4I5JA

Pp2a pr70 holoenzyme
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 266
sequence length 272
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5jA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5jA01
1XFVO 3CGAA 2E6WA 3TUYC 2M29A 1CDNA 1KK8C 1SKTA 4DCKA 1WDCB 3O4YA 4MVFA 4OR9B 4OV2A 2M7LA 1J1EA 1KFUL 3OX6A 3AAJA 1GGWA 2OTGC 1UWOA 2NCOA 2KQ6A 2JRFA 2WCBA 1YX8A 2MA2A 4NDDA 2LHLA 4P2YB 1E8AA 1DJWA 1M31A 2MLFC 1SR6C 2CXJA 4D1EA 4C0KA 3BUWB 5AXIA 2L5XB 1WY9A 3JVTC 1CDMA 4A4BA 2FJUB 2LP2A 4PHNA 1KSOA 1K93D 3I5FB 2JZIA 2JTTA 3SG3A 4UPGA 1NCZA 2L4IA 1TN4A 3BOWA 2F8PA 5ER5A 4I5NB 3TUYB 1KK8B 3BUXB 1SW8A 1C7WA 2AMIA 5HKWA 4JQ0D 4OCIA 2OTGB 3FWCA 2JNXA 2FCDA 3O78A 2F2PA 2K7BA 2MLEC 2KI6C 5AFPA 4PE4A 4XJKB 2BL0C 5TNCA 2KBMA 2KSPA 5JOLA 1TNXA 1SR6B 2LMVA 3VRPA 1K95A 3JVTB 2HQ8A 2OS8C 1FBVA 3DF0B 1PK0D 1MR8A 1JC2A 1K9UA 2I18A 3WNXB 1IQ5A 3LLEA 4I5JA 2K61A 1PSRA 3OB1B 1BODA 5BPJA 1F71A 1EJ3A 1SPYA 2HETA 1L2OC 4R1EA 3SG5A 1IRJA 1LKJA 2ZNEA 4PALA 1PRWA 2OPOA 3TDUA 2JC2A 4MEWA 4YGAA 4YGCB 1IJ5A 4L9MA 4N5XA 4NDBA 2BL0B 2WOSA 4QJ4B 1XFUO 1LXFC 1BLQA 3DF0A 5I8NA 1PVAA 2H61A 2SCPA 1AUIB 3HX4A 3PSRA 4HRHA 2HQWA 2OS8B 4N1FA 1WLMA 1NSHA 1ZUZA 3BXKA 2MJWB 1IKUA 3E3RA 1CKKA 1BJFA 4DUQA 3NSIA 2E30A 1FW4A 1B7TY 3PM8A 1TRFA 3IF7A 2KFGA 2HPSA 2ZRSA 3KHEA 1OQPA 1L2OB 1S1EA 3CR4X 4PE1A 4YGEB 5D69A 1CLMA 2I2RE 2K0JA 2O5GA 3WHUB 2BE6A 2CBLA 1QV0A 1MWNA 1NWDA 1OMDA 1C7VA 1YTZC 2AAOA 1MUXA 4A4CA 1PALA 5B8IB 1QX5B 1QX2A 2Y4QA 3C1VA 3LK0A 4YBHB 3I5HC 1CB1A 4GPLB 2MHHA 4CIDA 1UHJA 5K89A 3BUOB 5JJGA 3CR5X 2JWWA 5KU1A 1BMOA 3BUMB 2L51A 3OHMB 1S5GZ 2BKIB 1J1DA 1LA3A 1WRKA 1J7PA 4HSZA 5FYXA 1BT6A 3AKBA 1PULA 1UUSA 2PRUA 1AP4A 1YURA 3EVVA 2JU0A 2JT8A 2GV5A 1UHIA 1GGZA 1EG3A 3OX5A 1F8HA 1TTXA 1A29A 1CFDA 1JUOA 3I5HB 5CSIA 2NXQA 1Y6WA 3EVRA 4HREE 2LUXA 2M7NA 1ZFSA 2PMYA 1QTXA 1NX1A 2KDHA 1KQMC 3EK7A 1Y1UA 3FIAA 2M9GA 3LL8B 1QLKA 1TIZA 1WRLA 1XVJA 4IL1A 1RROA 3EVUA 1S6IA 2BECA 1CTRA 1DJHA 4N1GA 3EK8A 3LCPC 3CR2A 1XA5A 2VRGA 2WC8A 5G08A 1CFFA 1X02A 1IWQA 5DKNA 1XFXO 2KQYA 4ORCB 1DF0B 3WXAA 1YVLA 1YRUB 2JNFA 2LMUA 4ORBB 1DGUA 3JTDC 2O60A 2H2KA 1SY9A 1F54A 1NX0A 2EC6C 1KQMB 3CTNA 4PE0A 2EGDA 2BE4A 3K21A 4GBAA 2LLSA 2LAPA 2M49B 3OB2B 3PATA 1XFYO 1W7JB 1QXPA 1ZOTB 2EHBA 1AJ5A 1OSAA 1NCYA 4CLNA 2ZFDA 3O6BA 3NSLA 4CFQA 2JQ6A 2FOTA 2KYFA 1AHRA 2JT3A 3RM1A 4XYNA 1U5IB 1OZOA 2HF5A 4JPZB 1R6PA 1XK4C 2K7DA 2KI6D 2D8NA 2KYCA 5CSJA 4GAOA 2NCPA 1FI5A 2KBIA 1SCMC 1TNPA 3KPXA 1B8RA 1G8IA 3JTDB 2SASA 3FS7A 2M0RA 4BY4A 1BG1A 2EC6B 4GGNA 4E68A 1NYAA 2F33A 1B9AA 1BR1B 3EK4A 4P5OE 1DJZA 2PVBA 4WQ3A 1ZMZA 4XJKA 4C0LA 1RTP1 1K96A 3SG2A 5CPVA 3SG6A 1IGVA 1D1OA 3CLNA 1UHHA 1JBAA 5HYDA 1MQ1A 4MN0A 1DJXA 1XO5A 4MBEA 1IH0A 2K2FA 4WRIA 2BBNA 1F4OA 1SCMB 1SBJA 1KK7Z 3SG7A 3VGOA 1QJTA 4PE7A 1EXRA 1QIWA 2A4JA 2GGZA 1OMRA 4USLA 1RECA 1CM4A 4MSPA 4ZCUA 3MSEB 1WRZA 4M2PA 1EH2A 3TDIA 2KAVA 4ICBA 2QACA 2PASA 4MRYA 1SL8A 4YRUA 5D7FA 1NCXA 2F3ZA 1Y0VH 5J3XA 1UHNA 3O2PA 2L4HA 1CLLA 1C07A 2MAZA 2LLUA 4GGFC 1QVIZ 2I94A 4FTGA 2QPTA 1BOCA 1OZSA 2KI4C 2JPTA 5HKYA 3TS5C 3DVEA 1G33A 1SL9A 4M2OA 1PSBA 1MHOA 2LM5A 2WCFA 1DJIA 2GGMA 3VRQA 1SCVA 2JXCA 5KSZA 2B1UA 1KCYA 3CZTX 4ORAB 4OVNF 1XFZO 3KF9A 1CM1A 2K7CA 1RWYA 1RFJA 1ALWA 1PVBA 1BF5A 3VROA 1FI6A 1AVSA 1W7IB 2FCEA 2K8MB 2BCAA 4YI8A 2WCEA 2G9BA 3H4SE 2ZN9A 2KAXA 1K9PA 2ZNDA 2KGRA 5HLOA 2NLNA 2KI4B 4PHMA 4BY5A 1S5GY 3TS5B 3DD4A 4QJ5B 4GFTA 1KFUS 2PSRA 1JSAA 2RGIA 5GQQC 1H4BA 4CPVA 2JTZA 2KGBC 2LE9B 1G4YR 2F3YA 4YGDB 2M97A 1XYDA 1IJ6A 1CFCA 1K8UA 4AQJA 1OE9B 3M0WA 3QRXA 1ZACA 4GGFA 3SIAA 3A8RA 1Q80A 1B47A 3DVJA 1KWOC 1QV1A 3D10A 3LK1A 4I5LB 4MZJA 1CLBA 1KQVA 1BU3A 3NXAA 1A2XA 1B8CA 3KEVA 1B4CA 1WLZA 3A4UB 1ODBA 2COLB 1AK8A 1V1FA 2M8UA 3BUNB 5F6TA 3BOWB 3GK4X 5CSNA 1LA0A 1NUBA 2CT9A 2LMTA 3CS1A 1DMOA 1GJYA 1N2DA 2Y5IA 2LHIA 2BCBA 1MF8B 3DVKA 1ALVA 1SNLA 2Q4UA 3I5GC 4WQ2A 1NX2A 1IQ3A 1F70A 1AJ4A 1YVHA 1DF0A 2LUCA 1SMGA 1A75B 1M46A 1JF0A 3GK1A 1NP8A 3ZWHA 2KHNA 4YI9A 2KNEA 1KWOB 4MRXA 1DJYA 2KOTA 2H61C 3KO0A 1SYMA 1SL7A 1GQMA 1TOPA 1CNPA 1OOJA 3HCMA 1Y1XA 2L0PA 3IQOA 1M63B 1DGVA 1UHKA 5CSFA 3TDZA 2LVVA 4AQIA 4M2QA 1KSMA 4I5KA 2PALA 4NQGA 1Y1AA 3I5GB 2KFFA 2CNPA 1A75A 4MZLA 4F0ZB 4HRGA 1K94A 1NX3A 2M1KB 1L7ZA 3NSKA 1U5IA 2K7OA 1K90D 1TCOB 3GK2A 4NDCA 3VRNA 1J7OA 2JXLA 3EKHA 4GUKA 2LV7A 1M45A 1QASA 3OP0A 5KTYA 4GNKB 1IG5A 1FPWA 1NPQA 2LNKA 1B8LA 5AANA 4PHKA 2CTNA 1LINA 2NZ0A 1QATA 5ER4X 1OMVA 4QJ3B 1J7RA 2Q91A 2LCPA 1S36A 2BCXA 3DVMA 1V1GA 1B7TZ 1H8BA 5I2OA 4C0JA 1CMFA 4YGBB 3VRRA 4MLWA 5AERA 1YX7A 2CCMA 2WORA 1K9KA 3BQ3A 1N0YA 5HLVA 1CMGA 4ZCVA 1SRAA 1EG4A 1KK7Y 1S6CA 1XK4A 1J7QA 4DS7A 2IS9A 5PALA 2AUCA 2G2BA 1CDPA 5I2LA 3ZNIA 1YUUA 1NIWA 4PDZA 1TNQA 1JWDA 1KFXS 2JULA 4TNCA 5HKZA 1QIVA 1S3PA 1DVIA 2MRDA 3RLZA 3PLFB 2R2IA 4DIRA 1TCFA 5IBWA 1SK6D 1HT9A 1A03A 3SG4A 4JWQA 2ZKMX 2LVKA 1XFWO 2Y1MA 4CFRA 2JOJA 4DRWA 1R2UA 1TNWA 1UP5A 4Q04A 2BKHB 4ETOA 1QLSA 3BYAA 1M39A 1DTLA 2L2EA 4PCWA 3SIBA 3NSOA 2BBMA 1QVIY 2M3WA 3EKJA 5DKQA 5AEQA 1FF1A 2M1UA 3AAKA 3PFVA 1VRKA 2F2OA 3CWGA 2LVJA 3D0YB 2L98A 1S26D 3FWBA 1YRTB 3SJSA 3WHTB 2DOQA 2TN4A 1B1GA 3IQQA 1RK9A 3TZ1A 3PN7C 1S6JA 2ZRTA 1HQVA 4OKHA 1LVCD 1K2HA 5I2QA 1DJGA 1N65A 1MXLC 1UURA 2JT0A 1MXEA 3I5IC 4FQOA 4U8DA 1KFXL 2LVIA 1YUSA 1A4PA 4MZKA 1WDCC 4PHJA 2I7AA 2LANA 1YR5A 2LC5A 2LLTA 3AKAA 1EL4A 3PALA 2WNDA 1JFJA 1RJVA 1QS7A 1J55A 2MBXA 2P6BB 3GOFA 1JF2A 2KAYA 1DT7B 2ZN8A 2KFHA 2Y1NA 2V53A 1JFKA 3D0YA 1F55A 4AOMA 1F4QA 3I5FC 1QX7A 1YUTA 3PN7B 2L50A 3ICBA 3F45A 1BR4B 2K2AA 2LP3A 2ISDA 1CFPA 5DKRA 3I5IB 1CDLA
