S6I A;  2OTG C;  3AAK A;  4BY5 A;  2L50 A;  1B7T Y;  2H61 C;  1YTZ C;  4QJ3 B;  1JC2 A;  1LA3 A;  1J1E A;  1XK4 C;  3NSK A;  1BOD A;  2CT9 A;  4GGF A;  1FW4 A;  1PK0 D;  2GGM A;  1WY9 A;  3WXA A;  1GJY A;  2K7B A;  2BEC A;  4DS7 A;  1CLB A;  4Q04 A;  1YVL A;  2KAY A;  1XVJ A;  2L98 A;  2HQW A;  3BOW B;  4ETO A;  5CSN A;  1K2H A;  1QIW A;  4CFQ A;  2LVJ A;  1GGZ A;  1KK8 B;  1NCZ A;  3WNX B;  1MQ1 A;  3JTD B;  3M0W A;  5HKW A;  1CFC A;  1XO5 A;  1CFP A;  2Q91 A;  1OZS A;  4F0Z B;  3SIB A;  1EXR A;  2D8N A;  1TRF A;  1TCO B;  4D1E A;  1J1D A;  2M0R A;  4NQG A;  1F54 A;  2MA2 A;  3CR5 X;  1SW8 A;  4DIR A;  1XFY O;  1KFX S;  4OV2 A;  1KSM A;  3OX6 A;  4GFT A;  1UHJ A;  2ZRS A;  4MSP A;  2ISD A;  1C07 A;  1IJ6 A;  4I5K A;  1XK4 A;  1QX7 A;  5FYX A;  2HET A;  2M7N A;  2WCB A;  3FWC A;  4M2Q A;  5HYD A;  1DJH A;  4MRY A;  1IQ3 A;  2BBN A;  5AFP A;  5KTY A;  2KBI A;  1KFU S;  4E68 A;  5CSI A;  1H8B A;  1A75 A;  1BT6 A;  2MBX A;  2NXQ A;  1MUX A;  1CFD A;  2KFH A;  1DF0 A;  1IGV A;  3JVT B;  4YI9 A;  1B8C A;  2AMI A;  4HRG A;  5HKY A;  3PM8 A;  4NDB A;  2WCE A;  2OS8 C;  3I5F C;  1BU3 A;  4IL1 A;  1K9K A;  4PHM A;  1AK8 A;  1SL9 A;  2LVV A;  3EKJ A;  2KQ6 A;  4JPZ B;  4YI8 A;  2DOQ A;  1S5G Z;  4OR9 B;  1PAL A;  2LUX A;  2JRF A;  2EGD A;  1E8A A;  2ZND A;  4DCK A;  2F3Y A;  3TUY B;  4HSZ A;  1DJG A;  1NX3 A;  2Y4Q A;  3OX5 A;  2LLT A;  1XFX O;  1KQM C;  3CWG A;  2F33 A;  1OOJ A;  2LNK A;  1DJZ A;  1WRK A;  4XYN A;  1BOC A;  2AAO A;  1NCX A;  1KCY A;  4AQJ A;  1DJX A;  1U5I A;  1YX8 A;  2KOT A;  2LV7 A;  1CFF A;  2EHB A;  1S1E A;  1BJF A;  1K9P A;  1YUU A;  1S3P A;  1ZUZ A;  2LHI A;  3CTN A;  4MN0 A;  2BE4 A;  1DMO A;  2HQ8 A;  1TNQ A;  3FIA A;  1XFZ O;  4YBH B;  4MLW A;  4MRX A;  3D0Y A;  4ORA B;  4MZJ A;  1S6J A;  2G9B A;  2MHH A;  1NSH A;  4MBE A;  4DUQ A;  3IQO A;  1SK6 D;  2LMT A;  3WHU B;  1QS7 A;  3I5H B;  1REC A;  2LLS A;  2ZN9 A;  1V1F A;  3BQ3 A;  1HQV A;  2LAP A;  4OKH A;  1F4Q A;  5CPV A;  4HRE E;  1KWO C;  1CLL A;  4YGC B;  1HT9 A;  1S5G Y;  2Y5I A;  1JUO A;  3VRR A;  2KFF A;  2VRG A;  3I5G B;  3ZWH A;  1W7J B;  2KI4 B;  1CDL A;  1YUT A;  4WRI A;  1B47 A;  3BUO B;  1ZAC A;  2GV5 A;  5CSJ A;  2M29 A;  1GGW A;  1TNP A;  2K2A A;  1NCY A;  3A8R A;  2ZFD A;  1DT7 B;  2LAN A;  5ER4 X;  3DVK A;  2WCF A;  2K8M B;  2LMU A;  3TDZ A;  2EC6 B;  1Y1U A;  2FCE A;  2M9G A;  2BCX A;  4OVN F;  4MVF A;  5AAN A;  3EK7 A;  1QAT A;  3HCM A;  2A4J A;  1UHK A;  3I5I B;  1DVI A;  2P6B B;  3CR4 X;  2LE9 B;  4FQO A;  4C0K A;  4P5O E;  4AOM A;  2SCP A;  1B8R A;  1SL8 A;  1MR8 A;  2LMV A;  3VRO A;  2KDH A;  1QX2 A;  1UUS A;  2I2R E;  4TNC A;  1WLZ A;  3PN7 C;  4WQ3 A;  1SR6 C;  2KNE A;  2LVK