4I5JA

Pp2a pr70 holoenzyme
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
total genus 106
structure length 266
sequence length 272
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5jA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5jA01
1YUUA 3JVTC 3MSEB 3SG5A 5HKYA 1TNPA 3IQQA 4CFRA 3CLNA 4QJ3B 1AP4A 5HLVA 1RROA 2JULA 2LAPA 4MZJA 2JT8A 2ZKMX 1SW8A 1DJZA 4GGFC 1DJXA 1PVBA 2AMIA 1BMOA 1TRFA 2JT0A 2GGMA 1DGVA 1DMOA 2M1UA 4NDCA 1KQMB 1C7VA 1DJWA 3TS5B 1WRLA 3LL8B 2LLSA 2KAXA 1ZMZA 2I7AA 2NCOA 1EXRA 1NX1A 2PALA 2PSRA 1AVSA 2COLB 1GGWA 1QV0A 1QX5B 1AHRA 3A8RA 3I5FB 4HRHA 3PALA 4AQIA 3PLFB 2JRFA 4YGAA 5ER5A 3NXAA 3RM1A 1QLKA 2FJUB 1KSMA 1K9KA 1L2OC 1KK8C 3BOWB 2L50A 1N0YA 1N65A 1KQMC 3TS5C 1F8HA 1MHOA 1YX8A 1F4QA 2KI4C 1WY9A 4CPVA 3I5GC 4FTGA 3DF0B 4OCIA 1CDPA 2IS9A 1E8AA 3EVUA 2KBIA 2CNPA 1EG3A 2K0JA 3BUWB 3ICBA 2K8MB 1XO5A 1KWOB 4C0JA 2LVKA 3GK4X 1KK7Z 4ZCUA 1FW4A 3PN7B 2LMVA 3VROA 3D0YA 3KEVA 1CLLA 1JFJA 3CTNA 1ALWA 4QJ4B 2BCXA 2KI4B 5ER4X 5KU1A 2JU0A 1PSRA 1KSOA 1LVCD 5JJGA 5I2LA 1B8CA 1CKKA 2RGIA 1IGVA 1GQMA 1A75B 1WRZA 3VGOA 1CB1A 2HQ8A 1YURA 2WOSA 1CMFA 2KBMA 5HKWA 1KK7Y 2EC6B 1NX3A 4XJKA 1H4BA 3VRRA 1OZOA 4C0LA 2MAZA 3NSIA 1M46A 3IF7A 2ZRTA 4I5JA 3FWBA 1N2DA 3CR2A 5CSJA 1XK4A 1DTLA 1NUBA 3M0WA 5AANA 3C1VA 4GGFA 3JVTB 1YRUB 2PVBA 1BR4B 1YVLA 1K9UA 4D1EA 2Q4UA 4BY4A 3WNXB 3DVEA 1IH0A 1LKJA 2KHNA 1JFKA 2ZN8A 2K2AA 2K61A 2F3YA 4PE4A 5G08A 1CFPA 1QTXA 3CS1A 3EK4A 2Q91A 5D69A 2M97A 1NCZA 2NLNA 2V53A 4A4CA 2R2IA 2FOTA 3OB2B 1TN4A 1YUTA 1EH2A 2Y4QA 3KF9A 1XFVO 2O60A 1F70A 1CFDA 3DVMA 1F54A 1B4CA 1UWOA 1TNQA 1S36A 2E6WA 1JSAA 1NX0A 2M7LA 1FPWA 3JTDB 4GAOA 1PVAA 1IKUA 1J7OA 2WNDA 1DJIA 1HT9A 1S6IA 2NCPA 1KCYA 2G9BA 1PRWA 3GK2A 1C7WA 2E30A 3OX5A 1K8UA 4PALA 4I5KA 5IBWA 1K96A 3O78A 1NPQA 1UUSA 1XFYO 1XFXO 1TIZA 3O6BA 4ICBA 2JTTA 1NP8A 1QVIZ 4YI9A 3SIAA 1SCMC 1TCFA 1SK6D 4DCKA 4N1FA 1MWNA 5KSZA 1UP5A 2OTGC 1CM4A 1KWOC 1SY9A 4IL1A 2P6BB 2AAOA 1M45A 1VRKA 2SASA 2H61C 5I2OA 2JTZA 3F45A 4OR9B 1AJ4A 1PULA 1FI6A 1J7QA 1K94A 2I18A 1OMDA 2LE9B 1B8RA 2L98A 1S26D 4DUQA 1TTXA 4HSZA 3EK7A 5GQQC 1CDLA 4WQ2A 2BL0B 4MBEA 4GFTA 1GGZA 2KAVA 1XK4C 1IJ5A 3AAKA 2K7DA 3I5IB 4MEWA 2KI6C 1CTRA 1SL9A 2F33A 1TOPA 1OE9B 1J1EA 2WORA 5I2QA 1V1GA 2CXJA 1Y1XA 1ZOTB 1LA0A 2D8NA 3AAJA 3EK8A 3VRNA 2B1UA 2LP2A 4ORAB 2F8PA 1SCVA 1EG4A 2CBLA 1IJ6A 4PCWA 3CZTX 3TDUA 3KHEA 2BKHB 2WCFA 1B7TY 3LLEA 1U5IA 4UPGA 4JWQA 3AKBA 2LCPA 4JQ0D 1U5IB 3DVKA 2FCDA 1K95A 1R2UA 1IG5A 2LMUA 4NQGA 1SR6B 2M9GA 1BR1B 2OS8C 2TN4A 3EKHA 4NDBA 1QV1A 2LVJA 4GPLB 4CFQA 1AUIB 4PHJA 5KTYA 1KQVA 2HPSA 1J1DA 1CFFA 4HRGA 1S5GY 4TNCA 4DIRA 2BE6A 4YGCB 1KFXL 2MHHA 4PHNA 4AOMA 4USLA 1JBAA 3PN7C 1QVIY 2LHLA 2HF5A 2K7BA 1K93D 3OX6A 4YGBB 1R6PA 2BKIB 3CR4X 1A2XA 3JTDC 4M2QA 3SG2A 3VRQA 5TNCA 1CNPA 1LXFC 2PMYA 2L4HA 2KI6D 1MR8A 2JOJA 2LV7A 3WXAA 1CLBA 1NCXA 1K2HA 2JT3A 2M49B 2JQ6A 1YTZC 2ZNDA 4CIDA 2H61A 3BUNB 2I94A 1L2OB 1BT6A 1SYMA 5BPJA 3DF0A 1KK8B 1OSAA 2JWWA 3SG4A 3A4UB 4WRIA 4MRYA 2MBXA 1SR6C 1XFUO 2LP3A 3I5GB 2CCMA 2K7CA 2KYCA 2H2KA 4U8DA 3WHTB 1K90D 4XYNA 1AJ5A 2L51A 1X02A 2QPTA 1F55A 1HQVA 4CLNA 1SBJA 3TUYB 5JOLA 2K7OA 1NCYA 4L9MA 1RWYA 1Y6WA 2MLEC 1MUXA 2JPTA 1CDNA 1ODBA 3IQOA 4OV2A 2L5XB 3HCMA 1D1OA 2FCEA 1BF5A 1OOJA 4YI8A 2ZRSA 1F71A 1W7IB 2L0PA 1BJFA 3NSOA 1QS7A 2MA2A 2OPOA 1M31A 3OP0A 4GGNA 1L7ZA 1QIVA 1W7JB 1OZSA 2LHIA 1DT7B 1BODA 2KFFA 1WRKA 1IQ3A 3VRPA 3TUYC 1NSHA 3LK1A 2MRDA 3WHUB 1LA3A 1PALA 2SCPA 1S5GZ 3BUOB 1C07A 2BCBA 3BXKA 3LCPC 3O2PA 4AQJA 1GJYA 1M63B 1KFUL 1CM1A 1PK0D 3ZWHA 4HREE 1BLQA 3FWCA 2F2OA 3SG6A 1SRAA 4PE1A 3DVJA 2M0RA 2LANA 2LMTA 3OB1B 1WDCC 3E3RA 1UHKA 3QRXA 1DGUA 3D0YB 1XFZO 2JXLA 2G2BA 4QJ5B 1A4PA 1KFXS 2KDHA 2M3WA 1UHIA 2ZFDA 1EL4A 2F3ZA 5CPVA 1QATA 2KQYA 3GOFA 5F6TA 1A75A 2Y1NA 4GNKB 5B8IB 3K21A 1JF2A 1WLMA 4YGEB 5K89A 4BY5A 1JUOA 4NDDA 1ZFSA 4YGDB 5DKQA 4M2OA 4ZCVA 3D10A 3OHMB 1SL7A 1UHNA 4N5XA 1S6CA 3BYAA 3ZNIA 1Y0VH 1CDMA 1MXEA 4YRUA 1JWDA 2CT9A 5I8NA 3CGAA 4A4BA 2LUXA 3BQ3A 3DD4A 3I5IC 4PE7A 1FF1A 1QXPA 1TNXA 4MVFA 1A03A 1JC2A 2NXQA 3SG3A 1UHJA 3NSKA 1XVJA 5AEQA 1YVHA 1XA5A 3PATA 2KSPA 2LC5A 2ZN9A 2LVIA 1NWDA 3HX4A 3BUMB 5HKZA 3BOWA 1V1FA 4MZLA 2WCEA 1B8LA 5AERA 1Y1AA 2LM5A 3O4YA 2OTGB 3PFVA 1QIWA 2BBNA 4MSPA 1OMVA 1S3PA 1ZUZA 1DF0B 2JXCA 1SKTA 3EKJA 4ORBB 3SG7A 4ETOA 2JNFA 3I5HB 1FI5A 2EHBA 2JC2A 4C0KA 5CSIA 2VRGA 4M2PA 1RFJA 2BE4A 1F4OA 1OQPA 1QX2A 2AUCA 2Y1MA 1A29A 1ALVA 2BCAA 3BUXB 4MZKA 1DVIA 4OKHA 4XJKB 2KFHA 4FQOA 3GK1A 5FYXA 2OS8B 2BL0C 2K2FA 1EJ3A 2LVVA 2KQ6A 2GV5A 5D7FA 2HQWA 5J3XA 1NX2A 1OMRA 2BECA 2KAYA 2LLUA 3TZ1A 1KFUS 1Q80A 1AK8A 2KFGA 1PSBA 3H4SE 2KNEA 2NZ0A 4I5NB 1QX7A 1WDCB 1B9AA 2LUCA 4I5LB 1B1GA 1SCMB 4MN0A 4PHMA 3EVVA 2I2RE 4OVNF 1BG1A 2M29A 5DKRA 2EC6C 4E68A 2ZNEA 1H8BA 1J55A 1RTP1 1RECA 3SIBA 4JPZB 2JNXA 4GBAA 2LNKA 1UHHA 4MLWA 1SPYA 1S1EA 1XFWO 4DS7A 1DF0A 3NSLA 2F2PA 1YRTB 2WC8A 1NIWA 4PDZA 3I5FC 5HYDA 4N1GA 4MRXA 1YX7A 1IRJA 1DJHA 4P2YB 5AFPA 1LINA 1K9PA 1DJYA 2BBMA 2WCBA 4ORCB 1B7TZ 1G33A 3EVRA 1TNWA 2PRUA 1FBVA 1BOCA 1QLSA 1G8IA 3PM8A 2Y5IA 1SMGA 2QACA 2ISDA 1MXLC 1Y1UA 5DKNA 2M1KB 3CWGA 3CR5X 3TDZA 3AKAA 1QASA 2L4IA 1QJTA 4PHKA 2JZIA 3SJSA 1YUSA 1UURA 2KGRA 1S6JA 2KYFA 2LLTA 1CFCA 2DOQA 5PALA 2O5GA 1B47A 3LK0A 1M39A 1ZACA 3KO0A 4YBHB 2MLFC 1NYAA 4F0ZB 3I5HC 1RJVA 1RK9A 3PSRA 2EGDA 5AXIA 1JF0A 3RLZA 4DRWA 2GGZA 3FIAA 2M7NA 3KPXA 2KGBC 1IWQA 5CSFA 1IQ5A 3FS7A 1TCOB 2M8UA 2A4JA 1XYDA 2PASA 1SL8A 5HLOA 1G4YR 2KOTA 1CLMA 1SNLA 4P5OE 4PE0A 3TDIA 1CMGA 1MF8B 4GUKA 2MJWB 1WLZA 4WQ3A 1YR5A 1BU3A 1J7RA 1DJGA 2CTNA 4R1EA 5CSNA 1J7PA 2L2EA 2HETA 1MQ1A 4Q04A
