4I5JA

Pp2a pr70 holoenzyme
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 266
sequence length 272
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5jA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5jA01
1UHKA 2Y5IA 3OX5A 2BECA 1J1EA 1FI5A 1CMGA 2JZIA 1WRLA 3KO0A 4PDZA 1KSMA 3BUNB 1G4YR 1YX8A 2WC8A 1XYDA 2L0PA 1PK0D 5HKWA 2JOJA 2OS8B 1B8RA 5FYXA 4M2PA 4PHNA 3KF9A 1SRAA 2BKHB 1YUTA 2NZ0A 1G33A 1UHJA 3NSKA 1B47A 1SL7A 1C07A 2K2FA 1BU3A 1W7JB 1DJIA 2SCPA 5CSNA 1K9UA 1NX0A 3JVTB 3LK1A 1D1OA 1GGWA 2FOTA 1CNPA 1NSHA 4CIDA 2M29A 2OS8C 4XJKA 4YGCB 4OR9B 4M2OA 1DF0A 5HLOA 3WXAA 1XVJA 2M49B 3EVVA 5I2QA 1RK9A 4TNCA 1RWYA 2FCEA 1SY9A 2JRFA 1F55A 3LLEA 2Y4QA 2JC2A 2JWWA 3M0WA 4MEWA 1PVAA 4N5XA 4MRXA 1L2OB 4CLNA 1BMOA 2KI6D 1KWOB 1K95A 1B9AA 1Y1UA 4PALA 1Y1XA 3D0YB 1LA3A 1FF1A 2H2KA 4QJ3B 2MHHA 4OV2A 2E30A 1F8HA 2KI4B 2A4JA 2K8MB 4ZCVA 1L2OC 3GK4X 3SG6A 4N1GA 3CZTX 1R2UA 1AHRA 3IF7A 1QVIY 2RGIA 2BE6A 1F4QA 2CXJA 2BE4A 1A29A 1BR4B 3FWCA 1UP5A 5ER4X 5F6TA 1S26D 2KAXA 2F3ZA 2MAZA 2OTGB 2M97A 1QX2A 1XFZO 1YX7A 1Y6WA 1CLLA 1PVBA 2V53A 2IS9A 3PLFB 4YI9A 1CMFA 5DKNA 1L7ZA 1LXFC 1QXPA 1K2HA 1OZSA 1KK7Y 1SKTA 2JT3A 3FS7A 1YR5A 3O4YA 3EKHA 4PHJA 2OTGC 2K61A 5AXIA 3PALA 4DUQA 1UWOA 3CLNA 1OQPA 1F71A 5D69A 4I5JA 4IL1A 4MLWA 1G8IA 1YURA 2WCFA 1XFXO 3MSEB 1SL9A 1S5GZ 4BY4A 2BBMA 1JFKA 2BCBA 4FTGA 1J1DA 1DJZA 4JPZB 1F70A 2F33A 4OVNF 4Q04A 3VRRA 2JT8A 3I5GB 1S5GY 2KBMA 1CDPA 2LVVA 1MHOA 2KNEA 3A8RA 4P5OE 2R2IA 1XK4C 3KHEA 3NSOA 3I5FB 1JWDA 1ALVA 3AKBA 1A4PA 1CKKA 4HSZA 2KHNA 1BG1A 1TRFA 1KK8C 1KFXS 3BXKA 1MQ1A 5I8NA 2PALA 2K7DA 4GAOA 3I5GC 1K8UA 2HETA 1DJHA 3A4UB 3DVKA 5CSFA 4CFRA 1ODBA 2AUCA 3I5FC 1KFUS 1TN4A 2CTNA 2LCPA 1KQMB 4NDCA 3OP0A 2KAYA 3VRNA 5DKRA 5AEQA 5I2OA 1C7VA 2K7CA 2SASA 1CDLA 5HLVA 2H61C 2Y1MA 1DVIA 2LHIA 1X02A 4MBEA 2FCDA 1EJ3A 4M2QA 3VROA 4HRHA 3SG5A 4AQJA 3TDIA 4A4BA 1JBAA 1TOPA 2ZKMX 1IKUA 1M63B 1KQMC 3KPXA 1FBVA 3F45A 4NDDA 1ZACA 4I5NB 4D1EA 3DVJA 4WQ2A 2HQWA 1YRTB 3OHMB 1JFJA 1VRKA 4FQOA 2NLNA 1DGUA 2ZN8A 3CWGA 3LL8B 3HX4A 1K9KA 2JXCA 3FIAA 2K7OA 2ZN9A 1CDMA 4PE4A 1SK6D 5D7FA 3I5HB 1K96A 1NYAA 1QLSA 2JT0A 1A75B 3DVEA 1SBJA 