A;  3O78 A;  3BYA A;  1KSO A;  1NX2 A;  1FF1 A;  1WDC B;  3KEV A;  1C7V A;  4I5N B;  4DRW A;  1K9U A;  1SPY A;  1TIZ A;  2F8P A;  1XA5 A;  1F4O A;  2PMY A;  3VRN A;  4JQ0 D;  2JT0 A;  2CTN A;  3TZ1 A;  1J7P A;  1DF0 B;  3CR2 A;  4PE4 A;  1NX0 A;  1B9A A;  1MWN A;  3KHE A;  1QVI Z;  3MSE B;  2JZI A;  1A29 A;  1AUI B;  1EH2 A;  2G2B A;  2KI6 C;  2FJU B;  2NLN A;  3BUX B;  2LCP A;  1NIW A;  1YR5 A;  1K96 A;  1JFJ A;  2KYF A;  1K93 D;  2H61 A;  3JTD C;  1K8U A;  4M2P A;  1FPW A;  2CXJ A;  1RWY A;  4A4B A;  5KU1 A;  1TNX A;  3FS7 A;  1NP8 A;  1QV0 A;  1IWQ A;  1CTR A;  3PSR A;  2M49 B;  1PUL A;  1YUR A;  4USL A;  2K7D A;  1Y1X A;  3LCP C;  2KSP A;  1OMV A;  1PVA A;  1X02 A;  4CID A;  1Y0V H;  4NDD A;  1A03 A;  1OMR A;  1U5I B;  1F71 A;  2B1U A;  3SJS A;  3LK0 A;  2RGI A;  4GPL B;  4N1G A;  4PHK A;  4PE7 A;  3FWB A;  3AKB A;  1AP4 A;  2K0J A;  3PLF B;  1M63 B;  5J3X A;  5I2L A;  3TS5 B;  1YVH A;  2MRD A;  2BBM A;  1F55 A;  1RFJ A;  4ICB A;  3BOW A;  3SG5 A;  1H4B A;  1YUS A;  4PDZ A;  2Q4U A;  5AEQ A;  1K95 A;  1XFU O;  2M1U A;  2WOR A;  5AER A;  1JSA A;  3IQQ A;  5BPJ A;  1QVI Y;  3JVT C;  2M7L A;  2JTT A;  2JWW A;  4HRH A;  5CSF A;  3VRP A;  3DVE A;  1N0Y A;  1BG1 A;  3DF0 B;  4AQI A;  1CM4 A;  1SCM B;  2PAS A;  2BL0 B;  2JT8 A;  1CLM A;  3GK4 X;  1W7I B;  1EG3 A;  1LXF C;  1TNW A;  3OHM B;  4GGN A;  4A4C A;  3TUY C;  1B1G A;  1UP5 A;  4PHJ A;  4ZCU A;  5TNC A;  1IRJ A;  3BXK A;  4QJ4 B;  5I8N A;  4YGD B;  1C7W A;  1L2O B;  1DGU A;  4ORB B;  2BCA A;  2BKH B;  1SL7 A;  1S36 A;  2WND A;  4GUK A;  1AJ4 A;  2MJW B;  4XJK B;  1J55 A;  2LVI A;  1WRL A;  3SG2 A;  4N5X A;  1FI5 A;  2KI6 D;  3SIA A; 
#chains in the Genus database with same CATH topology
 5GQQ C;  3BUM B;  1IKU A;  1M31 A;  3DZT A;  3LK1 A;  1K90 D;  2KAV A;  2LP3 A;  1B4C A;  1EJ3 A;  3TDI A;  3O2P A;  1PSR A;  3PJI A;  3EK8 A;  1NWD A;  4QJ5 B;  2L5X B;  1KQV A;  3CZT X;  2CNP A;  4I5J A;  1ALV A;  3EVR A;  1M46 A;  2BKI B;  2O60 A;  4ORC B;  2L2E A;  2KAX A;  3NSL A;  4PHN A;  3KPX A;  2KPH A;  1EL4 A;  5HLV A;  3SG3 A;  1QLS A;  3E3R A;  3I5H C;  2KGR A;  1UHN A;  3B86 A;  3OP0 A;  2JPT A;  1N65 A;  1WRZ A;  1DJY A;  3VRQ A;  3BUW B;  4GGF C;  1PRW A;  2JXL A;  1RK9 A;  2JOJ A;  3CZ0 A;  4CLN A;  1SKT A;  1F8H A;  3AAJ A;  1KK7 Z;  1TCF A;  2LP2 A;  3CYZ A;  3VB1 A;  1OZO A;  2NCO A;  3EVU A;  3I5G C;  3PM2 A;  2KFG A;  2L51 A;  2KI4 C;  2KYC A;  3B88 A;  5I94 A;  5KSZ A;  1A2X A;  3QME A;  1OOF A;  1LVC D;  1SNL A;  1J7O A;  2SAS A;  2OTG B;  2LC5 A;  3R72 A;  1TUZ A;  2JTZ A;  2EC6 C;  1WLM A;  2V53 A;  3GK2 A;  3HX4 A;  3LLE A;  2L4H A;  3PAL A;  1UUR A;  1MXE A;  5DKR A;  3UO9 A;  5JJG A;  3KF9 A;  1OE9 