chains in the Genus database with same CATH superfamily
1YUUA 3JVTC 3MSEB 3SG5A 2PYQA 5HKYA 1TNPA 3IQQA 4JD9A 4CFRA 3CLNA 4QJ3B 1AP4A 5HLVA 1RROA 2JULA 2LAPA 4MZJA 2JT8A 5HL1A 2ZKMX 1SW8A 1DJZA 3O4XA 4GGFC 1DJXA 1PVBA 2AMIA 2QEBA 1BMOA 1TRFA 2JT0A 2GGMA 3OBVA 1DGVA 1DMOA 2M1UA 4NDCA 1KQMB 1C7VA 3SS3A 1DJWA 3TS5B 1WRLA 3LL8B 2LLSA 2KAXA 1ZMZA 2QDIA 2I7AA 1DQEA 2NCOA 1EXRA 1NX1A 2PALA 2PSRA 3FE6A 1AVSA 2COLB 1GGWA 1QV0A 1QX5B 1AHRA 3A8RA 3I5FB 4HRHA 3PALA 4AQIA 3PLFB 2JRFA 4PT1A 4YGAA 5ER5A 3NXAA 3RM1A 1QLKA 2FJUB 1KSMA 1K9KA 1L2OC 1KK8C 3BOWB 2L50A 1N0YA 1N65A 1KQMC 3TS5C 1F8HA 1MHOA 1YX8A 1F4QA 3Q8IA 2KI4C 1WY9A 4CPVA 3I5GC 4FTGA 3DF0B 4OCIA 1CDPA 2IS9A 1E8AA 3EVUA 2KBIA 2CNPA 1EG3A 2K0JA 4KYNA 3BUWB 3ICBA 2K8MB 3QMEA 1XO5A 1KWOB 4C0JA 2LVKA 3EG5B 3GK4X 1KK7Z 4ZCUA 1FW4A 3PN7B 2LMVA 3VROA 3D0YA 3KEVA 1CLLA 3FE8A 5DICA 1JFJA 3CTNA 3B86A 1ALWA 4QJ4B 2BCXA 2KI4B 5ER4X 5KU1A 3S0DA 2JU0A 2L5YA 1PSRA 1KSOA 1LVCD 5JJGA 5I2LA 3CABA 1B8CA 1CKKA 2RGIA 1IGVA 1GQMA 1A75B 1WRZA 3VGOA 1CB1A 2HQ8A 1YURA 2WOSA 1CMFA 2KBMA 5HKWA 1KK7Y 2EC6B 3L4AA 1NX3A 4XJKA 1H4BA 3VRRA 1OZOA 2FJYA 4C0LA 2MAZA 3NSIA 1M46A 3IF7A 2ZRTA 4I5JA 3FWBA 1N2DA 3CR2A 5CSJA 1XK4A 1DTLA 3DY9A 1NUBA 3M0WA 5AANA 3C1VA 4GGFA 3JVTB 1YRUB 2PVBA 1BR4B 1DELA 1YVLA 1C3ZA 1K9UA 2Q4UA 4BY4A 4D1EA 3WNXB 3DVEA 1IH0A 1LKJA 2KHNA 1C3YA 1W9ZA 1JFKA 2ZN8A 2K2AA 2K61A 2F3YA 4PE4A 5G08A 3UO9A 1CFPA 3NGVA 1QTXA 3CS1A 3EK4A 2Q91A 5D69A 2M97A 1NCZA 2NLNA 2V53A 3BFBA 4A4CA 2R2IA 2YGUA 2FOTA 3OB2B 1TN4A 1TUZA 1YUTA 1EH2A 2Y4QA 3KF9A 2JPOA 1XFVO 2O60A 5I94A 1F70A 1CFDA 3RZSA 3D78A 3DVMA 1F54A 1B4CA 1UWOA 1TNQA 1S36A 2E6WA 1JSAA 1NX0A 2M7LA 1FPWA 1ORGA 3JTDB 4GAOA 1PVAA 1IKUA 1J7OA 2WNDA 1DJIA 1HT9A 1S6IA 2NCPA 1KCYA 2G9BA 1PRWA 3BFAA 3GK2A 1C7WA 2E30A 3OX5A 1K8UA 4PALA 4I5KA 5IBWA 1K96A 3O78A 1NPQA 1UUSA 1XFYO 1XFXO 1TIZA 3O6BA 4ICBA 2JTTA 1NP8A 1QVIZ 3CZ0A 4YI9A 3D75A 3SIAA 1SCMC 1TCFA 1SK6D 4DCKA 4N1FA 1MWNA 5KSZA 2KLDA 1UP5A 2OTGC 1CM4A 1KWOC 3CDNA 1SY9A 4IL1A 2P6BB 2WC5A 1OOGA 2AAOA 1M45A 1VRKA 2SASA 2H61C 3BFHA 2JTZA 3S0EA 3F45A 5I2OA 4OR9B 1AJ4A 1PULA 1FI6A 1J7QA 1K94A 2I18A 1OMDA 2LE9B 1B8RA 2L98A 1S26D 4DUQA 1TTXA 4HSZA 3EK7A 5GQQC 1CDLA 4WQ2A 2BL0B 4MBEA 4GFTA 1GGZA 4INWA 2KAVA 1XK4C 1IJ5A 3AAKA 2K7DA 3I5IB 3SS5A 4MEWA 2KI6C 2WCMA 1CTRA 1SL9A 4OZDA 2F33A 1TOPA 1OE9B 1J1EA 2WORA 5I2QA 1V1GA 2WCLA 2CXJA 1Y1XA 1ZOTB 1LA0A 2D8NA 3AAJA 3EK8A 3PM2A 3VRNA 2B1UA 1IIOA 2LP2A 4ORAB 2F8PA 1SCVA 1EG4A 2CBLA 2P71A 2WC6A 1IJ6A 4PCWA 3CZTX 3TDUA 3KHEA 2BKHB 2WCFA 1B7TY 1OOHA 1QWVA 1U5IA 3LLEA 4UPGA 4JWQA 3AKBA 2LCPA 4JQ0D 2BNXA 1U5IB 4JKTA 3DVKA 2FCDA 1K95A 1R2UA 1IG5A 2LMUA 4NQGA 1Z4HA 2WCKA 1SR6B 2M9GA 1BR1B 2OS8C 2TN4A 3EKHA 4NDBA 1QV1A 2LVJA 4GPLB 4CFQA 1AUIB 4PHJA 5KTYA 1KQVA 2HPSA 1DEKA 1J1DA 1CFFA 4HRGA 1S5GY 4TNCA 4DIRA 2BE6A 2L2CA 4YGCB 1KFXL 2MHHA 4IJ7A 5D3OA 3R72A 4PHNA 4AOMA 4USLA 1JBAA 3PN7C 1QVIY 2LHLA 5FI6A 2HF5A 2K7BA 1K93D 3OX6A 4YGBB 1R6PA 2BKIB 3CR4X 1A2XA 2QEVA 3BJHA 3JTDC 4M2QA 3D77A 3SG2A 3VRQA 5TNCA 3K1EA 1P28A 1CNPA 1LXFC 2PMYA 2L4HA 1OOIX 1MR8A 2JOJA 2KI6D 2LV7A 3WXAA 1CLBA 3PJIA 1NCXA 1K2HA 2JT3A 2M49B 2JQ6A 1YTZC 2ZNDA 3S0GA 4CIDA 2H61A 3BUNB 2I94A 1L2OB 1BT6A 1SYMA 5BPJA 3DF0A 1KK8B 1OSAA 2JWWA 3SG4A 3D76A 3A4UB 4WRIA 4MRYA 2MBXA 1SR6C 1XFUO 2LP3A 3I5GB 2CCMA 2K7CA 3DXLA 2KYCA 2H2KA 4U8DA 3WHTB 1K90D 4XYNA 1AJ5A 2L51A 1X02A 2QPTA 1F55A 1HQVA 1TWOA 1SBJA 3TUYB 5JOLA 4CLNA 2K7OA 1NCYA 4L9MA 1RWYA 1Y6WA 2MLEC 1DC1A 1MUXA 2JPTA 1CDNA 3R1VA 1ODBA 3B87A 3D74A 2L5XB 3HCMA 3IQOA 4OV2A 2FCEA 1BF5A 1D1OA 1OOJA 4YI8A 2ZRSA 1F71A 1W7IB 2L0PA 1BJFA 3NSOA 1QS7A 2MA2A 1T14A 2OPOA 1M31A 3OP0A 4GGNA 1L7ZA 1QIVA 1W7JB 1OZSA 2LHIA 1DT7B 1BODA 2KFFA 1WRKA 1IQ3A 3VRPA 2QEOA 3L47A 5FI7A 1NSHA 3TUYC 3LK1A 2QEHA 2MRDA 3WHUB 5EL2A 1LA3A 1PALA 2SCPA 1S5GZ 3BUOB 1C07A 2BCBA 3BXKA 3LCPC 3O2PA 4AQJA 1GJYA 1M63B 1KFUL 1CM1A 1PK0D 3ZWHA 4HREE 1BLQA 3FWCA 2F2OA 3SG6A 1SRAA 4PE1A 3DVJA 2M0RA 2LANA 2LMTA 3L4LA 3OB1B 1WDCC 3E3RA 1UHKA 3QRXA 1DGUA 3D0YB 1XFZO 2JXLA 2G2BA 3SS4A 4QJ5B 1A4PA 3B6XA 1KFXS 2KDHA 2M3WA 1UHIA 2ZFDA 1EL4A 2F3ZA 5CPVA 1QATA 2KPHA 2KQYA 3GOFA 1A75A 2Y1NA 3N7HA 5F6TA 4F7FA 4GNKB 5B8IB 3K21A 1JF2A 1WLMA 4YGEB 5K89A 4BY5A 1JUOA 4NDDA 1ZFSA 4YGDB 5DKQA 3V2LA 4M2OA 4ZCVA 3D10A 2K60A 3OHMB 1SL7A 1UHNA 4N5XA 1S6CA 3BYAA 3ZNIA 1Y0VH 1CDMA 1MXEA 4YRUA 1JWDA 2CT9A 5I8NA 3CGAA 4A4BA 2LUXA 3BQ3A 3R1PA 3DD4A 3I5IC 4PE7A 1FF1A 1QXPA 1TNXA 4MVFA 1A03A 1JC2A 2NXQA 3SG3A 1UHJA 3NSKA 1XVJA 5AEQA 1YVHA 1XA5A 3PATA 2KSPA 3D73A 2LC5A 2P70A 2ZN9A 2LVIA 1NWDA 3HX4A 3BUMB 5HKZA 3BOWA 1V1FA 4MZLA 3NHIA 2WCEA 2WCJA 1B8LA 5AERA 2H8VA 3DYEA 1Y1AA 2LM5A 4INXA 3O4YA 2OTGB 3PFVA 1QIWA 2BBNA 4MSPA 1OMVA 1S3PA 1ZUZA 1DF0B 2JXCA 1SKTA 3EKJA 4ORBB 3SG7A 4ETOA 2JNFA 3B7AA 3I5HB 1FI5A 2KLEA 2EHBA 4FQTA 2JC2A 4C0KA 5CSIA 2VRGA 4M2PA 1RFJA 2BE4A 1F4OA 1OQPA 1GM0A 1QX2A 2AUCA 2Y1MA 1A29A 1ALVA 2BCAA 3BUXB 4MZKA 1DVIA 4OKHA 4XJKB 2KFHA 1SSEB 3GK1A 4FQOA 2OS8B 2BL0C 2K2FA 1EJ3A 5FYXA 2LVVA 2KQ6A 2GV5A 5D7FA 2HQWA 5J3XA 1NX2A 1OMRA 1LS8A 2BECA 2KAYA 2LLUA 3NHTA 3TZ1A 1KFUS 1Q80A 1AK8A 2KFGA 3CZ2A 1PSBA 3H4SE 2KNEA 2NZ0A 4I5NB 1QX7A 1WDCB 1B9AA 2LUCA 4I5LB 3B88A 1B1GA 1SCMB 4MN0A 4PHMA 