3GK2A 3QRXA 1JUOA 1WLMA 1K90D 1GJYA 1QIVA 2ZFDA 3ZNIA 1MF8B 1UHNA 1QV1A 4DIRA 1QX5B 1H4BA 1SCMB 3OX6A 1DTLA 3JVTC 3BUOB 3I5HC 3TUYC 1BT6A 5CSIA 3D0YA 1N65A 2I18A 2LVJA 4WRIA 5DKQA 1CDNA 1NPQA 2EC6B 3SG7A 2F8PA 1EH2A 1UHHA 2KYFA 4DCKA 2BKIB 3H4SE 1WRKA 2KSPA 1SCMC 1Q80A 3DF0B 4CPVA 1QATA 2FJUB 3BOWA 4GUKA 3PM8A 4ZCUA 1RECA 4JWQA 3RM1A 3TZ1A 2JTZA 2OPOA 1MR8A 1H8BA 2LVKA 2LMUA 2M3WA 1QVIZ 2TN4A 3CR4X 1MUXA 1KSOA 3CR5X 1HQVA 3EVRA 1KWOC 1M39A 1TCFA 3O2PA 1QS7A 4PE7A 2COLB 1DF0B 1NX3A 1OMDA 1FI6A 1U5IA 1BR1B 2BCAA 1PULA 1WDCB 1PRWA 1NIWA 2LP3A 2QPTA 4DS7A 2KI4C 3O6BA 3EK8A 4NQGA 1K9PA 2MRDA 3WNXB 3I5IB 2JTTA 1DJYA 3PN7B 2DOQA 1KK7Z 1DGVA 2JNXA 1NCXA 1WY9A 2LHLA 1N0YA 1LKJA 3AKAA 2GV5A 1B1GA 2I2RE 4YGDB 1YVHA 1BODA 1XK4A 2JNFA 1CFFA 3CTNA 2M7NA 5TNCA 5HKYA 1JC2A 4YRUA 1K94A 5CPVA 3AAJA 1DJXA 1QLKA 2LV7A 5AFPA 2PRUA 3C1VA 2LMTA 3I5IC 1IGVA 4GGFC 4PE1A 3EK7A 3PN7C 3VGOA 2JQ6A 3IQQA 1JF2A 3EVUA 2M8UA 1SMGA 2LP2A 4MN0A 5JOLA 2ZRSA 4I5LB 1CM1A 3OB2B 2JXLA 1OE9B 1AK8A 3GK1A 4BY5A 4MRYA 1ZFSA 3BQ3A 4PE0A 2BBNA 5AERA 1EG3A 1OMRA 2B1UA 4MSPA 4YGAA 2Q91A 2MA2A 4PCWA 4OCIA 1Y1AA 4PHKA 1PALA 2L5XB 4ORBB 3PSRA 4MVFA 1RTP1 1BLQA 3EK4A 2PSRA 2ZNDA 2D8NA 5BPJA 2KI6C 1KQVA 1N2DA 2CT9A 3BUMB 2WCBA 1SNLA 4C0JA 2CNPA 2LUCA 3K21A 4L9MA 4WQ3A 2LAPA 1A03A 2Y1NA 2Q4UA 2JU0A 3DD4A 1AJ4A 2K7BA 1DJWA 1K93D 4GNKB 1CTRA 2LVIA 1AJ5A 4QJ5B 5B8IB 4P2YB 1AP4A 3GOFA 1M31A 2G9BA 1IH0A 1OOJA 1BOCA 1TNWA 1JSAA 1UUSA 1YTZC 2NCPA 3SJSA 2PASA 1SL8A 1TCOB 1S3PA 3FWBA 1S1EA 2I7AA 3OB1B 1V1FA 2LLTA 3WHUB 3KEVA 2WNDA 1W7IB 4E68A 3LCPC 1MXEA 2F2PA 1SPYA 4YGEB 3NSLA 3SG2A 1XFWO 1TNPA 2KDHA 2KQYA 3CGAA 1AVSA 4I5KA 3EKJA 1GGZA 1QV0A 2QACA 1C7WA 1XFVO 1F54A 1IWQA 4OKHA 4ETOA 1DMOA 1V1GA 5CSJA 4GGNA 2JPTA 5KU1A 1SR6B 5I2LA 2EGDA 3CS1A 3SG4A 2KQ6A 1Y0VH 2GGMA 2LM5A 2O60A 5GQQC 3DF0A 3D10A 1KCYA 4C0KA 2HPSA 4HRGA 2BL0B 1KFXL 2KFHA 1ZUZA 2AAOA 1LINA 2LMVA 3TDZA 4PHMA 1NCYA 2PMYA 1SR6C 1TNQA 4A4CA 3NXAA 3LK0A 3O78A 5JJGA 2PVBA 1F4OA 2NXQA 1KFUL 4MZJA 1JF0A 2EC6C 1B8LA 2BL0C 2K0JA 1XFYO 4AOMA 1UHIA 2P6BB 4XJKB 3WHTB 1XFUO 2MLFC 1SYMA 4GGFA 1E8AA 1MXLC 1UURA 1J7PA 1QJTA 1IQ5A 2L98A 2I94A 1CM4A 