chains in the Genus database with same CATH superfamily
1XFVO 3CGAA 2E6WA 3TUYC 2M29A 1CDNA 1KK8C 1SKTA 4DCKA 1WDCB 3O4YA 4MVFA 4OR9B 4OV2A 2M7LA 1J1EA 1KFUL 1Z4HA 3AAJA 3K1EA 2OTGC 1UWOA 2NCOA 3OX6A 4PT1A 3B87A 2KQ6A 3D76A 2JRFA 2WCBA 1YX8A 2MA2A 3CYZA 4NDDA 2LHLA 4P2YB 1E8AA 1DJWA 1M31A 2MLFC 1SR6C 2CXJA 4D1EA 4C0KA 3BUWB 5AXIA 2L5XB 5FI7A 1WY9A 3JVTC 1CDMA 4A4BA 2FJUB 2LP2A 4PHNA 1KSOA 1K93D 3I5FB 2JZIA 2JTTA 3SG3A 4UPGA 1NCZA 2L4IA 1TN4A 3BOWA 3R1OA 2F8PA 5ER5A 3NHIA 2L5YA 4I5NB 3TUYB 1KK8B 3BUXB 1SW8A 1C7WA 2AMIA 2QDIA 5HKWA 4JQ0D 4OCIA 2OTGB 3FWCA 2JNXA 2FCDA 3O78A 3DZTA 2F2PA 2K7BA 2MLEC 2KI6C 5AFPA 4PE4A 4XJKB 2BL0C 5TNCA 2KBMA 2KSPA 5JOLA 1TNXA 1SR6B 2LMVA 3VRPA 1DQEA 1K95A 3JVTB 2HQ8A 2OS8C 1FBVA 3DF0B 1PK0D 4KYNA 1MR8A 1JC2A 1K9UA 2I18A 3WNXB 1IQ5A 3LLEA 3OGNA 4I5JA 2K61A 1PSRA 3DYEA 1OOHA 1SSEB 3OB1B 1BODA 5BPJA 1F71A 1EJ3A 1SPYA 2HETA 1XFRA 3V2LA 1L2OC 4R1EA 3SG5A 1GGWA 1IRJA 1LKJA 2ZNEA 4PALA 1C3YA 1PRWA 2OPOA 3TDUA 2JC2A 4MEWA 4YGAA 4YGCB 1IJ5A 4L9MA 4N5XA 3B88A 4NDBA 2BL0B 2WOSA 4QJ4B 1XFUO 1LXFC 1BLQA 3DF0A 3CZ0A 5I8NA 1PVAA 2H61A 2QEHA 2SCPA 1AUIB 3HX4A 3PSRA 4HRHA 3RZSA 2HQWA 2OS8B 4N1FA 1WLMA 1NSHA 1ZUZA 3BXKA 2MJWB 1IKUA 3E3RA 1CKKA 4INXA 1BJFA 3D75A 4DUQA 3NSIA 2E30A 1FW4A 4OZDA 1B7TY 3PM8A 1TRFA 3IF7A 2KFGA 2HPSA 2ZRSA 3KHEA 1OQPA 1L2OB 1S1EA 3CR4X 4PE1A 4YGEB 5D69A 1T14A 1CLMA 2I2RE 2K0JA 2O5GA 3WHUB 2BE6A 2CBLA 1TUJA 1QV0A 1MWNA 1NWDA 1OMDA 2JPOA 1C7VA 1YTZC 2AAOA 1MUXA 4A4CA 1PALA 5FI2A 5B8IB 1QX5B 1QX2A 2Y4QA 3C1VA 3LK0A 4YBHB 2KLDA 3I5HC 3NGVA 4GPLB 1CB1A 2MHHA 4CIDA 1UHJA 5K89A 3BUOB 5JJGA 3CR5X 2JWWA 5EL2A 4JKTA 5KU1A 2BAPA 1BMOA 3BUMB 2L51A 3OHMB 1S5GZ 2BKIB 1J1DA 1LA3A 1WRKA 2WCHA 1OOIX 3S0EA 2L2CA 1DELA 1J7PA 4HSZA 5FYXA 1BT6A 3AKBA 1PULA 1UUSA 2PRUA 1AP4A 1YURA 3EVVA 2JU0A 2JT8A 2GV5A 3IVTA 1UHIA 1GGZA 1EG3A 2QEVA 3OX5A 1TTXA 1A29A 1CFDA 1JUOA 3I5HB 4JD9A 2NXQA 5CSIA 1Y6WA 3EVRA 5FI6A 3EG5B 2LUXA 2M7NA 4HREE 1ZFSA 2PMYA 1QTXA 1NX1A 2KDHA 1KQMC 3EK7A 1Y1UA 3FIAA 2M9GA 3LL8B 1QLKA 1TIZA 1WRLA 1XVJA 2QEOA 1RROA 4IL1A 3EVUA 1S6IA 2BECA 1CTRA 1DJHA 4N1GA 3S0DA 3EK8A 3LCPC 3CR2A 1OW4A 1XA5A 2VRGA 2WC8A 5G08A 1CFFA 2K60A 1X02A 1IWQA 5DKNA 1LS8A 1XFXO 2KQYA 4ORCB 3UNWA 1DF0B 3WXAA 1YVLA 1YRUB 3DY9A 2JNFA 2H8VA 1OOGA 2LMUA 4ORBB 1DGUA 3JTDC 2O60A 4IJ7A 2H2KA 1SY9A 1F54A 1NX0A 2EC6C 1KQMB 3CTNA 4PE0A 2EGDA 2BE4A 3K21A 4GBAA 2LLSA 2LAPA 2M49B 3OB2B 3PATA 1XFYO 1W7JB 1QXPA 1ZOTB 2EHBA 1AJ5A 1OSAA 1NCYA 4CLNA 2ZFDA 3O6BA 3NSLA 4CFQA 5DICA 2JQ6A 1IIOA 2FOTA 2KYFA 1AHRA 2JT3A 3RM1A 4XYNA 1U5IB 2WCMA 1OZOA 2HF5A 4JPZB 1R6PA 1XK4C 2K7DA 2KI6D 2D8NA 2BNXA 2KYCA 5CSJA 4GAOA 2NCPA 1FI5A 2KBIA 1SCMC 1TNPA 3KPXA 3B6XA 1B8RA 1G8IA 3JTDB 3OBVA 2SASA 3FS7A 2M0RA 4BY4A 1BG1A 2EC6B 4GGNA 5I94A 4E68A 1NYAA 2F33A 1B9AA 2P70A 1BR1B 3EK4A 4P5OE 1DJZA 2PVBA 4WQ3A 1ZMZA 3VB1A 1C3ZA 4XJKA 4C0LA 1RTP1 1K96A 3SG2A 5CPVA 3SG6A 1IGVA 1D1OA 3CLNA 1UHHA 1JBAA 5HYDA 1MQ1A 4MN0A 3BFAA 1DJXA 1XO5A 4MBEA 1IH0A 2K2FA 4WRIA 2PYQA 2WC6A 2BBNA 1TWOA 1F4OA 1SCMB 1SBJA 1KK7Z 3SG7A 3VGOA 1QJTA 3D73A 1F8HA 3SS4A 4PE7A 1EXRA 1QIWA 2A4JA 2GGZA 1OMRA 4USLA 3PJIA 1QWVA 1RECA 1CM4A 4MSPA 4ZCUA 3MSEB 1WRZA 4M2PA 1EH2A 3TDIA 3BFHA 2KAVA 4ICBA 2QACA 2PASA 3FE8A 4MRYA 1SL8A 4YRUA 5D7FA 1NCXA 2F3ZA 1Y0VH 5J3XA 1UHNA 3O2PA 2L4HA 1CLLA 5D3OA 1C07A 2MAZA 2LLUA 3Q8IA 3SS5A 4GGFC 1QVIZ 2I94A 1OOFA 4FTGA 2ERBA 2QPTA 1BOCA 1OZSA 2KI4C 2JPTA 5HKYA 3TS5C 3DVEA 1G33A 1SL9A 4M2OA 3CZ1A 1PSBA 3QMEA 1MHOA 2LM5A 2WCFA 1DJIA 2GGMA 3VRQA 1SCVA 2JXCA 3BJHA 5KSZA 2B1UA 1KCYA 3CZTX 4ORAB 4OVNF 1XFZO 3KF9A 1CM1A 1P28A 2K7CA 1RWYA 1RFJA 1ALWA 1PVBA 1BF5A 4FQTA 3VROA 1FI6A 3PM2A 1AVSA 1W7IB 2FCEA 3DXLA 3R72A 2K8MB 2BCAA 4YI8A 2WCEA 2G9BA 3H4SE 2ZN9A 2KAXA 1K9PA 2ZNDA 2KGRA 5HLOA 2NLNA 2KI4B 4PHMA 4BY5A 1S5GY 3TS5B 3DD4A 4QJ5B 4GFTA 1KFUS 2PSRA 3B86A 1JSAA 2RGIA 5GQQC 1DEKA 1H4BA 4CPVA 2JTZA 2KGBC 2QEBA 2LE9B 1G4YR 2F3YA 4YGDB 2M97A 3S0FA 1XYDA 1IJ6A 1CFCA 1K8UA 4AQJA 1OE9B 3M0WA 3QRXA 1ZACA 4GGFA 3SIAA 3A8RA 1Q80A 1B47A 3DVJA 1KWOC 1QV1A 2PQLA 3D10A 3LK1A 4I5LB 4MZJA 1CLBA 1BU3A 3NXAA 1A2XA 1GM0A 1KQVA 1B8CA 3KEVA 1Z2CB 1B4CA 2KPHA 1WLZA 3A4UB 1ODBA 2P71A 2COLB 1AK8A 1V1FA 2M8UA 3BUNB 5F6TA 2WCKA 3BOWB 1TUZA 3GK4X 1LA0A 1NUBA 2CT9A 2LMTA 5CSNA 3CS1A 1DMOA 1GJYA 1N2DA 2Y5IA 3D74A 2LHIA 2BCBA 1MF8B 3DVKA 1ALVA 1SNLA 2Q4UA 3I5GC 4WQ2A 1NX2A 1IQ3A 1F70A 1AJ4A 1YVHA 1DF0A 2LUCA 3CDNA 1SMGA 1A75B 1M46A 1JF0A 3GK1A 1NP8A 3ZWHA 1W9ZA 2KHNA 4YI9A 2KNEA 1KWOB 4MRXA 1DJYA 3D77A 2GTEA 2KOTA 2H61C 3KO0A 3N7HA 1SYMA 1SL7A 1GQMA 1TOPA 1CNPA 3R1PA 1OOJA 3HCMA 1Y1XA 3D78A 2L0PA 3IQOA 3O4XA 2WC5A 1M63B 1DGVA 1UHKA 5CSFA 3TDZA 2LVVA 4AQIA 4M2QA 1KSMA 4I5KA 2PALA 4NQGA 1Y1AA 3I5GB 2KFFA 2CNPA 1A75A 4MZLA 4F0ZB 4HRGA 1K94A 1NX3A 2M1KB 1L7ZA 3NSKA 1U5IA 3BFBA 2K7OA 1K90D 1TCOB 3GK2A 4NDCA 3VRNA 1J7OA 2WCJA 2JXLA 3EKHA 4GUKA 2LV7A 1M45A 1QASA 3OP0A 5KTYA 4GNKB 1IG5A 1FPWA 1NPQA 2LNKA 1B8LA 2WCLA 5AANA 4PHKA 3S0GA 2CTNA 4F7FA 1LINA 2NZ0A 1QATA 2KLEA 5ER4X 1OMVA 4QJ3B 1J7RA 2Q91A 2LCPA 1S36A 2BCXA 3DVMA 1V1GA 1B7TZ 1H8BA 5I2OA 4C0JA 1CMFA 4YGBB 3VRRA 4MLWA 5AERA 1YX7A 2CCMA 2WORA 1K9KA 3BQ3A 1N0YA 3L47A 5HLVA 4ZCVA 1CMGA 1SRAA 1EG4A 1KK7Y 1S6CA 1XK4A 1J7QA 3L4AA 4DS7A 2IS9A 5PALA 2AUCA 