1WRLA

Crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of human cardiac troponin C in complex with trifluoperazine
rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 25
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wrlA00
3CTNA 2LMTA 1UHIA 2L2EA 5AXIA 2L50A 1EG3A 2JU0A 1CFDA 1JFJA 3ICBA 4JWQA 1SBJA 2I94A 2K7BA 2F3ZA 4C0JA 3MSEB 4UPGA 2OTGC 3NSKA 1QIVA 2M29A 2COLB 2EGDA 1NX2A 2JXCA 4NDBA 2H61C 1EJ3A 1UHJA 1FF1A 2CBLA 1IGVA 1IRJA 2KBMA 1E8AA 1UHNA 4QJ3B 3OB2B 3FWBA 2K8MB 2BE6A 3KEVA 2LUCA 4C0LA 2CTNA 2LANA 3SIBA 2PVBA 3CR4X 1M46A 1RROA 1BLQA 3I5IC 1QX5B 5GQQC 1TCOB 4R1EA 3TDIA 1NX0A 2M3WA 3ZNIA 1S5GZ 1TTXA 3I5FC 5PALA 2SCPA 2WORA 1SY9A 1AK8A 3PN7B 5J3XA 1M39A 1PVAA 1QLSA 1QTXA 1OMRA 5ER4X 1DJWA 3FWCA 1JFKA 1C7WA 2E30A 1YUUA 4YRUA 2LHIA 4HRGA 3CLNA 3CR5X 3OHMB 2LC5A 3NSLA 2I18A 1SL9A 2DOQA 1XO5A 1YRTB 1WDCB 2M1UA 3EVUA 3C1VA 1CLBA 1JSAA 3PFVA 3TDUA 1L2OC 1XFWO 4MZKA 3I5GB 3OB1B 1MHOA 2KAVA 1NCYA 2JULA 4XYNA 2JRFA 1RJVA 1QX7A 2TN4A 5HLVA 2KI4C 1MXEA 1SRAA 4PHJA 1BR1B 1K94A 1QATA 1UHKA 1IKUA 2M49B 3TUYC 4XJKB 1NYAA 4ZCVA 4CLNA 3NSIA 3EVVA 2LVVA 1UP5A 1W7IB 4Q04A 1AJ4A 2O5GA 4YGBB 4HSZA 1YR5A 2LP3A 3SG5A 3DVMA 5D69A 2OS8B 4YGDB 4F0ZB 2LMUA 4PE1A 1NCXA 3DD4A 4I5LB 4YI8A 2K2FA 4DUQA 1DJZA 2AUCA 4E68A 2I7AA 1L7ZA 1Y1UA 2K0JA 3HX4A 2WCFA 2EC6C 2BL0B 3OX6A 4WRIA 1QV1A 2MBXA 4BY5A 2F2PA 4GUKA 1EG4A 3ZWHA 4GGFA 2LUXA 2F8PA 2KAYA 1K2HA 4ETOA 2EC6B 1QASA 2KQ6A 4TNCA 1B8RA 2LHLA 5HYDA 2WCEA 4I5KA 2GGMA 1SCMC 2JOJA 2JQ6A 3EKHA 3VGOA 1BOCA 2LLUA 2Y4QA 1IWQA 1G8IA 2WC8A 1C07A 1SKTA 2GGZA 3BUOB 1ZFSA 1BJFA 2OPOA 5FYXA 1TNPA 1SPYA 3PSRA 2LVJA 1XFVO 1S1EA 3O6BA 1ALVA 1YUSA 4OKHA 4ORCB 1Y0VH 3TS5C 2BL0C 5K89A 1KFXL 4I5NB 1BG1A 1A2XA 1WDCC 1DVIA 3CGAA 2KI6D 1IJ5A 4ORAB 1LKJA 4DRWA 1KFXS 3VRRA 1XVJA 1DGVA 1YRUB 3BOWA 1XFZO 5CPVA 4YBHB 1FI5A 1S6IA 2L51A 1Y6WA 1SCVA 1ZACA 5HKZA 3F45A 1DTLA 1S5GY 1L2OB 3BUMB 3WHTB 2JPTA 2GV5A 3SIAA 4OV2A 1S6JA 1QJTA 2ZNEA 5I2LA 2G9BA 1TIZA 5AEQA 1B4CA 2HPSA 1MXLC 5ER5A 1R2UA 1QVIZ 2KYCA 2O60A 4HRHA 1NCZA 2F33A 1DF0B 3BUXB 2ISDA 1SNLA 1XK4A 2HETA 1CB1A 1KCYA 2HQWA 4M2QA 1SL7A 1J55A 1F55A 2A4JA 2LNKA 1QXPA 3RLZA 4GAOA 2L5XB 3IQOA 2H2KA 3VRNA 4PHNA 3I5FB 1WY9A 1KWOC 4MRYA 1CDMA 2Q91A 5HKYA 1UURA 2BE4A 3SG2A 2BCBA 1BF5A 2Y1NA 4CFRA 1AVSA 2OTGB 3GK2A 1DT7B 1KQMC 1N2DA 3DF0B 1U5IA 1AJ5A 3NSOA 1X02A 3OX5A 3D10A 1UHHA 1S36A 4GPLB 4MZLA 3NXAA 1XA5A 2G2BA 3EKJA 4AOMA 1XFUO 2KBIA 4D1EA 1A75A 1KFUL 1GGZA 2NCPA 4ORBB 1EH2A 4YGAA 2IS9A 2SASA 1HT9A 1BR4B 4FTGA 3SG6A 1NX3A 1OSAA 1AP4A 2BCAA 2KGBC 3I5IB 4PHMA 1RFJA 2JNXA 5CSIA 5G08A 1Y1AA 1MR8A 2HQ8A 2KQYA 4ZCUA 1MUXA 2MAZA 5AFPA 2KNEA 1V1GA 3TS5B 3BYAA 1A75B 1J1DA 1LINA 2F2OA 5DKRA 3O78A 3LLEA 4DCKA 2M7LA 1UUSA 1YURA 1QLKA 1QIWA 1SW8A 4OVNF 1KK7Z 1NUBA 3OP0A 2HF5A 1TCFA 2KFGA 5JJGA 1IJ6A 1YX7A 2PSRA 4MVFA 3JTDB 2L98A 5CSJA 3A8RA 4A4BA 3LK1A 4N5XA 4GNKB 2FCEA 3CWGA 5JOLA 1A03A 1YTZC 1CDPA 4M2PA 1M63B 1K96A 2QPTA 3JVTB 1H4BA 2ZKMX 3VROA 1FI6A 2ZNDA 3EVRA 3HCMA 4YGEB 1S3PA 3PALA 3AKBA 5CSFA 4IL1A 4YI9A 5D7FA 1ZUZA 4PE7A 5I2QA 3WNXB 4WQ2A 1NSHA 1DGUA 4U8DA 1IH0A 4OCIA 1EL4A 1OQPA 1YVLA 2KAXA 3BUNB 1SMGA 4NQGA 3SJSA 2NXQA 3GK1A 3PATA 2V53A 3CS1A 3DVJA 4GFTA 3FIAA 1QVIY 2P6BB 3QRXA 3IQQA 1M45A 1XFXO 1B7TZ 5IBWA 1GGWA 3GOFA 4OR9B 1ZOTB 1K8UA 1R6PA 5I8NA 1CMGA 2CNPA 1K9PA 4CIDA 2Y5IA 1RWYA 1EXRA 2KFHA 3FS7A 3LK0A 4PHKA 1B1GA 1S6CA 3WXAA 1NWDA 2PALA 2H61A 3DVEA 1MF8B 4MRXA 1OZOA 3VRQA 4MLWA 1CTRA 2LMVA 3IF7A 3EK7A 3BQ3A 1SCMB 3JTDC 1ODBA 1NX1A 1IQ3A 1LXFC 1AHRA 5KSZA 3AKAA 2WOSA 4GBAA 4P2YB 2MLEC 2KGRA 3AAJA 1F4OA 2BKHB 4PALA 3A4UB 1G33A 2K7CA 1PSBA 1JUOA 3RM1A 1QX2A 1WLZA 3JVTC 1FW4A 2K7OA 4NDCA 5I2OA 3TDZA 1KK7Y 1WRZA 1UWOA 1K95A 1M31A 2K7DA 4DIRA 2M0RA 3PM8A 4DS7A 4HREE 1F70A 1D1OA 1DJXA 1CFPA 1OMDA 3BXKA 3D0YA 4C0KA 1XFYO 1J7QA 2PMYA 1NP8A 4MEWA 4MZJA 2E6WA 4A4CA 2JNFA 5KTYA 1OOJA 2JT8A 2LCPA 4N1GA 4MBEA 1CDNA 1NIWA 4MSPA 2JT0A 3DF0A 3VRPA 5HLOA 3LL8B 2FOTA 5KU1A 2LP2A 3SG7A 4N1FA 1QS7A 1TN4A 2JC2A 4NDDA 1K9KA 1PSRA 2B1UA 2KSPA 2LV7A 1TOPA 2MRDA 1K93D 2KI4B 1SR6B 2QACA 4GGNA 4YGCB 1JC2A 1A29A 1F4QA 1CNPA 1OZSA 3O4YA 1V1FA 4M2OA 3GK4X 3I5HC 2VRGA 1G4YR 1IG5A 3D0YB 2JT3A 1JWDA 1CFFA 1N65A 4FQOA 4CPVA 2D8NA 2M1KB 3KHEA 1KQVA 4PDZA 1N0YA 1RECA 3H4SE 1KWOB 2WNDA 3BOWB 1TNQA 2NLNA 4CFQA 2LM5A 2M9GA 3WHUB 1B7TY 2LVIA 1J1EA 1BU3A 1RTP1 4ICBA 1GJYA 4PCWA 4MN0A 2WCBA 1CLLA 1Q80A 2KYFA 2ZRTA 1XYDA 2MA2A 3CR2A 2MLFC 2MJWB 3KO0A 2R2IA 3SG3A 1BT6A 4PE4A 4BY4A 1SR6C 1IQ5A 3EK8A 1CDLA 2LAPA 2M97A 1PK0D 2BBNA 1TRFA 3E3RA 4WQ3A 4L9MA 4JQ0D 1JF2A 1ALWA 1YUTA 1BMOA 3CZTX 2AMIA 1C7VA 1A4PA 1DMOA 1LA3A 3M0WA 4JPZB 2Q4UA 3AAKA 4USLA 2JTZA 4QJ4B 2JZIA 1PALA 1OE9B 2L0PA 2KOTA 1PRWA 1CM1A 1FPWA 5AANA 1S26D 3O2PA 5B8IB 1PVBA 1J7OA 4AQIA 2K2AA 1DJIA 2LLSA 1SYMA 1Y1XA 2NCOA 4P5OE 5F6TA 1KSMA 2KDHA 2JTTA 2CT9A 2CCMA 4XJKA 1TNWA 2CXJA 2M7NA 1YVHA 2F3YA 2AAOA 1KQMB 4PE0A 1SL8A 1CMFA 2BKIB 2OS8C 2ZN9A 1QV0A 5BPJA 3BUWB 2PRUA 3TUYB 2PASA 2ZFDA 1K90D 1B9AA 1DF0A 2KFFA 1WLMA 3LCPC 1J7RA 1F8HA 2BCXA 1PULA 4I5JA 5DKQA 2K61A 1KK8C 1J7PA 3K21A 2ZN8A 1CM4A 1DJYA 2RGIA 2LLTA 1CFCA 2BBMA 5CSNA 1B8CA 1XK4C 5TNCA 1OMVA 1W7JB 2JWWA 1ZMZA 1VRKA 2LVKA 2ZRSA 3KPXA 3TZ1A 1KFUS 4QJ5B 1LA0A 2LE9B 1HQVA 1MQ1A 2L4IA 1JBAA 3SG4A 1DJGA 2NZ0A 1CKKA 2BECA 1AUIB 5DKNA 1U5IB 3I5HB 1NPQA 1KSOA 2L4HA 1MWNA 1GQMA 1B47A 1JF0A 4GGFC 1H8BA 3EK4A 1FBVA 2KHNA 2I2RE 3KF9A 3DVKA 1TNXA 1WRKA 3PLFB 3PN7C 2KI6C 1K9UA 2MHHA 1KK8B 5HKWA 1B8LA 4AQJA 1YX8A 1F71A 1LVCD 1RK9A 3I5GC 2FCDA 2EHBA 1SK6D 2JXLA 1BODA 1WRLA 2Y1MA 1F54A 5AERA 2FJUB 2M8UA 1CLMA 1DJHA