B;  1XFV O;  1CB1 A;  3GOF A;  3I5I C;  2JC2 A;  1CNP A;  2JXC A;  1NX1 A;  5I2O A;  3O6B A;  3SS3 A;  3PN7 B;  3RLZ A;  1A75 B;  1NUB A;  2F2O A;  1LKJ A;  3K21 A;  2F2P A;  3LL8 B;  1VRK A;  1CMF A;  1V1G A;  2H8V A;  2M8U A;  2NZ0 A;  4C0L A;  3IF7 A;  1ALW A;  1S6C A;  3C1V A;  2HPS A;  3DD4 A;  2KBM A;  1BF5 A;  2WC6 A;  1LA0 A;  1R2U A;  1QIV A;  4FTG A;  2F3Z A;  4MZK A;  3WHT B;  1WDC C;  1NYA A;  1NPQ A;  1KK8 C;  1AJ5 A;  2BE6 A;  4IJ7 A;  1BR1 B;  1SRA A;  1SBJ A;  1Y1A A;  1A4P A;  5DKN A;  1KK7 Y;  4GAO A;  2HF5 A;  2JNF A;  4U8D A;  5ER5 A;  1MXL C;  1YRU B;  1RRO A;  3EKH A;  1JF0 A;  1YRT B;  4YGE B;  4MZL A;  1DJI A;  3NHI A;  4PE1 A;  2KGB C;  1M45 A;  1CMG A;  3UNW A;  3D77 A;  2E6W A;  2JUL A;  1XFR A;  2KHN A;  1QLK A;  2L0P A;  1CDM A;  2WOS A;  5B8I B;  5F6T A;  2L4I A;  1MHO A;  2MLF C;  4YGB B;  3OB1 B;  5HLO A;  3TDU A;  2JPO A;  3DVM A;  3L4L A;  4UPG A;  2JT3 A;  2KQY A;  1AHR A;  1JF2 A;  2PRU A;  1OW4 A;  2OPO A;  2WCH A;  3O4Y A;  4C0J A;  1L7Z A;  1R6P A;  3F45 A;  1EG4 A;  2LHL A;  1QV1 A;  1M39 A;  1FI6 A;  3S0D A;  2QPT A;  1RTP 1;  3D0Y B;  1G8I A;  2OS8 B;  1XFW O;  3I5F B;  3SG4 A;  3PAT A;  3ZNI A;  4P2Y B;  2MLE C;  2CCM A;  2I94 A;  4JWQ A;  2GGZ A;  3EK4 A;  3SG7 A;  3FE6 A;  1TN4 A;  2GTE A;  3TS5 C;  2L2C A;  4YGA A;  1KFX L;  1SSE B;  4CFR A;  4N1F A;  3VGO A;  4OZD A;  2WC5 A;  2ZN8 A;  1TOP A;  1N2D A;  3EG5 B;  1KQM B;  3NXA A;  1CDP A;  2E30 A;  1Y6W A;  3V2L A;  1QTX A;  1BMO A;  1UHH A;  5PAL A;  1AVS A;  2WC8 A;  1QAS A;  1K94 A;  4GNK B;  1ODB A;  4PAL A;  2ZNE A;  5HKZ A;  3NSI A;  1UHI A;  1LIN A;  4PE0 A;  1DC1 A;  1BLQ A;  1KFU L;  2I18 A;  1SMG A;  1JBA A;  3EVV A;  1SYM A;  1JWD A;  2I7A A;  3OBV A;  5FI7 A;  1OSA A;  3R1P A;  1SCM C;  3DYE A;  4M2O A;  1IG5 A;  2K2F A;  1PSB A;  2JNX A;  1B8L A;  2BL0 C;  2COL B;  2WCK A;  3K1E A;  1C3Y A;  2PSR A;  1JFK A;  4PCW A;  5JOL A;  2K7O A;  2LM5 A;  1CKK A;  1QJT A;  2FCD A;  5D7F A;  4BY4 A;  4R1E A;  1G33 A;  2ZKM X;  1P28 A;  2NCP A;  2JU0 A;  3QRX A;  4NDC A;  1L2O C;  3TUY C;  1IH0 A;  3CZ2 A;  3AKA A;  5DKQ A;  1GM0 A;  1DGV A;  1B7T Z;  3IVT A;  2AUC A;  2CBL A;  3OB2 B;  2M3W A;  4YRU A;  1KWO B;  1UWO A;  2PVB A;  1F70 A;  1Q80 A;  3ICB A;  1GQM A;  4KYN A;  5D69 A;  3PFV A;  2M97 A;  1SY9 A;  3RM1 A;  1FBV A;  3KO0 A;  5D3O A;  3H4S E;  5AXI A;  3D10 A;  1CDN A;  1DJW A;  3CGA A;  1IQ5 A;  1S26 D;  3CLN A;  3GK1 A;  3NSO A;  2R2I A;  4I5L B;  2IS9 A;  3NHT A;  1YX7 A;  3BUN B;  3S0G A;  4WQ2 A;  4INW A;  3DF0 A;  1QX5 B;  1OQP A;  5K89 A;  1OMD A;  1IJ5 A;  2ZRT A;  5I2Q A;  1IIO A;  1BR4 B;  1SCV A;  3A4U B;  2PAL A;  3CS1 A;  3DVJ A;  4OCI A;  2MAZ A;  