2G2BA 1CDPA 5I2LA 3SS3A 3ZNIA 1YUUA 1NIWA 4PDZA 1TNQA 1JWDA 1KFXS 2JULA 3FE9A 4TNCA 5HKZA 1QIVA 1S3PA 1DVIA 2FJYA 2MRDA 3RLZA 3PLFB 2R2IA 4DIRA 3CABA 1TCFA 5IBWA 1SK6D 1HT9A 1A03A 3SG4A 4INWA 4JWQA 2ZKMX 2LVKA 1XFWO 1ORGA 2Y1MA 4CFRA 2JOJA 4DRWA 1R2UA 1TNWA 1UP5A 4Q04A 2BKHB 4ETOA 1QLSA 3BYAA 1M39A 1DTLA 2L2EA 4PCWA 3UO9A 3SIBA 3NSOA 2BBMA 1QVIY 3L4LA 2M3WA 3EKJA 3S0AA 5DKQA 5AEQA 1FF1A 2M1UA 3AAKA 3PFVA 1VRKA 2F2OA 2YGUA 3CWGA 2LVJA 3D0YB 2L98A 1S26D 3FWBA 1YRTB 3NHTA 3SJSA 3WHTB 2DOQA 2TN4A 1B1GA 3IQQA 1RK9A 3TZ1A 3PN7C 1S6JA 2ZRTA 1HQVA 4OKHA 1LVCD 1K2HA 5I2QA 1DJGA 1N65A 1MXLC 1UURA 2JT0A 1MXEA 3I5IC 4FQOA 4U8DA 1KFXL 2LVIA 1YUSA 1A4PA 3R1VA 4MZKA 1WDCC 4PHJA 2I7AA 2LANA 1YR5A 2LC5A 2LLTA 3AKAA 1EL4A 3PALA 2WNDA 1JFJA 1RJVA 1QS7A 1J55A 2MBXA 2P6BB 3GOFA 1JF2A 2KAYA 3FE6A 1DT7B 2ZN8A 2KFHA 3CZ2A 2Y1NA 2V53A 1JFKA 3D0YA 5HL1A 1F55A 4AOMA 1F4QA 3I5FC 3B7AA 1QX7A 3S0BA 1YUTA 3PN7B 1DC1A 2L50A 3ICBA 3F45A 1BR4B 2K2AA 2LP3A 2ISDA 1CFPA 5DKRA 3I5IB 1CDLA
chains in the Genus database with same CATH topology
1XFVO 3CGAA 2E6WA 3TUYC 2M29A 1CDNA 1KK8C 1SKTA 4DCKA 1WDCB 3O4YA 4MVFA 4OR9B 4OV2A 2M7LA 1J1EA 1KFUL 3OX6A 3AAJA 1GGWA 2OTGC 1UWOA 2NCOA 1Z4HA 3SS3A 2KQ6A 2JRFA 2WCBA 1YX8A 2MA2A 4NDDA 2LHLA 4P2YB 1E8AA 1DJWA 1M31A 2MLFC 1SR6C 2CXJA 4D1EA 4C0KA 3BUWB 5AXIA 2L5XB 5FI7A 1WY9A 3JVTC 1CDMA 4A4BA 2FJUB 2LP2A 4PHNA 1KSOA 1K93D 3I5FB 2JZIA 2JTTA 3SG3A 4UPGA 1NCZA 2L4IA 1TN4A 3BOWA 2F8PA 5ER5A 2L5YA 4I5NB 3TUYB 1KK8B 3BUXB 1SW8A 1C7WA 2AMIA 5HKWA 4JQ0D 4OCIA 2OTGB 3FWCA 2JNXA 2FCDA 3O78A 2F2PA 2K7BA 2MLEC 2KI6C 5AFPA 4PE4A 4XJKB 2BL0C 5TNCA 2KBMA 2KSPA 5JOLA 1TNXA 1SR6B 2LMVA 3VRPA 1K95A 3JVTB 2HQ8A 2OS8C 1FBVA 3DF0B 1PK0D 4KYNA 1MR8A 1JC2A 1K9UA 2I18A 3WNXB 1IQ5A 3LLEA 4I5JA 2K61A 1PSRA 3OB1B 1BODA 5BPJA 1F71A 1EJ3A 1SPYA 2HETA 1L2OC 4R1EA 3SG5A 1IRJA 1LKJA 2ZNEA 4PALA 1PRWA 2OPOA 3TDUA 2JC2A 4MEWA 4YGAA 4YGCB 1IJ5A 4L9MA 4N5XA 4NDBA 2BL0B 2WOSA 4QJ4B 1XFUO 1LXFC 1BLQA 3DF0A 5I8NA 1PVAA 2H61A 2SCPA 1AUIB 3HX4A 3PSRA 4HRHA 2HQWA 2OS8B 4N1FA 1WLMA 1NSHA 1ZUZA 3BXKA 2MJWB 1IKUA 3E3RA 1CKKA 1BJFA 4DUQA 3NSIA 2E30A 1FW4A 1B7TY 3PM8A 1TRFA 3IF7A 2KFGA 2HPSA 2ZRSA 3KHEA 1OQPA 1L2OB 1S1EA 3CR4X 4PE1A 4YGEB 5D69A 1CLMA 2I2RE 2K0JA 2O5GA 3WHUB 2BE6A 2CBLA 1QV0A 1MWNA 1NWDA 1OMDA 1C7VA 1YTZC 2AAOA 1MUXA 4A4CA 1PALA 5FI2A 5B8IB 1QX5B 1QX2A 2Y4QA 3C1VA 3LK0A 4YBHB 3I5HC 1CB1A 4GPLB 2KLDA 2MHHA 4CIDA 1UHJA 5K89A 3BUOB 5JJGA 3CR5X 2JWWA 4JKTA 5KU1A 2BAPA 1BMOA 3BUMB 2L51A 3OHMB 1S5GZ 2BKIB 1J1DA 1LA3A 1WRKA 1DELA 1J7PA 4HSZA 5FYXA 1BT6A 3AKBA 1PULA 1UUSA 2PRUA 1AP4A 1YURA 3EVVA 2JU0A 2JT8A 2GV5A 3IVTA 1UHIA 1GGZA 1EG3A 3OX5A 1F8HA 1TTXA 1A29A 1CFDA 1JUOA 3I5HB 5CSIA 2NXQA 1Y6WA 3EVRA 5FI6A 4HREE 2LUXA 2M7NA 3EG5B 1ZFSA 2PMYA 1QTXA 1NX1A 2KDHA 1KQMC 3EK7A 1Y1UA 3FIAA 2M9GA 3LL8B 1QLKA 1TIZA 1WRLA 1XVJA 4IL1A 1RROA 3EVUA 1S6IA 2BECA 1CTRA 1DJHA 4N1GA 3EK8A 3LCPC 3CR2A 1XA5A 2VRGA 2WC8A 5G08A 1CFFA 2K60A 1X02A 1IWQA 5DKNA 1XFXO 2KQYA 4ORCB 3UNWA 1DF0B 3WXAA 1YVLA 1YRUB 2JNFA 2LMUA 4ORBB 1DGUA 3JTDC 2O60A 4IJ7A 2H2KA 1SY9A 1F54A 1NX0A 2EC6C 1KQMB 3CTNA 4PE0A 2EGDA 2BE4A 3K21A 4GBAA 2LLSA 2LAPA 2M49B 3OB2B 3PATA 1XFYO 1W7JB 1QXPA 1ZOTB 2EHBA 1AJ5A 1OSAA 1NCYA 4CLNA 2ZFDA 3O6BA 3NSLA 4CFQA 2JQ6A 2FOTA 2KYFA 1AHRA 2JT3A 3RM1A 4XYNA 1U5IB 1OZOA 2HF5A 4JPZB 1R6PA 1XK4C 2K7DA 2KI6D 2D8NA 2KYCA 5CSJA 2BNXA 4GAOA 2NCPA 1FI5A 2KBIA 1SCMC 1TNPA 3KPXA 1B8RA 1G8IA 3JTDB 3OBVA 2SASA 3FS7A 2M0RA 4BY4A 1BG1A 2EC6B 4GGNA 5I94A 4E68A 1NYAA 2F33A 1B9AA 1BR1B 3EK4A 4P5OE 1DJZA 2PVBA 4WQ3A 1ZMZA 4XJKA 4C0LA 1RTP1 1K96A 3SG2A 5CPVA 3SG6A 1IGVA 1D1OA 3CLNA 1UHHA 1JBAA 5HYDA 1MQ1A 4MN0A 1DJXA 1XO5A 4MBEA 1IH0A 2K2FA 4WRIA 2BBNA 1F4OA 1SCMB 1SBJA 1KK7Z 3SG7A 3VGOA 1QJTA 3SS4A 4PE7A 1EXRA 1QIWA 2A4JA 2GGZA 1OMRA 4USLA 1RECA 1CM4A 4MSPA 4ZCUA 3MSEB 1WRZA 4M2PA 1EH2A 3TDIA 2KAVA 4ICBA 2QACA 2PASA 4MRYA 1SL8A 4YRUA 5D7FA 1NCXA 2F3ZA 1Y0VH 5J3XA 1UHNA 3O2PA 2L4HA 1CLLA 1C07A 5D3OA 2MAZA 2LLUA 3SS5A 4GGFC 1QVIZ 2I94A 4FTGA 2QPTA 1BOCA 1OZSA 2KI4C 2JPTA 5HKYA 3TS5C 3DVEA 1G33A 1SL9A 4M2OA 1PSBA 1MHOA 2LM5A 2WCFA 1DJIA 2GGMA 3VRQA 1SCVA 2JXCA 5KSZA 2B1UA 1KCYA 3CZTX 4ORAB 4OVNF 1XFZO 3KF9A 1CM1A 2K7CA 1RWYA 1RFJA 1ALWA 1PVBA 1BF5A 3VROA 1FI6A 3PM2A 1AVSA 1W7IB 2FCEA 2K8MB 2BCAA 4YI8A 2WCEA 2G9BA 3H4SE 2ZN9A 2KAXA 1K9PA 2ZNDA 2KGRA 5HLOA 2NLNA 2KI4B 4PHMA 4BY5A 1S5GY 3TS5B 3DD4A 4QJ5B 4GFTA 1KFUS 2PSRA 1JSAA 2RGIA 5GQQC 1DEKA 1H4BA 4CPVA 2JTZA 2KGBC 2LE9B 1G4YR 2F3YA 4YGDB 2M97A 1XYDA 1IJ6A 1CFCA 1K8UA 4AQJA 1OE9B 3M0WA 3QRXA 1ZACA 4GGFA 3SIAA 3A8RA 1Q80A 1B47A 3DVJA 1KWOC 1QV1A 3D10A 3LK1A 4I5LB 4MZJA 1CLBA 1KQVA 1BU3A 3NXAA 1A2XA 1B8CA 3KEVA 1Z2CB 1B4CA 1WLZA 3A4UB 1ODBA 2COLB 1AK8A 1V1FA 2M8UA 3BUNB 5F6TA 3BOWB 3GK4X 5CSNA 1LA0A 1NUBA 2CT9A 2LMTA 3CS1A 1DMOA 1GJYA 1N2DA 2Y5IA 2LHIA 2BCBA 1MF8B 3DVKA 1ALVA 1SNLA 2Q4UA 3I5GC 4WQ2A 1NX2A 1IQ3A 1F70A 1AJ4A 1YVHA 1DF0A 2LUCA 1SMGA 1A75B 1M46A 1JF0A 3GK1A 1NP8A 3ZWHA 2KHNA 1W9ZA 4YI9A 2KNEA 1KWOB 4MRXA 1DJYA 2KOTA 2H61C 3KO0A 1SYMA 1SL7A 1GQMA 1TOPA 1CNPA 1OOJA 3HCMA 1Y1XA 2L0PA 3IQOA 3O4XA 1M63B 1DGVA 1UHKA 5CSFA 3TDZA 2LVVA 4AQIA 4M2QA 1KSMA 4I5KA 2PALA 4NQGA 1Y1AA 3I5GB 2KFFA 2CNPA 1A75A 4MZLA 4F0ZB 4HRGA 1K94A 1NX3A 2M1KB 1L7ZA 3NSKA 1U5IA 2K7OA 1K90D 1TCOB 3GK2A 4NDCA 3VRNA 1J7OA 2JXLA 3EKHA 4GUKA 2LV7A 1M45A 1QASA 3OP0A 5KTYA 4GNKB 1IG5A 1FPWA 1NPQA 2LNKA 1B8LA 5AANA 