4ORAB 2BCXA 2KBIA 3ICBA 1ZOTB 3VRQA 1ALWA 4N1FA 4USLA 1LA0A 3BUWB 2M7LA 3HCMA 1A2XA 2VRGA 2ZRTA 1IQ3A 4YBHB 4NDBA 1CLMA 1NCZA 2LLSA 5KSZA 1B8CA 1SCVA 4U8DA 2GGZA 1S36A 1WDCC 3BOWB 2KYCA 1CB1A 1OSAA 1XA5A 1S6CA 2M0RA 2KFGA 2CCMA 4ICBA 2WCEA 3CR2A 1ZMZA 2M1KB 2LNKA 1DT7B 2MJWB 2JULA 2LANA 1IJ6A 3VRPA 1BJFA 1OZOA 3BUXB 3SIAA 1U5IB 1WRZA 4CFQA 1YVLA 1J7OA 1CLBA 5IBWA 3NSIA 1GQMA 5HYDA 1NX2A 2EHBA 4HREE 4QJ4B 5HKZA 2F2OA 1TTXA 2MLEC 1NX1A 2H61A 3IQOA 4MZKA 1AUIB 3SG3A 2AMIA 3E3RA 2CBLA 1DJGA 3SIBA 2KGBC 2F3YA 1TNXA 2KAVA 3PFVA 2WORA 3DVMA 1OMVA 1FW4A 2E6WA 1LVCD 5ER5A 3PATA 3TDUA 1IRJA 4AQIA 2WOSA 1CFPA 1QIWA 2LE9B 5PALA 2MBXA 1B4CA 1KK8B 1EG4A 5AANA 2L2EA 1MWNA 5J3XA 2M9GA 1BF5A 3BYAA 2O5GA 2NCOA 1IG5A 1PSBA 1J7QA 2L4IA 1CFDA 1YRUB 4MZLA 1J7RA 4C0LA 2LC5A 4DRWA 4UPGA 1FPWA 3TS5B 1PSRA 2ZNEA 1M45A 4YGBB 4F0ZB 1EXRA 1NP8A 4ORCB 1YUSA 1QTXA 2K2AA 1QX7A 2L51A 3ZWHA 1S6JA 2KFFA 1NUBA 1XO5A 5G08A 1R6PA 1EL4A 1RROA 1HT9A 2HF5A 1WLZA 5K89A 4YI8A 4XYNA 1YUUA 3TUYB 3JTDB 2HQ8A 3TS5C 3RLZA 1IJ5A 1NWDA 1B7TZ 2G2BA 2LUXA 4GFTA 4JQ0D 1S6IA 1A75A 2KOTA 2LLUA 2ISDA 4R1EA 1RFJA 1M46A 1SW8A 1B7TY 4GBAA 2M1UA 1TIZA 1RJVA 1CFCA 4GPLB 2KGRA 2L50A 1QASA 2L4HA 1J55A 5KTYA 3AAKA 3JTDC
chains in the Genus database with same CATH superfamily
1OOHA 1UHKA 2Y5IA 3OX5A 2BECA 1J1EA 1FI5A 1CMGA 2JZIA 1WRLA 1DQEA 3KO0A 1KSMA 4PDZA 5FI2A 3BUNB 1G4YR 1YX8A 2WC8A 1XYDA 2L0PA 1PK0D 3Q8IA 5HKWA 2JOJA 2OS8B 1B8RA 5FYXA 4M2PA 3OGNA 4PHNA 3KF9A 1SRAA 2BKHB 3S0AA 1YUTA 2NZ0A 1G33A 1UHJA 3NSKA 1B47A 1SL7A 1C07A 2K2FA 1BU3A 1W7JB 1DJIA 2SCPA 3SS4A 5CSNA 1K9UA 1NX0A 3JVTB 3LK1A 1D1OA 3NHIA 4INWA 1GGWA 2FOTA 1CNPA 3PJIA 1NSHA 4CIDA 2M29A 2OS8C 2P71A 4XJKA 4YGCB 4OR9B 4M2OA 1DF0A 5HLOA 3WXAA 3SS3A 1XVJA 2M49B 3EVVA 5I2QA 1RK9A 4TNCA 1RWYA 2FCEA 1SY9A 2JRFA 1F55A 3LLEA 3FE9A 2Y4QA 2JC2A 2JWWA 3M0WA 4MEWA 1PVAA 4N5XA 4MRXA 1L2OB 4CLNA 1BMOA 2KI6D 1KWOB 1K95A 1B9AA 1Y1UA 3FE6A 4PALA 1Y1XA 3D0YB 1LA3A 1FF1A 2H2KA 4QJ3B 3IVTA 2MHHA 4OV2A 2JPOA 2E30A 1F8HA 2KI4B 2WCJA 2A4JA 2K8MB 3R1VA 4ZCVA 1L2OC 3B88A 1OOIX 2GTEA 3D77A 3GK4X 3SG6A 4N1GA 3CZTX 1R2UA 1AHRA 3IF7A 1QVIY 2RGIA 2BE6A 1F4QA 