3EVVA 2I2RE 4OVNF 1BG1A 2M29A 5DKRA 2EC6C 4E68A 2ZNEA 3UNWA 1H8BA 4DRWA 1J55A 1RTP1 1RECA 3SIBA 4JPZB 2JNXA 2GTEA 3OGNA 2LNKA 1UHHA 4GBAA 4MLWA 1SPYA 1S1EA 1XFWO 3S0FA 4DS7A 1DF0A 3NSLA 2F2PA 1YRTB 2WC8A 1NIWA 4PDZA 3I5FC 5HYDA 4N1GA 4MRXA 1YX7A 1IRJA 1DJHA 4P2YB 3CZ1A 5AFPA 3R1OA 1LINA 1K9PA 1DJYA 2BBMA 2WCBA 3DZTA 4ORCB 2BAPA 1B7TZ 1G33A 2PQLA 1TNWA 3EVRA 2PRUA 1FBVA 1BOCA 1QLSA 1G8IA 3PM8A 2Y5IA 1SMGA 2QACA 5FI2A 2ISDA 1MXLC 1Y1UA 5DKNA 2M1KB 3CWGA 3VB1A 3CR5X 3TDZA 3AKAA 1QASA 2L4IA 1QJTA 4PHKA 2JZIA 3SJSA 1OOFA 1YUSA 1UURA 2KGRA 2WCHA 1S6JA 2KYFA 2LLTA 1CFCA 2DOQA 5PALA 1XFRA 2O5GA 1B47A 3LK0A 1M39A 1ZACA 1Z2CB 3KO0A 3CYZA 4YBHB 2MLFC 1NYAA 4F0ZB 3I5HC 1RJVA 1RK9A 3FE9A 2EGDA 3IVTA 1JF0A 3PSRA 5AXIA 3RLZA 3S0AA 2GGZA 3FIAA 2ERBA 2M7NA 3KPXA 2KGBC 1IWQA 5CSFA 1IQ5A 3FS7A 1TCOB 2M8UA 2A4JA 1XYDA 2PASA 1SL8A 5HLOA 1G4YR 2KOTA 1CLMA 1SNLA 4P5OE 4PE0A 3TDIA 1CMGA 1MF8B 4GUKA 2MJWB 1WLZA 1OW4A 4WQ3A 1TUJA 1YR5A 1BU3A 1J7RA 1DJGA 2CTNA 4R1EA 5CSNA 3S0BA 1J7PA 2L2EA 2HETA 1MQ1A 4Q04A
chains in the Genus database with same CATH topology
1YUUA 3JVTC 3MSEB 3SG5A 5HKYA 1TNPA 3IQQA 4CFRA 3CLNA 4QJ3B 1AP4A 5HLVA 1RROA 2JULA 2LAPA 4MZJA 2JT8A 5HL1A 2ZKMX 1SW8A 1DJZA 3O4XA 4GGFC 1DJXA 1PVBA 2AMIA 1BMOA 1TRFA 2JT0A 2GGMA 3OBVA 1DGVA 1DMOA 2M1UA 4NDCA 1KQMB 1C7VA 3SS3A 1DJWA 3TS5B 1WRLA 3LL8B 2LLSA 2KAXA 1ZMZA 2I7AA 2NCOA 1EXRA 1NX1A 2PALA 2PSRA 1AVSA 2COLB 1GGWA 1QV0A 1QX5B 1AHRA 3A8RA 3I5FB 4HRHA 3PALA 4AQIA 3PLFB 2JRFA 4YGAA 5ER5A 3NXAA 3RM1A 1QLKA 2FJUB 1KSMA 1K9KA 1L2OC 1KK8C 3BOWB 2L50A 1N0YA 1N65A 1KQMC 3TS5C 1F8HA 1MHOA 1YX8A 1F4QA 2KI4C 1WY9A 4CPVA 3I5GC 4FTGA 3DF0B 4OCIA 1CDPA 2IS9A 1E8AA 3EVUA 2KBIA 2CNPA 1EG3A 2K0JA 4KYNA 3BUWB 3ICBA 2K8MB 1XO5A 1KWOB 4C0JA 2LVKA 3EG5B 3GK4X 1KK7Z 4ZCUA 1FW4A 3PN7B 2LMVA 3VROA 3D0YA 3KEVA 1CLLA 1JFJA 3CTNA 1ALWA 4QJ4B 2BCXA 2KI4B 5ER4X 5KU1A 2JU0A 2L5YA 1PSRA 1KSOA 1LVCD 5JJGA 5I2LA 1B8CA 1CKKA 2RGIA 1IGVA 1GQMA 1A75B 1WRZA 3VGOA 1CB1A 2HQ8A 1YURA 2WOSA 1CMFA 2KBMA 5HKWA 1KK7Y 2EC6B 1NX3A 4XJKA 1H4BA 3VRRA 1OZOA 4C0LA 2MAZA 3NSIA 1M46A 3IF7A 2ZRTA 4I5JA 3FWBA 1N2DA 3CR2A 5CSJA 1XK4A 1DTLA 1NUBA 3M0WA 5AANA 3C1VA 4GGFA 3JVTB 1YRUB 2PVBA 1BR4B 1DELA 1YVLA 1K9UA 4D1EA 2Q4UA 4BY4A 3WNXB 3DVEA 1IH0A 1LKJA 2KHNA 1W9ZA 1JFKA 2ZN8A 2K2AA 2K61A 2F3YA 4PE4A 5G08A 1CFPA 3UO9A 1QTXA 3CS1A 3EK4A 2Q91A 5D69A 2M97A 1NCZA 2NLNA 2V53A 4A4CA 2R2IA 2YGUA 2FOTA 3OB2B 1TN4A 1YUTA 1EH2A 2Y4QA 3KF9A 5I94A 1XFVO 2O60A 1F70A 1CFDA 3DVMA 1F54A 1B4CA 1UWOA 1TNQA 1S36A 2E6WA 1JSAA 1NX0A 2M7LA 1FPWA 3JTDB 4GAOA 1PVAA 1IKUA 1J7OA 2WNDA 1DJIA 1HT9A 1S6IA 2NCPA 1KCYA 2G9BA 1PRWA 3GK2A 1C7WA 2E30A 3OX5A 1K8UA 4PALA 4I5KA 5IBWA 1K96A 3O78A 1NPQA 1UUSA 1XFYO 1XFXO 1TIZA 3O6BA 4ICBA 2JTTA 1NP8A 1QVIZ 4YI9A 3SIAA 1SCMC 1TCFA 1SK6D 4DCKA 4N1FA 1MWNA 5KSZA 2KLDA 1UP5A 2OTGC 1CM4A 1KWOC 1SY9A 4IL1A 2P6BB 2AAOA 1M45A 1VRKA 2SASA 2H61C 5I2OA 2JTZA 3F45A 4OR9B 1AJ4A 1PULA 1FI6A 1J7QA 1K94A 2I18A 1OMDA 2LE9B 1B8RA 2L98A 1S26D 4DUQA 1TTXA 4HSZA 3EK7A 5GQQC 1CDLA 4WQ2A 2BL0B 4MBEA 4GFTA 1GGZA 2KAVA 1XK4C 1IJ5A 3AAKA 2K7DA 3I5IB 3SS5A 4MEWA 2KI6C 1CTRA 1SL9A 2F33A 1TOPA 1OE9B 1J1EA 2WORA 5I2QA 1V1GA 3PM2A 2CXJA 1Y1XA 1ZOTB 1LA0A 2D8NA 3AAJA 3EK8A 3VRNA 2B1UA 2LP2A 4ORAB 2F8PA 1SCVA 1EG4A 2CBLA 1IJ6A 4PCWA 3CZTX 3TDUA 3KHEA 2BKHB 2WCFA 1B7TY 3LLEA 1U5IA 4UPGA 4JWQA 3AKBA 2LCPA 4JQ0D 2BNXA 1U5IB 4JKTA 3DVKA 2FCDA 1K95A 1R2UA 1IG5A 2LMUA 4NQGA 1Z4HA 1SR6B 2M9GA 1BR1B 2OS8C 2TN4A 3EKHA 4NDBA 1QV1A 2LVJA 4GPLB 4CFQA 1AUIB 4PHJA 5KTYA 1KQVA 2HPSA 1DEKA 1J1DA 1CFFA 4HRGA 1S5GY 4TNCA 4DIRA 2BE6A 4YGCB 1KFXL 2MHHA 4IJ7A 5D3OA 4PHNA 4AOMA 4USLA 1JBAA 3PN7C 1QVIY 2LHLA 5FI6A 2HF5A 2K7BA 1K93D 3OX6A 4YGBB 1R6PA 2BKIB 3CR4X 1A2XA 3JTDC 4M2QA 3SG2A 3VRQA 5TNCA 1CNPA 1LXFC 2PMYA 2L4HA 2KI6D 1MR8A 2JOJA 2LV7A 3WXAA 1CLBA 1NCXA 1K2HA 2JT3A 2M49B 2JQ6A 1YTZC 2ZNDA 4CIDA 2H61A 3BUNB 2I94A 1L2OB 1BT6A 1SYMA 5BPJA 3DF0A 1KK8B 1OSAA 2JWWA 3SG4A 3A4UB 4WRIA 4MRYA 2MBXA 1SR6C 1XFUO 2LP3A 3I5GB 2CCMA 2K7CA 2KYCA 2H2KA 4U8DA 3WHTB 1K90D 4XYNA 1AJ5A 2L51A 1X02A 2QPTA 1F55A 1HQVA 4CLNA 1SBJA 3TUYB 5JOLA 2K7OA 1NCYA 4L9MA 1RWYA 1Y6WA 2MLEC 1DC1A 1MUXA 2JPTA 1CDNA 1ODBA 3IQOA 4OV2A 2L5XB 3HCMA 1D1OA 2FCEA 1BF5A 1OOJA 4YI8A 2ZRSA 1F71A 1W7IB 2L0PA 1BJFA 3NSOA 1QS7A 2MA2A 2OPOA 1M31A 3OP0A 4GGNA 1L7ZA 1QIVA 1W7JB 1OZSA 2LHIA 1DT7B 1BODA 2KFFA 1WRKA 1IQ3A 3VRPA 3TUYC 5FI7A 1NSHA 3LK1A 2MRDA 3WHUB 1LA3A 1PALA 2SCPA 1S5GZ 3BUOB 1C07A 2BCBA 3BXKA 3LCPC 3O2PA 4AQJA 1GJYA 1M63B 1KFUL 1CM1A 1PK0D 3ZWHA 4HREE 1BLQA 3FWCA 2F2OA 3SG6A 1SRAA 4PE1A 3DVJA 2M0RA 2LANA 2LMTA 3OB1B 1WDCC 3E3RA 1UHKA 3QRXA 1DGUA 3D0YB 1XFZO 2JXLA 2G2BA 4QJ5B 3SS4A 1A4PA 1KFXS 2KDHA 2M3WA 1UHIA 2ZFDA 1EL4A 2F3ZA 5CPVA 1QATA 2KQYA 3GOFA 5F6TA 1A75A 2Y1NA 4GNKB 5B8IB 3K21A 1JF2A 1WLMA 4YGEB 5K89A 4BY5A 1JUOA 4NDDA 1ZFSA 4YGDB 5DKQA 4M2OA 4ZCVA 3D10A 2K60A 3OHMB 1SL7A 1UHNA 4N5XA 1S6CA 3BYAA 3ZNIA 1Y0VH 1CDMA 1MXEA 4YRUA 1JWDA 2CT9A 5I8NA 3CGAA 4A4BA 2LUXA 3BQ3A 3DD4A 3I5IC 4PE7A 1FF1A 1QXPA 1TNXA 4MVFA 1A03A 1JC2A 2NXQA 3SG3A 1UHJA 3NSKA 1XVJA 5AEQA 1YVHA 1XA5A 3PATA 2KSPA 2LC5A 2ZN9A 2LVIA 1NWDA 3HX4A 3BUMB 5HKZA 3BOWA 1V1FA 4MZLA 2WCEA 1B8LA 5AERA 1Y1AA 2LM5A 3O4YA 2OTGB 3PFVA 1QIWA 2BBNA 4MSPA 1OMVA 1S3PA 1ZUZA 1DF0B 2JXCA 1SKTA 3EKJA 4ORBB 3SG7A 4ETOA 2JNFA 3I5HB 1FI5A 2KLEA 2EHBA 2JC2A 4C0KA 5CSIA 2VRGA 4M2PA 1RFJA 2BE4A 1F4OA 1OQPA 1QX2A 2AUCA 