2FOT A;  2BCB A;  1G4Y R;  1D1O A;  2K61 A;  1ZOT B;  2K7C A;  2M1K B;  4CPV A;  1TTX A;  2BNX A;  1J7Q A;  1CM1 A;  4L9M A;  5G08 A;  1ZMZ A;  1XYD A;  3D75 A;  4MEW A;  3B87 A;  1PVB A;  1MF8 B;  2JQ6 A;  2PQL A;  2TN4 A;  4GBA A;  3S0F A;  1ZFS A;  1RJV A;  2Y1N A;  3BJH A;  2Y1M A;  1QXP A;  4XJK A;  1Z2C B;  2H2K A;  2O5G A;  3SG6 A;  1SR6 B;  1J7R A;  1DTL A;  2LUC A;  2LLU A;  2QAC A;  4ZCV A;  5IBW A;  1S6I A;  2OTG C;  3AAK A;  3FE8 A;  4BY5 A;  2L50 A;  1B7T Y;  2H61 C;  1YTZ C;  4QJ3 B;  1JC2 A;  1LA3 A;  1J1E A;  1XK4 C;  3NSK A;  1BOD A;  2CT9 A;  4GGF A;  1FW4 A;  1PK0 D;  2GGM A;  1WY9 A;  3L4A A;  3WXA A;  1GJY A;  2K7B A;  2BEC A;  4DS7 A;  1CLB A;  4Q04 A;  1YVL A;  2KAY A;  1XVJ A;  2L98 A;  2HQW A;  3BOW B;  4ETO A;  5CSN A;  1K2H A;  1QIW A;  4CFQ A;  2LVJ A;  1OOG A;  2QEV A;  3S0A A;  1GGZ A;  1KK8 B;  4JKT A;  1NCZ A;  3WNX B;  1MQ1 A;  3JTD B;  3M0W A;  5HKW A;  1CFC A;  1XO5 A;  1CFP A;  2Q91 A;  1OZS A;  4F0Z B;  3SIB A;  1EXR A;  2D8N A;  1TRF A;  2PYQ A;  1TCO B;  4D1E A;  1J1D A;  2M0R A;  4NQG A;  1F54 A;  2MA2 A;  3CR5 X;  3D78 A;  1SW8 A;  4DIR A;  1XFY O;  1KFX S;  4OV2 A;  1KSM A;  3OX6 A;  4GFT A;  1LS8 A;  1UHJ A;  2ZRS A;  4MSP A;  2ISD A;  1C07 A;  1IJ6 A;  4I5K A;  3S0B A;  1XK4 A;  1QX7 A;  5FYX A;  2HET A;  2M7N A;  2WCB A;  3FWC A;  4M2Q A;  5HYD A;  1DJH A;  4MRY A;  2QEO A;  1IQ3 A;  2BBN A;  5AFP A;  5KTY A;  2KBI A;  1KFU S;  4E68 A;  5CSI A;  1H8B A;  1A75 A;  1BT6 A;  2MBX A;  2NXQ A;  1MUX A;  1CFD A;  4FQT A;  2KFH A;  1DF0 A;  1IGV A;  3JVT B;  4YI9 A;  1B8C A;  2AMI A;  4HRG A;  5HKY A;  3D76 A;  3PM8 A;  3BFH A;  4NDB A;  2WCE A;  2OS8 C;  3SS4 A;  3BFA A;  3I5F C;  1BU3 A;  4IL1 A;  1K9K A;  4PHM A;  1AK8 A;  4INX A;  1SL9 A;  2LVV A;  3EKJ A;  2KQ6 A;  4JPZ B;  4YI8 A;  2DOQ A;  1S5G Z;  4OR9 B;  1PAL A;  2LUX A;  2JRF A;  2EGD A;  1E8A A;  2ZND A;  4DCK A;  2F3Y A;  3CDN A;  3TUY B;  4HSZ A;  1DJG A;  1NX3 A;  2Y4Q A;  3OX5 A;  2LLT A;  1XFX O;  1KQM C;  3CWG A;  3O4X A;  3SS5 A;  5FI2 A;  2F33 A;  1OOJ A;  2LNK A;  3DY9 A;  1DJZ A;  3D74 A;  1WRK A;  4XYN A;  1BOC A;  2AAO A;  1NCX A;  1KCY A;  4AQJ A;  1DJX A;  1U5I A;  1YX8 A;  2KOT A;  2LV7 A;  1CFF A;  2EHB A;  1S1E A;  1BJF A;  1QWV A;  1K9P A;  1YUU A;  1S3P A;  1TUJ A;  1ZUZ A;  2LHI A;  3CTN A;  4MN0 A;  2BE4 A;  3B7A A;  2BAP A;  1DMO A;  2HQ8 A;  1TNQ A;  3FIA A;  1XFZ O;  4YBH B;  4MLW A;  3L47 A;  4MRX A;  3D0Y A;  3DXL A;  4ORA B;  4MZJ A;  1S6J A;  2G9B A;  2MHH A;  1NSH A;  4MBE A;  4DUQ A;  2KLD A;  3IQO A;  1SK6 D;  2LMT A;  3WHU B;  1QS7 A;  3D73 A;  3I5H B;  1OOI X;  1REC A;  2LLS A;  2ZN9 A;  1V1F A;  3BQ3 A;  1HQV A;  2LAP A;  4OKH A;  1F4Q