chains in the Genus database with same CATH superfamily
3CTNA 2LMTA 3N7HA 1UHIA 2L2EA 5AXIA 2L50A 1EG3A 3S0FA 2WCLA 2JU0A 3S0EA 1CFDA 1JFJA 3ICBA 4JWQA 1SBJA 2I94A 2K7BA 3BFHA 2F3ZA 4C0JA 3MSEB 4UPGA 2OTGC 3NSKA 1QIVA 2M29A 2COLB 2EGDA 1NX2A 2JXCA 3CDNA 4NDBA 2H61C 1EJ3A 1UHJA 5FI6A 1FF1A 2CBLA 1IGVA 1IRJA 2KBMA 1E8AA 1UHNA 4QJ3B 3OB2B 3FWBA 2K8MB 2BE6A 3KEVA 5D3OA 2LUCA 1Z2CB 3FE9A 4C0LA 2CTNA 2LANA 3SIBA 2PVBA 3CR4X 1M46A 1RROA 1BLQA 3I5IC 1QX5B 5GQQC 1DEKA 1TCOB 4R1EA 3TDIA 4OZDA 1NX0A 2M3WA 3CABA 3ZNIA 1S5GZ 3UO9A 1TTXA 3I5FC 1OOIX 5PALA 2SCPA 2WORA 1SY9A 1AK8A 3PN7B 5J3XA 1M39A 1PVAA 1QLSA 1QTXA 1OMRA 5ER4X 1DJWA 1TWOA 3FWCA 3L4AA 1JFKA 1C7WA 2E30A 1YUUA 4YRUA 2LHIA 4HRGA 3CLNA 3CR5X 3OHMB 2LC5A 3NSLA 2I18A 1SL9A 2DOQA 4F7FA 1XO5A 1YRTB 1WDCB 2M1UA 3EVUA 3C1VA 1CLBA 1JSAA 3PFVA 3TDUA 1L2OC 2QEBA 1XFWO 4MZKA 3I5GB 3OB1B 1MHOA 3S0GA 1C3ZA 2GTEA 1NCYA 2JULA 2KAVA 2JRFA 1RJVA 1QX7A 2P71A 2TN4A 4XYNA 5HLVA 3NGVA 2KI4C 1MXEA 3S0DA 1C3YA 1SRAA 4PHJA 1BR1B 1K94A 1QATA 1UHKA 1IKUA 1LS8A 2M49B 2YGUA 3TUYC 4XJKB 1NYAA 4ZCVA 4CLNA 3NSIA 3EVVA 2LVVA 1OW4A 1UP5A 1W7IB 4Q04A 1AJ4A 2O5GA 3L4LA 3B88A 3DZTA 4YGBB 4INXA 4HSZA 1YR5A 2LP3A 3SG5A 3DVMA 5D69A 3QMEA 2OS8B 3B7AA 3R1OA 4YGDB 4F0ZB 2LMUA 4PE1A 1NCXA 3DD4A 4I5LB 4YI8A 2K2FA 4DUQA 1DJZA 2AUCA 4E68A 2I7AA 2BAPA 1L7ZA 1Y1UA 2K0JA 3CYZA 3HX4A 2WCFA 2JPOA 2EC6C 2BL0B 3OX6A 4WRIA 1QV1A 2MBXA 4BY5A 3PJIA 5HL1A 3FE6A 2F2PA 4GUKA 1EG4A 3ZWHA 4GGFA 2LUXA 2F8PA 2KAYA 1K2HA 1OOGA 2QDIA 4ETOA 2EC6B 1QASA 2KQ6A 4TNCA 1B8RA 2LHLA 5HYDA 2WCEA 4I5KA 2GGMA 1SCMC 1DQEA 2JOJA 2JQ6A 3EKHA 3VGOA 1BOCA 2LLUA 2Y4QA 2WCKA 1IWQA 1ORGA 1G8IA 2WC8A 1C07A 1SKTA 2GGZA 3BUOB 1ZFSA 1BJFA 2OPOA 5FYXA 3B86A 1TNPA 1SPYA 3PSRA 2LVJA 5FI2A 1XFVO 1S1EA 4FQTA 3O6BA 1ALVA 1YUSA 4OKHA 4ORCB 1Y0VH 3TS5C 2BL0C 5K89A 1KFXL 2KPHA 4I5NB 1BG1A 1A2XA 1WDCC 1DVIA 3CGAA 3V2LA 2KI6D 1IJ5A 4ORAB 1LKJA 4DRWA 1KFXS 2KLDA 3VRRA 1XVJA 1DGVA 1YRUB 3BOWA 1XFZO 5CPVA 3IVTA 4YBHB 1FI5A 1S6IA 2L51A 1Y6WA 1SCVA 1ZACA 5HKZA 3F45A 1DTLA 1S5GY 1L2OB 3BUMB 3WHTB 2JPTA 2GV5A 3SIAA 4OV2A 1S6JA 1QJTA 2ZNEA 5I2LA 2G9BA 1TIZA 5AEQA 1B4CA 2HPSA 1MXLC 5ER5A 1R2UA 1QVIZ 2KYCA 2O60A 4HRHA 1NCZA 2F33A 1DF0B 3BUXB 2ISDA 1SNLA 1XK4A 2HETA 1CB1A 1KCYA 2HQWA 4M2QA 1SL7A 1J55A 1F55A 2A4JA 2LNKA 1QXPA 3RLZA 4GAOA 2L5XB 3IQOA 2H2KA 3VRNA 4PHNA 3I5FB 1WY9A 1KWOC 4MRYA 1CDMA 2Q91A 5HKYA 1UURA 2BE4A 3SG2A 2BCBA 1BF5A 1IIOA 2Y1NA 4CFRA 1AVSA 2P70A 2OTGB 3GK2A 1DT7B 1KQMC 1N2DA 2L5YA 3DF0B 1U5IA 1AJ5A 3EG5B 3NSOA 1X02A 3OX5A 3NHIA 3D10A 1UHHA 1S36A 4GPLB 4MZLA 3NXAA 1XA5A 2G2BA 3EKJA 4AOMA 1XFUO 2KBIA 4D1EA 1A75A 1KFUL 3CZ2A 1GGZA 2NCPA 2KLEA 3R72A 4ORBB 1XFRA 1EH2A 3D75A 4YGAA 3BFAA 2IS9A 2SASA 1HT9A 1BR4B 4FTGA 3SG6A 1NX3A 3VB1A 3B87A 1OSAA 1AP4A 2BCAA 1P28A 2KGBC 3I5IB 4PHMA 1RFJA 2JNXA 5CSIA 5G08A 1Y1AA 1MR8A 2HQ8A 2KQYA 3DXLA 1MUXA 2MAZA 4ZCUA 2KNEA 5AFPA 1V1GA 2K60A 4PT1A 3TS5B 3BYAA 1A75B 1J1DA 1LINA 2F2OA 5DKRA 3O78A 3LLEA 4DCKA 2M7LA 1UUSA 1YURA 1QLKA 1QIWA 1SW8A 4OVNF 1GM0A 1KK7Z 1NUBA 3OP0A 4JKTA 2HF5A 1TCFA 2KFGA 5JJGA 2WC5A 3D73A 1IJ6A 1YX7A 2PSRA 4MVFA 3JTDB 2L98A 5CSJA 3A8RA 4A4BA 3DYEA 3LK1A 4N5XA 4GNKB 2FCEA 3CWGA 5JOLA 1A03A 1YTZC 3D76A 1CDPA 4M2PA 3FE8A 3CZ1A 1M63B 1K96A 3PM2A 2QPTA 3JVTB 1H4BA 2ZKMX 3VROA 1FI6A 2ZNDA 3EVRA 3HCMA 4YGEB 1S3PA 3PALA 3AKBA 5CSFA 4IL1A 1OOHA 4YI9A 5D7FA 1OOFA 1ZUZA 4PE7A 5I2QA 1TUZA 3WNXB 4WQ2A 1NSHA 1DGUA 4U8DA 1IH0A 4OCIA 1EL4A 1OQPA 1YVLA 2KAXA 3BUNB 1SMGA 4NQGA 3SJSA 2NXQA 3GK1A 3PATA 2V53A 3CS1A 3DVJA 4GFTA 3FIAA 1QVIY 2P6BB 3NHTA 3QRXA 1QWVA 3IQQA 1M45A 1XFXO 1B7TZ 5IBWA 1GGWA 3GOFA 4OR9B 1ZOTB 3D74A 1K8UA 1R6PA 5I8NA 1CMGA 2CNPA 1K9PA 4CIDA 3B6XA 2Y5IA 1RWYA 1EXRA 2KFHA 3FS7A 3LK0A 4PHKA 1B1GA 1S6CA 3WXAA 1NWDA 2PALA 2WCMA 2H61A 3DVEA 1MF8B 4MRXA 1OZOA 3VRQA 4MLWA 1CTRA 2LMVA 3IF7A 3EK7A 3BQ3A 1SCMB 3JTDC 1ODBA 1NX1A 3CZ0A 1IQ3A 1LXFC 1AHRA 5KSZA 3L47A 3AKAA 2WOSA 4GBAA 4P2YB 2MLEC 2KGRA 3AAJA 1F4OA 2BKHB 4PALA 3A4UB 2QEHA 1G33A 2K7CA 1PSBA 1JUOA 3RM1A 1WLZA 1QX2A 3JVTC 1FW4A 2K7OA 4NDCA 5I2OA 3TDZA 3OGNA 1KK7Y 2BNXA 1DELA 2ERBA 1WRZA 4INWA 1UWOA 1K95A 1M31A 2K7DA 2PYQA 4DIRA 2M0RA 3PM8A 4DS7A 4HREE 1F70A 1D1OA 1DJXA 1CFPA 1OMDA 3BXKA 3D0YA 4C0KA 1XFYO 1J7QA 2PMYA 1NP8A 4MEWA 4MZJA 2E6WA 4A4CA 2JNFA 1DC1A 1Z4HA 5KTYA 1OOJA 2JT8A 2LCPA 4N1GA 4MBEA 1CDNA 1NIWA 4MSPA 2JT0A 3DF0A 3VRPA 5HLOA 3LL8B 2FOTA 2FJYA 5KU1A 2LP2A 3SG7A 4N1FA 1QS7A 1TN4A 2JC2A 4NDDA 1K9KA 1PSRA 2B1UA 2KSPA 2LV7A 1TOPA 2MRDA 1K93D 2KI4B 1SR6B 2QACA 4GGNA 4YGCB 1JC2A 1A29A 1F4QA 1CNPA 1OZSA 3O4YA 1V1FA 4M2OA 3Q8IA 3GK4X 3I5HC 2VRGA 1G4YR 1IG5A 3D0YB 2JT3A 1JWDA 5I94A 1CFFA 1N65A 4FQOA 4CPVA 2D8NA 2M1KB 3KHEA 1KQVA 4PDZA 1N0YA 1RECA 2H8VA 3H4SE 1KWOB 2WNDA 3BOWB 1TNQA 2NLNA 4CFQA 3R1VA 2LM5A 2M9GA 3WHUB 1B7TY 2LVIA 1J1EA 1BU3A 1RTP1 2QEOA 1GJYA 4ICBA 4PCWA 4MN0A 2WCBA 1CLLA 1Q80A 2KYFA 2ZRTA 1XYDA 2MA2A 3CR2A 2MLFC 2MJWB 3KO0A 2R2IA 3SG3A 1BT6A 4PE4A 4BY4A 1SR6C 1IQ5A 3EK8A 1CDLA 2WCJA 2LAPA 2M97A 3O4XA 1PK0D 2BBNA 1TRFA 3E3RA 4WQ3A 4L9MA 4JQ0D 1JF2A 1ALWA 1YUTA 1BMOA 3CZTX 2AMIA 1C7VA 1A4PA 3SS3A 