2Y1MA 1A29A 1ALVA 2BCAA 3BUXB 4MZKA 1DVIA 4OKHA 4XJKB 2KFHA 4FQOA 3GK1A 5FYXA 2OS8B 2BL0C 2K2FA 1EJ3A 2LVVA 2KQ6A 2GV5A 5D7FA 2HQWA 5J3XA 1NX2A 1OMRA 2BECA 2KAYA 2LLUA 3TZ1A 1KFUS 1Q80A 1AK8A 2KFGA 1PSBA 3H4SE 2KNEA 2NZ0A 4I5NB 1QX7A 1WDCB 1B9AA 2LUCA 4I5LB 1B1GA 1SCMB 4MN0A 4PHMA 3EVVA 2I2RE 4OVNF 1BG1A 2M29A 5DKRA 2EC6C 4E68A 2ZNEA 3UNWA 1H8BA 1J55A 1RTP1 1RECA 3SIBA 4JPZB 2JNXA 4GBAA 2LNKA 1UHHA 4MLWA 1SPYA 1S1EA 1XFWO 4DS7A 1DF0A 3NSLA 2F2PA 1YRTB 2WC8A 1NIWA 4PDZA 3I5FC 5HYDA 4N1GA 4MRXA 1YX7A 1IRJA 1DJHA 4P2YB 5AFPA 1LINA 1K9PA 1DJYA 2BBMA 2WCBA 4ORCB 2BAPA 1B7TZ 1G33A 3EVRA 1TNWA 2PRUA 1FBVA 1BOCA 1QLSA 1G8IA 3PM8A 2Y5IA 1SMGA 2QACA 2ISDA 5FI2A 1MXLC 1Y1UA 5DKNA 2M1KB 3CWGA 3CR5X 3TDZA 3AKAA 1QASA 2L4IA 1QJTA 4PHKA 2JZIA 3SJSA 1YUSA 1UURA 2KGRA 1S6JA 2KYFA 2LLTA 1CFCA 2DOQA 5PALA 2O5GA 1B47A 3LK0A 1M39A 1ZACA 1Z2CB 3KO0A 4YBHB 2MLFC 1NYAA 4F0ZB 3I5HC 1RJVA 1RK9A 3PSRA 2EGDA 5AXIA 1JF0A 3RLZA 4DRWA 3IVTA 2GGZA 3FIAA 2M7NA 3KPXA 2KGBC 1IWQA 5CSFA 1IQ5A 3FS7A 1TCOB 2M8UA 2A4JA 1XYDA 2PASA 1SL8A 5HLOA 1G4YR 2KOTA 1CLMA 1SNLA 4P5OE 4PE0A 3TDIA 1CMGA 1MF8B 4GUKA 2MJWB 1WLZA 4WQ3A 1YR5A 1BU3A 1J7RA 1DJGA 2CTNA 4R1EA 5CSNA 1J7PA 2L2EA 2HETA 1MQ1A 4Q04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  3JVT C;  3MSE B;  3SG5 A;  5HKY A;  1TNP A;  3IQQ A;  4CFR A;  3CLN A;  4QJ3 B;  1AP4 A;  5HLV A;  1RRO A;  2JUL A;  2LAP A;  4MZJ A;  2JT8 A;  2ZKM X;  1SW8 A;  1DJZ A;  4GGF C;  1DJX A;  1PVB A;  2AMI A;  1BMO A;  1TRF A;  2JT0 A;  2GGM A;  1DGV A;  1DMO A;  2M1U A;  4NDC A;  1KQM B;  1C7V A;  1DJW A;  3TS5 B;  1WRL A;  3LL8 B;  2LLS A;  2KAX A;  1ZMZ A;  2I7A A;  2NCO A;  1EXR A;  1NX1 A;  2PAL A;  2PSR A;  1AVS A;  2COL B;  1GGW A;  1QV0 A;  1QX5 B;  1AHR A;  3A8R A;  3I5F B;  4HRH A;  3PAL A;  4AQI A;  3PLF B;  2JRF A;  4YGA A;  5ER5 A;  3NXA A;  3RM1 A;  1QLK A;  2FJU B;  1KSM A;  1K9K A;  1L2O C;  1KK8 C;  3BOW B;  2L50 A;  1N0Y A;  1N65 A;  1KQM C;  3TS5 C;  1F8H A;  1MHO A;  1YX8 A;  1F4Q A;  2KI4 C;  1WY9 A;  4CPV A;  3I5G C;  4FTG A;  3DF0 B;  4OCI A;  1CDP A;  2IS9 A;  1E8A A;  3EVU A;  2KBI A;  2CNP A;  1EG3 A;  2K0J A;  3BUW B;  3ICB A;  2K8M B;  1XO5 A;  1KWO B;  4C0J A;  2LVK A;  3GK4 X;  1KK7 Z;  4ZCU A;  1FW4 A;  3PN7 B;  2LMV A;  3VRO A;  3D0Y A;  3KEV A;  1CLL A;  1JFJ A;  3CTN A;  1ALW A;  4QJ4 B;  2BCX A;  2KI4 B;  5ER4 X;  5KU1 A;  2JU0 A;  1PSR A;  1KSO A;  1LVC D;  5JJG A;  5I2L A;  1B8C A;  1CKK A;  2RGI A;  1IGV A;  1GQM A;  1A75 B;  1WRZ A;  3VGO A;  1CB1 A;  2HQ8 A;  1YUR A;  2WOS A;  1CMF A;  2KBM A;  5HKW A;  1KK7 Y;  2EC6 B;  1NX3 A;  4XJK A;  1H4B A;  3VRR A;  1OZO A;  4C0L A;  2MAZ A;  3NSI A;  1M46 A;  3IF7 A;  2ZRT A;  4I5J A;  3FWB A;  1N2D A;  3CR2 A;  5CSJ A;  1XK4 A;  1DTL A;  1NUB A;  3M0W A;  5AAN A;  3C1V A;  4GGF A;  3JVT B;  1YRU B;  2PVB A;  1BR4 B;  1YVL A;  1K9U A;  4D1E A;  2Q4U A;  4BY4 A;  3WNX B;  3DVE A;  1IH0 A;  1LKJ A;  2KHN A;  1JFK A;  2ZN8 A;  2K2A A;  2K61 A;  2F3Y A;  4PE4 A;  5G08 A;  1CFP A;  1QTX A;  3CS1 A;  3EK4 A;  2Q91 A;  5D69 A;  2M97 A;  1NCZ A;  2NLN A;  2V53 A;  4A4C A;  2R2I A;  2FOT A;  3OB2 B;  1TN4 A;  1YUT A;  1EH2 A;  2Y4Q A;  3KF9 A;  1XFV O;  2O60 A;  1F70 A;  1CFD A;  3DVM A;  1F54 A;  1B4C A;  1UWO A;  1TNQ A;  1S36 A;  2E6W A;  1JSA A;  1NX0 A;  2M7L A;  1FPW A;  3JTD B;  4GAO A;  1PVA A;  1IKU A;  1J7O A;  2WND A;  1DJI A;  1HT9 A;  1S6I A;  2NCP A;  1KCY A;  2G9B A;  1PRW A;  3GK2 A;  1C7W A;  2E30 A;  3OX5 A;  1K8U A;  4PAL A;  4I5K A;  5IBW A;  1K96 A;  3O78 A;  1NPQ A;  1UUS A;  1XFY O;  1XFX O;  1TIZ A;  3O6B A;  4ICB A;  2JTT A;  1NP8 A;  1QVI Z;  4YI9 A;  3SIA A;  1SCM C;  1TCF A;  1SK6 D;  4DCK A;  4N1F A;  1MWN A;  5KSZ A;  1UP5 A;  2OTG C;  1CM4 A;  1KWO C;  1SY9 A;  4IL1 A;  2P6B B;  2AAO A;  1M45 A;  1VRK A;  2SAS A;  2H61 C;  5I2O A;  2JTZ A;  3F45 A;  4OR9 B;  1AJ4 A;  1PUL A;  1FI6 A;  1J7Q A;  1K94 A;  2I18 A;  1OMD A;  2LE9 B;  1B8R A;  2L98 A;  1S26 D;  4DUQ A;  1TTX A;  4HSZ A;  3EK7 A;  5GQQ C;  1CDL A;  4WQ2 A;  2BL0 B;  4MBE A;  4GFT A;  1GGZ A;  2KAV A;  1XK4 C;  1IJ5 A;  3AAK A;  2K7D A;  3I5I B;  4MEW A;  2KI6 C;  1CTR A;  1SL9 A;  2F33 A;  1TOP A;  1OE9 B;  1J1E A;  2WOR A;  5I2Q A;  1V1G A;  2CXJ A;  1Y1X A;  1ZOT B;  1LA0 A;  2D8N A;  3AAJ A;  3EK8 A;  3VRN A;  2B1U A;  2LP2 A;  4ORA B;  2F8P A;  1SCV A;  1EG4 A;  2CBL A;  1IJ6 A;  4PCW A;  3CZT X;  3TDU A;  3KHE A;  2BKH B;  2WCF A;  1B7T Y;  3LLE A;  1U5I A;  4UPG A;  4JWQ A;  3AKB A;  2LCP A;  4JQ0 D;  1U5I B;  3DVK A;  2FCD A;  1K95 A;  1R2U A;  1IG5 A;  2LMU A;  4NQG A;  1SR6 B;  2M9G A;  1BR1 B;  2OS8 C;  2TN4 A;  3EKH A;  4NDB A;  1QV1 A;  2LVJ A;  4GPL B;  4CFQ A;  1AUI B;  4PHJ A;  5KTY A;  1KQV A;  2HPS A;  1J1D A;  1CFF A;  4HRG A;  1S5G Y;  4TNC A;  4DIR A;  2BE6 A;  4YGC B;  1KFX L;  2MHH A;  4PHN A;  4AOM A;  4USL A;  1JBA A;  3PN7 C;  1QVI Y;  2LHL A;  2HF5 A;  2K7B A;  1K93 D;  3OX6 A;  4YGB B;  1R6P A;  2BKI B;  3CR4 X;  1A2X A;  3JTD C;  4M2Q A;  3SG2 A;  3VRQ A;  5TNC A;  1CNP A;  1LXF C;  2PMY A;  2L4H A;  2KI6 D;  1MR8 A;  2JOJ A;  2LV7 A;  3WXA A;  1CLB A;  1NCX A;  1K2H A;  2JT3 A;  2M49 B;  2JQ6 A;  1YTZ C;  2ZND A;  4CID A;  2H61 A;  3BUN B;  2I94 A;  1L2O B;  1BT6 A;  1SYM A;  5BPJ A;  3DF0 A;  1KK8 B;  1OSA A;  2JWW A;  3SG4 A;  3A4U B;  4WRI A;  4MRY A;  2MBX A;  1SR6 C;  1XFU O;  