A;  5CPV A;  4HRE E;  1KWO C;  2L5Y A;  1CLL A;  4YGC B;  1HT9 A;  1S5G Y;  2Y5I A;  1JUO A;  4JD9 A;  3VRR A;  1DEL A;  2KFF A;  2VRG A;  3I5G B;  3ZWH A;  1W7J B;  2KI4 B;  1CDL A;  1YUT A;  4WRI A;  1B47 A;  3BUO B;  1ZAC A;  2GV5 A;  3N7H A;  5CSJ A;  2M29 A;  1GGW A;  1TNP A;  2K2A A;  1NCY A;  3A8R A;  2ZFD A;  1DT7 B;  2LAN A;  5ER4 X;  3DVK A;  2WCF A;  2FJY A;  2K8M B;  2LMU A;  3TDZ A;  2EC6 B;  1Y1U A;  2FCE A;  2M9G A;  2BCX A;  4F7F A;  4OVN F;  4MVF A;  5DIC A;  5AAN A;  3EK7 A;  1QAT A;  3HCM A;  2A4J A;  1UHK A;  3I5I B;  1Z4H A;  1DEK A;  1DVI A;  1T14 A;  2P6B B;  3CR4 X;  2LE9 B;  4FQO A;  4C0K A;  1TWO A;  4P5O E;  4AOM A;  2SCP A;  1B8R A;  1SL8 A;  1MR8 A;  2LMV A;  3B6X A;  2KDH A;  1QX2 A;  2QDI A;  3VRO A;  1UUS A;  2I2R E;  3FE9 A;  4TNC A;  1WLZ A;  4PT1 A;  3PN7 C;  4WQ3 A;  1SR6 C;  2KNE A;  3S0E A;  2LVK A;  3O78 A;  3BYA A;  1KSO A;  1NX2 A;  1FF1 A;  1WDC B;  3KEV A;  1C7V A;  4I5N B;  4DRW A;  1K9U A;  1SPY A;  1TIZ A;  2F8P A;  1XA5 A;  1F4O A;  2PMY A;  3VRN A;  4JQ0 D;  2JT0 A;  2CTN A;  3TZ1 A;  2KLE A;  1DF0 B;  3CR2 A;  1J7P A;  4PE4 A;  1NX0 A;  1B9A A;  1MWN A;  3KHE A;  3CAB A;  1QVI Z;  2YGU A;  3MSE B;  2JZI A;  1A29 A;  1AUI B;  2WCM A;  1EH2 A;  2G2B A;  2KI6 C;  2FJU B;  2NLN A;  3BUX B;  2LCP A;  1NIW A;  1YR5 A;  1K96 A;  1JFJ A;  2KYF A;  1K93 D;  2H61 A;  3JTD C;  1K8U A;  4M2P A;  1FPW A;  2CXJ A;  1RWY A;  2K60 A;  4A4B A;  5KU1 A;  1TNX A;  3FS7 A;  3Q8I A;  1NP8 A;  1QV0 A;  1IWQ A;  1CTR A;  3R1O A;  3PSR A;  2M49 B;  1PUL A;  1YUR A;  2WCJ A;  4USL A;  2K7D A;  1Y1X A;  3LCP C;  3OGN A;  2KSP A;  1OMV A;  2P71 A;  1PVA A;  1X02 A;  4CID A;  1Y0V H;  4NDD A;  1A03 A;  1OMR A;  1U5I B;  1F71 A;  2B1U A;  3SJS A;  3LK0 A;  2RGI A;  4GPL B;  4N1G A;  4PHK A;  3R1V A;  4PE7 A;  3FWB A;  3AKB A;  1AP4 A;  2K0J A;  3PLF B;  1DQE A;  1M63 B;  5J3X A;  5I2L A;  3TS5 B;  1YVH A;  2MRD A;  2BBM A;  2QEH A;  1RFJ A;  3BFB A;  1F55 A;  4ICB A;  3BOW A;  3SG5 A;  2P70 A;  1H4B A;  1YUS A;  4PDZ A;  2Q4U A;  5AEQ A;  1K95 A;  1XFU O;  2M1U A;  2WOR A;  5HL1 A;  5AER A;  1JSA A;  3IQQ A;  5BPJ A;  1QVI Y;  2ERB A;  3JVT C;  2JTT A;  2M7L A;  2JWW A;  2QEB A;  4HRH A;  5CSF A;  3VRP A;  3DVE A;  1N0Y A;  1BG1 A;  3DF0 B;  4AQI A;  1ORG A;  3RZS A;  1CM4 A;  1SCM B;  3CZ1 A;  2PAS A;  2BL0 B;  2JT8 A;  1CLM A;  3GK4 X;  1W7I B;  1C3Z A;  2WCL A;  5EL2 A;  1EG3 A;  1LXF C;  1TNW A;  3OHM B;  4GGN A;  3NGV A;  5FI6 A;  4A4C A;  1UP5 A;  4PHJ A;  4ZCU A;  5TNC A;  1IRJ A;  3BXK A;  4QJ4 B;  1B1G A;  5I8N A;  4YGD B;  1C7W A;  1L2O B;  1DGU A;  1W9Z A;  4ORB B;  2BCA A;  2BKH B;  1SL7 A;  1S36 A;  2WND A;  4GUK A;  1AJ4 A;  2MJW B;  4XJK B;  1J55 A;  2LVI A;  1WRL A;  3SG2 A;  1OOH A;  4N5X A;  1FI5 A;  2KI6 D;  3SIA A; 