1DMOA 1LA3A 1T14A 3M0WA 4JPZB 2WC6A 2Q4UA 3AAKA 4USLA 2JTZA 4QJ4B 2JZIA 1PALA 1OE9B 5DICA 2L0PA 3DY9A 2KOTA 1PRWA 5EL2A 1CM1A 1FPWA 5AANA 1S26D 4KYNA 3O2PA 5B8IB 1PVBA 1J7OA 4AQIA 2K2AA 1DJIA 2LLSA 3SS5A 1SYMA 1Y1XA 2NCOA 3D77A 4P5OE 5F6TA 1KSMA 2KDHA 2JTTA 2CT9A 2CCMA 4XJKA 1TNWA 2CXJA 2M7NA 1YVHA 2F3YA 2AAOA 1KQMB 3BFBA 4PE0A 1SL8A 1CMFA 2BKIB 2OS8C 2ZN9A 1QV0A 3OBVA 5BPJA 3BUWB 2PRUA 3TUYB 2PASA 2ZFDA 1K90D 3S0AA 1B9AA 1DF0A 2KFFA 1WLMA 3LCPC 1J7RA 1F8HA 2BCXA 1PULA 4I5JA 3BJHA 5DKQA 1SSEB 2K61A 1KK8C 1J7PA 2WCHA 2ZN8A 3K21A 1CM4A 1DJYA 2RGIA 2LLTA 1CFCA 2BBMA 2L2CA 5CSNA 1B8CA 1XK4C 5TNCA 1OMVA 3D78A 1W7JB 2JWWA 1ZMZA 1VRKA 2LVKA 2ZRSA 3KPXA 3TZ1A 5FI7A 3SS4A 1KFUS 4QJ5B 1LA0A 2LE9B 1HQVA 1MQ1A 2L4IA 1JBAA 3R1PA 1DJGA 1W9ZA 2NZ0A 3SG4A 2BECA 1AUIB 5DKNA 1CKKA 1U5IB 3I5HB 1NPQA 1KSOA 2QEVA 2L4HA 1MWNA 1GQMA 1B47A 1JF0A 1TUJA 4GGFC 3EK4A 4IJ7A 1H8BA 3S0BA 3RZSA 1FBVA 2KHNA 2I2RE 3KF9A 3DVKA 1TNXA 1WRKA 3PLFB 2PQLA 3PN7C 2KI6C 1K9UA 2MHHA 1KK8B 4JD9A 1B8LA 5HKWA 1YX8A 4AQJA 1LVCD 1F71A 1RK9A 3I5GC 3K1EA 2FCDA 2EHBA 3UNWA 1SK6D 2JXLA 1BODA 1WRLA 2Y1MA 1F54A 5AERA 2FJUB 2M8UA 1CLMA 1DJHA
chains in the Genus database with same CATH topology
3CTNA 2LMTA 1UHIA 2L2EA 5AXIA 2L50A 1EG3A 2JU0A 1CFDA 1JFJA 3ICBA 4JWQA 1SBJA 2I94A 2K7BA 2F3ZA 4C0JA 3MSEB 4UPGA 2OTGC 3NSKA 1QIVA 2M29A 2COLB 2EGDA 1NX2A 2JXCA 4NDBA 2H61C 1EJ3A 1UHJA 1FF1A 2CBLA 1IGVA 1IRJA 2KBMA 1E8AA 1UHNA 4QJ3B 3OB2B 3FWBA 2K8MB 2BE6A 3KEVA 2LUCA 4C0LA 2CTNA 2LANA 3SIBA 2PVBA 3CR4X 1M46A 1RROA 1BLQA 3I5IC 1QX5B 5GQQC 1TCOB 4R1EA 3TDIA 1NX0A 2M3WA 3ZNIA 1S5GZ 1TTXA 3I5FC 5PALA 2SCPA 2WORA 1SY9A 1AK8A 3PN7B 5J3XA 1M39A 1PVAA 1QLSA 1QTXA 1OMRA 5ER4X 1DJWA 3FWCA 1JFKA 1C7WA 2E30A 1YUUA 4YRUA 2LHIA 4HRGA 3CLNA 3CR5X 3OHMB 2LC5A 3NSLA 2I18A 1SL9A 2DOQA 1XO5A 1YRTB 1WDCB 2M1UA 3EVUA 3C1VA 1CLBA 1JSAA 3PFVA 3TDUA 1L2OC 1XFWO 4MZKA 3I5GB 3OB1B 1MHOA 2KAVA 1NCYA 2JULA 4XYNA 2JRFA 1RJVA 1QX7A 2TN4A 5HLVA 2KI4C 1MXEA 1SRAA 4PHJA 1BR1B 1K94A 1QATA 1UHKA 1IKUA 2M49B 3TUYC 4XJKB 1NYAA 4ZCVA 4CLNA 3NSIA 3EVVA 2LVVA 1UP5A 1W7IB 4Q04A 1AJ4A 2O5GA 4YGBB 4HSZA 1YR5A 2LP3A 3SG5A 3DVMA 5D69A 2OS8B 4YGDB 4F0ZB 2LMUA 4PE1A 1NCXA 3DD4A 4I5LB 4YI8A 2K2FA 4DUQA 1DJZA 2AUCA 4E68A 2I7AA 1L7ZA 1Y1UA 2K0JA 3HX4A 2WCFA 2EC6C 2BL0B 3OX6A 4WRIA 1QV1A 2MBXA 4BY5A 2F2PA 4GUKA 1EG4A 3ZWHA 4GGFA 2LUXA 2F8PA 2KAYA 1K2HA 4ETOA 2EC6B 1QASA 2KQ6A 4TNCA 1B8RA 2LHLA 5HYDA 2WCEA 4I5KA 2GGMA 1SCMC 2JOJA 2JQ6A 3EKHA 3VGOA 1BOCA 2LLUA 2Y4QA 1IWQA 1G8IA 2WC8A 1C07A 1SKTA 2GGZA 3BUOB 1ZFSA 1BJFA 2OPOA 5FYXA 1TNPA 1SPYA 3PSRA 2LVJA 1XFVO 1S1EA 3O6BA 1ALVA 1YUSA 4OKHA 4ORCB 1Y0VH 3TS5C 2BL0C 5K89A 1KFXL 4I5NB 1BG1A 1A2XA 1WDCC 1DVIA 3CGAA 2KI6D 1IJ5A 4ORAB 1LKJA 4DRWA 1KFXS 3VRRA 1XVJA 1DGVA 1YRUB 3BOWA 1XFZO 5CPVA 4YBHB 1FI5A 1S6IA 2L51A 1Y6WA 1SCVA 1ZACA 5HKZA 3F45A 1DTLA 1S5GY 1L2OB 3BUMB 3WHTB 2JPTA 2GV5A 3SIAA 4OV2A 1S6JA 1QJTA 2ZNEA 5I2LA 2G9BA 1TIZA 5AEQA 1B4CA 2HPSA 1MXLC 5ER5A 1R2UA 1QVIZ 2KYCA 2O60A 4HRHA 1NCZA 2F33A 1DF0B 3BUXB 2ISDA 1SNLA 1XK4A 2HETA 1CB1A 1KCYA 2HQWA 4M2QA 1SL7A 1J55A 1F55A 2A4JA 2LNKA 1QXPA 3RLZA 4GAOA 2L5XB 3IQOA 2H2KA 3VRNA 4PHNA 3I5FB 1WY9A 1KWOC 4MRYA 1CDMA 2Q91A 5HKYA 1UURA 2BE4A 3SG2A 2BCBA 1BF5A 2Y1NA 4CFRA 1AVSA 2OTGB 3GK2A 1DT7B 1KQMC 1N2DA 3DF0B 1U5IA 1AJ5A 3NSOA 1X02A 3OX5A 3D10A 1UHHA 1S36A 4GPLB 4MZLA 3NXAA 1XA5A 2G2BA 3EKJA 4AOMA 1XFUO 2KBIA 4D1EA 1A75A 1KFUL 1GGZA 2NCPA 4ORBB 1EH2A 4YGAA 2IS9A 2SASA 1HT9A 1BR4B 4FTGA 3SG6A 1NX3A 1OSAA 1AP4A 2BCAA 2KGBC 3I5IB 4PHMA 1RFJA 2JNXA 5CSIA 5G08A 1Y1AA 1MR8A 2HQ8A 2KQYA 4ZCUA 1MUXA 2MAZA 5AFPA 2KNEA 1V1GA 3TS5B 3BYAA 1A75B 1J1DA 1LINA 2F2OA 5DKRA 3O78A 3LLEA 4DCKA 2M7LA 1UUSA 1YURA 1QLKA 1QIWA 1SW8A 4OVNF 1KK7Z 1NUBA 3OP0A 2HF5A 1TCFA 2KFGA 5JJGA 1IJ6A 1YX7A 2PSRA 4MVFA 3JTDB 2L98A 5CSJA 3A8RA 4A4BA 3LK1A 4N5XA 4GNKB 2FCEA 3CWGA 5JOLA 1A03A 1YTZC 1CDPA 4M2PA 1M63B 1K96A 2QPTA 3JVTB 1H4BA 2ZKMX 3VROA 1FI6A 2ZNDA 3EVRA 3HCMA 4YGEB 1S3PA 3PALA 3AKBA 5CSFA 4IL1A 4YI9A 5D7FA 1ZUZA 4PE7A 5I2QA 3WNXB 4WQ2A 1NSHA 1DGUA 4U8DA 1IH0A 4OCIA 1EL4A 1OQPA 1YVLA 2KAXA 3BUNB 1SMGA 4NQGA 3SJSA 2NXQA 3GK1A 3PATA 2V53A 3CS1A 3DVJA 4GFTA 3FIAA 1QVIY 2P6BB 3QRXA 3IQQA 1M45A 1XFXO 1B7TZ 5IBWA 1GGWA 3GOFA 4OR9B 1ZOTB 1K8UA 1R6PA 5I8NA 1CMGA 2CNPA 1K9PA 4CIDA 2Y5IA 1RWYA 1EXRA 2KFHA 3FS7A 3LK0A 4PHKA 1B1GA 1S6CA 3WXAA 1NWDA 2PALA 2H61A 3DVEA 1MF8B 4MRXA 1OZOA 3VRQA 4MLWA 1CTRA 2LMVA 3IF7A 3EK7A 3BQ3A 1SCMB 3JTDC 1ODBA 1NX1A 1IQ3A 1LXFC 1AHRA 5KSZA 3AKAA 2WOSA 4GBAA 4P2YB 2MLEC 2KGRA 3AAJA 1F4OA 2BKHB 4PALA 3A4UB 1G33A 2K7CA 1PSBA 1JUOA 3RM1A 1QX2A 1WLZA 3JVTC 1FW4A 2K7OA 4NDCA 5I2OA 3TDZA 1KK7Y 1WRZA 1UWOA 1K95A 1M31A 2K7DA 4DIRA 2M0RA 3PM8A 4DS7A 4HREE 1F70A 1D1OA 1DJXA 1CFPA 1OMDA 3BXKA 3D0YA 4C0KA 1XFYO 1J7QA 2PMYA 1NP8A 4MEWA 4MZJA 2E6WA 4A4CA 2JNFA 5KTYA 1OOJA 2JT8A 2LCPA 4N1GA 4MBEA 1CDNA 1NIWA 4MSPA 2JT0A 3DF0A 3VRPA 5HLOA 3LL8B 2FOTA 5KU1A 2LP2A 3SG7A 4N1FA 1QS7A 1TN4A 2JC2A 4NDDA 1K9KA 1PSRA 2B1UA 2KSPA 2LV7A 1TOPA 2MRDA 1K93D 2KI4B 1SR6B 2QACA 4GGNA 4YGCB 1JC2A 1A29A 1F4QA 1CNPA 1OZSA 3O4YA 1V1FA 4M2OA 3GK4X 3I5HC 2VRGA 1G4YR 1IG5A 3D0YB 2JT3A 1JWDA 1CFFA 1N65A 4FQOA 4CPVA 2D8NA 2M1KB 3KHEA 1KQVA 4PDZA 1N0YA 1RECA 3H4SE 1KWOB 2WNDA 3BOWB 1TNQA 2NLNA 4CFQA 2LM5A 2M9GA 3WHUB 1B7TY 2LVIA 1J1EA 1BU3A 1RTP1 4ICBA 1GJYA 4PCWA 4MN0A 2WCBA 