2LP3 A;  3I5G B;  2CCM A;  2K7C A;  2KYC A;  2H2K A;  4U8D A;  3WHT B;  1K90 D;  4XYN A;  1AJ5 A;  2L51 A;  1X02 A;  2QPT A;  1F55 A;  1HQV A;  4CLN A;  1SBJ A;  3TUY B;  5JOL A;  2K7O A;  1NCY A;  4L9M A;  1RWY A;  1Y6W A;  2MLE C;  1MUX A;  2JPT A;  1CDN A;  1ODB A;  3IQO A;  4OV2 A;  2L5X B;  3HCM A;  1D1O A;  2FCE A;  1BF5 A;  1OOJ A;  4YI8 A;  2ZRS A;  1F71 A;  1W7I B;  2L0P A;  1BJF A;  3NSO A;  1QS7 A;  2MA2 A;  2OPO A;  1M31 A;  3OP0 A;  4GGN A;  1L7Z A;  1QIV A;  1W7J B;  1OZS A;  2LHI A;  1DT7 B;  1BOD A;  2KFF A;  1WRK A;  1IQ3 A;  3VRP A;  3TUY C;  1NSH A;  3LK1 A;  2MRD A;  3WHU B;  1LA3 A;  1PAL A;  2SCP A;  1S5G Z;  3BUO B;  1C07 A;  2BCB A;  3BXK A;  3LCP C;  3O2P A;  4AQJ A;  1GJY A;  1M63 B;  1KFU L;  1CM1 A;  1PK0 D;  3ZWH A;  4HRE E;  1BLQ A;  3FWC A;  2F2O A;  3SG6 A;  1SRA A;  4PE1 A;  3DVJ A;  2M0R A;  2LAN A;  2LMT A;  3OB1 B;  1WDC C;  3E3R A;  1UHK A;  3QRX A;  1DGU A;  3D0Y B;  1XFZ O;  2JXL A;  2G2B A;  4QJ5 B;  1A4P A;  1KFX S;  2KDH A;  2M3W A;  1UHI A;  2ZFD A;  1EL4 A;  2F3Z A;  5CPV A;  1QAT A;  2KQY A;  3GOF A;  5F6T A;  1A75 A;  2Y1N A;  4GNK B;  5B8I B;  3K21 A;  1JF2 A;  1WLM A;  4YGE B;  5K89 A;  4BY5 A;  1JUO A;  4NDD A;  1ZFS A;  4YGD B;  5DKQ A;  4M2O A;  4ZCV A;  3D10 A;  3OHM B;  1SL7 A;  1UHN A;  4N5X A;  1S6C A;  3BYA A;  3ZNI A;  1Y0V H;  1CDM A;  1MXE A;  4YRU A;  1JWD A;  2CT9 A;  5I8N A;  3CGA A;  4A4B A;  2LUX A;  3BQ3 A;  3DD4 A;  3I5I C;  4PE7 A;  1FF1 A;  1QXP A;  1TNX A;  4MVF A;  1A03 A;  1JC2 A;  2NXQ A;  3SG3 A;  1UHJ A;  3NSK A;  1XVJ A;  5AEQ A;  1YVH A;  1XA5 A;  3PAT A;  2KSP A;  2LC5 A;  2ZN9 A;  2LVI A;  1NWD A;  3HX4 A;  3BUM B;  5HKZ A;  3BOW A;  1V1F A;  4MZL A;  2WCE A;  1B8L A;  5AER A;  1Y1A A;  2LM5 A;  3O4Y A;  2OTG B;  3PFV A;  1QIW A;  2BBN A;  4MSP A;  1OMV A;  1S3P A;  1ZUZ A;  1DF0 B;  2JXC A;  1SKT A;  3EKJ A;  4ORB B;  3SG7 A;  4ETO A;  2JNF A;  3I5H B;  1FI5 A;  2EHB A;  2JC2 A;  4C0K A;  5CSI A;  2VRG A;  4M2P A;  1RFJ A;  2BE4 A;  1F4O A;  1OQP A;  1QX2 A;  2AUC A;  2Y1M A;  1A29 A;  1ALV A;  2BCA A;  3BUX B;  4MZK A;  1DVI A;  4OKH A;  4XJK B;  2KFH A;  4FQO A;  3GK1 A;  5FYX A;  2OS8 B;  2BL0 C;  2K2F A;  1EJ3 A;  2LVV A;  2KQ6 A;  2GV5 A;  5D7F A;  2HQW A;  5J3X A;  1NX2 A;  1OMR A;  2BEC A;  2KAY A;  2LLU A;  3TZ1 A;  1KFU S;  1Q80 A;  1AK8 A;  2KFG A;  1PSB A;  3H4S E;  2KNE A;  2NZ0 A;  4I5N B;  1QX7 A;  1WDC B;  1B9A A;  2LUC A;  4I5L B;  1B1G A;  1SCM B;  4MN0 A;  4PHM A;  3EVV A;  2I2R E;  4OVN F;  1BG1 A;  2M29 A;  5DKR A;  2EC6 C;  4E68 A;  2ZNE A;  1H8B A;  1J55 A;  1RTP 1;  1REC A;  3SIB A;  4JPZ B;  2JNX A;  4GBA A;  2LNK A;  1UHH A;  4MLW A;  1SPY A;  1S1E A;  1XFW O;  4DS7 A;  1DF0 A;  3NSL A;  2F2P A;  1YRT B;  2WC8 A;  1NIW A;  4PDZ A;  3I5F C;  5HYD A;  4N1G A;  4MRX A;  1YX7 A;  1IRJ A;  1DJH A;  4P2Y B;  5AFP A;  1LIN A;  1K9P A;  1DJY A;  2BBM A;  2WCB A;  4ORC B;  1B7T Z;  1G33 A;  3EVR A;  1TNW A;  2PRU A;  1FBV A;  1BOC A;  1QLS A;  1G8I A;  3PM8 A;  2Y5I A;  1SMG A;  2QAC A;  2ISD A;  1MXL C;  1Y1U A;  5DKN A;  2M1K B;  3CWG A;  3CR5 X;  3TDZ A;  3AKA A;  1QAS A;  2L4I A;  1QJT A;  4PHK A;  2JZI A;  3SJS A;  1YUS A;  1UUR A;  2KGR A;  1S6J A;  2KYF A;  2LLT A;  1CFC A;  2DOQ A;  5PAL A;  2O5G A;  1B47 A;  3LK0 A;  1M39 A;  1ZAC A;  3KO0 A;  4YBH B;  2MLF C;  1NYA A;  4F0Z B;  3I5H C;  1RJV A;  1RK9 A;  3PSR A;  2EGD A;  5AXI A;  1JF0 A;  3RLZ A;  4DRW A;  2GGZ A;  3FIA A;  2M7N A;  3KPX A;  2KGB C;  1IWQ A;  5CSF A;  1IQ5 A;  3FS7 A;  1TCO B;  2M8U A;  2A4J A;  1XYD A;  2PAS A;  1SL8 A;  5HLO A;  1G4Y R;  2KOT A;  1CLM A;  1SNL A;  4P5O E;  4PE0 A;  3TDI A;  1CMG A;  1MF8 B;  4GUK A;  2MJW B;  1WLZ A;  4WQ3 A;  1YR5 A;  1BU3 A;  1J7R A;  1DJG A;  2CTN A;  4R1E A;  5CSN A;  1J7P A;  2L2E A;  2HET A;  1MQ1 A;  4Q04 A; 
#chains in the Genus database with same CATH topology
 1YUU A;  3JVT C;  3MSE B;  3SG5 A;  2PYQ A;  5HKY A;  1TNP A;  3IQQ A;  4JD9 A;  4CFR A;  3CLN A;  4QJ3 B;  1AP4 A;  5HLV A;  1RRO A;  2JUL A;  2LAP A;  4MZJ A;  2JT8 A;  5HL1 A;  2ZKM X;  1SW8 A;  1DJZ A;  3O4X A;  4GGF C;  1DJX A;  1PVB A;  2AMI A;  2QEB A;  1BMO A;  1TRF A;  2JT0 A;  2GGM A;  3OBV A;  1DGV A;  1DMO A;  2M1U A;  4NDC A;  1KQM B;  1C7V A;  3SS3 A;  1DJW A;  3TS5 B;  1WRL A;  3LL8 B;  2LLS A;  2KAX A;  1ZMZ A;  2QDI A;  2I7A A;  1DQE A;  2NCO A;  1EXR A;  1NX1 A;  2PAL A;  2PSR A;  3FE6 A;  1AVS A;  2COL B;  1GGW A;  1QV0 A;  1QX5 B;  1AHR A;  3A8R A;  3I5F B;  4HRH A;  3PAL A;  4AQI A;  3PLF B;  2JRF A;  4PT1 A;  4YGA A;  5ER5 A;  3NXA A;  3RM1 A;  1QLK A;  2FJU B;  1KSM A;  1K9K A;  1L2O C;  1KK8 C;  3BOW B;  2L50 A;  1N0Y A;  1N65 A;  1KQM C;  3TS5 C;  1F8H A;  1MHO A;  1YX8 A;  1F4Q A;  3Q8I A;  2KI4 C;  1WY9 A;  4CPV A;  3I5G C;  4FTG A;  3DF0 B;  4OCI A;  1CDP A;  2IS9 A;  1E8A A;  3EVU A;  2KBI A;  2CNP A;  1EG3 A;  2K0J A;  4KYN A;  3BUW B;  3ICB A;  2K8M B;  3QME A;  1XO5 A;  1KWO B;  4C0J A;  2LVK A;  3EG5 B;  3GK4 X;  1KK7 Z;  4ZCU A;  1FW4 A;  3PN7 B;  2LMV A;  3VRO A;  3D0Y A;  3KEV A;  1CLL A;  3FE8 A;  5DIC A;  1JFJ A;  3CTN A;  3B86 A;  1ALW A;  4QJ4 B;  2BCX A;  2KI4 B;  5ER4 X;  5KU1 A;  3S0D A;  2JU0 A;  2L5Y A;  1PSR A;  1KSO A;  1LVC D;  5JJG A;  5I2L A;  3CAB A;  1B8C A;  1CKK A;  2RGI A;  1IGV A;  1GQM A;  1A75 B;  1WRZ A;  3VGO A;  1CB1 A;  2HQ8 A;  1YUR