#chains in the Genus database with same CATH homology
 5GQQ C;  3BUM B;  1IKU A;  1M31 A;  3LK1 A;  1K90 D;  2KAV A;  2LP3 A;  1B4C A;  1EJ3 A;  3TDI A;  3O2P A;  1PSR A;  3EK8 A;  1NWD A;  4QJ5 B;  2L5X B;  1KQV A;  3CZT X;  2CNP A;  4I5J A;  1ALV A;  3EVR A;  1M46 A;  2BKI B;  2O60 A;  4ORC B;  2L2E A;  2KAX A;  3NSL A;  4PHN A;  3KPX A;  1EL4 A;  5HLV A;  3SG3 A;  1QLS A;  3E3R A;  3I5H C;  2KGR A;  1UHN A;  3OP0 A;  2JPT A;  1N65 A;  1WRZ A;  1DJY A;  3VRQ A;  3BUW B;  4GGF C;  1PRW A;  2JXL A;  1RK9 A;  2JOJ A;  4CLN A;  1SKT A;  1F8H A;  3AAJ A;  1KK7 Z;  1TCF A;  2LP2 A;  1OZO A;  2NCO A;  3EVU A;  3I5G C;  2KFG A;  2L51 A;  2KI4 C;  2KYC A;  5KSZ A;  1A2X A;  1LVC D;  1SNL A;  1J7O A;  2SAS A;  2OTG B;  2LC5 A;  2JTZ A;  2EC6 C;  1WLM A;  2V53 A;  3GK2 A;  3HX4 A;  3LLE A;  2L4H A;  3PAL A;  1UUR A;  1MXE A;  5DKR A;  5JJG A;  3KF9 A;  1OE9 B;  1XFV O;  1CB1 A;  3GOF A;  3I5I C;  2JC2 A;  1CNP A;  2JXC A;  1NX1 A;  5I2O A;  3O6B A;  3PN7 B;  3RLZ A;  1A75 B;  1NUB A;  2F2O A;  1LKJ A;  3K21 A;  2F2P A;  3LL8 B;  1VRK A;  1CMF A;  1V1G A;  4C0L A;  2M8U A;  2NZ0 A;  3IF7 A;  1ALW A;  1S6C A;  3C1V A;  2HPS A;  3DD4 A;  2KBM A;  1BF5 A;  1LA0 A;  1R2U A;  1QIV A;  4FTG A;  2F3Z A;  4MZK A;  3WHT B;  1WDC C;  1NYA A;  1NPQ A;  1KK8 C;  1AJ5 A;  2BE6 A;  1BR1 B;  1SRA A;  1SBJ A;  1Y1A A;  1A4P A;  5DKN A;  1KK7 Y;  4GAO A;  2HF5 A;  2JNF A;  4U8D A;  5ER5 A;  1MXL C;  1YRU B;  1RRO A;  3EKH A;  1JF0 A;  1YRT B;  4YGE B;  4MZL A;  1DJI A;  4PE1 A;  2KGB C;  1M45 A;  1CMG A;  2E6W A;  2JUL A;  2L0P A;  2KHN A;  1QLK A;  2WOS A;  1CDM A;  5B8I B;  5F6T A;  2L4I A;  1MHO A;  2MLF C;  4YGB B;  3OB1 B;  5HLO A;  3TDU A;  3DVM A;  4UPG A;  2JT3 A;  2KQY A;  1AHR A;  1JF2 A;  2PRU A;  4C0J A;  2OPO A;  3O4Y A;  1L7Z A;  1R6P A;  3F45 A;  1EG4 A;  2LHL A;  1QV1 A;  1M39 A;  1FI6 A;  2QPT A;  1RTP 1;  3D0Y B;  1G8I A;  2OS8 B;  1XFW O;  3I5F B;  3SG4 A;  3PAT A;  3ZNI A;  4P2Y B;  2MLE C;  2CCM A;  2I94 A;  4JWQ A;  2GGZ A;  3EK4 A;  3SG7 A;  1TN4 A;  3TS5 C;  4YGA A;  1KFX L;  4CFR A;  4N1F A;  3VGO A;  2ZN8 A;  1TOP A;  1N2D A;  3NXA A;  1KQM B;  1CDP A;  2E30 A;  1Y6W A;  1QTX A;  1BMO A;  1UHH A;  5PAL A;  1AVS A;  2WC8 A;  1QAS A;  1K94 A;  4GNK B;  1ODB A;  4PAL A;  2ZNE A;  5HKZ A;  3NSI A;  1UHI A;  1LIN A;  4PE0 A;  1BLQ A;  1KFU L;  2I18 A;  1SMG A;  1JBA A;  3EVV A;  1SYM A;  1JWD A;  2I7A A;  1OSA A;  1SCM C;  4M2O A;  1IG5 A;  2K2F A;  1PSB A;  2JNX A;  1B8L A;  2BL0 C;  2COL B;  2PSR A;  1JFK A;  4PCW A;  5JOL A;  2K7O A;  2LM5 A;  1CKK A;  1QJT A;  2FCD A;  5D7F A;  