4PHKA 2CTNA 1LINA 2NZ0A 1QATA 2KLEA 5ER4X 1OMVA 4QJ3B 1J7RA 2Q91A 2LCPA 1S36A 2BCXA 3DVMA 1V1GA 1B7TZ 1H8BA 5I2OA 4C0JA 1CMFA 4YGBB 3VRRA 4MLWA 5AERA 1YX7A 2CCMA 2WORA 1K9KA 3BQ3A 1N0YA 5HLVA 1CMGA 4ZCVA 1SRAA 1EG4A 1KK7Y 1S6CA 1XK4A 1J7QA 4DS7A 2IS9A 5PALA 2AUCA 2G2BA 1CDPA 5I2LA 3ZNIA 1YUUA 1NIWA 4PDZA 1TNQA 1JWDA 1KFXS 2JULA 4TNCA 5HKZA 1QIVA 1S3PA 1DVIA 2MRDA 3RLZA 3PLFB 2R2IA 4DIRA 1TCFA 5IBWA 1SK6D 1HT9A 1A03A 3SG4A 4JWQA 2ZKMX 2LVKA 1XFWO 2Y1MA 4CFRA 2JOJA 4DRWA 1R2UA 1TNWA 1UP5A 4Q04A 2BKHB 4ETOA 1QLSA 3BYAA 1M39A 1DTLA 2L2EA 4PCWA 3UO9A 3SIBA 3NSOA 2BBMA 1QVIY 2M3WA 3EKJA 5DKQA 5AEQA 1FF1A 2M1UA 3AAKA 3PFVA 1VRKA 2F2OA 2YGUA 3CWGA 2LVJA 3D0YB 2L98A 1S26D 3FWBA 1YRTB 3SJSA 3WHTB 2DOQA 2TN4A 1B1GA 3IQQA 1RK9A 3TZ1A 3PN7C 1S6JA 2ZRTA 1HQVA 4OKHA 1LVCD 1K2HA 5I2QA 1DJGA 1N65A 1MXLC 1UURA 2JT0A 1MXEA 3I5IC 4FQOA 4U8DA 1KFXL 2LVIA 1YUSA 1A4PA 4MZKA 1WDCC 4PHJA 2I7AA 2LANA 1YR5A 2LC5A 2LLTA 3AKAA 1EL4A 3PALA 2WNDA 1JFJA 1RJVA 1QS7A 1J55A 2MBXA 2P6BB 3GOFA 1JF2A 2KAYA 1DT7B 2ZN8A 2KFHA 2Y1NA 2V53A 1JFKA 3D0YA 1F55A 5HL1A 4AOMA 1F4QA 3I5FC 1QX7A 1YUTA 3PN7B 1DC1A 2L50A 3ICBA 3F45A 1BR4B 2K2AA 2LP3A 2ISDA 1CFPA 5DKRA 3I5IB 1CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFV O;  3CGA A;  2E6W A;  3TUY C;  2M29 A;  1CDN A;  1KK8 C;  1SKT A;  4DCK A;  1WDC B;  3O4Y A;  4MVF A;  4OR9 B;  4OV2 A;  2M7L A;  1J1E A;  1KFU L;  3OX6 A;  3AAJ A;  1GGW A;  2OTG C;  1UWO A;  2NCO A;  2KQ6 A;  2JRF A;  2WCB A;  1YX8 A;  2MA2 A;  4NDD A;  2LHL A;  4P2Y B;  1E8A A;  1DJW A;  1M31 A;  2MLF C;  1SR6 C;  2CXJ A;  4D1E A;  4C0K A;  3BUW B;  5AXI A;  2L5X B;  1WY9 A;  3JVT C;  1CDM A;  4A4B A;  2FJU B;  2LP2 A;  4PHN A;  1KSO A;  1K93 D;  3I5F B;  2JZI A;  2JTT A;  3SG3 A;  4UPG A;  1NCZ A;  2L4I A;  1TN4 A;  3BOW A;  2F8P A;  5ER5 A;  4I5N B;  3TUY B;  1KK8 B;  3BUX B;  1SW8 A;  1C7W A;  2AMI A;  5HKW A;  4JQ0 D;  4OCI A;  2OTG B;  3FWC A;  2JNX A;  2FCD A;  3O78 A;  2F2P A;  2K7B A;  2MLE C;  2KI6 C;  5AFP A;  4PE4 A;  4XJK B;  2BL0 C;  5TNC A;  2KBM A;  2KSP A;  5JOL A;  1TNX A;  1SR6 B;  2LMV A;  3VRP A;  1K95 A;  3JVT B;  2HQ8 A;  2OS8 C;  1FBV A;  3DF0 B;  1PK0 D;  1MR8 A;  1JC2 A;  1K9U A;  2I18 A;  3WNX B;  1IQ5 A;  3LLE A;  4I5J A;  2K61 A;  1PSR A;  3OB1 B;  1BOD A;  5BPJ A;  1F71 A;  1EJ3 A;  1SPY A;  2HET A;  1L2O C;  4R1E A;  3SG5 A;  1IRJ A;  1LKJ A;  2ZNE A;  4PAL A;  1PRW A;  2OPO A;  3TDU A;  2JC2 A;  4MEW A;  4YGA A;  4YGC B;  1IJ5 A;  4L9M A;  4N5X A;  4NDB A;  2BL0 B;  2WOS A;  4QJ4 B;  1XFU O;  1LXF C;  1BLQ A;  3DF0 A;  5I8N A;  1PVA A;  2H61 A;  2SCP A;  1AUI B;  3HX4 A;  3PSR A;  4HRH A;  2HQW A;  2OS8 B;  4N1F A;  1WLM A;  1NSH A;  1ZUZ A;  3BXK A;  2MJW B;  1IKU A;  3E3R A;  1CKK A;  1BJF A;  4DUQ A;  3NSI A;  2E30 A;  1FW4 A;  1B7T Y;  3PM8 A;  1TRF A;  3IF7 A;  2KFG A;  2HPS A;  2ZRS A;  3KHE A;  1OQP A;  1L2O B;  1S1E A;  3CR4 X;  4PE1 A;  4YGE B;  5D69 A;  1CLM A;  2I2R E;  2K0J A;  2O5G A;  3WHU B;  2BE6 A;  2CBL A;  1QV0 A;  1MWN A;  1NWD A;  1OMD A;  1C7V A;  1YTZ C;  2AAO A;  1MUX A;  4A4C A;  1PAL A;  5B8I B;  1QX5 B;  1QX2 A;  2Y4Q A;  3C1V A;  3LK0 A;  4YBH B;  3I5H C;  1CB1 A;  4GPL B;  2MHH A;  4CID A;  1UHJ A;  5K89 A;  3BUO B;  5JJG A;  3CR5 X;  2JWW A;  5KU1 A;  1BMO A;  3BUM B;  2L51 A;  3OHM B;  1S5G Z;  2BKI B;  1J1D A;  1LA3 A;  1WRK A;  1J7P A;  4HSZ A;  5FYX A;  1BT6 A;  3AKB A;  1PUL A;  1UUS A;  2PRU A;  1AP4 A;  1YUR A;  3EVV A;  2JU0 A;  2JT8 A;  2GV5 A;  1UHI A;  1GGZ A;  1EG3 A;  3OX5 A;  1F8H A;  1TTX A;  1A29 A;  1CFD A;  1JUO A;  3I5H B;  5CSI A;  2NXQ A;  1Y6W A;  3EVR A;  4HRE E;  2LUX A;  2M7N A;  1ZFS A;  2PMY A;  1QTX A;  1NX1 A;  2KDH A;  1KQM C;  3EK7 A;  1Y1U A;  3FIA A;  2M9G A;  3LL8 B;  1QLK A;  1TIZ A;  1WRL A;  1XVJ A;  4IL1 A;  1RRO A;  3EVU A;  1S6I A;  2BEC A;  1CTR A;  1DJH A;  4N1G A;  3EK8 A;  3LCP C;  3CR2 A;  1XA5 A;  2VRG A;  2WC8 A;  5G08 A;  1CFF A;  1X02 A;  1IWQ A;  5DKN A;  1XFX O;  2KQY A;  4ORC B;  1DF0 B;  3WXA A;  1YVL A;  1YRU B;  2JNF A;  2LMU A;  4ORB B;  1DGU A;  3JTD C;  2O60 A;  2H2K A;  1SY9 A;  1F54 A;  1NX0 A;  2EC6 C;  1KQM B;  3CTN A;  4PE0 A;  2EGD A;  2BE4 A;  3K21 A;  4GBA A;  2LLS A;  2LAP A;  2M49 B;  3OB2 B;  3PAT A;  1XFY O;  1W7J B;  1QXP A;  1ZOT B;  2EHB A;  1AJ5 A;  1OSA A;  1NCY A;  4CLN A;  2ZFD A;  3O6B A;  3NSL A;  4CFQ A;  2JQ6 A;  2FOT A;  2KYF A;  1AHR A;  2JT3 A;  3RM1 A;  4XYN A;  1U5I B;  1OZO A;  2HF5 A;  4JPZ B;  1R6P A;  1XK4 C;  2K7D A;  2KI6 D;  2D8N A;  2KYC A;  5CSJ A;  4GAO A;  2NCP A;  1FI5 A;  2KBI A;  1SCM C;  1TNP A;  3KPX A;  1B8R A;  1G8I A;  3JTD B;  2SAS A;  3FS7 A;  2M0R A;  4BY4 A;  1BG1 A;  2EC6 B;  4GGN A;  4E68 A;  1NYA A;  2F33 A;  1B9A A;  1BR1 B;  3EK4 A;  4P5O E;  1DJZ A;  2PVB A;  4WQ3 A;  1ZMZ A;  4XJK A;  4C0L A;  1RTP 1;  1K96 A;  3SG2 A;  5CPV A;  3SG6 A;  1IGV A;  1D1O A;  3CLN A;  1UHH A;  1JBA A;  5HYD A;  1MQ1 A;  4MN0 A;  1DJX A;  1XO5 A;  4MBE A;  1IH0 A;  2K2F A;  4WRI A;  2BBN A;  1F4O A;  1SCM B;  1SBJ A;  1KK7 Z;  3SG7 A;  3VGO A;  1QJT A;  4PE7 A;  1EXR A;  1QIW A;  2A4J A;  2GGZ A;  1OMR A;  4USL A;  1REC A;  1CM4 A;  4MSP A;  4ZCU A;  3MSE B;  1WRZ A;  4M2P A;  1EH2 A;  3TDI A;  2KAV A;  4ICB A;  2QAC A;  2PAS A;  4MRY A;  1SL8 A;  4YRU A;  5D7F A;  1NCX A;  2F3Z A;  1Y0V H;  5J3X A;  1UHN A;  3O2P A;  2L4H A;  1CLL