2CXJA 5FI7A 1A29A 1BR4B 2BE4A 3FWCA 1UP5A 5ER4X 5F6TA 1S26D 2KAXA 3L47A 2F3ZA 2MAZA 2OTGB 2M97A 1QX2A 1XFZO 4JKTA 3RZSA 3D74A 1YX7A 1Y6WA 1CLLA 1PVBA 2V53A 3DXLA 2IS9A 3PLFB 4YI9A 1CMFA 2WCKA 5DKNA 1L7ZA 1LXFC 1QXPA 1K2HA 1OZSA 1KK7Y 1SKTA 2JT3A 3FS7A 1YR5A 3L4AA 3EKHA 3O4YA 4PHJA 2OTGC 1DEKA 2K61A 5AXIA 3PALA 4DUQA 1UWOA 3CLNA 1OQPA 1F71A 1C3ZA 5D69A 4I5JA 4IL1A 1OOGA 4MLWA 4OZDA 1G8IA 3CZ1A 1YURA 2WCFA 1XFXO 5DICA 3MSEB 2BNXA 1SL9A 1S5GZ 4BY4A 3K1EA 2BBMA 1JFKA 2BCBA 2WC6A 1J1DA 3O4XA 1DJZA 4FTGA 4JPZB 1F70A 2F33A 4OVNF 4Q04A 3VRRA 2JT8A 3I5GB 1S5GY 2KBMA 1CDPA 2LVVA 1MHOA 2KNEA 3A8RA 4P5OE 2R2IA 1XK4C 3KHEA 3NSOA 3I5FB 1JWDA 1ALVA 1TUJA 1A4PA 3AKBA 1CKKA 4HSZA 2KHNA 3V2LA 1BG1A 2KPHA 1TRFA 1KK8C 1KFXS 3BXKA 1MQ1A 4PT1A 2PALA 5I8NA 2K7DA 4GAOA 3I5GC 1K8UA 3D76A 2L5YA 2HETA 1DJHA 3A4UB 3DVKA 5FI6A 5CSFA 4CFRA 1ODBA 2AUCA 3I5FC 1KFUS 1TN4A 4FQTA 2CTNA 2LCPA 1KQMB 4NDCA 3OP0A 2KAYA 3VRNA 5DKRA 5AEQA 5I2OA 1C7VA 2K7CA 2SASA 1CDLA 5HLVA 2H61C 2Y1MA 1DVIA 2LHIA 3CDNA 1X02A 4MBEA 2FCDA 1EJ3A 4M2QA 3VROA 4HRHA 3SG5A 4AQJA 3TDIA 2KLDA 4A4BA 3CYZA 1JBAA 1TOPA 2ZKMX 1IKUA 1M63B 1KQMC 3KPXA 1FBVA 3F45A 4NDDA 1ZACA 4I5NB 4D1EA 3DVJA 3D75A 4WQ2A 2HQWA 1YRTB 3OHMB 1JFJA 1VRKA 4FQOA 2NLNA 1DGUA 2ZN8A 3CABA 3CWGA 3LL8B 3HX4A 1K9KA 2JXCA 3FIAA 2K7OA 2L2CA 2ZN9A 1CDMA 4PE4A 1SK6D 5D7FA 3D73A 3I5HB 1K96A 1NYAA 1QLSA 3S0EA 3L4LA 2JT0A 1A75B 3DVEA 1OW4A 1SBJA 3GK2A 3S0DA 3QRXA 1JUOA 1WLMA 1K90D 1GJYA 1QIVA 2K60A 2ZFDA 3ZNIA 1MF8B 2BAPA 1UHNA 1QV1A 4DIRA 1QX5B 1C3YA 1H4BA 3UO9A 1SCMB 3OX6A 1DTLA 3JVTC 3BUOB 3I5HC 3TUYC 1BT6A 5CSIA 3D0YA 1N65A 2I18A 2LVJA 4WRIA 5DKQA 1CDNA 1NPQA 2EC6B 3SG7A 2F8PA 1EH2A 1UHHA 2KYFA 4DCKA 2BKIB 3H4SE 1WRKA 2KSPA 1SCMC 1Q80A 3DF0B 4CPVA 1QATA 2FJUB 2WCMA 3BJHA 3BOWA 4GUKA 3PM8A 4ZCUA 1RECA 4JWQA 3RM1A 3TZ1A 2JTZA 2OPOA 1MR8A 1H8BA 2LVKA 2LMUA 2M3WA 1QVIZ 2TN4A 3CR4X 1MUXA 1KSOA 3CR5X 1HQVA 3EVRA 1KWOC 1M39A 1TCFA 3O2PA 1QS7A 4PE7A 2COLB 1DF0B 1NX3A 1OMDA 1FI6A 1U5IA 1BR1B 1GM0A 2BCAA 1PULA 1WDCB 1PRWA 1NIWA 2LP3A 2QPTA 2WC5A 2KI4C 4DS7A 3O6BA 3EK8A 3DYEA 4NQGA 1K9PA 2MRDA 3WNXB 3I5IB 2JTTA 1DJYA 3PN7B 2QEVA 2DOQA 1KK7Z 1DGVA 