4BY4 A;  4R1E A;  1G33 A;  2ZKM X;  2NCP A;  2JU0 A;  3QRX A;  4NDC A;  1L2O C;  1IH0 A;  3AKA A;  5DKQ A;  1DGV A;  1B7T Z;  2AUC A;  2CBL A;  3OB2 B;  2M3W A;  4YRU A;  1KWO B;  1UWO A;  2PVB A;  1F70 A;  1Q80 A;  3ICB A;  1GQM A;  5D69 A;  3PFV A;  2M97 A;  1SY9 A;  3RM1 A;  1FBV A;  3KO0 A;  3H4S E;  5AXI A;  3D10 A;  1CDN A;  1DJW A;  3CGA A;  1IQ5 A;  1S26 D;  3CLN A;  3GK1 A;  3NSO A;  2R2I A;  4I5L B;  2IS9 A;  1YX7 A;  3BUN B;  4WQ2 A;  3DF0 A;  1QX5 B;  1OQP A;  5K89 A;  1OMD A;  1IJ5 A;  2ZRT A;  5I2Q A;  1BR4 B;  1SCV A;  3A4U B;  2PAL A;  3CS1 A;  3DVJ A;  4OCI A;  2MAZ A;  2FOT A;  2BCB A;  1G4Y R;  1D1O A;  2K61 A;  1ZOT B;  2K7C A;  2M1K B;  4CPV A;  1TTX A;  1J7Q A;  1CM1 A;  4L9M A;  5G08 A;  1ZMZ A;  1XYD A;  4MEW A;  1PVB A;  1MF8 B;  2JQ6 A;  2TN4 A;  4GBA A;  1ZFS A;  1RJV A;  2Y1N A;  2Y1M A;  1QXP A;  4XJK A;  2H2K A;  2O5G A;  3SG6 A;  1SR6 B;  1J7R A;  1DTL A;  2LUC A;  2LLU A;  2QAC A;  4ZCV A;  5IBW A;  1S6I A;  2OTG C;  3AAK A;  4BY5 A;  2L50 A;  1B7T Y;  2H61 C;  1YTZ C;  4QJ3 B;  1JC2 A;  1LA3 A;  1J1E A;  1XK4 C;  3NSK A;  1BOD A;  2CT9 A;  4GGF A;  1FW4 A;  1PK0 D;  2GGM A;  1WY9 A;  3WXA A;  1GJY A;  2K7B A;  2BEC A;  4DS7 A;  1CLB A;  4Q04 A;  1YVL A;  2KAY A;  1XVJ A;  2L98 A;  2HQW A;  3BOW B;  4ETO A;  5CSN A;  1K2H A;  1QIW A;  4CFQ A;  2LVJ A;  1GGZ A;  1KK8 B;  1NCZ A;  3WNX B;  1MQ1 A;  3JTD B;  3M0W A;  5HKW A;  1CFC A;  1XO5 A;  1CFP A;  2Q91 A;  1OZS A;  4F0Z B;  3SIB A;  1EXR A;  2D8N A;  1TRF A;  1TCO B;  4D1E A;  1J1D A;  2M0R A;  4NQG A;  1F54 A;  2MA2 A;  3CR5 X;  1SW8 A;  4DIR A;  1XFY O;  1KFX S;  4OV2 A;  1KSM A;  3OX6 A;  4GFT A;  1UHJ A;  2ZRS A;  4MSP A;  2ISD A;  1C07 A;  1IJ6 A;  4I5K A;  1XK4 A;  1QX7 A;  5FYX A;  2HET A;  2M7N A;  2WCB A;  3FWC A;  4M2Q A;  5HYD A;  1DJH A;  4MRY A;  1IQ3 A;  2BBN A;  5AFP A;  5KTY A;  2KBI A;  1KFU S;  4E68 A;  5CSI A;  1H8B A;  1A75 A;  1BT6 A;  2MBX A;  2NXQ A;  1MUX A;  1CFD A;  2KFH A;  1DF0 A;  1IGV A;  3JVT B;  4YI9 A;  1B8C A;  2AMI A;  4HRG A;  5HKY A;  3PM8 A;  4NDB A;  2WCE A;  2OS8 C;  3I5F C;  1BU3 A;  4IL1 A;  1K9K A;  4PHM A;  1AK8 A;  1SL9 A;  2LVV A;  3EKJ A;  2KQ6 A;  4JPZ B;  4YI8 A;  2DOQ A;  1S5G Z;  4OR9 B;  1PAL A;  2LUX A;  2JRF A;  2EGD A;  1E8A A;  2ZND A;  4DCK A;  2F3Y A;  3TUY B;  4HSZ A;  1DJG A;  1NX3 A;  2Y4Q A;  3OX5 A;  2LLT A;  1XFX O;  1KQM C;  3CWG A;  2F33 A;  1OOJ A;  2LNK A;  1DJZ A;  1WRK A;  4XYN A;  1BOC A;  2AAO A;  1NCX A;  1KCY A;  4AQJ A;  1DJX A;  1U5I A;  1YX8 A;  2KOT A;  2LV7 A;  1CFF A;  2EHB A;  1S1E A;  1BJF A;  1K9P A;  1YUU A;  1S3P A;  1ZUZ A;  2LHI A;  3CTN A;  4MN0 A;  2BE4 A;  1DMO A;  2HQ8 A;  1TNQ A;  3FIA A;  