A;  1C07 A;  2MAZ A;  2LLU A;  4GGF C;  1QVI Z;  2I94 A;  4FTG A;  2QPT A;  1BOC A;  1OZS A;  2KI4 C;  2JPT A;  5HKY A;  3TS5 C;  3DVE A;  1G33 A;  1SL9 A;  4M2O A;  1PSB A;  1MHO A;  2LM5 A;  2WCF A;  1DJI A;  2GGM A;  3VRQ A;  1SCV A;  2JXC A;  5KSZ A;  2B1U A;  1KCY A;  3CZT X;  4ORA B;  4OVN F;  1XFZ O;  3KF9 A;  1CM1 A;  2K7C A;  1RWY A;  1RFJ A;  1ALW A;  1PVB A;  1BF5 A;  3VRO A;  1FI6 A;  1AVS A;  1W7I B;  2FCE A;  2K8M B;  2BCA A;  4YI8 A;  2WCE A;  2G9B A;  3H4S E;  2ZN9 A;  2KAX A;  1K9P A;  2ZND A;  2KGR A;  5HLO A;  2NLN A;  2KI4 B;  4PHM A;  4BY5 A;  1S5G Y;  3TS5 B;  3DD4 A;  4QJ5 B;  4GFT A;  1KFU S;  2PSR A;  1JSA A;  2RGI A;  5GQQ C;  1H4B A;  4CPV A;  2JTZ A;  2KGB C;  2LE9 B;  1G4Y R;  2F3Y A;  4YGD B;  2M97 A;  1XYD A;  1IJ6 A;  1CFC A;  1K8U A;  4AQJ A;  1OE9 B;  3M0W A;  3QRX A;  1ZAC A;  4GGF A;  3SIA A;  3A8R A;  1Q80 A;  1B47 A;  3DVJ A;  1KWO C;  1QV1 A;  3D10 A;  3LK1 A;  4I5L B;  4MZJ A;  1CLB A;  1KQV A;  1BU3 A;  3NXA A;  1A2X A;  1B8C A;  3KEV A;  1B4C A;  1WLZ A;  3A4U B;  1ODB A;  2COL B;  1AK8 A;  1V1F A;  2M8U A;  3BUN B;  5F6T A;  3BOW B;  3GK4 X;  5CSN A;  1LA0 A;  1NUB A;  2CT9 A;  2LMT A;  3CS1 A;  1DMO A;  1GJY A;  1N2D A;  2Y5I A;  2LHI A;  2BCB A;  1MF8 B;  3DVK A;  1ALV A;  1SNL A;  2Q4U A;  3I5G C;  4WQ2 A;  1NX2 A;  1IQ3 A;  1F70 A;  1AJ4 A;  1YVH A;  1DF0 A;  2LUC A;  1SMG A;  1A75 B;  1M46 A;  1JF0 A;  3GK1 A;  1NP8 A;  3ZWH A;  2KHN A;  4YI9 A;  2KNE A;  1KWO B;  4MRX A;  1DJY A;  2KOT A;  2H61 C;  3KO0 A;  1SYM A;  1SL7 A;  1GQM A;  1TOP A;  1CNP A;  1OOJ A;  3HCM A;  1Y1X A;  2L0P A;  3IQO A;  1M63 B;  1DGV A;  1UHK A;  5CSF A;  3TDZ A;  2LVV A;  4AQI A;  4M2Q A;  1KSM A;  4I5K A;  2PAL A;  4NQG A;  1Y1A A;  3I5G B;  2KFF A;  2CNP A;  1A75 A;  4MZL A;  4F0Z B;  4HRG A;  1K94 A;  1NX3 A;  2M1K B;  1L7Z A;  3NSK A;  1U5I A;  2K7O A;  1K90 D;  1TCO B;  3GK2 A;  4NDC A;  3VRN A;  1J7O A;  2JXL A;  3EKH A;  4GUK A;  2LV7 A;  1M45 A;  1QAS A;  3OP0 A;  5KTY A;  4GNK B;  1IG5 A;  1FPW A;  1NPQ A;  2LNK A;  1B8L A;  5AAN A;  4PHK A;  2CTN A;  1LIN A;  2NZ0 A;  1QAT A;  5ER4 X;  1OMV A;  4QJ3 B;  1J7R A;  2Q91 A;  2LCP A;  1S36 A;  2BCX A;  3DVM A;  1V1G A;  1B7T Z;  1H8B A;  5I2O A;  4C0J A;  1CMF A;  4YGB B;  3VRR A;  4MLW A;  5AER A;  1YX7 A;  2CCM A;  2WOR A;  1K9K A;  3BQ3 A;  1N0Y A;  5HLV A;  1CMG A;  4ZCV A;  1SRA A;  1EG4 A;  1KK7 Y;  1S6C A;  1XK4 A;  1J7Q A;  4DS7 A;  2IS9 A;  5PAL A;  2AUC A;  2G2B A;  1CDP A;  5I2L A;  3ZNI A;  1YUU A;  1NIW A;  4PDZ A;  1TNQ A;  1JWD A;  1KFX S;  2JUL A;  4TNC A;  5HKZ A;  1QIV A;  1S3P A;  1DVI A;  2MRD A;  3RLZ A;  3PLF B;  2R2I A;  4DIR A;  1TCF A;  5IBW A;  1SK6 D;  1HT9 A;  1A03 A;  3SG4 A;  4JWQ A;  2ZKM X;  2LVK A;  1XFW O;  2Y1M A;  4CFR A;  2JOJ A;  4DRW A;  1R2U A;  1TNW A;  1UP5 A;  4Q04 A;  2BKH B;  4ETO A;  1QLS A;  3BYA A;  1M39 A;  1DTL A;  2L2E A;  4PCW A;  3SIB A;  3NSO A;  2BBM A;  1QVI Y;  2M3W A;  3EKJ A;  5DKQ A;  5AEQ A;  1FF1 A;  2M1U A;  3AAK A;  3PFV A;  1VRK A;  2F2O A;  3CWG A;  2LVJ A;  3D0Y B;  2L98 A;  1S26 D;  3FWB A;  1YRT B;  3SJS A;  3WHT B;  2DOQ A;  2TN4 A;  1B1G A;  3IQQ A;  1RK9 A;  3TZ1 A;  3PN7 C;  1S6J A;  2ZRT A;  1HQV A;  4OKH A;  1LVC D;  1K2H A;  5I2Q A;  1DJG A;  1N65 A;  1MXL C;  1UUR A;  2JT0 A;  1MXE A;  3I5I C;  4FQO A;  4U8D A;  1KFX L;  2LVI A;  1YUS A;  1A4P A;  4MZK A;  1WDC C;  4PHJ A;  2I7A A;  2LAN A;  1YR5 A;  2LC5 A;  2LLT A;  3AKA A;  1EL4 A;  3PAL A;  2WND A;  1JFJ A;  1RJV A;  1QS7 A;  1J55 A;  2MBX A;  2P6B B;  3GOF A;  1JF2 A;  2KAY A;  1DT7 B;  2ZN8 A;  2KFH A;  2Y1N A;  2V53 A;  1JFK A;  3D0Y A;  1F55 A;  4AOM A;  1F4Q A;  3I5F C;  1QX7 A;  1YUT A;  3PN7 B;  2L50 A;  3ICB A;  3F45 A;  1BR4 B;  2K2A A;  2LP3 A;  2ISD A;  1CFP A;  5DKR A;  3I5I B;  1CDL A; 
#chains in the Genus database with same CATH topology
 1XFV O;  3CGA A;  2E6W A;  3TUY C;  2M29 A;  1CDN A;  1KK8 C;  1SKT A;  4DCK A;  1WDC B;  3O4Y A;  4MVF A;  4OR9 B;  4OV2 A;  2M7L A;  1J1E A;  1KFU L;  1Z4H A;  3AAJ A;  3K1E A;  2OTG C;  1UWO A;  2NCO A;  3OX6 A;  4PT1 A;  3B87 A;  2KQ6 A;  3D76 A;  2JRF A;  2WCB A;  1YX8 A;  2MA2 A;  3CYZ A;  4NDD A;  2LHL A;  4P2Y B;  1E8A A;  1DJW A;  1M31 A;  2MLF C;  1SR6 C;  2CXJ A;  4D1E A;  4C0K A;  3BUW B;  5AXI A;  2L5X B;  5FI7 A;  1WY9 A;  3JVT C;  1CDM A;  4A4B A;  2FJU B;  2LP2 A;  4PHN A;  1KSO A;  1K93 D;  3I5F B;  2JZI A;  2JTT A;  3SG3 A;  4UPG A;  1NCZ A;  2L4I A;  1TN4 A;  3BOW A;  3R1O A;  2F8P A;  5ER5 A;  3NHI A;  2L5Y A;  4I5N B;  3TUY B;  1KK8 B;  3BUX B;  1SW8 A;  1C7W A;  2AMI A;  2QDI A;  5HKW A;  4JQ0 D;  4OCI A;  2OTG B;  3FWC A;  2JNX A;  2FCD A;  3O78 A;  3DZT A;  2F2P A;  2K7B A;  2MLE C;  2KI6 C;  5AFP A;  4PE4 A;  4XJK B;  2BL0 C;  5TNC A;  2KBM A;  2KSP A;  5JOL A;  1TNX A;  1SR6 B;  2LMV A;  3VRP A;  1DQE A;  1K95 A;  3JVT B;  2HQ8 A;  2OS8 C;  1FBV A;  3DF0 B;  1PK0 D;  4KYN A;  1MR8 A;  1JC2 A;  1K9U A;  2I18 A;  3WNX B;  1IQ5 A;  3LLE A;  3OGN A;  4I5J A;  2K61 A;  1PSR A;  3DYE A;  1OOH A;  1SSE B;  3OB1 B;  1BOD A;  5BPJ A;  1F71 A;  1EJ3 A;  1SPY A;  2HET A;  1XFR A;  3V2L A;  1L2O C;  4R1E A;  3SG5 A;  1GGW A;  1IRJ A;  1LKJ A;  2ZNE A;  4PAL A;  1C3Y A;  1PRW A;  2OPO A;  3TDU A;  2JC2 A;  4MEW A;  4YGA A;  4YGC B;  1IJ5 A;  4L9M A;  4N5X A;  3B88 A;  4NDB A;  2BL0 B;  2WOS