2JNXA 1NCXA 1WY9A 2LHLA 1N0YA 1LKJA 3AKAA 2GV5A 1B1GA 2I2RE 4YGDB 1YVHA 3B87A 5D3OA 1BODA 1XK4A 2JNFA 1CFFA 3CTNA 2M7NA 5TNCA 5HKYA 1JC2A 4YRUA 1K94A 5CPVA 3AAJA 1DJXA 1QLKA 2LV7A 5AFPA 2PRUA 3C1VA 2LMTA 3I5IC 1IGVA 4GGFC 1OOFA 4PE1A 1DELA 3EK7A 3PN7C 3VGOA 2JQ6A 3IQQA 1JF2A 3UNWA 3EVUA 2M8UA 1SMGA 2LP2A 4MN0A 5JOLA 2ZRSA 4I5LB 1CM1A 3SS5A 3OB2B 2JXLA 1OE9B 3EG5B 3GK1A 1AK8A 4BY5A 4MRYA 3VB1A 1ZFSA 3BQ3A 4F7FA 3D78A 4PE0A 2BBNA 5AERA 1EG3A 1OMRA 2B1UA 3DZTA 4MSPA 4YGAA 2Q91A 2MA2A 3N7HA 4PCWA 4OCIA 1XFRA 1Y1AA 1PALA 1T14A 2L5XB 4ORBB 4PHKA 3PSRA 4MVFA 1RTP1 1BLQA 1Z4HA 3EK4A 2PSRA 2ZNDA 2D8NA 5BPJA 2KI6C 2P70A 3BFBA 1N2DA 1KQVA 2CT9A 3BUMB 2WCBA 2WCHA 1SNLA 4C0JA 2CNPA 2LUCA 3K21A 4L9MA 4WQ3A 1DC1A 2LAPA 1A03A 2PYQA 2Y1NA 2Q4UA 2JU0A 3QMEA 3DD4A 1AJ4A 2K7BA 1DJWA 1K93D 1W9ZA 1CTRA 4GNKB 2LVIA 3FE8A 1AJ5A 4QJ5B 5B8IB 4P2YB 1AP4A 3GOFA 1M31A 2G9BA 5EL2A 1OOJA 1IH0A 1BOCA 1TNWA 1JSAA 1UUSA 1YTZC 2NCPA 3SJSA 2PASA 1SL8A 1TCOB 2QEBA 1S3PA 3FWBA 1S1EA 2I7AA 3OB1B 1V1FA 2LLTA 3B86A 3WHUB 3KEVA 2WNDA 1W7IB 4E68A 3R72A 3LCPC 1MXEA 2F2PA 1SPYA 4YGEB 3NSLA 3SG2A 1XFWO 1TNPA 2KDHA 2KQYA 2QEOA 1AVSA 3CGAA 4I5KA 3EKJA 1GGZA 1QV0A 2QACA 1C7WA 1XFVO 1F54A 1IWQA 4OKHA 4ETOA 1Z2CB 1V1GA 5CSJA 4GGNA 2JPTA 5KU1A 1DMOA 1SR6B 5I2LA 3BFHA 2EGDA 3CS1A 3SG4A 2KQ6A 1Y0VH 2GGMA 2LM5A 2O60A 5GQQC 3DF0A 3D10A 1KCYA 4C0KA 2HPSA 1SSEB 4HRGA 2BL0B 1KFXL 2KFHA 5HL1A 1ZUZA 2AAOA 3DY9A 1LINA 3NGVA 2LMVA 3TDZA 4PHMA 1NCYA 2PMYA 1SR6C 1TNQA 4A4CA 3NXAA 3LK0A 3O78A 2H8VA 5JJGA 3NHTA 2PVBA 1F4OA 2NXQA 1KFUL 4MZJA 1JF0A 2EC6C 1B8LA 2BL0C 2K0JA 1XFYO 4AOMA 1UHIA 2P6BB 4XJKB 3WHTB 1XFUO 2MLFC 1SYMA 4GGFA 1E8AA 1MXLC 1UURA 1J7PA 4INXA 1QJTA 1IQ5A 2L98A 2I94A 1CM4A 4ORAB 3B6XA 2BCXA 2KBIA 3ICBA 1ZOTB 3VRQA 1ALWA 4N1FA 4USLA 1LA0A 3BUWB 2M7LA 3HCMA 1A2XA 2VRGA 2ZRTA 1IQ3A 4YBHB 4NDBA 1CLMA 1NCZA 2LLSA 5KSZA 1B8CA 1SCVA 4U8DA 2GGZA 1S36A 1WDCC 3BOWB 2KYCA 3CZ2A 1CB1A 1OSAA 1XA5A 1S6CA 2M0RA 3R1OA 2QDIA 2KFGA 2CCMA 4ICBA 2QEHA 1TWOA 2WCEA 3CR2A 1ZMZA 2M1KB 2LNKA 1DT7B 2MJWB 2JULA 3OBVA 2LANA 1IJ6A 3VRPA 1BJFA 1OZOA 3B7AA 3BUXB 4JD9A 4IJ7A 1U5IB 1WRZA 3SIAA 4CFQA 1TUZA 1YVLA 