1CLLA 1Q80A 2KYFA 2ZRTA 1XYDA 2MA2A 3CR2A 2MLFC 2MJWB 3KO0A 2R2IA 3SG3A 1BT6A 4PE4A 4BY4A 1SR6C 1IQ5A 3EK8A 1CDLA 2LAPA 2M97A 1PK0D 2BBNA 1TRFA 3E3RA 4WQ3A 4L9MA 4JQ0D 1JF2A 1ALWA 1YUTA 1BMOA 3CZTX 2AMIA 1C7VA 1A4PA 1DMOA 1LA3A 3M0WA 4JPZB 2Q4UA 3AAKA 4USLA 2JTZA 4QJ4B 2JZIA 1PALA 1OE9B 2L0PA 2KOTA 1PRWA 1CM1A 1FPWA 5AANA 1S26D 3O2PA 5B8IB 1PVBA 1J7OA 4AQIA 2K2AA 1DJIA 2LLSA 1SYMA 1Y1XA 2NCOA 4P5OE 5F6TA 1KSMA 2KDHA 2JTTA 2CT9A 2CCMA 4XJKA 1TNWA 2CXJA 2M7NA 1YVHA 2F3YA 2AAOA 1KQMB 4PE0A 1SL8A 1CMFA 2BKIB 2OS8C 2ZN9A 1QV0A 5BPJA 3BUWB 2PRUA 3TUYB 2PASA 2ZFDA 1K90D 1B9AA 1DF0A 2KFFA 1WLMA 3LCPC 1J7RA 1F8HA 2BCXA 1PULA 4I5JA 5DKQA 2K61A 1KK8C 1J7PA 3K21A 2ZN8A 1CM4A 1DJYA 2RGIA 2LLTA 1CFCA 2BBMA 5CSNA 1B8CA 1XK4C 5TNCA 1OMVA 1W7JB 2JWWA 1ZMZA 1VRKA 2LVKA 2ZRSA 3KPXA 3TZ1A 1KFUS 4QJ5B 1LA0A 2LE9B 1HQVA 1MQ1A 2L4IA 1JBAA 3SG4A 1DJGA 2NZ0A 1CKKA 2BECA 1AUIB 5DKNA 1U5IB 3I5HB 1NPQA 1KSOA 2L4HA 1MWNA 1GQMA 1B47A 1JF0A 4GGFC 1H8BA 3EK4A 1FBVA 2KHNA 2I2RE 3KF9A 3DVKA 1TNXA 1WRKA 3PLFB 3PN7C 2KI6C 1K9UA 2MHHA 1KK8B 5HKWA 1B8LA 4AQJA 1YX8A 1F71A 1LVCD 1RK9A 3I5GC 2FCDA 2EHBA 1SK6D 2JXLA 1BODA 1WRLA 2Y1MA 1F54A 5AERA 2FJUB 2M8UA 1CLMA 1DJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTN A;  2LMT A;  1UHI A;  2L2E A;  5AXI A;  2L50 A;  1EG3 A;  2JU0 A;  1CFD A;  1JFJ A;  3ICB A;  4JWQ A;  1SBJ A;  2I94 A;  2K7B A;  2F3Z A;  4C0J A;  3MSE B;  4UPG A;  2OTG C;  3NSK A;  1QIV A;  2M29 A;  2COL B;  2EGD A;  1NX2 A;  2JXC A;  4NDB A;  2H61 C;  1EJ3 A;  1UHJ A;  1FF1 A;  2CBL A;  1IGV A;  1IRJ A;  2KBM A;  1E8A A;  1UHN A;  4QJ3 B;  3OB2 B;  3FWB A;  2K8M B;  2BE6 A;  3KEV A;  2LUC A;  4C0L A;  2CTN A;  2LAN A;  3SIB A;  2PVB A;  3CR4 X;  1M46 A;  1RRO A;  1BLQ A;  3I5I C;  1QX5 B;  5GQQ C;  1TCO B;  4R1E A;  3TDI A;  1NX0 A;  2M3W A;  3ZNI A;  1S5G Z;  1TTX A;  3I5F C;  5PAL A;  2SCP A;  2WOR A;  1SY9 A;  1AK8 A;  3PN7 B;  5J3X A;  1M39 A;  1PVA A;  1QLS A;  1QTX A;  1OMR A;  5ER4 X;  1DJW A;  3FWC A;  1JFK A;  1C7W A;  2E30 A;  1YUU A;  4YRU A;  2LHI A;  4HRG A;  3CLN A;  3CR5 X;  3OHM B;  2LC5 A;  3NSL A;  2I18 A;  1SL9 A;  2DOQ A;  1XO5 A;  1YRT B;  1WDC B;  2M1U A;  3EVU A;  3C1V A;  1CLB A;  1JSA A;  3PFV A;  3TDU A;  1L2O C;  1XFW O;  4MZK A;  3I5G B;  3OB1 B;  1MHO A;  2KAV A;  1NCY A;  2JUL A;  4XYN A;  2JRF A;  1RJV A;  1QX7 A;  2TN4 A;  5HLV A;  2KI4 C;  1MXE A;  1SRA A;  4PHJ A;  1BR1 B;  1K94 A;  1QAT A;  1UHK A;  1IKU A;  2M49 B;  3TUY C;  4XJK B;  1NYA A;  4ZCV A;  4CLN A;  3NSI A;  3EVV A;  2LVV A;  1UP5 A;  1W7I B;  4Q04 A;  1AJ4 A;  2O5G A;  4YGB B;  4HSZ A;  1YR5 A;  2LP3 A;  3SG5 A;  3DVM A;  5D69 A;  2OS8 B;  4YGD B;  4F0Z B;  2LMU A;  4PE1 A;  1NCX A;  3DD4 A;  4I5L B;  4YI8 A;  2K2F A;  4DUQ A;  1DJZ A;  2AUC A;  4E68 A;  2I7A A;  1L7Z A;  1Y1U A;  2K0J A;  3HX4 A;  2WCF A;  2EC6 C;  2BL0 B;  3OX6 A;  4WRI A;  1QV1 A;  2MBX A;  4BY5 A;  2F2P A;  4GUK A;  1EG4 A;  3ZWH A;  4GGF A;  2LUX A;  2F8P A;  2KAY A;  1K2H A;  4ETO A;  2EC6 B;  1QAS A;  2KQ6 A;  4TNC A;  1B8R A;  2LHL A;  5HYD A;  2WCE A;  4I5K A;  2GGM A;  1SCM C;  2JOJ A;  2JQ6 A;  3EKH A;  3VGO A;  1BOC A;  2LLU A;  2Y4Q A;  1IWQ A;  1G8I A;  2WC8 A;  1C07 A;  1SKT A;  2GGZ A;  3BUO B;  1ZFS A;  1BJF A;  2OPO A;  5FYX A;  1TNP A;  1SPY A;  3PSR A;  2LVJ A;  1XFV O;  1S1E A;  3O6B A;  1ALV A;  1YUS A;  4OKH A;  4ORC B;  1Y0V H;  3TS5 C;  2BL0 C;  5K89 A;  1KFX L;  4I5N B;  1BG1 A;  1A2X A;  1WDC C;  1DVI A;  3CGA A;  2KI6 D;  1IJ5 A;  4ORA B;  1LKJ A;  4DRW A;  1KFX S;  3VRR A;  1XVJ A;  1DGV A;  1YRU B;  3BOW A;  1XFZ O;  5CPV A;  4YBH B;  1FI5 A;  1S6I A;  2L51 A;  1Y6W A;  1SCV A;  1ZAC A;  5HKZ A;  3F45 A;  1DTL A;  1S5G Y;  1L2O B;  3BUM B;  3WHT B;  2JPT A;  2GV5 A;  3SIA A;  4OV2 A;  1S6J A;  1QJT A;  2ZNE A;  5I2L A;  2G9B A;  1TIZ A;  5AEQ A;  1B4C A;  2HPS A;  1MXL C;  5ER5 A;  1R2U A;  1QVI Z;  2KYC A;  2O60 A;  4HRH A;  1NCZ A;  2F33 A;  1DF0 B;  3BUX B;  2ISD A;  1SNL A;  1XK4 A;  2HET A;  1CB1 A;  1KCY A;  2HQW A;  4M2Q A;  1SL7 A;  1J55 A;  1F55 A;  2A4J A;  2LNK A;  1QXP A;  3RLZ A;  4GAO A;  2L5X B;  3IQO A;  2H2K A;  3VRN A;  4PHN A;  3I5F B;  1WY9 A;  1KWO C;  4MRY A;  1CDM A;  2Q91 A;  5HKY A;  1UUR A;  2BE4 A;  3SG2 A;  2BCB A;  1BF5 A;  2Y1N A;  4CFR A;  1AVS A;  2OTG B;  3GK2 A;  1DT7 B;  1KQM C;  1N2D A;  3DF0 B;  1U5I A;  1AJ5 A;  3NSO A;  1X02 A;  3OX5 A;  3D10 A;  1UHH A;  1S36 A;  4GPL B;  4MZL A;  3NXA A;  1XA5 A;  2G2B A;  3EKJ A;  4AOM A;  1XFU O;  2KBI A;  4D1E A;  1A75 A;  1KFU L;  1GGZ A;  2NCP A;  4ORB B;  1EH2 A;  4YGA A;  2IS9 A;  2SAS A;  1HT9 A;  1BR4 B;  4FTG A;  3SG6 A;  1NX3 A;  1OSA A;  1AP4 A;  2BCA A;  2KGB C;  3I5I B;  4PHM A;  1RFJ A;  2JNX A;  5CSI A;  5G08 A;  1Y1A A;  1MR8 A;  2HQ8 A;  2KQY A;  4ZCU A;  1MUX A;  2MAZ A;  5AFP A;  2KNE A;  1V1G A;  3TS5 B;  3BYA A;  1A75 B;  1J1D A;  1LIN A;  2F2O A;  5DKR A;  3O78 A;  3LLE A;  4DCK A;  2M7L A;  1UUS A;  1YUR A;  1QLK A;  1QIW A;  1SW8 A;  4OVN F;  1KK7 Z;  1NUB A;  3OP0 A;  2HF5 A;  1TCF A;  2KFG A;  5JJG A;  1IJ6 A;  1YX7 A;  2PSR A;  4MVF A;  3JTD B;  2L98 A;  5CSJ A;  3A8R A;  4A4B A;  3LK1 A;  4N5X A;  4GNK B;  2FCE A;  3CWG A;  5JOL A;  1A03 A;  1YTZ C;  1CDP A;  4M2P A;  1M63 B;  1K96 A;  2QPT A;  3JVT B;  1H4B A;  2ZKM X;  3VRO A;  