A;  4QJ4 B;  1XFU O;  1LXF C;  1BLQ A;  3DF0 A;  3CZ0 A;  5I8N A;  1PVA A;  2H61 A;  2QEH A;  2SCP A;  1AUI B;  3HX4 A;  3PSR A;  4HRH A;  3RZS A;  2HQW A;  2OS8 B;  4N1F A;  1WLM A;  1NSH A;  1ZUZ A;  3BXK A;  2MJW B;  1IKU A;  3E3R A;  1CKK A;  4INX A;  1BJF A;  3D75 A;  4DUQ A;  3NSI A;  2E30 A;  1FW4 A;  4OZD A;  1B7T Y;  3PM8 A;  1TRF A;  3IF7 A;  2KFG A;  2HPS A;  2ZRS A;  3KHE A;  1OQP A;  1L2O B;  1S1E A;  3CR4 X;  4PE1 A;  4YGE B;  5D69 A;  1T14 A;  1CLM A;  2I2R E;  2K0J A;  2O5G A;  3WHU B;  2BE6 A;  2CBL A;  1TUJ A;  1QV0 A;  1MWN A;  1NWD A;  1OMD A;  2JPO A;  1C7V A;  1YTZ C;  2AAO A;  1MUX A;  4A4C A;  1PAL A;  5FI2 A;  5B8I B;  1QX5 B;  1QX2 A;  2Y4Q A;  3C1V A;  3LK0 A;  4YBH B;  2KLD A;  3I5H C;  3NGV A;  4GPL B;  1CB1 A;  2MHH A;  4CID A;  1UHJ A;  5K89 A;  3BUO B;  5JJG A;  3CR5 X;  2JWW A;  5EL2 A;  4JKT A;  5KU1 A;  2BAP A;  1BMO A;  3BUM B;  2L51 A;  3OHM B;  1S5G Z;  2BKI B;  1J1D A;  1LA3 A;  1WRK A;  2WCH A;  1OOI X;  3S0E A;  2L2C A;  1DEL A;  1J7P A;  4HSZ A;  5FYX A;  1BT6 A;  3AKB A;  1PUL A;  1UUS A;  2PRU A;  1AP4 A;  1YUR A;  3EVV A;  2JU0 A;  2JT8 A;  2GV5 A;  3IVT A;  1UHI A;  1GGZ A;  1EG3 A;  2QEV A;  3OX5 A;  1TTX A;  1A29 A;  1CFD A;  1JUO A;  3I5H B;  4JD9 A;  2NXQ A;  5CSI A;  1Y6W A;  3EVR A;  5FI6 A;  3EG5 B;  2LUX A;  2M7N A;  4HRE E;  1ZFS A;  2PMY A;  1QTX A;  1NX1 A;  2KDH A;  1KQM C;  3EK7 A;  1Y1U A;  3FIA A;  2M9G A;  3LL8 B;  1QLK A;  1TIZ A;  1WRL A;  1XVJ A;  2QEO A;  1RRO A;  4IL1 A;  3EVU A;  1S6I A;  2BEC A;  1CTR A;  1DJH A;  4N1G A;  3S0D A;  3EK8 A;  3LCP C;  3CR2 A;  1OW4 A;  1XA5 A;  2VRG A;  2WC8 A;  5G08 A;  1CFF A;  2K60 A;  1X02 A;  1IWQ A;  5DKN A;  1LS8 A;  1XFX O;  2KQY A;  4ORC B;  3UNW A;  1DF0 B;  3WXA A;  1YVL A;  1YRU B;  3DY9 A;  2JNF A;  2H8V A;  1OOG A;  2LMU A;  4ORB B;  1DGU A;  3JTD C;  2O60 A;  4IJ7 A;  2H2K A;  1SY9 A;  1F54 A;  1NX0 A;  2EC6 C;  1KQM B;  3CTN A;  4PE0 A;  2EGD A;  2BE4 A;  3K21 A;  4GBA A;  2LLS A;  2LAP A;  2M49 B;  3OB2 B;  3PAT A;  1XFY O;  1W7J B;  1QXP A;  1ZOT B;  2EHB A;  1AJ5 A;  1OSA A;  1NCY A;  4CLN A;  2ZFD A;  3O6B A;  3NSL A;  4CFQ A;  5DIC A;  2JQ6 A;  1IIO A;  2FOT A;  2KYF A;  1AHR A;  2JT3 A;  3RM1 A;  4XYN A;  1U5I B;  2WCM A;  1OZO A;  2HF5 A;  4JPZ B;  1R6P A;  1XK4 C;  2K7D A;  2KI6 D;  2D8N A;  2BNX A;  2KYC A;  5CSJ A;  4GAO A;  2NCP A;  1FI5 A;  2KBI A;  1SCM C;  1TNP A;  3KPX A;  3B6X A;  1B8R A;  1G8I A;  3JTD B;  3OBV A;  2SAS A;  3FS7 A;  2M0R A;  4BY4 A;  1BG1 A;  2EC6 B;  4GGN A;  5I94 A;  4E68 A;  1NYA A;  2F33 A;  1B9A A;  2P70 A;  1BR1 B;  3EK4 A;  4P5O E;  1DJZ A;  2PVB A;  4WQ3 A;  1ZMZ A;  3VB1 A;  1C3Z A;  4XJK A;  4C0L A;  1RTP 1;  1K96 A;  3SG2 A;  5CPV A;  3SG6 A;  1IGV A;  1D1O A;  3CLN A;  1UHH A;  1JBA A;  5HYD A;  1MQ1 A;  4MN0 A;  3BFA A;  1DJX A;  1XO5 A;  4MBE A;  1IH0 A;  2K2F A;  4WRI A;  2PYQ A;  2WC6 A;  2BBN A;  1TWO A;  1F4O A;  1SCM B;  1SBJ A;  1KK7 Z;  3SG7 A;  3VGO A;  1QJT A;  3D73 A;  1F8H A;  3SS4 A;  4PE7 A;  1EXR A;  1QIW A;  2A4J A;  2GGZ A;  1OMR A;  4USL A;  3PJI A;  1QWV A;  1REC A;  1CM4 A;  4MSP A;  4ZCU A;  3MSE B;  1WRZ A;  4M2P A;  1EH2 A;  3TDI A;  3BFH A;  2KAV A;  4ICB A;  2QAC A;  2PAS A;  3FE8 A;  4MRY A;  1SL8 A;  4YRU A;  5D7F A;  1NCX A;  2F3Z A;  1Y0V H;  5J3X A;  1UHN A;  3O2P A;  2L4H A;  1CLL A;  5D3O A;  1C07 A;  2MAZ A;  2LLU A;  3Q8I A;  3SS5 A;  4GGF C;  1QVI Z;  2I94 A;  1OOF A;  4FTG A;  2ERB A;  2QPT A;  1BOC A;  1OZS A;  2KI4 C;  2JPT A;  5HKY A;  3TS5 C;  3DVE A;  1G33 A;  1SL9 A;  4M2O A;  3CZ1 A;  1PSB A;  3QME A;  1MHO A;  2LM5 A;  2WCF A;  1DJI A;  2GGM A;  3VRQ A;  1SCV A;  2JXC A;  3BJH A;  5KSZ A;  2B1U A;  1KCY A;  3CZT X;  4ORA B;  4OVN F;  1XFZ O;  3KF9 A;  1CM1 A;  1P28 A;  2K7C A;  1RWY A;  1RFJ A;  1ALW A;  1PVB A;  1BF5 A;  4FQT A;  3VRO A;  1FI6 A;  3PM2 A;  1AVS A;  1W7I B;  2FCE A;  3DXL A;  3R72 A;  2K8M B;  2BCA A;  4YI8 A;  2WCE A;  2G9B A;  3H4S E;  2ZN9 A;  2KAX A;  1K9P A;  2ZND A;  2KGR A;  5HLO A;  2NLN A;  2KI4 B;  4PHM A;  4BY5 A;  1S5G Y;  3TS5 B;  3DD4 A;  4QJ5 B;  4GFT A;  1KFU S;  2PSR A;  3B86 A;  1JSA A;  2RGI A;  5GQQ C;  1DEK A;  1H4B A;  4CPV A;  2JTZ A;  2KGB C;  2QEB A;  2LE9 B;  1G4Y R;  2F3Y A;  4YGD B;  2M97 A;  3S0F A;  1XYD A;  1IJ6 A;  1CFC A;  1K8U A;  4AQJ A;  1OE9 B;  3M0W A;  3QRX A;  1ZAC A;  4GGF A;  3SIA A;  3A8R A;  1Q80 A;  1B47 A;  3DVJ A;  1KWO C;  1QV1 A;  2PQL A;  3D10 A;  3LK1 A;  4I5L B;  4MZJ A;  1CLB A;  1BU3 A;  3NXA A;  1A2X A;  1GM0 A;  1KQV A;  1B8C A;  3KEV A;  1Z2C B;  1B4C A;  2KPH A;  1WLZ A;  3A4U B;  1ODB A;  2P71 A;  2COL B;  1AK8 A;  1V1F A;  2M8U A;  3BUN B;  5F6T A;  2WCK A;  3BOW B;  1TUZ A;  3GK4 X;  1LA0 A;  1NUB A;  2CT9 A;  2LMT A;  5CSN A;  3CS1 A;  1DMO A;  1GJY A;  1N2D A;  2Y5I A;  3D74 A;  2LHI A;  2BCB A;  1MF8 B;  3DVK A;  1ALV A;  1SNL A;  2Q4U A;  3I5G C;  4WQ2 A;  1NX2 A;  1IQ3 A;  1F70 A;  1AJ4 A;  1YVH A;  1DF0 A;  2LUC A;  3CDN A;  1SMG A;  1A75 B;  1M46 A;  1JF0 A;  3GK1 A;  1NP8 A;  3ZWH A;  1W9Z A;  2KHN A;  4YI9 A;  2KNE A;  1KWO B;  4MRX A;  1DJY A;  3D77 A;  2GTE A;  2KOT A;  2H61 C;  3KO0 A;  3N7H A;  1SYM A;  1SL7 A;  1GQM A;  1TOP A;  1CNP A;  3R1P A;  1OOJ A;  3HCM A;  1Y1X A;  3D78 A;  2L0P A;  3IQO A;  3O4X A;  2WC5 A;  1M63 B;  1DGV A;  1UHK A;  5CSF A;  3TDZ A;  2LVV A;  