1J7OA 3BFAA 1CLBA 5IBWA 1QWVA 3NSIA 1GQMA 5HYDA 1NX2A 2EHBA 4HREE 4QJ4B 2KLEA 5HKZA 2F2OA 1TTXA 2MLEC 1NX1A 2H61A 3IQOA 4MZKA 1AUIB 3SG3A 2AMIA 3E3RA 2CBLA 1DJGA 3SIBA 2KGBC 2F3YA 1TNXA 2KAVA 4KYNA 3PFVA 2WORA 3DVMA 1OMVA 1FW4A 2E6WA 1LVCD 3PM2A 5ER5A 1IIOA 3PATA 1P28A 2ERBA 3TDUA 3S0GA 1IRJA 4AQIA 2WOSA 1CFPA 1QIWA 2LE9B 5PALA 2MBXA 1B4CA 1KK8B 1EG4A 5AANA 2L2EA 1MWNA 5J3XA 2M9GA 1BF5A 3BYAA 2O5GA 2NCOA 1IG5A 1PSBA 1J7QA 2L4IA 1CFDA 1YRUB 4MZLA 1ORGA 5I94A 1J7RA 4C0LA 2LC5A 4DRWA 4UPGA 1FPWA 3TS5B 1PSRA 2ZNEA 1M45A 4YGBB 4F0ZB 1EXRA 1NP8A 4ORCB 1YUSA 1QTXA 2K2AA 1QX7A 3CZ0A 2L51A 3ZWHA 1S6JA 3S0BA 2KFFA 1NUBA 3R1PA 1XO5A 5G08A 1R6PA 1EL4A 1RROA 1HT9A 2HF5A 1WLZA 2YGUA 4YI8A 5K89A 3S0FA 4XYNA 1YUUA 2PQLA 3JTDB 2HQ8A 3TS5C 3RLZA 3TUYB 1LS8A 1IJ5A 1NWDA 1B7TZ 2G2BA 2LUXA 4GFTA 4JQ0D 1S6IA 2FJYA 1A75A 2KOTA 2LLUA 2WCLA 4R1EA 1RFJA 2ISDA 1M46A 1SW8A 1B7TY 4GBAA 2M1UA 1TIZA 1RJVA 1CFCA 4GPLB 2KGRA 2L50A 1QASA 2L4HA 1J55A 5KTYA 3AAKA 3JTDC
chains in the Genus database with same CATH topology
1UHKA 2Y5IA 3OX5A 2BECA 1J1EA 1FI5A 1CMGA 2JZIA 1WRLA 3KO0A 4PDZA 1KSMA 5FI2A 3BUNB 1G4YR 1YX8A 2WC8A 1XYDA 2L0PA 1PK0D 5HKWA 2JOJA 2OS8B 1B8RA 5FYXA 4M2PA 4PHNA 3KF9A 1SRAA 2BKHB 1YUTA 2NZ0A 1G33A 1UHJA 3NSKA 1B47A 1SL7A 1C07A 2K2FA 1BU3A 1W7JB 1DJIA 2SCPA 3SS4A 5CSNA 1K9UA 1NX0A 3JVTB 3LK1A 1D1OA 1GGWA 2FOTA 1CNPA 1NSHA 4CIDA 2M29A 2OS8C 4XJKA 4YGCB 4OR9B 4M2OA 1DF0A 5HLOA 3WXAA 3SS3A 1XVJA 2M49B 3EVVA 5I2QA 1RK9A 4TNCA 1RWYA 2FCEA 1SY9A 2JRFA 1F55A 3LLEA 2Y4QA 2JC2A 2JWWA 3M0WA 4MEWA 1PVAA 4N5XA 4MRXA 1L2OB 4CLNA 1BMOA 2KI6D 1KWOB 1K95A 1B9AA 1Y1UA 4PALA 1Y1XA 3D0YB 1LA3A 1FF1A 2H2KA 4QJ3B 3IVTA 2MHHA 4OV2A 2E30A 1F8HA 2KI4B 2A4JA 2K8MB 4ZCVA 1L2OC 3GK4X 3SG6A 4N1GA 3CZTX 1R2UA 1AHRA 3IF7A 1QVIY 2RGIA 2BE6A 1F4QA 2CXJA 5FI7A 2BE4A 1A29A 1BR4B 3FWCA 1UP5A 5ER4X 5F6TA 1S26D 2KAXA 2F3ZA 2MAZA 2OTGB 2M97A 1QX2A 1XFZO 4JKTA 1YX7A 1Y6WA 1CLLA 1PVBA 2V53A 2IS9A 3PLFB 4YI9A 1CMFA 5DKNA 1L7ZA 1LXFC 1QXPA 1K2HA 1OZSA 1KK7Y 1SKTA 2JT3A 3FS7A 1YR5A 3O4YA 3EKHA 4PHJA 2OTGC 1DEKA 2K61A 5AXIA 3PALA 4DUQA 1UWOA 3CLNA 1OQPA 1F71A 5D69A 4I5JA 4IL1A 4MLWA 1G8IA 1YURA 