1FI6 A;  2ZND A;  3EVR A;  3HCM A;  4YGE B;  1S3P A;  3PAL A;  3AKB A;  5CSF A;  4IL1 A;  4YI9 A;  5D7F A;  1ZUZ A;  4PE7 A;  5I2Q A;  3WNX B;  4WQ2 A;  1NSH A;  1DGU A;  4U8D A;  1IH0 A;  4OCI A;  1EL4 A;  1OQP A;  1YVL A;  2KAX A;  3BUN B;  1SMG A;  4NQG A;  3SJS A;  2NXQ A;  3GK1 A;  3PAT A;  2V53 A;  3CS1 A;  3DVJ A;  4GFT A;  3FIA A;  1QVI Y;  2P6B B;  3QRX A;  3IQQ A;  1M45 A;  1XFX O;  1B7T Z;  5IBW A;  1GGW A;  3GOF A;  4OR9 B;  1ZOT B;  1K8U A;  1R6P A;  5I8N A;  1CMG A;  2CNP A;  1K9P A;  4CID A;  2Y5I A;  1RWY A;  1EXR A;  2KFH A;  3FS7 A;  3LK0 A;  4PHK A;  1B1G A;  1S6C A;  3WXA A;  1NWD A;  2PAL A;  2H61 A;  3DVE A;  1MF8 B;  4MRX A;  1OZO A;  3VRQ A;  4MLW A;  1CTR A;  2LMV A;  3IF7 A;  3EK7 A;  3BQ3 A;  1SCM B;  3JTD C;  1ODB A;  1NX1 A;  1IQ3 A;  1LXF C;  1AHR A;  5KSZ A;  3AKA A;  2WOS A;  4GBA A;  4P2Y B;  2MLE C;  2KGR A;  3AAJ A;  1F4O A;  2BKH B;  4PAL A;  3A4U B;  1G33 A;  2K7C A;  1PSB A;  1JUO A;  3RM1 A;  1QX2 A;  1WLZ A;  3JVT C;  1FW4 A;  2K7O A;  4NDC A;  5I2O A;  3TDZ A;  1KK7 Y;  1WRZ A;  1UWO A;  1K95 A;  1M31 A;  2K7D A;  4DIR A;  2M0R A;  3PM8 A;  4DS7 A;  4HRE E;  1F70 A;  1D1O A;  1DJX A;  1CFP A;  1OMD A;  3BXK A;  3D0Y A;  4C0K A;  1XFY O;  1J7Q A;  2PMY A;  1NP8 A;  4MEW A;  4MZJ A;  2E6W A;  4A4C A;  2JNF A;  5KTY A;  1OOJ A;  2JT8 A;  2LCP A;  4N1G A;  4MBE A;  1CDN A;  1NIW A;  4MSP A;  2JT0 A;  3DF0 A;  3VRP A;  5HLO A;  3LL8 B;  2FOT A;  5KU1 A;  2LP2 A;  3SG7 A;  4N1F A;  1QS7 A;  1TN4 A;  2JC2 A;  4NDD A;  1K9K A;  1PSR A;  2B1U A;  2KSP A;  2LV7 A;  1TOP A;  2MRD A;  1K93 D;  2KI4 B;  1SR6 B;  2QAC A;  4GGN A;  4YGC B;  1JC2 A;  1A29 A;  1F4Q A;  1CNP A;  1OZS A;  3O4Y A;  1V1F A;  4M2O A;  3GK4 X;  3I5H C;  2VRG A;  1G4Y R;  1IG5 A;  3D0Y B;  2JT3 A;  1JWD A;  1CFF A;  1N65 A;  4FQO A;  4CPV A;  2D8N A;  2M1K B;  3KHE A;  1KQV A;  4PDZ A;  1N0Y A;  1REC A;  3H4S E;  1KWO B;  2WND A;  3BOW B;  1TNQ A;  2NLN A;  4CFQ A;  2LM5 A;  2M9G A;  3WHU B;  1B7T Y;  2LVI A;  1J1E A;  1BU3 A;  1RTP 1;  4ICB A;  1GJY A;  4PCW A;  4MN0 A;  2WCB A;  1CLL A;  1Q80 A;  2KYF A;  2ZRT A;  1XYD A;  2MA2 A;  3CR2 A;  2MLF C;  2MJW B;  3KO0 A;  2R2I A;  3SG3 A;  1BT6 A;  4PE4 A;  4BY4 A;  1SR6 C;  1IQ5 A;  3EK8 A;  1CDL A;  2LAP A;  2M97 A;  1PK0 D;  2BBN A;  1TRF A;  3E3R A;  4WQ3 A;  4L9M A;  4JQ0 D;  1JF2 A;  1ALW A;  1YUT A;  1BMO A;  3CZT X;  2AMI A;  1C7V A;  1A4P A;  1DMO A;  1LA3 A;  3M0W A;  4JPZ B;  2Q4U A;  3AAK A;  4USL A;  2JTZ A;  4QJ4 B;  2JZI A;  1PAL A;  1OE9 B;  2L0P A;  2KOT A;  1PRW A;  1CM1 A;  1FPW A;  5AAN A;  1S26 D;  3O2P A;  5B8I B;  1PVB A;  1J7O A;  4AQI A;  2K2A A;  1DJI A;  2LLS A;  1SYM A;  1Y1X A;  2NCO A;  4P5O E;  5F6T A;  1KSM A;  2KDH A;  2JTT A;  2CT9 A;  2CCM A;  4XJK A;  1TNW A;  2CXJ A;  2M7N A;  1YVH A;  2F3Y A;  2AAO A;  1KQM B;  4PE0 A;  1SL8 A;  1CMF A;  2BKI B;  2OS8 C;  2ZN9 A;  1QV0 A;  5BPJ A;  3BUW B;  2PRU A;  3TUY B;  2PAS A;  2ZFD A;  1K90 D;  1B9A A;  1DF0 A;  2KFF A;  1WLM A;  3LCP C;  1J7R A;  1F8H A;  2BCX A;  1PUL A;  4I5J A;  5DKQ A;  2K61 A;  1KK8 C;  1J7P A;  3K21 A;  2ZN8 A;  1CM4 A;  1DJY A;  2RGI A;  2LLT A;  1CFC A;  2BBM A;  5CSN A;  1B8C A;  1XK4 C;  5TNC A;  1OMV A;  1W7J B;  2JWW A;  1ZMZ A;  1VRK A;  2LVK A;  2ZRS A;  3KPX A;  3TZ1 A;  1KFU S;  4QJ5 B;  1LA0 A;  2LE9 B;  1HQV A;  1MQ1 A;  2L4I A;  1JBA A;  3SG4 A;  1DJG A;  2NZ0 A;  1CKK A;  2BEC A;  1AUI B;  5DKN A;  1U5I B;  3I5H B;  1NPQ A;  1KSO A;  2L4H A;  1MWN A;  1GQM A;  1B47 A;  1JF0 A;  4GGF C;  1H8B A;  3EK4 A;  1FBV A;  2KHN A;  2I2R E;  3KF9 A;  3DVK A;  1TNX A;  1WRK A;  3PLF B;  3PN7 C;  2KI6 C;  1K9U A;  2MHH A;  1KK8 B;  5HKW A;  1B8L A;  4AQJ A;  1YX8 A;  1F71 A;  1LVC D;  1RK9 A;  3I5G C;  2FCD A;  2EHB A;  1SK6 D;  2JXL A;  1BOD A;  1WRL A;  2Y1M A;  1F54 A;  5AER A;  2FJU B;  2M8U A;  1CLM A;  1DJH A; 
#chains in the Genus database with same CATH topology
 3CTN A;  2LMT A;  3N7H A;  1UHI A;  2L2E A;  5AXI A;  2L50 A;  1EG3 A;  3S0F A;  2WCL A;  2JU0 A;  3S0E A;  1CFD A;  1JFJ A;  3ICB A;  4JWQ A;  1SBJ A;  2I94 A;  2K7B A;  3BFH A;  2F3Z A;  4C0J A;  3MSE B;  4UPG A;  2OTG C;  3NSK A;  1QIV A;  2M29 A;  2COL B;  2EGD A;  1NX2 A;  2JXC A;  3CDN A;  4NDB A;  2H61 C;  1EJ3 A;  1UHJ A;  5FI6 A;  1FF1 A;  2CBL A;  1IGV A;  1IRJ A;  2KBM A;  1E8A A;  1UHN A;  4QJ3 B;  3OB2 B;  3FWB A;  2K8M B;  2BE6 A;  3KEV A;  5D3O A;  2LUC A;  1Z2C B;  3FE9 A;  4C0L A;  2CTN A;  2LAN A;  3SIB A;  2PVB A;  3CR4 X;  1M46 A;  1RRO A;  1BLQ A;  3I5I C;  1QX5 B;  5GQQ C;  1DEK A;  1TCO B;  4R1E A;  3TDI A;  4OZD A;  1NX0 A;  2M3W A;  3CAB A;  3ZNI A;  1S5G Z;  3UO9 A;  1TTX A;  3I5F C;  1OOI X;  5PAL A;  2SCP A;  2WOR A;  1SY9 A;  1AK8 A;  3PN7 B;  5J3X A;  1M39 A;  1PVA A;  1QLS A;  1QTX A;  1OMR A;  5ER4 X;  1DJW A;  1TWO A;  3FWC A;  3L4A A;  1JFK A;  1C7W A;  2E30 A;  1YUU A;  4YRU A;  2LHI A;  4HRG A;  3CLN A;  3CR5 X;  3OHM B;  2LC5 A;  3NSL A;  2I18 A;  1SL9 A;  2DOQ A;  4F7F A;  1XO5 A;  1YRT B;  1WDC B;  2M1U A;  3EVU A;  3C1V A;  1CLB A;  1JSA A;  3PFV A;  3TDU A;  1L2O C;  2QEB A;  1XFW O;  4MZK A;  3I5G B;  3OB1 B;  1MHO A;  3S0G A;  1C3Z A;  2GTE A;  1NCY A;  2JUL A;  2KAV A;  2JRF A;  1RJV A;  1QX7 A;  2P71 A;  2TN4 A;  4XYN A;  5HLV A;  3NGV A;  2KI4 C;  