4AQI A;  4M2Q A;  1KSM A;  4I5K A;  2PAL A;  4NQG A;  1Y1A A;  3I5G B;  2KFF A;  2CNP A;  1A75 A;  4MZL A;  4F0Z B;  4HRG A;  1K94 A;  1NX3 A;  2M1K B;  1L7Z A;  3NSK A;  1U5I A;  3BFB A;  2K7O A;  1K90 D;  1TCO B;  3GK2 A;  4NDC A;  3VRN A;  1J7O A;  2WCJ A;  2JXL A;  3EKH A;  4GUK A;  2LV7 A;  1M45 A;  1QAS A;  3OP0 A;  5KTY A;  4GNK B;  1IG5 A;  1FPW A;  1NPQ A;  2LNK A;  1B8L A;  2WCL A;  5AAN A;  4PHK A;  3S0G A;  2CTN A;  4F7F A;  1LIN A;  2NZ0 A;  1QAT A;  2KLE A;  5ER4 X;  1OMV A;  4QJ3 B;  1J7R A;  2Q91 A;  2LCP A;  1S36 A;  2BCX A;  3DVM A;  1V1G A;  1B7T Z;  1H8B A;  5I2O A;  4C0J A;  1CMF A;  4YGB B;  3VRR A;  4MLW A;  5AER A;  1YX7 A;  2CCM A;  2WOR A;  1K9K A;  3BQ3 A;  1N0Y A;  3L47 A;  5HLV A;  4ZCV A;  1CMG A;  1SRA A;  1EG4 A;  1KK7 Y;  1S6C A;  1XK4 A;  1J7Q A;  3L4A A;  4DS7 A;  2IS9 A;  5PAL A;  2AUC A;  2G2B A;  1CDP A;  5I2L A;  3SS3 A;  3ZNI A;  1YUU A;  1NIW A;  4PDZ A;  1TNQ A;  1JWD A;  1KFX S;  2JUL A;  3FE9 A;  4TNC A;  5HKZ A;  1QIV A;  1S3P A;  1DVI A;  2FJY A;  2MRD A;  3RLZ A;  3PLF B;  2R2I A;  4DIR A;  3CAB A;  1TCF A;  5IBW A;  1SK6 D;  1HT9 A;  1A03 A;  3SG4 A;  4INW A;  4JWQ A;  2ZKM X;  2LVK A;  1XFW O;  1ORG A;  2Y1M A;  4CFR A;  2JOJ A;  4DRW A;  1R2U A;  1TNW A;  1UP5 A;  4Q04 A;  2BKH B;  4ETO A;  1QLS A;  3BYA A;  1M39 A;  1DTL A;  2L2E A;  4PCW A;  3UO9 A;  3SIB A;  3NSO A;  2BBM A;  1QVI Y;  3L4L A;  2M3W A;  3EKJ A;  3S0A A;  5DKQ A;  5AEQ A;  1FF1 A;  2M1U A;  3AAK A;  3PFV A;  1VRK A;  2F2O A;  2YGU A;  3CWG A;  2LVJ A;  3D0Y B;  2L98 A;  1S26 D;  3FWB A;  1YRT B;  3NHT A;  3SJS A;  3WHT B;  2DOQ A;  2TN4 A;  1B1G A;  3IQQ A;  1RK9 A;  3TZ1 A;  3PN7 C;  1S6J A;  2ZRT A;  1HQV A;  4OKH A;  1LVC D;  1K2H A;  5I2Q A;  1DJG A;  1N65 A;  1MXL C;  1UUR A;  2JT0 A;  1MXE A;  3I5I C;  4FQO A;  4U8D A;  1KFX L;  2LVI A;  1YUS A;  1A4P A;  3R1V A;  4MZK A;  1WDC C;  4PHJ A;  2I7A A;  2LAN A;  1YR5 A;  2LC5 A;  2LLT A;  3AKA A;  1EL4 A;  3PAL A;  2WND A;  1JFJ A;  1RJV A;  1QS7 A;  1J55 A;  2MBX A;  2P6B B;  3GOF A;  1JF2 A;  2KAY A;  3FE6 A;  1DT7 B;  2ZN8 A;  2KFH A;  3CZ2 A;  2Y1N A;  2V53 A;  1JFK A;  3D0Y A;  5HL1 A;  1F55 A;  4AOM A;  1F4Q A;  3I5F C;  3B7A A;  1QX7 A;  3S0B A;  1YUT A;  3PN7 B;  1DC1 A;  2L50 A;  3ICB A;  3F45 A;  1BR4 B;  2K2A A;  2LP3 A;  2ISD A;  1CFP A;  5DKR A;  3I5I B;  1CDL A; 
#chains in the Genus database with same CATH homology
 1XFV O;  3CGA A;  2E6W A;  3TUY C;  2M29 A;  1CDN A;  1KK8 C;  1SKT A;  4DCK A;  1WDC B;  3O4Y A;  4MVF A;  4OR9 B;  4OV2 A;  2M7L A;  1J1E A;  1KFU L;  3OX6 A;  3AAJ A;  1GGW A;  2OTG C;  1UWO A;  2NCO A;  1Z4H A;  3SS3 A;  2KQ6 A;  2JRF A;  2WCB A;  1YX8 A;  2MA2 A;  4NDD A;  2LHL A;  4P2Y B;  1E8A A;  1DJW A;  1M31 A;  2MLF C;  1SR6 C;  2CXJ A;  4D1E A;  4C0K A;  3BUW B;  5AXI A;  2L5X B;  5FI7 A;  1WY9 A;  3JVT C;  1CDM A;  4A4B A;  2FJU B;  2LP2 A;  4PHN A;  1KSO A;  1K93 D;  3I5F B;  2JZI A;  2JTT A;  3SG3 A;  4UPG A;  1NCZ A;  2L4I A;  1TN4 A;  3BOW A;  2F8P A;  5ER5 A;  2L5Y A;  4I5N B;  3TUY B;  1KK8 B;  3BUX B;  1SW8 A;  1C7W A;  2AMI A;  5HKW A;  4JQ0 D;  4OCI A;  2OTG B;  3FWC A;  2JNX A;  2FCD A;  3O78 A;  2F2P A;  2K7B A;  2MLE C;  2KI6 C;  5AFP A;  4PE4 A;  4XJK B;  2BL0 C;  5TNC A;  2KBM A;  2KSP A;  5JOL A;  1TNX A;  1SR6 B;  2LMV A;  3VRP A;  1K95 A;  3JVT B;  2HQ8 A;  2OS8 C;  1FBV A;  3DF0 B;  1PK0 D;  4KYN A;  1MR8 A;  1JC2 A;  1K9U A;  2I18 A;  3WNX B;  1IQ5 A;  3LLE A;  4I5J A;  2K61 A;  1PSR A;  3OB1 B;  1BOD A;  5BPJ A;  1F71 A;  1EJ3 A;  1SPY A;  2HET A;  1L2O C;  4R1E A;  3SG5 A;  1IRJ A;  1LKJ A;  2ZNE A;  4PAL A;  1PRW A;  2OPO A;  3TDU A;  2JC2 A;  4MEW A;  4YGA A;  4YGC B;  1IJ5 A;  4L9M A;  4N5X A;  4NDB A;  2BL0 B;  2WOS A;  4QJ4 B;  1XFU O;  1LXF C;  1BLQ A;  3DF0 A;  5I8N A;  1PVA A;  2H61 A;  2SCP A;  1AUI B;  3HX4 A;  3PSR A;  4HRH A;  2HQW A;  2OS8 B;  4N1F A;  1WLM A;  1NSH A;  1ZUZ A;  3BXK A;  2MJW B;  1IKU A;  3E3R A;  1CKK A;  1BJF A;  4DUQ A;  3NSI A;  2E30 A;  1FW4 A;  1B7T Y;  3PM8 A;  1TRF A;  3IF7 A;  2KFG A;  2HPS A;  2ZRS A;  3KHE A;  1OQP A;  1L2O B;  1S1E A;  3CR4 X;  4PE1 A;  4YGE B;  5D69 A;  1CLM A;  2I2R E;  2K0J A;  2O5G A;  3WHU B;  2BE6 A;  2CBL A;  1QV0 A;  1MWN A;  1NWD A;  1OMD A;  1C7V A;  1YTZ C;  2AAO A;  1MUX A;  4A4C A;  1PAL A;  5FI2 A;  5B8I B;  1QX5 B;  1QX2 A;  2Y4Q A;  3C1V A;  3LK0 A;  4YBH B;  3I5H C;  1CB1 A;  4GPL B;  2KLD A;  2MHH A;  4CID A;  1UHJ A;  5K89 A;  3BUO B;  5JJG A;  3CR5 X;  2JWW A;  4JKT A;  5KU1 A;  2BAP A;  1BMO A;  3BUM B;  2L51 A;  3OHM B;  1S5G Z;  2BKI B;  1J1D A;  1LA3 A;  1WRK A;  1DEL A;  1J7P A;  4HSZ A;  5FYX A;  1BT6 A;  3AKB A;  1PUL A;  1UUS A;  2PRU A;  1AP4 A;  1YUR A;  3EVV A;  2JU0 A;  2JT8 A;  2GV5 A;  3IVT A;  1UHI A;  1GGZ A;  1EG3 A;  3OX5 A;  1F8H A;  1TTX A;  1A29 A;  1CFD A;  1JUO A;  3I5H B;  5CSI A;  2NXQ A;  1Y6W A;  3EVR A;  5FI6 A;  4HRE E;  2LUX A;  2M7N A;  3EG5 B;  1ZFS A;  2PMY A;  1QTX A;  1NX1 A;  2KDH A;  1KQM C;  3EK7 A;  1Y1U A;  3FIA A;  2M9G A;  3LL8 B;  1QLK A;  1TIZ A;  1WRL A;  1XVJ A;  4IL1 A;  1RRO A;  3EVU A;  1S6I A;  2BEC A;  1CTR A;  1DJH A;  4N1G A;  3EK8 A;  3LCP C;  3CR2 A;  1XA5 A;  2VRG A;  2WC8 A;  5G08 A;  1CFF A;  2K60 A;  1X02 A;  1IWQ A;  5DKN A;  1XFX O;  2KQY A;  4ORC B;  3UNW A;  1DF0 B;  3WXA A;  1YVL A;  1YRU B;  