A;  2WOS A;  1CMF A;  2KBM A;  5HKW A;  1KK7 Y;  2EC6 B;  3L4A A;  1NX3 A;  4XJK A;  1H4B A;  3VRR A;  1OZO A;  2FJY A;  4C0L A;  2MAZ A;  3NSI A;  1M46 A;  3IF7 A;  2ZRT A;  4I5J A;  3FWB A;  1N2D A;  3CR2 A;  5CSJ A;  1XK4 A;  1DTL A;  3DY9 A;  1NUB A;  3M0W A;  5AAN A;  3C1V A;  4GGF A;  3JVT B;  1YRU B;  2PVB A;  1BR4 B;  1DEL A;  1YVL A;  1C3Z A;  1K9U A;  2Q4U A;  4BY4 A;  4D1E A;  3WNX B;  3DVE A;  1IH0 A;  1LKJ A;  2KHN A;  1C3Y A;  1W9Z A;  1JFK A;  2ZN8 A;  2K2A A;  2K61 A;  2F3Y A;  4PE4 A;  5G08 A;  3UO9 A;  1CFP A;  3NGV A;  1QTX A;  3CS1 A;  3EK4 A;  2Q91 A;  5D69 A;  2M97 A;  1NCZ A;  2NLN A;  2V53 A;  3BFB A;  4A4C A;  2R2I A;  2YGU A;  2FOT A;  3OB2 B;  1TN4 A;  1TUZ A;  1YUT A;  1EH2 A;  2Y4Q A;  3KF9 A;  2JPO A;  1XFV O;  2O60 A;  5I94 A;  1F70 A;  1CFD A;  3RZS A;  3D78 A;  3DVM A;  1F54 A;  1B4C A;  1UWO A;  1TNQ A;  1S36 A;  2E6W A;  1JSA A;  1NX0 A;  2M7L A;  1FPW A;  1ORG A;  3JTD B;  4GAO A;  1PVA A;  1IKU A;  1J7O A;  2WND A;  1DJI A;  1HT9 A;  1S6I A;  2NCP A;  1KCY A;  2G9B A;  1PRW A;  3BFA A;  3GK2 A;  1C7W A;  2E30 A;  3OX5 A;  1K8U A;  4PAL A;  4I5K A;  5IBW A;  1K96 A;  3O78 A;  1NPQ A;  1UUS A;  1XFY O;  1XFX O;  1TIZ A;  3O6B A;  4ICB A;  2JTT A;  1NP8 A;  1QVI Z;  3CZ0 A;  4YI9 A;  3D75 A;  3SIA A;  1SCM C;  1TCF A;  1SK6 D;  4DCK A;  4N1F A;  1MWN A;  5KSZ A;  2KLD A;  1UP5 A;  2OTG C;  1CM4 A;  1KWO C;  3CDN A;  1SY9 A;  4IL1 A;  2P6B B;  2WC5 A;  1OOG A;  2AAO A;  1M45 A;  1VRK A;  2SAS A;  2H61 C;  3BFH A;  2JTZ A;  3S0E A;  3F45 A;  5I2O A;  4OR9 B;  1AJ4 A;  1PUL A;  1FI6 A;  1J7Q A;  1K94 A;  2I18 A;  1OMD A;  2LE9 B;  1B8R A;  2L98 A;  1S26 D;  4DUQ A;  1TTX A;  4HSZ A;  3EK7 A;  5GQQ C;  1CDL A;  4WQ2 A;  2BL0 B;  4MBE A;  4GFT A;  1GGZ A;  4INW A;  2KAV A;  1XK4 C;  1IJ5 A;  3AAK A;  2K7D A;  3I5I B;  3SS5 A;  4MEW A;  2KI6 C;  2WCM A;  1CTR A;  1SL9 A;  4OZD A;  2F33 A;  1TOP A;  1OE9 B;  1J1E A;  2WOR A;  5I2Q A;  1V1G A;  2WCL A;  2CXJ A;  1Y1X A;  1ZOT B;  1LA0 A;  2D8N A;  3AAJ A;  3EK8 A;  3PM2 A;  3VRN A;  2B1U A;  1IIO A;  2LP2 A;  4ORA B;  2F8P A;  1SCV A;  1EG4 A;  2CBL A;  2P71 A;  2WC6 A;  1IJ6 A;  4PCW A;  3CZT X;  3TDU A;  3KHE A;  2BKH B;  2WCF A;  1B7T Y;  1OOH A;  1QWV A;  1U5I A;  3LLE A;  4UPG A;  4JWQ A;  3AKB A;  2LCP A;  4JQ0 D;  2BNX A;  1U5I B;  4JKT A;  3DVK A;  2FCD A;  1K95 A;  1R2U A;  1IG5 A;  2LMU A;  4NQG A;  1Z4H A;  2WCK A;  1SR6 B;  2M9G A;  1BR1 B;  2OS8 C;  2TN4 A;  3EKH A;  4NDB A;  1QV1 A;  2LVJ A;  4GPL B;  4CFQ A;  1AUI B;  4PHJ A;  5KTY A;  1KQV A;  2HPS A;  1DEK A;  1J1D A;  1CFF A;  4HRG A;  1S5G Y;  4TNC A;  4DIR A;  2BE6 A;  2L2C A;  4YGC B;  1KFX L;  2MHH A;  4IJ7 A;  5D3O A;  3R72 A;  4PHN A;  4AOM A;  4USL A;  1JBA A;  3PN7 C;  1QVI Y;  2LHL A;  5FI6 A;  2HF5 A;  2K7B A;  1K93 D;  3OX6 A;  4YGB B;  1R6P A;  2BKI B;  3CR4 X;  1A2X A;  2QEV A;  3BJH A;  3JTD C;  4M2Q A;  3D77 A;  3SG2 A;  3VRQ A;  5TNC A;  3K1E A;  1P28 A;  1CNP A;  1LXF C;  2PMY A;  2L4H A;  1OOI X;  1MR8 A;  2JOJ A;  2KI6 D;  2LV7 A;  3WXA A;  1CLB A;  3PJI A;  1NCX A;  1K2H A;  2JT3 A;  2M49 B;  2JQ6 A;  1YTZ C;  2ZND A;  3S0G A;  4CID A;  2H61 A;  3BUN B;  2I94 A;  1L2O B;  1BT6 A;  1SYM A;  5BPJ A;  3DF0 A;  1KK8 B;  1OSA A;  2JWW A;  3SG4 A;  3D76 A;  3A4U B;  4WRI A;  4MRY A;  2MBX A;  1SR6 C;  1XFU O;  2LP3 A;  3I5G B;  2CCM A;  2K7C A;  3DXL A;  2KYC A;  2H2K A;  4U8D A;  3WHT B;  1K90 D;  4XYN A;  1AJ5 A;  2L51 A;  1X02 A;  2QPT A;  1F55 A;  1HQV A;  1TWO A;  1SBJ A;  3TUY B;  5JOL A;  4CLN A;  2K7O A;  1NCY A;  4L9M A;  1RWY A;  1Y6W A;  2MLE C;  1DC1 A;  1MUX A;  2JPT A;  1CDN A;  3R1V A;  1ODB A;  3B87 A;  3D74 A;  2L5X B;  3HCM A;  3IQO A;  4OV2 A;  2FCE A;  1BF5 A;  1D1O A;  1OOJ A;  4YI8 A;  2ZRS A;  1F71 A;  1W7I B;  2L0P A;  1BJF A;  3NSO A;  1QS7 A;  2MA2 A;  1T14 A;  2OPO A;  1M31 A;  3OP0 A;  4GGN A;  1L7Z A;  1QIV A;  1W7J B;  1OZS A;  2LHI A;  1DT7 B;  1BOD A;  2KFF A;  1WRK A;  1IQ3 A;  3VRP A;  2QEO A;  3L47 A;  5FI7 A;  1NSH A;  3TUY C;  3LK1 A;  2QEH A;  2MRD A;  3WHU B;  5EL2 A;  1LA3 A;  1PAL A;  2SCP A;  1S5G Z;  3BUO B;  1C07 A;  2BCB A;  3BXK A;  3LCP C;  3O2P A;  4AQJ A;  1GJY A;  1M63 B;  1KFU L;  1CM1 A;  1PK0 D;  3ZWH A;  4HRE E;  1BLQ A;  3FWC A;  2F2O A;  3SG6 A;  1SRA A;  4PE1 A;  3DVJ A;  2M0R A;  2LAN A;  2LMT A;  3L4L A;  3OB1 B;  1WDC C;  3E3R A;  1UHK A;  3QRX A;  1DGU A;  3D0Y B;  1XFZ O;  2JXL A;  2G2B A;  3SS4 A;  4QJ5 B;  1A4P A;  3B6X A;  1KFX S;  2KDH A;  2M3W A;  1UHI A;  2ZFD A;  1EL4 A;  2F3Z A;  5CPV A;  1QAT A;  2KPH A;  2KQY A;  3GOF A;  1A75 A;  2Y1N A;  3N7H A;  5F6T A;  4F7F A;  4GNK B;  5B8I B;  3K21 A;  1JF2 A;  1WLM A;  4YGE B;  5K89 A;  4BY5 A;  1JUO A;  4NDD A;  1ZFS A;  4YGD B;  5DKQ A;  3V2L A;  4M2O A;  4ZCV A;  3D10 A;  2K60 A;  3OHM B;  1SL7 A;  1UHN A;  4N5X A;  1S6C A;  3BYA A;  3ZNI A;  1Y0V H;  1CDM A;  1MXE A;  4YRU A;  1JWD A;  2CT9 A;  5I8N A;  3CGA A;  4A4B A;  2LUX A;  3BQ3 A;  3R1P A;  3DD4 A;  3I5I C;  4PE7 A;  1FF1 A;  1QXP A;  1TNX A;  4MVF A;  1A03 A;  1JC2 A;  2NXQ A;  3SG3 A;  1UHJ A;  3NSK A;  1XVJ A;  5AEQ A;  1YVH A;  1XA5 A;  3PAT A;  2KSP A;  3D73 A;  2LC5 A;  2P70 A;  2ZN9 A;  2LVI A;  1NWD A;  3HX4 A;  3BUM B;  5HKZ A;  3BOW A;  1V1F A;  4MZL A;  3NHI A;  2WCE A;  2WCJ A;  1B8L A;  5AER A;  2H8V A;  3DYE A;  1Y1A A;  2LM5 