1MXE A;  3S0D A;  1C3Y A;  1SRA A;  4PHJ A;  1BR1 B;  1K94 A;  1QAT A;  1UHK A;  1IKU A;  1LS8 A;  2M49 B;  2YGU A;  3TUY C;  4XJK B;  1NYA A;  4ZCV A;  4CLN A;  3NSI A;  3EVV A;  2LVV A;  1OW4 A;  1UP5 A;  1W7I B;  4Q04 A;  1AJ4 A;  2O5G A;  3L4L A;  3B88 A;  3DZT A;  4YGB B;  4INX A;  4HSZ A;  1YR5 A;  2LP3 A;  3SG5 A;  3DVM A;  5D69 A;  3QME A;  2OS8 B;  3B7A A;  3R1O A;  4YGD B;  4F0Z B;  2LMU A;  4PE1 A;  1NCX A;  3DD4 A;  4I5L B;  4YI8 A;  2K2F A;  4DUQ A;  1DJZ A;  2AUC A;  4E68 A;  2I7A A;  2BAP A;  1L7Z A;  1Y1U A;  2K0J A;  3CYZ A;  3HX4 A;  2WCF A;  2JPO A;  2EC6 C;  2BL0 B;  3OX6 A;  4WRI A;  1QV1 A;  2MBX A;  4BY5 A;  3PJI A;  5HL1 A;  3FE6 A;  2F2P A;  4GUK A;  1EG4 A;  3ZWH A;  4GGF A;  2LUX A;  2F8P A;  2KAY A;  1K2H A;  1OOG A;  2QDI A;  4ETO A;  2EC6 B;  1QAS A;  2KQ6 A;  4TNC A;  1B8R A;  2LHL A;  5HYD A;  2WCE A;  4I5K A;  2GGM A;  1SCM C;  1DQE A;  2JOJ A;  2JQ6 A;  3EKH A;  3VGO A;  1BOC A;  2LLU A;  2Y4Q A;  2WCK A;  1IWQ A;  1ORG A;  1G8I A;  2WC8 A;  1C07 A;  1SKT A;  2GGZ A;  3BUO B;  1ZFS A;  1BJF A;  2OPO A;  5FYX A;  3B86 A;  1TNP A;  1SPY A;  3PSR A;  2LVJ A;  5FI2 A;  1XFV O;  1S1E A;  4FQT A;  3O6B A;  1ALV A;  1YUS A;  4OKH A;  4ORC B;  1Y0V H;  3TS5 C;  2BL0 C;  5K89 A;  1KFX L;  2KPH A;  4I5N B;  1BG1 A;  1A2X A;  1WDC C;  1DVI A;  3CGA A;  3V2L A;  2KI6 D;  1IJ5 A;  4ORA B;  1LKJ A;  4DRW A;  1KFX S;  2KLD A;  3VRR A;  1XVJ A;  1DGV A;  1YRU B;  3BOW A;  1XFZ O;  5CPV A;  3IVT A;  4YBH B;  1FI5 A;  1S6I A;  2L51 A;  1Y6W A;  1SCV A;  1ZAC A;  5HKZ A;  3F45 A;  1DTL A;  1S5G Y;  1L2O B;  3BUM B;  3WHT B;  2JPT A;  2GV5 A;  3SIA A;  4OV2 A;  1S6J A;  1QJT A;  2ZNE A;  5I2L A;  2G9B A;  1TIZ A;  5AEQ A;  1B4C A;  2HPS A;  1MXL C;  5ER5 A;  1R2U A;  1QVI Z;  2KYC A;  2O60 A;  4HRH A;  1NCZ A;  2F33 A;  1DF0 B;  3BUX B;  2ISD A;  1SNL A;  1XK4 A;  2HET A;  1CB1 A;  1KCY A;  2HQW A;  4M2Q A;  1SL7 A;  1J55 A;  1F55 A;  2A4J A;  2LNK A;  1QXP A;  3RLZ A;  4GAO A;  2L5X B;  3IQO A;  2H2K A;  3VRN A;  4PHN A;  3I5F B;  1WY9 A;  1KWO C;  4MRY A;  1CDM A;  2Q91 A;  5HKY A;  1UUR A;  2BE4 A;  3SG2 A;  2BCB A;  1BF5 A;  1IIO A;  2Y1N A;  4CFR A;  1AVS A;  2P70 A;  2OTG B;  3GK2 A;  1DT7 B;  1KQM C;  1N2D A;  2L5Y A;  3DF0 B;  1U5I A;  1AJ5 A;  3EG5 B;  3NSO A;  1X02 A;  3OX5 A;  3NHI A;  3D10 A;  1UHH A;  1S36 A;  4GPL B;  4MZL A;  3NXA A;  1XA5 A;  2G2B A;  3EKJ A;  4AOM A;  1XFU O;  2KBI A;  4D1E A;  1A75 A;  1KFU L;  3CZ2 A;  1GGZ A;  2NCP A;  2KLE A;  3R72 A;  4ORB B;  1XFR A;  1EH2 A;  3D75 A;  4YGA A;  3BFA A;  2IS9 A;  2SAS A;  1HT9 A;  1BR4 B;  4FTG A;  3SG6 A;  1NX3 A;  3VB1 A;  3B87 A;  1OSA A;  1AP4 A;  2BCA A;  1P28 A;  2KGB C;  3I5I B;  4PHM A;  1RFJ A;  2JNX A;  5CSI A;  5G08 A;  1Y1A A;  1MR8 A;  2HQ8 A;  2KQY A;  3DXL A;  1MUX A;  2MAZ A;  4ZCU A;  2KNE A;  5AFP A;  1V1G A;  2K60 A;  4PT1 A;  3TS5 B;  3BYA A;  1A75 B;  1J1D A;  1LIN A;  2F2O A;  5DKR A;  3O78 A;  3LLE A;  4DCK A;  2M7L A;  1UUS A;  1YUR A;  1QLK A;  1QIW A;  1SW8 A;  4OVN F;  1GM0 A;  1KK7 Z;  1NUB A;  3OP0 A;  4JKT A;  2HF5 A;  1TCF A;  2KFG A;  5JJG A;  2WC5 A;  3D73 A;  1IJ6 A;  1YX7 A;  2PSR A;  4MVF A;  3JTD B;  2L98 A;  5CSJ A;  3A8R A;  4A4B A;  3DYE A;  3LK1 A;  4N5X A;  4GNK B;  2FCE A;  3CWG A;  5JOL A;  1A03 A;  1YTZ C;  3D76 A;  1CDP A;  4M2P A;  3FE8 A;  3CZ1 A;  1M63 B;  1K96 A;  3PM2 A;  2QPT A;  3JVT B;  1H4B A;  2ZKM X;  3VRO A;  1FI6 A;  2ZND A;  3EVR A;  3HCM A;  4YGE B;  1S3P A;  3PAL A;  3AKB A;  5CSF A;  4IL1 A;  1OOH A;  4YI9 A;  5D7F A;  1OOF A;  1ZUZ A;  4PE7 A;  5I2Q A;  1TUZ A;  3WNX B;  4WQ2 A;  1NSH A;  1DGU A;  4U8D A;  1IH0 A;  4OCI A;  1EL4 A;  1OQP A;  1YVL A;  2KAX A;  3BUN B;  1SMG A;  4NQG A;  3SJS A;  2NXQ A;  3GK1 A;  3PAT A;  2V53 A;  3CS1 A;  3DVJ A;  4GFT A;  3FIA A;  1QVI Y;  2P6B B;  3NHT A;  3QRX A;  1QWV A;  3IQQ A;  1M45 A;  1XFX O;  1B7T Z;  5IBW A;  1GGW A;  3GOF A;  4OR9 B;  1ZOT B;  3D74 A;  1K8U A;  1R6P A;  5I8N A;  1CMG A;  2CNP A;  1K9P A;  4CID A;  3B6X A;  2Y5I A;  1RWY A;  1EXR A;  2KFH A;  3FS7 A;  3LK0 A;  4PHK A;  1B1G A;  1S6C A;  3WXA A;  1NWD A;  2PAL A;  2WCM A;  2H61 A;  3DVE A;  1MF8 B;  4MRX A;  1OZO A;  3VRQ A;  4MLW A;  1CTR A;  2LMV A;  3IF7 A;  3EK7 A;  3BQ3 A;  1SCM B;  3JTD C;  1ODB A;  1NX1 A;  3CZ0 A;  1IQ3 A;  1LXF C;  1AHR A;  5KSZ A;  3L47 A;  3AKA A;  2WOS A;  4GBA A;  4P2Y B;  2MLE C;  2KGR A;  3AAJ A;  1F4O A;  2BKH B;  4PAL A;  3A4U B;  2QEH A;  1G33 A;  2K7C A;  1PSB A;  1JUO A;  3RM1 A;  1WLZ A;  1QX2 A;  3JVT C;  1FW4 A;  2K7O A;  4NDC A;  5I2O A;  3TDZ A;  3OGN A;  1KK7 Y;  2BNX A;  1DEL A;  2ERB A;  1WRZ A;  4INW A;  1UWO A;  1K95 A;  1M31 A;  2K7D A;  2PYQ A;  4DIR A;  2M0R A;  3PM8 A;  4DS7 A;  4HRE E;  1F70 A;  1D1O A;  1DJX A;  1CFP A;  1OMD A;  3BXK A;  3D0Y A;  4C0K A;  1XFY O;  1J7Q A;  2PMY A;  1NP8 A;  4MEW A;  4MZJ A;  2E6W A;  4A4C A;  2JNF A;  1DC1 A;  1Z4H A;  5KTY A;  1OOJ A;  2JT8 A;  2LCP A;  4N1G A;  4MBE A;  1CDN A;  1NIW A;  4MSP A;  2JT0 A;  3DF0 A;  3VRP A;  5HLO A;  3LL8 B;  2FOT A;  2FJY A;  5KU1 A;  2LP2 A;  3SG7 A;  4N1F A;  1QS7 A;  1TN4 A;  2JC2 A;  4NDD A;  1K9K A;  1PSR A;  2B1U A;  2KSP A;  2LV7 A;  1TOP A;  2MRD A;  1K93 D;  2KI4 B;  1SR6 B;  2QAC A;  4GGN A;  4YGC B;  1JC2 A;  1A29 A;  