2JNF A;  2LMU A;  4ORB B;  1DGU A;  3JTD C;  2O60 A;  4IJ7 A;  2H2K A;  1SY9 A;  1F54 A;  1NX0 A;  2EC6 C;  1KQM B;  3CTN A;  4PE0 A;  2EGD A;  2BE4 A;  3K21 A;  4GBA A;  2LLS A;  2LAP A;  2M49 B;  3OB2 B;  3PAT A;  1XFY O;  1W7J B;  1QXP A;  1ZOT B;  2EHB A;  1AJ5 A;  1OSA A;  1NCY A;  4CLN A;  2ZFD A;  3O6B A;  3NSL A;  4CFQ A;  2JQ6 A;  2FOT A;  2KYF A;  1AHR A;  2JT3 A;  3RM1 A;  4XYN A;  1U5I B;  1OZO A;  2HF5 A;  4JPZ B;  1R6P A;  1XK4 C;  2K7D A;  2KI6 D;  2D8N A;  2KYC A;  5CSJ A;  2BNX A;  4GAO A;  2NCP A;  1FI5 A;  2KBI A;  1SCM C;  1TNP A;  3KPX A;  1B8R A;  1G8I A;  3JTD B;  3OBV A;  2SAS A;  3FS7 A;  2M0R A;  4BY4 A;  1BG1 A;  2EC6 B;  4GGN A;  5I94 A;  4E68 A;  1NYA A;  2F33 A;  1B9A A;  1BR1 B;  3EK4 A;  4P5O E;  1DJZ A;  2PVB A;  4WQ3 A;  1ZMZ A;  4XJK A;  4C0L A;  1RTP 1;  1K96 A;  3SG2 A;  5CPV A;  3SG6 A;  1IGV A;  1D1O A;  3CLN A;  1UHH A;  1JBA A;  5HYD A;  1MQ1 A;  4MN0 A;  1DJX A;  1XO5 A;  4MBE A;  1IH0 A;  2K2F A;  4WRI A;  2BBN A;  1F4O A;  1SCM B;  1SBJ A;  1KK7 Z;  3SG7 A;  3VGO A;  1QJT A;  3SS4 A;  4PE7 A;  1EXR A;  1QIW A;  2A4J A;  2GGZ A;  1OMR A;  4USL A;  1REC A;  1CM4 A;  4MSP A;  4ZCU A;  3MSE B;  1WRZ A;  4M2P A;  1EH2 A;  3TDI A;  2KAV A;  4ICB A;  2QAC A;  2PAS A;  4MRY A;  1SL8 A;  4YRU A;  5D7F A;  1NCX A;  2F3Z A;  1Y0V H;  5J3X A;  1UHN A;  3O2P A;  2L4H A;  1CLL A;  1C07 A;  5D3O A;  2MAZ A;  2LLU A;  3SS5 A;  4GGF C;  1QVI Z;  2I94 A;  4FTG A;  2QPT A;  1BOC A;  1OZS A;  2KI4 C;  2JPT A;  5HKY A;  3TS5 C;  3DVE A;  1G33 A;  1SL9 A;  4M2O A;  1PSB A;  1MHO A;  2LM5 A;  2WCF A;  1DJI A;  2GGM A;  3VRQ A;  1SCV A;  2JXC A;  5KSZ A;  2B1U A;  1KCY A;  3CZT X;  4ORA B;  4OVN F;  1XFZ O;  3KF9 A;  1CM1 A;  2K7C A;  1RWY A;  1RFJ A;  1ALW A;  1PVB A;  1BF5 A;  3VRO A;  1FI6 A;  3PM2 A;  1AVS A;  1W7I B;  2FCE A;  2K8M B;  2BCA A;  4YI8 A;  2WCE A;  2G9B A;  3H4S E;  2ZN9 A;  2KAX A;  1K9P A;  2ZND A;  2KGR A;  5HLO A;  2NLN A;  2KI4 B;  4PHM A;  4BY5 A;  1S5G Y;  3TS5 B;  3DD4 A;  4QJ5 B;  4GFT A;  1KFU S;  2PSR A;  1JSA A;  2RGI A;  5GQQ C;  1DEK A;  1H4B A;  4CPV A;  2JTZ A;  2KGB C;  2LE9 B;  1G4Y R;  2F3Y A;  4YGD B;  2M97 A;  1XYD A;  1IJ6 A;  1CFC A;  1K8U A;  4AQJ A;  1OE9 B;  3M0W A;  3QRX A;  1ZAC A;  4GGF A;  3SIA A;  3A8R A;  1Q80 A;  1B47 A;  3DVJ A;  1KWO C;  1QV1 A;  3D10 A;  3LK1 A;  4I5L B;  4MZJ A;  1CLB A;  1KQV A;  1BU3 A;  3NXA A;  1A2X A;  1B8C A;  3KEV A;  1Z2C B;  1B4C A;  1WLZ A;  3A4U B;  1ODB A;  2COL B;  1AK8 A;  1V1F A;  2M8U A;  3BUN B;  5F6T A;  3BOW B;  3GK4 X;  5CSN A;  1LA0 A;  1NUB A;  2CT9 A;  2LMT A;  3CS1 A;  1DMO A;  1GJY A;  1N2D A;  2Y5I A;  2LHI A;  2BCB A;  1MF8 B;  3DVK A;  1ALV A;  1SNL A;  2Q4U A;  3I5G C;  4WQ2 A;  1NX2 A;  1IQ3 A;  1F70 A;  1AJ4 A;  1YVH A;  1DF0 A;  2LUC A;  1SMG A;  1A75 B;  1M46 A;  1JF0 A;  3GK1 A;  1NP8 A;  3ZWH A;  2KHN A;  1W9Z A;  4YI9 A;  2KNE A;  1KWO B;  4MRX A;  1DJY A;  2KOT A;  2H61 C;  3KO0 A;  1SYM A;  1SL7 A;  1GQM A;  1TOP A;  1CNP A;  1OOJ A;  3HCM A;  1Y1X A;  2L0P A;  3IQO A;  3O4X A;  1M63 B;  1DGV A;  1UHK A;  5CSF A;  3TDZ A;  2LVV A;  4AQI A;  4M2Q A;  1KSM A;  4I5K A;  2PAL A;  4NQG A;  1Y1A A;  3I5G B;  2KFF A;  2CNP A;  1A75 A;  4MZL A;  4F0Z B;  4HRG A;  1K94 A;  1NX3 A;  2M1K B;  1L7Z A;  3NSK A;  1U5I A;  2K7O A;  1K90 D;  1TCO B;  3GK2 A;  4NDC A;  3VRN A;  1J7O A;  2JXL A;  3EKH A;  4GUK A;  2LV7 A;  1M45 A;  1QAS A;  3OP0 A;  5KTY A;  4GNK B;  1IG5 A;  1FPW A;  1NPQ A;  2LNK A;  1B8L A;  5AAN A;  4PHK A;  2CTN A;  1LIN A;  2NZ0 A;  1QAT A;  2KLE A;  5ER4 X;  1OMV A;  4QJ3 B;  1J7R A;  2Q91 A;  2LCP A;  1S36 A;  2BCX A;  3DVM A;  1V1G A;  1B7T Z;  1H8B A;  5I2O A;  4C0J A;  1CMF A;  4YGB B;  3VRR A;  4MLW A;  5AER A;  1YX7 A;  2CCM A;  2WOR A;  1K9K A;  3BQ3 A;  1N0Y A;  5HLV A;  1CMG A;  4ZCV A;  1SRA A;  1EG4 A;  1KK7 Y;  1S6C A;  1XK4 A;  1J7Q A;  4DS7 A;  2IS9 A;  5PAL A;  2AUC A;  2G2B A;  1CDP A;  5I2L A;  3ZNI A;  1YUU A;  1NIW A;  4PDZ A;  1TNQ A;  1JWD A;  1KFX S;  2JUL A;  4TNC A;  5HKZ A;  1QIV A;  1S3P A;  1DVI A;  2MRD A;  3RLZ A;  3PLF B;  2R2I A;  4DIR A;  1TCF A;  5IBW A;  1SK6 D;  1HT9 A;  1A03 A;  3SG4 A;  4JWQ A;  2ZKM X;  2LVK A;  1XFW O;  2Y1M A;  4CFR A;  2JOJ A;  4DRW A;  1R2U A;  1TNW A;  1UP5 A;  4Q04 A;  2BKH B;  4ETO A;  1QLS A;  3BYA A;  1M39 A;  1DTL A;  2L2E A;  4PCW A;  3UO9 A;  3SIB A;  3NSO A;  2BBM A;  1QVI Y;  2M3W A;  3EKJ A;  5DKQ A;  5AEQ A;  1FF1 A;  2M1U A;  3AAK A;  3PFV A;  1VRK A;  2F2O A;  2YGU A;  3CWG A;  2LVJ A;  3D0Y B;  2L98 A;  1S26 D;  3FWB A;  1YRT B;  3SJS A;  3WHT B;  2DOQ A;  2TN4 A;  1B1G A;  3IQQ A;  1RK9 A;  3TZ1 A;  3PN7 C;  1S6J A;  2ZRT A;  1HQV A;  4OKH A;  1LVC D;  1K2H A;  5I2Q A;  1DJG A;  1N65 A;  1MXL C;  1UUR A;  2JT0 A;  1MXE A;  3I5I C;  4FQO A;  4U8D A;  1KFX L;  2LVI A;  1YUS A;  1A4P A;  4MZK A;  1WDC C;  4PHJ A;  2I7A A;  2LAN A;  1YR5 A;  2LC5 A;  2LLT A;  3AKA A;  1EL4 A;  3PAL A;  2WND A;  1JFJ A;  1RJV A;  1QS7 A;  1J55 A;  2MBX A;  2P6B B;  3GOF A;  1JF2 A;  2KAY A;  1DT7 B;  2ZN8 A;  2KFH A;  2Y1N A;  2V53 A;  1JFK A;  3D0Y A;  1F55 A;  5HL1 A;  4AOM A;  1F4Q A;  3I5F C;  1QX7 A;  1YUT A;  3PN7 B;  1DC1 A;  2L50 A;  3ICB A;  3F45 A;  1BR4 B;  2K2A A;  2LP3 A;  2ISD A;  1CFP A;  5DKR A;  3I5I B;  1CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...