1XFZ O;  4YBH B;  4MLW A;  4MRX A;  3D0Y A;  4ORA B;  4MZJ A;  1S6J A;  2G9B A;  2MHH A;  1NSH A;  4MBE A;  4DUQ A;  3IQO A;  1SK6 D;  2LMT A;  3WHU B;  1QS7 A;  3I5H B;  1REC A;  2LLS A;  2ZN9 A;  1V1F A;  3BQ3 A;  1HQV A;  2LAP A;  4OKH A;  1F4Q A;  5CPV A;  4HRE E;  1KWO C;  1CLL A;  4YGC B;  1HT9 A;  1S5G Y;  2Y5I A;  1JUO A;  3VRR A;  2KFF A;  2VRG A;  3I5G B;  3ZWH A;  1W7J B;  2KI4 B;  1CDL A;  1YUT A;  4WRI A;  1B47 A;  3BUO B;  1ZAC A;  2GV5 A;  5CSJ A;  2M29 A;  1GGW A;  1TNP A;  2K2A A;  1NCY A;  3A8R A;  2ZFD A;  1DT7 B;  2LAN A;  5ER4 X;  3DVK A;  2WCF A;  2K8M B;  2LMU A;  3TDZ A;  2EC6 B;  1Y1U A;  2FCE A;  2M9G A;  2BCX A;  4OVN F;  4MVF A;  5AAN A;  3EK7 A;  1QAT A;  3HCM A;  2A4J A;  1UHK A;  3I5I B;  1DVI A;  2P6B B;  3CR4 X;  2LE9 B;  4FQO A;  4C0K A;  4P5O E;  4AOM A;  2SCP A;  1B8R A;  1SL8 A;  1MR8 A;  2LMV A;  3VRO A;  2KDH A;  1QX2 A;  1UUS A;  2I2R E;  4TNC A;  1WLZ A;  3PN7 C;  4WQ3 A;  1SR6 C;  2KNE A;  2LVK A;  3O78 A;  3BYA A;  1KSO A;  1NX2 A;  1FF1 A;  1WDC B;  3KEV A;  1C7V A;  4I5N B;  4DRW A;  1K9U A;  1SPY A;  1TIZ A;  2F8P A;  1XA5 A;  1F4O A;  2PMY A;  3VRN A;  4JQ0 D;  2JT0 A;  2CTN A;  3TZ1 A;  1J7P A;  1DF0 B;  3CR2 A;  4PE4 A;  1NX0 A;  1B9A A;  1MWN A;  3KHE A;  1QVI Z;  3MSE B;  2JZI A;  1A29 A;  1AUI B;  1EH2 A;  2G2B A;  2KI6 C;  2FJU B;  2NLN A;  3BUX B;  2LCP A;  1NIW A;  1YR5 A;  1K96 A;  1JFJ A;  2KYF A;  1K93 D;  2H61 A;  3JTD C;  1K8U A;  4M2P A;  1FPW A;  2CXJ A;  1RWY A;  4A4B A;  5KU1 A;  1TNX A;  3FS7 A;  1NP8 A;  1QV0 A;  1IWQ A;  1CTR A;  3PSR A;  2M49 B;  1PUL A;  1YUR A;  4USL A;  2K7D A;  1Y1X A;  3LCP C;  2KSP A;  1OMV A;  1PVA A;  1X02 A;  4CID A;  1Y0V H;  4NDD A;  1A03 A;  1OMR A;  1U5I B;  1F71 A;  2B1U A;  3SJS A;  3LK0 A;  2RGI A;  4GPL B;  4N1G A;  4PHK A;  4PE7 A;  3FWB A;  3AKB A;  1AP4 A;  2K0J A;  3PLF B;  1M63 B;  5J3X A;  5I2L A;  3TS5 B;  1YVH A;  2MRD A;  2BBM A;  1F55 A;  1RFJ A;  4ICB A;  3BOW A;  3SG5 A;  1H4B A;  1YUS A;  4PDZ A;  2Q4U A;  5AEQ A;  1K95 A;  1XFU O;  2M1U A;  2WOR A;  5AER A;  1JSA A;  3IQQ A;  5BPJ A;  1QVI Y;  3JVT C;  2M7L A;  2JTT A;  2JWW A;  4HRH A;  5CSF A;  3VRP A;  3DVE A;  1N0Y A;  1BG1 A;  3DF0 B;  4AQI A;  1CM4 A;  1SCM B;  2PAS A;  2BL0 B;  2JT8 A;  1CLM A;  3GK4 X;  1W7I B;  1EG3 A;  1LXF C;  1TNW A;  3OHM B;  4GGN A;  4A4C A;  3TUY C;  1B1G A;  1UP5 A;  4PHJ A;  4ZCU A;  5TNC A;  1IRJ A;  3BXK A;  4QJ4 B;  5I8N A;  4YGD B;  1C7W A;  1L2O B;  1DGU A;  4ORB B;  2BCA A;  2BKH B;  1SL7 A;  1S36 A;  2WND A;  4GUK A;  1AJ4 A;  2MJW B;  4XJK B;  1J55 A;  2LVI A;  1WRL A;  3SG2 A;  4N5X A;  1FI5 A;  2KI6 D;  3SIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...