1F4Q A;  1CNP A;  1OZS A;  3O4Y A;  1V1F A;  4M2O A;  3Q8I A;  3GK4 X;  3I5H C;  2VRG A;  1G4Y R;  1IG5 A;  3D0Y B;  2JT3 A;  1JWD A;  5I94 A;  1CFF A;  1N65 A;  4FQO A;  4CPV A;  2D8N A;  2M1K B;  3KHE A;  1KQV A;  4PDZ A;  1N0Y A;  1REC A;  2H8V A;  3H4S E;  1KWO B;  2WND A;  3BOW B;  1TNQ A;  2NLN A;  4CFQ A;  3R1V A;  2LM5 A;  2M9G A;  3WHU B;  1B7T Y;  2LVI A;  1J1E A;  1BU3 A;  1RTP 1;  2QEO A;  1GJY A;  4ICB A;  4PCW A;  4MN0 A;  2WCB A;  1CLL A;  1Q80 A;  2KYF A;  2ZRT A;  1XYD A;  2MA2 A;  3CR2 A;  2MLF C;  2MJW B;  3KO0 A;  2R2I A;  3SG3 A;  1BT6 A;  4PE4 A;  4BY4 A;  1SR6 C;  1IQ5 A;  3EK8 A;  1CDL A;  2WCJ A;  2LAP A;  2M97 A;  3O4X A;  1PK0 D;  2BBN A;  1TRF A;  3E3R A;  4WQ3 A;  4L9M A;  4JQ0 D;  1JF2 A;  1ALW A;  1YUT A;  1BMO A;  3CZT X;  2AMI A;  1C7V A;  1A4P A;  3SS3 A;  1DMO A;  1LA3 A;  1T14 A;  3M0W A;  4JPZ B;  2WC6 A;  2Q4U A;  3AAK A;  4USL A;  2JTZ A;  4QJ4 B;  2JZI A;  1PAL A;  1OE9 B;  5DIC A;  2L0P A;  3DY9 A;  2KOT A;  1PRW A;  5EL2 A;  1CM1 A;  1FPW A;  5AAN A;  1S26 D;  4KYN A;  3O2P A;  5B8I B;  1PVB A;  1J7O A;  4AQI A;  2K2A A;  1DJI A;  2LLS A;  3SS5 A;  1SYM A;  1Y1X A;  2NCO A;  3D77 A;  4P5O E;  5F6T A;  1KSM A;  2KDH A;  2JTT A;  2CT9 A;  2CCM A;  4XJK A;  1TNW A;  2CXJ A;  2M7N A;  1YVH A;  2F3Y A;  2AAO A;  1KQM B;  3BFB A;  4PE0 A;  1SL8 A;  1CMF A;  2BKI B;  2OS8 C;  2ZN9 A;  1QV0 A;  3OBV A;  5BPJ A;  3BUW B;  2PRU A;  3TUY B;  2PAS A;  2ZFD A;  1K90 D;  3S0A A;  1B9A A;  1DF0 A;  2KFF A;  1WLM A;  3LCP C;  1J7R A;  1F8H A;  2BCX A;  1PUL A;  4I5J A;  3BJH A;  5DKQ A;  1SSE B;  2K61 A;  1KK8 C;  1J7P A;  2WCH A;  2ZN8 A;  3K21 A;  1CM4 A;  1DJY A;  2RGI A;  2LLT A;  1CFC A;  2BBM A;  2L2C A;  5CSN A;  1B8C A;  1XK4 C;  5TNC A;  1OMV A;  3D78 A;  1W7J B;  2JWW A;  1ZMZ A;  1VRK A;  2LVK A;  2ZRS A;  3KPX A;  3TZ1 A;  5FI7 A;  3SS4 A;  1KFU S;  4QJ5 B;  1LA0 A;  2LE9 B;  1HQV A;  1MQ1 A;  2L4I A;  1JBA A;  3R1P A;  1DJG A;  1W9Z A;  2NZ0 A;  3SG4 A;  2BEC A;  1AUI B;  5DKN A;  1CKK A;  1U5I B;  3I5H B;  1NPQ A;  1KSO A;  2QEV A;  2L4H A;  1MWN A;  1GQM A;  1B47 A;  1JF0 A;  1TUJ A;  4GGF C;  3EK4 A;  4IJ7 A;  1H8B A;  3S0B A;  3RZS A;  1FBV A;  2KHN A;  2I2R E;  3KF9 A;  3DVK A;  1TNX A;  1WRK A;  3PLF B;  2PQL A;  3PN7 C;  2KI6 C;  1K9U A;  2MHH A;  1KK8 B;  4JD9 A;  1B8L A;  5HKW A;  1YX8 A;  4AQJ A;  1LVC D;  1F71 A;  1RK9 A;  3I5G C;  3K1E A;  2FCD A;  2EHB A;  3UNW A;  1SK6 D;  2JXL A;  1BOD A;  1WRL A;  2Y1M A;  1F54 A;  5AER A;  2FJU B;  2M8U A;  1CLM A;  1DJH A; 
#chains in the Genus database with same CATH homology
 3CTN A;  2LMT A;  1UHI A;  2L2E A;  5AXI A;  2L50 A;  1EG3 A;  2JU0 A;  1CFD A;  1JFJ A;  3ICB A;  4JWQ A;  1SBJ A;  2I94 A;  2K7B A;  2F3Z A;  4C0J A;  3MSE B;  4UPG A;  2OTG C;  3NSK A;  1QIV A;  2M29 A;  2COL B;  2EGD A;  1NX2 A;  2JXC A;  4NDB A;  2H61 C;  1EJ3 A;  1UHJ A;  1FF1 A;  2CBL A;  1IGV A;  1IRJ A;  2KBM A;  1E8A A;  1UHN A;  4QJ3 B;  3OB2 B;  3FWB A;  2K8M B;  2BE6 A;  3KEV A;  2LUC A;  4C0L A;  2CTN A;  2LAN A;  3SIB A;  2PVB A;  3CR4 X;  1M46 A;  1RRO A;  1BLQ A;  3I5I C;  1QX5 B;  5GQQ C;  1TCO B;  4R1E A;  3TDI A;  1NX0 A;  2M3W A;  3ZNI A;  1S5G Z;  1TTX A;  3I5F C;  5PAL A;  2SCP A;  2WOR A;  1SY9 A;  1AK8 A;  3PN7 B;  5J3X A;  1M39 A;  1PVA A;  1QLS A;  1QTX A;  1OMR A;  5ER4 X;  1DJW A;  3FWC A;  1JFK A;  1C7W A;  2E30 A;  1YUU A;  4YRU A;  2LHI A;  4HRG A;  3CLN A;  3CR5 X;  3OHM B;  2LC5 A;  3NSL A;  2I18 A;  1SL9 A;  2DOQ A;  1XO5 A;  1YRT B;  1WDC B;  2M1U A;  3EVU A;  3C1V A;  1CLB A;  1JSA A;  3PFV A;  3TDU A;  1L2O C;  1XFW O;  4MZK A;  3I5G B;  3OB1 B;  1MHO A;  2KAV A;  1NCY A;  2JUL A;  4XYN A;  2JRF A;  1RJV A;  1QX7 A;  2TN4 A;  5HLV A;  2KI4 C;  1MXE A;  1SRA A;  4PHJ A;  1BR1 B;  1K94 A;  1QAT A;  1UHK A;  1IKU A;  2M49 B;  3TUY C;  4XJK B;  1NYA A;  4ZCV A;  4CLN A;  3NSI A;  3EVV A;  2LVV A;  1UP5 A;  1W7I B;  4Q04 A;  1AJ4 A;  2O5G A;  4YGB B;  4HSZ A;  1YR5 A;  2LP3 A;  3SG5 A;  3DVM A;  5D69 A;  2OS8 B;  4YGD B;  4F0Z B;  2LMU A;  4PE1 A;  1NCX A;  3DD4 A;  4I5L B;  4YI8 A;  2K2F A;  4DUQ A;  1DJZ A;  2AUC A;  4E68 A;  2I7A A;  1L7Z A;  1Y1U A;  2K0J A;  3HX4 A;  2WCF A;  2EC6 C;  2BL0 B;  3OX6 A;  4WRI A;  1QV1 A;  2MBX A;  4BY5 A;  2F2P A;  4GUK A;  1EG4 A;  3ZWH A;  4GGF A;  2LUX A;  2F8P A;  2KAY A;  1K2H A;  4ETO A;  2EC6 B;  1QAS A;  2KQ6 A;  4TNC A;  1B8R A;  2LHL A;  5HYD A;  2WCE A;  4I5K A;  2GGM A;  1SCM C;  2JOJ A;  2JQ6 A;  3EKH A;  3VGO A;  1BOC A;  2LLU A;  2Y4Q A;  1IWQ A;  1G8I A;  2WC8 A;  1C07 A;  1SKT A;  2GGZ A;  3BUO B;  1ZFS A;  1BJF A;  2OPO A;  5FYX A;  1TNP A;  1SPY A;  3PSR A;  2LVJ A;  1XFV O;  1S1E A;  3O6B A;  1ALV A;  1YUS A;  4OKH A;  4ORC B;  1Y0V H;  3TS5 C;  2BL0 C;  5K89 A;  1KFX L;  4I5N B;  1BG1 A;  1A2X A;  1WDC C;  1DVI A;  3CGA A;  2KI6 D;  1IJ5 A;  4ORA B;  1LKJ A;  4DRW A;  1KFX S;  3VRR A;  1XVJ A;  1DGV A;  1YRU B;  3BOW A;  1XFZ O;  5CPV A;  4YBH B;  1FI5 A;  1S6I A;  2L51 A;  1Y6W A;  1SCV A;  1ZAC A;  5HKZ A;  3F45 A;  1DTL A;  1S5G Y;  1L2O B;  3BUM B;  3WHT B;  2JPT A;  2GV5 A;  3SIA A;  4OV2 A;  1S6J A;  1QJT A;  2ZNE A;  5I2L A;  2G9B A;  1TIZ A;  5AEQ A;  1B4C A;  2HPS A;  1MXL C;  5ER5 A;  1R2U A;  1QVI Z;  2KYC A;  2O60 A;  4HRH A;  1NCZ A;  2F33 