2WCFA 1XFXO 3MSEB 2BNXA 1SL9A 1S5GZ 4BY4A 2BBMA 1JFKA 2BCBA 4FTGA 1J1DA 3O4XA 1DJZA 4JPZB 1F70A 2F33A 4OVNF 4Q04A 3VRRA 2JT8A 3I5GB 1S5GY 2KBMA 1CDPA 2LVVA 1MHOA 2KNEA 3A8RA 4P5OE 2R2IA 1XK4C 3KHEA 3NSOA 3I5FB 1JWDA 1ALVA 3AKBA 1A4PA 1CKKA 4HSZA 2KHNA 1BG1A 1TRFA 1KK8C 1KFXS 3BXKA 1MQ1A 5I8NA 2PALA 2K7DA 4GAOA 3I5GC 1K8UA 2L5YA 2HETA 1DJHA 3A4UB 3DVKA 5FI6A 5CSFA 4CFRA 1ODBA 2AUCA 3I5FC 1KFUS 1TN4A 2CTNA 2LCPA 1KQMB 4NDCA 3OP0A 2KAYA 3VRNA 5DKRA 5AEQA 5I2OA 1C7VA 2K7CA 2SASA 1CDLA 5HLVA 2H61C 2Y1MA 1DVIA 2LHIA 1X02A 4MBEA 2FCDA 1EJ3A 4M2QA 3VROA 4HRHA 3SG5A 4AQJA 3TDIA 2KLDA 4A4BA 1JBAA 1TOPA 2ZKMX 1IKUA 1M63B 1KQMC 3KPXA 1FBVA 3F45A 4NDDA 1ZACA 4I5NB 4D1EA 3DVJA 4WQ2A 2HQWA 1YRTB 3OHMB 1JFJA 1VRKA 4FQOA 2NLNA 1DGUA 2ZN8A 3CWGA 3LL8B 3HX4A 1K9KA 2JXCA 3FIAA 2K7OA 2ZN9A 1CDMA 4PE4A 1SK6D 5D7FA 3I5HB 1K96A 1NYAA 1QLSA 2JT0A 1A75B 3DVEA 1SBJA 3GK2A 3QRXA 1JUOA 1WLMA 1K90D 1GJYA 1QIVA 2ZFDA 3ZNIA 2K60A 1MF8B 2BAPA 1UHNA 1QV1A 4DIRA 1QX5B 1H4BA 3UO9A 1SCMB 3OX6A 1DTLA 3JVTC 3BUOB 3I5HC 3TUYC 1BT6A 5CSIA 3D0YA 1N65A 2I18A 2LVJA 4WRIA 5DKQA 1CDNA 1NPQA 2EC6B 3SG7A 2F8PA 1EH2A 1UHHA 2KYFA 4DCKA 2BKIB 3H4SE 1WRKA 2KSPA 1SCMC 1Q80A 3DF0B 4CPVA 1QATA 2FJUB 3BOWA 4GUKA 3PM8A 4ZCUA 1RECA 4JWQA 3RM1A 3TZ1A 2JTZA 2OPOA 1MR8A 1H8BA 2LVKA 2LMUA 2M3WA 1QVIZ 2TN4A 3CR4X 1MUXA 1KSOA 3CR5X 1HQVA 3EVRA 1KWOC 1M39A 1TCFA 3O2PA 1QS7A 4PE7A 2COLB 1DF0B 1NX3A 1OMDA 1FI6A 1U5IA 1BR1B 2BCAA 1PULA 1WDCB 1PRWA 1NIWA 2LP3A 2QPTA 4DS7A 2KI4C 3O6BA 3EK8A 4NQGA 1K9PA 2MRDA 3WNXB 3I5IB 2JTTA 1DJYA 3PN7B 2DOQA 1KK7Z 1DGVA 2JNXA 1NCXA 1WY9A 2LHLA 1N0YA 1LKJA 3AKAA 2GV5A 1B1GA 2I2RE 4YGDB 1YVHA 5D3OA 1BODA 1XK4A 2JNFA 1CFFA 3CTNA 2M7NA 5TNCA 5HKYA 1JC2A 4YRUA 1K94A 5CPVA 3AAJA 1DJXA 1QLKA 2LV7A 5AFPA 2PRUA 3C1VA 2LMTA 3I5IC 1IGVA 4GGFC 4PE1A 3EK7A 3PN7C 1DELA 3VGOA 2JQ6A 3IQQA 1JF2A 3UNWA 3EVUA 2M8UA 1SMGA 2LP2A 4MN0A 5JOLA 2ZRSA 4I5LB 1CM1A 3SS5A 3OB2B 2JXLA 1OE9B 1AK8A 3GK1A 3EG5B 4BY5A 4MRYA 1ZFSA 3BQ3A 4PE0A 2BBNA 5AERA 1EG3A 1OMRA 2B1UA 4MSPA 4YGAA 2Q91A 2MA2A 4PCWA 4OCIA 1Y1AA 4PHKA 1PALA 2L5XB 4ORBB 3PSRA 4MVFA 1RTP1 1BLQA 1Z4HA 3EK4A 2PSRA 2ZNDA 2D8NA 5BPJA 2KI6C 