A;  4INX A;  3O4Y A;  2OTG B;  3PFV A;  1QIW A;  2BBN A;  4MSP A;  1OMV A;  1S3P A;  1ZUZ A;  1DF0 B;  2JXC A;  1SKT A;  3EKJ A;  4ORB B;  3SG7 A;  4ETO A;  2JNF A;  3B7A A;  3I5H B;  1FI5 A;  2KLE A;  2EHB A;  4FQT A;  2JC2 A;  4C0K A;  5CSI A;  2VRG A;  4M2P A;  1RFJ A;  2BE4 A;  1F4O A;  1OQP A;  1GM0 A;  1QX2 A;  2AUC A;  2Y1M A;  1A29 A;  1ALV A;  2BCA A;  3BUX B;  4MZK A;  1DVI A;  4OKH A;  4XJK B;  2KFH A;  1SSE B;  3GK1 A;  4FQO A;  2OS8 B;  2BL0 C;  2K2F A;  1EJ3 A;  5FYX A;  2LVV A;  2KQ6 A;  2GV5 A;  5D7F A;  2HQW A;  5J3X A;  1NX2 A;  1OMR A;  1LS8 A;  2BEC A;  2KAY A;  2LLU A;  3NHT A;  3TZ1 A;  1KFU S;  1Q80 A;  1AK8 A;  2KFG A;  3CZ2 A;  1PSB A;  3H4S E;  2KNE A;  2NZ0 A;  4I5N B;  1QX7 A;  1WDC B;  1B9A A;  2LUC A;  4I5L B;  3B88 A;  1B1G A;  1SCM B;  4MN0 A;  4PHM A;  3EVV A;  2I2R E;  4OVN F;  1BG1 A;  2M29 A;  5DKR A;  2EC6 C;  4E68 A;  2ZNE A;  3UNW A;  1H8B A;  4DRW A;  1J55 A;  1RTP 1;  1REC A;  3SIB A;  4JPZ B;  2JNX A;  2GTE A;  3OGN A;  2LNK A;  1UHH A;  4GBA A;  4MLW A;  1SPY A;  1S1E A;  1XFW O;  3S0F A;  4DS7 A;  1DF0 A;  3NSL A;  2F2P A;  1YRT B;  2WC8 A;  1NIW A;  4PDZ A;  3I5F C;  5HYD A;  4N1G A;  4MRX A;  1YX7 A;  1IRJ A;  1DJH A;  4P2Y B;  3CZ1 A;  5AFP A;  3R1O A;  1LIN A;  1K9P A;  1DJY A;  2BBM A;  2WCB A;  3DZT A;  4ORC B;  2BAP A;  1B7T Z;  1G33 A;  2PQL A;  1TNW A;  3EVR A;  2PRU A;  1FBV A;  1BOC A;  1QLS A;  1G8I A;  3PM8 A;  2Y5I A;  1SMG A;  2QAC A;  5FI2 A;  2ISD A;  1MXL C;  1Y1U A;  5DKN A;  2M1K B;  3CWG A;  3VB1 A;  3CR5 X;  3TDZ A;  3AKA A;  1QAS A;  2L4I A;  1QJT A;  4PHK A;  2JZI A;  3SJS A;  1OOF A;  1YUS A;  1UUR A;  2KGR A;  2WCH A;  1S6J A;  2KYF A;  2LLT A;  1CFC A;  2DOQ A;  5PAL A;  1XFR A;  2O5G A;  1B47 A;  3LK0 A;  1M39 A;  1ZAC A;  1Z2C B;  3KO0 A;  3CYZ A;  4YBH B;  2MLF C;  1NYA A;  4F0Z B;  3I5H C;  1RJV A;  1RK9 A;  3FE9 A;  2EGD A;  3IVT A;  1JF0 A;  3PSR A;  5AXI A;  3RLZ A;  3S0A A;  2GGZ A;  3FIA A;  2ERB A;  2M7N A;  3KPX A;  2KGB C;  1IWQ A;  5CSF A;  1IQ5 A;  3FS7 A;  1TCO B;  2M8U A;  2A4J A;  1XYD A;  2PAS A;  1SL8 A;  5HLO A;  1G4Y R;  2KOT A;  1CLM A;  1SNL A;  4P5O E;  4PE0 A;  3TDI A;  1CMG A;  1MF8 B;  4GUK A;  2MJW B;  1WLZ A;  1OW4 A;  4WQ3 A;  1TUJ A;  1YR5 A;  1BU3 A;  1J7R A;  1DJG A;  2CTN A;  4R1E A;  5CSN A;  3S0B A;  1J7P A;  2L2E A;  2HET A;  1MQ1 A;  4Q04 A; 
#chains in the Genus database with same CATH homology
 1YUU A;  3JVT C;  3MSE B;  3SG5 A;  5HKY A;  1TNP A;  3IQQ A;  4CFR A;  3CLN A;  4QJ3 B;  1AP4 A;  5HLV A;  1RRO A;  2JUL A;  2LAP A;  4MZJ A;  2JT8 A;  5HL1 A;  2ZKM X;  1SW8 A;  1DJZ A;  3O4X A;  4GGF C;  1DJX A;  1PVB A;  2AMI A;  1BMO A;  1TRF A;  2JT0 A;  2GGM A;  3OBV A;  1DGV A;  1DMO A;  2M1U A;  4NDC A;  1KQM B;  1C7V A;  3SS3 A;  1DJW A;  3TS5 B;  1WRL A;  3LL8 B;  2LLS A;  2KAX A;  1ZMZ A;  2I7A A;  2NCO A;  1EXR A;  1NX1 A;  2PAL A;  2PSR A;  1AVS A;  2COL B;  1GGW A;  1QV0 A;  1QX5 B;  1AHR A;  3A8R A;  3I5F B;  4HRH A;  3PAL A;  4AQI A;  3PLF B;  2JRF A;  4YGA A;  5ER5 A;  3NXA A;  3RM1 A;  1QLK A;  2FJU B;  1KSM A;  1K9K A;  1L2O C;  1KK8 C;  3BOW B;  2L50 A;  1N0Y A;  1N65 A;  1KQM C;  3TS5 C;  1F8H A;  1MHO A;  1YX8 A;  1F4Q A;  2KI4 C;  1WY9 A;  4CPV A;  3I5G C;  4FTG A;  3DF0 B;  4OCI A;  1CDP A;  2IS9 A;  1E8A A;  3EVU A;  2KBI A;  2CNP A;  1EG3 A;  2K0J A;  4KYN A;  3BUW B;  3ICB A;  2K8M B;  1XO5 A;  1KWO B;  4C0J A;  2LVK A;  3EG5 B;  3GK4 X;  1KK7 Z;  4ZCU A;  1FW4 A;  3PN7 B;  2LMV A;  3VRO A;  3D0Y A;  3KEV A;  1CLL A;  1JFJ A;  3CTN A;  1ALW A;  4QJ4 B;  2BCX A;  2KI4 B;  5ER4 X;  5KU1 A;  2JU0 A;  2L5Y A;  1PSR A;  1KSO A;  1LVC D;  5JJG A;  5I2L A;  1B8C A;  1CKK A;  2RGI A;  1IGV A;  1GQM A;  1A75 B;  1WRZ A;  3VGO A;  1CB1 A;  2HQ8 A;  1YUR A;  2WOS A;  1CMF A;  2KBM A;  5HKW A;  1KK7 Y;  2EC6 B;  1NX3 A;  4XJK A;  1H4B A;  3VRR A;  1OZO A;  4C0L A;  2MAZ A;  3NSI A;  1M46 A;  3IF7 A;  2ZRT A;  4I5J A;  3FWB A;  1N2D A;  3CR2 A;  5CSJ A;  1XK4 A;  1DTL A;  1NUB A;  3M0W A;  5AAN A;  3C1V A;  4GGF A;  3JVT B;  1YRU B;  2PVB A;  1BR4 B;  1DEL A;  1YVL A;  1K9U A;  4D1E A;  2Q4U A;  4BY4 A;  3WNX B;  3DVE A;  1IH0 A;  1LKJ A;  2KHN A;  1W9Z A;  1JFK A;  2ZN8 A;  2K2A A;  2K61 A;  2F3Y A;  4PE4 A;  5G08 A;  1CFP A;  3UO9 A;  1QTX A;  3CS1 A;  3EK4 A;  2Q91 A;  5D69 A;  2M97 A;  1NCZ A;  2NLN A;  2V53 A;  4A4C A;  2R2I A;  2YGU A;  2FOT A;  3OB2 B;  1TN4 A;  1YUT A;  1EH2 A;  2Y4Q A;  3KF9 A;  5I94 A;  1XFV O;  2O60 A;  1F70 A;  1CFD A;  3DVM A;  1F54 A;  1B4C A;  1UWO A;  1TNQ A;  1S36 A;  2E6W A;  1JSA A;  1NX0 A;  2M7L A;  1FPW A;  3JTD B;  4GAO A;  1PVA A;  1IKU A;  1J7O A;  2WND A;  1DJI A;  1HT9 A;  1S6I A;  2NCP A;  1KCY A;  2G9B A;  1PRW A;  3GK2 A;  1C7W A;  2E30 A;  3OX5 A;  1K8U A;  4PAL A;  4I5K A;  5IBW A;  1K96 A;  3O78 A;  1NPQ A;  1UUS A;  1XFY O;  1XFX O;  1TIZ A;  3O6B A;  4ICB A;  2JTT A;  1NP8 A;  1QVI Z;  4YI9 A;  3SIA A;  1SCM C;  1TCF A;  1SK6 D;  4DCK A;  4N1F A;  1MWN A;  5KSZ A;  2KLD A;  1UP5 A;  2OTG C;  1CM4 A;  1KWO C;  1SY9 A;  4IL1 A;  2P6B B;  2AAO A;  1M45 A;  1VRK A;  2SAS A;  2H61 C;  5I2O A;  2JTZ A;  3F45 A;  4OR9 B;  1AJ4 A;  1PUL A;  1FI6 A;  1J7Q A;  1K94 A;  2I18 A;  1OMD A;  2LE9 B;  1B8R A;  2L98 A;  1S26 D;  4DUQ A;  1TTX A;  4HSZ A;  3EK7 A;  5GQQ C;  1CDL A;  4WQ2 A;  2BL0 B;  4MBE A;  4GFT A;  