A;  1DF0 B;  3BUX B;  2ISD A;  1SNL A;  1XK4 A;  2HET A;  1CB1 A;  1KCY A;  2HQW A;  4M2Q A;  1SL7 A;  1J55 A;  1F55 A;  2A4J A;  2LNK A;  1QXP A;  3RLZ A;  4GAO A;  2L5X B;  3IQO A;  2H2K A;  3VRN A;  4PHN A;  3I5F B;  1WY9 A;  1KWO C;  4MRY A;  1CDM A;  2Q91 A;  5HKY A;  1UUR A;  2BE4 A;  3SG2 A;  2BCB A;  1BF5 A;  2Y1N A;  4CFR A;  1AVS A;  2OTG B;  3GK2 A;  1DT7 B;  1KQM C;  1N2D A;  3DF0 B;  1U5I A;  1AJ5 A;  3NSO A;  1X02 A;  3OX5 A;  3D10 A;  1UHH A;  1S36 A;  4GPL B;  4MZL A;  3NXA A;  1XA5 A;  2G2B A;  3EKJ A;  4AOM A;  1XFU O;  2KBI A;  4D1E A;  1A75 A;  1KFU L;  1GGZ A;  2NCP A;  4ORB B;  1EH2 A;  4YGA A;  2IS9 A;  2SAS A;  1HT9 A;  1BR4 B;  4FTG A;  3SG6 A;  1NX3 A;  1OSA A;  1AP4 A;  2BCA A;  2KGB C;  3I5I B;  4PHM A;  1RFJ A;  2JNX A;  5CSI A;  5G08 A;  1Y1A A;  1MR8 A;  2HQ8 A;  2KQY A;  4ZCU A;  1MUX A;  2MAZ A;  5AFP A;  2KNE A;  1V1G A;  3TS5 B;  3BYA A;  1A75 B;  1J1D A;  1LIN A;  2F2O A;  5DKR A;  3O78 A;  3LLE A;  4DCK A;  2M7L A;  1UUS A;  1YUR A;  1QLK A;  1QIW A;  1SW8 A;  4OVN F;  1KK7 Z;  1NUB A;  3OP0 A;  2HF5 A;  1TCF A;  2KFG A;  5JJG A;  1IJ6 A;  1YX7 A;  2PSR A;  4MVF A;  3JTD B;  2L98 A;  5CSJ A;  3A8R A;  4A4B A;  3LK1 A;  4N5X A;  4GNK B;  2FCE A;  3CWG A;  5JOL A;  1A03 A;  1YTZ C;  1CDP A;  4M2P A;  1M63 B;  1K96 A;  2QPT A;  3JVT B;  1H4B A;  2ZKM X;  3VRO A;  1FI6 A;  2ZND A;  3EVR A;  3HCM A;  4YGE B;  1S3P A;  3PAL A;  3AKB A;  5CSF A;  4IL1 A;  4YI9 A;  5D7F A;  1ZUZ A;  4PE7 A;  5I2Q A;  3WNX B;  4WQ2 A;  1NSH A;  1DGU A;  4U8D A;  1IH0 A;  4OCI A;  1EL4 A;  1OQP A;  1YVL A;  2KAX A;  3BUN B;  1SMG A;  4NQG A;  3SJS A;  2NXQ A;  3GK1 A;  3PAT A;  2V53 A;  3CS1 A;  3DVJ A;  4GFT A;  3FIA A;  1QVI Y;  2P6B B;  3QRX A;  3IQQ A;  1M45 A;  1XFX O;  1B7T Z;  5IBW A;  1GGW A;  3GOF A;  4OR9 B;  1ZOT B;  1K8U A;  1R6P A;  5I8N A;  1CMG A;  2CNP A;  1K9P A;  4CID A;  2Y5I A;  1RWY A;  1EXR A;  2KFH A;  3FS7 A;  3LK0 A;  4PHK A;  1B1G A;  1S6C A;  3WXA A;  1NWD A;  2PAL A;  2H61 A;  3DVE A;  1MF8 B;  4MRX A;  1OZO A;  3VRQ A;  4MLW A;  1CTR A;  2LMV A;  3IF7 A;  3EK7 A;  3BQ3 A;  1SCM B;  3JTD C;  1ODB A;  1NX1 A;  1IQ3 A;  1LXF C;  1AHR A;  5KSZ A;  3AKA A;  2WOS A;  4GBA A;  4P2Y B;  2MLE C;  2KGR A;  3AAJ A;  1F4O A;  2BKH B;  4PAL A;  3A4U B;  1G33 A;  2K7C A;  1PSB A;  1JUO A;  3RM1 A;  1QX2 A;  1WLZ A;  3JVT C;  1FW4 A;  2K7O A;  4NDC A;  5I2O A;  3TDZ A;  1KK7 Y;  1WRZ A;  1UWO A;  1K95 A;  1M31 A;  2K7D A;  4DIR A;  2M0R A;  3PM8 A;  4DS7 A;  4HRE E;  1F70 A;  1D1O A;  1DJX A;  1CFP A;  1OMD A;  3BXK A;  3D0Y A;  4C0K A;  1XFY O;  1J7Q A;  2PMY A;  1NP8 A;  4MEW A;  4MZJ A;  2E6W A;  4A4C A;  2JNF A;  5KTY A;  1OOJ A;  2JT8 A;  2LCP A;  4N1G A;  4MBE A;  1CDN A;  1NIW A;  4MSP A;  2JT0 A;  3DF0 A;  3VRP A;  5HLO A;  3LL8 B;  2FOT A;  5KU1 A;  2LP2 A;  3SG7 A;  4N1F A;  1QS7 A;  1TN4 A;  2JC2 A;  4NDD A;  1K9K A;  1PSR A;  2B1U A;  2KSP A;  2LV7 A;  1TOP A;  2MRD A;  1K93 D;  2KI4 B;  1SR6 B;  2QAC A;  4GGN A;  4YGC B;  1JC2 A;  1A29 A;  1F4Q A;  1CNP A;  1OZS A;  3O4Y A;  1V1F A;  4M2O A;  3GK4 X;  3I5H C;  2VRG A;  1G4Y R;  1IG5 A;  3D0Y B;  2JT3 A;  1JWD A;  1CFF A;  1N65 A;  4FQO A;  4CPV A;  2D8N A;  2M1K B;  3KHE A;  1KQV A;  4PDZ A;  1N0Y A;  1REC A;  3H4S E;  1KWO B;  2WND A;  3BOW B;  1TNQ A;  2NLN A;  4CFQ A;  2LM5 A;  2M9G A;  3WHU B;  1B7T Y;  2LVI A;  1J1E A;  1BU3 A;  1RTP 1;  4ICB A;  1GJY A;  4PCW A;  4MN0 A;  2WCB A;  1CLL A;  1Q80 A;  2KYF A;  2ZRT A;  1XYD A;  2MA2 A;  3CR2 A;  2MLF C;  2MJW B;  3KO0 A;  2R2I A;  3SG3 A;  1BT6 A;  4PE4 A;  4BY4 A;  1SR6 C;  1IQ5 A;  3EK8 A;  1CDL A;  2LAP A;  2M97 A;  1PK0 D;  2BBN A;  1TRF A;  3E3R A;  4WQ3 A;  4L9M A;  4JQ0 D;  1JF2 A;  1ALW A;  1YUT A;  1BMO A;  3CZT X;  2AMI A;  1C7V A;  1A4P A;  1DMO A;  1LA3 A;  3M0W A;  4JPZ B;  2Q4U A;  3AAK A;  4USL A;  2JTZ A;  4QJ4 B;  2JZI A;  1PAL A;  1OE9 B;  2L0P A;  2KOT A;  1PRW A;  1CM1 A;  1FPW A;  5AAN A;  1S26 D;  3O2P A;  5B8I B;  1PVB A;  1J7O A;  4AQI A;  2K2A A;  1DJI A;  2LLS A;  1SYM A;  1Y1X A;  2NCO A;  4P5O E;  5F6T A;  1KSM A;  2KDH A;  2JTT A;  2CT9 A;  2CCM A;  4XJK A;  1TNW A;  2CXJ A;  2M7N A;  1YVH A;  2F3Y A;  2AAO A;  1KQM B;  4PE0 A;  1SL8 A;  1CMF A;  2BKI B;  2OS8 C;  2ZN9 A;  1QV0 A;  5BPJ A;  3BUW B;  2PRU A;  3TUY B;  2PAS A;  2ZFD A;  1K90 D;  1B9A A;  1DF0 A;  2KFF A;  1WLM A;  3LCP C;  1J7R A;  1F8H A;  2BCX A;  1PUL A;  4I5J A;  5DKQ A;  2K61 A;  1KK8 C;  1J7P A;  3K21 A;  2ZN8 A;  1CM4 A;  1DJY A;  2RGI A;  2LLT A;  1CFC A;  2BBM A;  5CSN A;  1B8C A;  1XK4 C;  5TNC A;  1OMV A;  1W7J B;  2JWW A;  1ZMZ A;  1VRK A;  2LVK A;  2ZRS A;  3KPX A;  3TZ1 A;  1KFU S;  4QJ5 B;  1LA0 A;  2LE9 B;  1HQV A;  1MQ1 A;  2L4I A;  1JBA A;  3SG4 A;  1DJG A;  2NZ0 A;  1CKK A;  2BEC A;  1AUI B;  5DKN A;  1U5I B;  3I5H B;  1NPQ A;  1KSO A;  2L4H A;  1MWN A;  1GQM A;  1B47 A;  1JF0 A;  4GGF C;  1H8B A;  3EK4 A;  1FBV A;  2KHN A;  2I2R E;  3KF9 A;  3DVK A;  1TNX A;  1WRK A;  3PLF B;  3PN7 C;  2KI6 C;  1K9U A;  2MHH A;  1KK8 B;  5HKW A;  1B8L A;  4AQJ A;  1YX8 A;  1F71 A;  1LVC D;  1RK9 A;  3I5G C;  2FCD A;  2EHB A;  1SK6 D;  2JXL A;  1BOD A;  1WRL A;  2Y1M A;  1F54 A;  5AER A;  2FJU B;  2M8U A;  1CLM A;  1DJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...