1GGZ A;  2KAV A;  1XK4 C;  1IJ5 A;  3AAK A;  2K7D A;  3I5I B;  3SS5 A;  4MEW A;  2KI6 C;  1CTR A;  1SL9 A;  2F33 A;  1TOP A;  1OE9 B;  1J1E A;  2WOR A;  5I2Q A;  1V1G A;  3PM2 A;  2CXJ A;  1Y1X A;  1ZOT B;  1LA0 A;  2D8N A;  3AAJ A;  3EK8 A;  3VRN A;  2B1U A;  2LP2 A;  4ORA B;  2F8P A;  1SCV A;  1EG4 A;  2CBL A;  1IJ6 A;  4PCW A;  3CZT X;  3TDU A;  3KHE A;  2BKH B;  2WCF A;  1B7T Y;  3LLE A;  1U5I A;  4UPG A;  4JWQ A;  3AKB A;  2LCP A;  4JQ0 D;  2BNX A;  1U5I B;  4JKT A;  3DVK A;  2FCD A;  1K95 A;  1R2U A;  1IG5 A;  2LMU A;  4NQG A;  1Z4H A;  1SR6 B;  2M9G A;  1BR1 B;  2OS8 C;  2TN4 A;  3EKH A;  4NDB A;  1QV1 A;  2LVJ A;  4GPL B;  4CFQ A;  1AUI B;  4PHJ A;  5KTY A;  1KQV A;  2HPS A;  1DEK A;  1J1D A;  1CFF A;  4HRG A;  1S5G Y;  4TNC A;  4DIR A;  2BE6 A;  4YGC B;  1KFX L;  2MHH A;  4IJ7 A;  5D3O A;  4PHN A;  4AOM A;  4USL A;  1JBA A;  3PN7 C;  1QVI Y;  2LHL A;  5FI6 A;  2HF5 A;  2K7B A;  1K93 D;  3OX6 A;  4YGB B;  1R6P A;  2BKI B;  3CR4 X;  1A2X A;  3JTD C;  4M2Q A;  3SG2 A;  3VRQ A;  5TNC A;  1CNP A;  1LXF C;  2PMY A;  2L4H A;  2KI6 D;  1MR8 A;  2JOJ A;  2LV7 A;  3WXA A;  1CLB A;  1NCX A;  1K2H A;  2JT3 A;  2M49 B;  2JQ6 A;  1YTZ C;  2ZND A;  4CID A;  2H61 A;  3BUN B;  2I94 A;  1L2O B;  1BT6 A;  1SYM A;  5BPJ A;  3DF0 A;  1KK8 B;  1OSA A;  2JWW A;  3SG4 A;  3A4U B;  4WRI A;  4MRY A;  2MBX A;  1SR6 C;  1XFU O;  2LP3 A;  3I5G B;  2CCM A;  2K7C A;  2KYC A;  2H2K A;  4U8D A;  3WHT B;  1K90 D;  4XYN A;  1AJ5 A;  2L51 A;  1X02 A;  2QPT A;  1F55 A;  1HQV A;  4CLN A;  1SBJ A;  3TUY B;  5JOL A;  2K7O A;  1NCY A;  4L9M A;  1RWY A;  1Y6W A;  2MLE C;  1DC1 A;  1MUX A;  2JPT A;  1CDN A;  1ODB A;  3IQO A;  4OV2 A;  2L5X B;  3HCM A;  1D1O A;  2FCE A;  1BF5 A;  1OOJ A;  4YI8 A;  2ZRS A;  1F71 A;  1W7I B;  2L0P A;  1BJF A;  3NSO A;  1QS7 A;  2MA2 A;  2OPO A;  1M31 A;  3OP0 A;  4GGN A;  1L7Z A;  1QIV A;  1W7J B;  1OZS A;  2LHI A;  1DT7 B;  1BOD A;  2KFF A;  1WRK A;  1IQ3 A;  3VRP A;  3TUY C;  5FI7 A;  1NSH A;  3LK1 A;  2MRD A;  3WHU B;  1LA3 A;  1PAL A;  2SCP A;  1S5G Z;  3BUO B;  1C07 A;  2BCB A;  3BXK A;  3LCP C;  3O2P A;  4AQJ A;  1GJY A;  1M63 B;  1KFU L;  1CM1 A;  1PK0 D;  3ZWH A;  4HRE E;  1BLQ A;  3FWC A;  2F2O A;  3SG6 A;  1SRA A;  4PE1 A;  3DVJ A;  2M0R A;  2LAN A;  2LMT A;  3OB1 B;  1WDC C;  3E3R A;  1UHK A;  3QRX A;  1DGU A;  3D0Y B;  1XFZ O;  2JXL A;  2G2B A;  4QJ5 B;  3SS4 A;  1A4P A;  1KFX S;  2KDH A;  2M3W A;  1UHI A;  2ZFD A;  1EL4 A;  2F3Z A;  5CPV A;  1QAT A;  2KQY A;  3GOF A;  5F6T A;  1A75 A;  2Y1N A;  4GNK B;  5B8I B;  3K21 A;  1JF2 A;  1WLM A;  4YGE B;  5K89 A;  4BY5 A;  1JUO A;  4NDD A;  1ZFS A;  4YGD B;  5DKQ A;  4M2O A;  4ZCV A;  3D10 A;  2K60 A;  3OHM B;  1SL7 A;  1UHN A;  4N5X A;  1S6C A;  3BYA A;  3ZNI A;  1Y0V H;  1CDM A;  1MXE A;  4YRU A;  1JWD A;  2CT9 A;  5I8N A;  3CGA A;  4A4B A;  2LUX A;  3BQ3 A;  3DD4 A;  3I5I C;  4PE7 A;  1FF1 A;  1QXP A;  1TNX A;  4MVF A;  1A03 A;  1JC2 A;  2NXQ A;  3SG3 A;  1UHJ A;  3NSK A;  1XVJ A;  5AEQ A;  1YVH A;  1XA5 A;  3PAT A;  2KSP A;  2LC5 A;  2ZN9 A;  2LVI A;  1NWD A;  3HX4 A;  3BUM B;  5HKZ A;  3BOW A;  1V1F A;  4MZL A;  2WCE A;  1B8L A;  5AER A;  1Y1A A;  2LM5 A;  3O4Y A;  2OTG B;  3PFV A;  1QIW A;  2BBN A;  4MSP A;  1OMV A;  1S3P A;  1ZUZ A;  1DF0 B;  2JXC A;  1SKT A;  3EKJ A;  4ORB B;  3SG7 A;  4ETO A;  2JNF A;  3I5H B;  1FI5 A;  2KLE A;  2EHB A;  2JC2 A;  4C0K A;  5CSI A;  2VRG A;  4M2P A;  1RFJ A;  2BE4 A;  1F4O A;  1OQP A;  1QX2 A;  2AUC A;  2Y1M A;  1A29 A;  1ALV A;  2BCA A;  3BUX B;  4MZK A;  1DVI A;  4OKH A;  4XJK B;  2KFH A;  4FQO A;  3GK1 A;  5FYX A;  2OS8 B;  2BL0 C;  2K2F A;  1EJ3 A;  2LVV A;  2KQ6 A;  2GV5 A;  5D7F A;  2HQW A;  5J3X A;  1NX2 A;  1OMR A;  2BEC A;  2KAY A;  2LLU A;  3TZ1 A;  1KFU S;  1Q80 A;  1AK8 A;  2KFG A;  1PSB A;  3H4S E;  2KNE A;  2NZ0 A;  4I5N B;  1QX7 A;  1WDC B;  1B9A A;  2LUC A;  4I5L B;  1B1G A;  1SCM B;  4MN0 A;  4PHM A;  3EVV A;  2I2R E;  4OVN F;  1BG1 A;  2M29 A;  5DKR A;  2EC6 C;  4E68 A;  2ZNE A;  3UNW A;  1H8B A;  1J55 A;  1RTP 1;  1REC A;  3SIB A;  4JPZ B;  2JNX A;  4GBA A;  2LNK A;  1UHH A;  4MLW A;  1SPY A;  1S1E A;  1XFW O;  4DS7 A;  1DF0 A;  3NSL A;  2F2P A;  1YRT B;  2WC8 A;  1NIW A;  4PDZ A;  3I5F C;  5HYD A;  4N1G A;  4MRX A;  1YX7 A;  1IRJ A;  1DJH A;  4P2Y B;  5AFP A;  1LIN A;  1K9P A;  1DJY A;  2BBM A;  2WCB A;  4ORC B;  2BAP A;  1B7T Z;  1G33 A;  3EVR A;  1TNW A;  2PRU A;  1FBV A;  1BOC A;  1QLS A;  1G8I A;  3PM8 A;  2Y5I A;  1SMG A;  2QAC A;  2ISD A;  5FI2 A;  1MXL C;  1Y1U A;  5DKN A;  2M1K B;  3CWG A;  3CR5 X;  3TDZ A;  3AKA A;  1QAS A;  2L4I A;  1QJT A;  4PHK A;  2JZI A;  3SJS A;  1YUS A;  1UUR A;  2KGR A;  1S6J A;  2KYF A;  2LLT A;  1CFC A;  2DOQ A;  5PAL A;  2O5G A;  1B47 A;  3LK0 A;  1M39 A;  1ZAC A;  1Z2C B;  3KO0 A;  4YBH B;  2MLF C;  1NYA A;  4F0Z B;  3I5H C;  1RJV A;  1RK9 A;  3PSR A;  2EGD A;  5AXI A;  1JF0 A;  3RLZ A;  4DRW A;  3IVT A;  2GGZ A;  3FIA A;  2M7N A;  3KPX A;  2KGB C;  1IWQ A;  5CSF A;  1IQ5 A;  3FS7 A;  1TCO B;  2M8U A;  2A4J A;  1XYD A;  2PAS A;  1SL8 A;  5HLO A;  1G4Y R;  2KOT A;  1CLM A;  1SNL A;  4P5O E;  4PE0 A;  3TDI A;  1CMG A;  1MF8 B;  4GUK A;  2MJW B;  1WLZ A;  4WQ3 A;  1YR5 A;  1BU3 A;  1J7R A;  1DJG A;  2CTN A;  4R1E A;  5CSN A;  1J7P A;  2L2E A;  2HET A;  1MQ1 A;  4Q04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...