1KQVA 1N2DA 2CT9A 3BUMB 2WCBA 1SNLA 4C0JA 2CNPA 2LUCA 3K21A 4L9MA 4WQ3A 1DC1A 2LAPA 1A03A 2Y1NA 2Q4UA 2JU0A 3DD4A 1AJ4A 2K7BA 1DJWA 1K93D 4GNKB 1CTRA 1W9ZA 2LVIA 1AJ5A 4QJ5B 5B8IB 4P2YB 1AP4A 3GOFA 1M31A 2G9BA 1IH0A 1OOJA 1BOCA 1TNWA 1JSAA 1UUSA 1YTZC 2NCPA 3SJSA 2PASA 1SL8A 1TCOB 1S3PA 3FWBA 1S1EA 2I7AA 3OB1B 1V1FA 2LLTA 3WHUB 3KEVA 2WNDA 1W7IB 4E68A 3LCPC 1MXEA 2F2PA 1SPYA 4YGEB 3NSLA 3SG2A 1XFWO 1TNPA 2KDHA 2KQYA 3CGAA 1AVSA 4I5KA 3EKJA 1GGZA 1QV0A 2QACA 1C7WA 1XFVO 1F54A 1IWQA 4OKHA 4ETOA 1DMOA 1V1GA 5CSJA 4GGNA 2JPTA 5KU1A 1Z2CB 1SR6B 5I2LA 2EGDA 3CS1A 3SG4A 2KQ6A 1Y0VH 2GGMA 2LM5A 2O60A 5GQQC 3DF0A 3D10A 1KCYA 4C0KA 2HPSA 4HRGA 2BL0B 1KFXL 2KFHA 5HL1A 1ZUZA 2AAOA 1LINA 2LMVA 3TDZA 4PHMA 1NCYA 2PMYA 1SR6C 1TNQA 4A4CA 3NXAA 3LK0A 3O78A 5JJGA 2PVBA 1F4OA 2NXQA 1KFUL 4MZJA 1JF0A 2EC6C 1B8LA 2BL0C 2K0JA 1XFYO 4AOMA 1UHIA 2P6BB 4XJKB 3WHTB 1XFUO 2MLFC 1SYMA 4GGFA 1E8AA 1MXLC 1UURA 1J7PA 1QJTA 1IQ5A 2L98A 2I94A 1CM4A 4ORAB 2BCXA 2KBIA 3ICBA 1ZOTB 3VRQA 1ALWA 4N1FA 4USLA 1LA0A 3BUWB 2M7LA 3HCMA 1A2XA 2VRGA 2ZRTA 1IQ3A 4YBHB 4NDBA 1CLMA 1NCZA 2LLSA 5KSZA 1B8CA 1SCVA 4U8DA 2GGZA 1S36A 1WDCC 3BOWB 2KYCA 1CB1A 1OSAA 1XA5A 1S6CA 2M0RA 2KFGA 2CCMA 4ICBA 2WCEA 3CR2A 1ZMZA 2M1KB 2LNKA 1DT7B 2MJWB 2JULA 3OBVA 2LANA 1IJ6A 3VRPA 1BJFA 1OZOA 3BUXB 3SIAA 1U5IB 1WRZA 4CFQA 4IJ7A 1YVLA 1J7OA 1CLBA 5IBWA 3NSIA 1GQMA 5HYDA 1NX2A 2EHBA 4HREE 4QJ4B 5HKZA 2KLEA 2F2OA 1TTXA 2MLEC 1NX1A 2H61A 3IQOA 4MZKA 1AUIB 3SG3A 2AMIA 3E3RA 2CBLA 1DJGA 3SIBA 2KGBC 2F3YA 1TNXA 2KAVA 4KYNA 3PFVA 2WORA 3DVMA 1OMVA 1FW4A 2E6WA 1LVCD 5ER5A 3PM2A 3PATA 3TDUA 1IRJA 4AQIA 2WOSA 1CFPA 1QIWA 2LE9B 5PALA 2MBXA 1B4CA 1KK8B 1EG4A 5AANA 2L2EA 1MWNA 5J3XA 2M9GA 1BF5A 3BYAA 2O5GA 2NCOA 1IG5A 1PSBA 1J7QA 2L4IA 1CFDA 1YRUB 4MZLA 5I94A 1J7RA 4C0LA 2LC5A 4DRWA 4UPGA 1FPWA 3TS5B 1PSRA 2ZNEA 1M45A 4YGBB 4F0ZB 1EXRA 1NP8A 4ORCB 1YUSA 1QTXA 2K2AA 1QX7A 2L51A 3ZWHA 1S6JA 2KFFA 1NUBA 1XO5A 5G08A 1R6PA 1EL4A 1RROA 1HT9A 2HF5A 1WLZA 5K89A 4YI8A 2YGUA 4XYNA 1YUUA 3TUYB 3JTDB 2HQ8A 3TS5C 3RLZA 1IJ5A 1NWDA 1B7TZ 2G2BA 2LUXA 4GFTA 4JQ0D 1S6IA 1A75A 2KOTA 2LLUA 2ISDA 4R1EA 1RFJA 1M46A 1SW8A 1B7TY 4GBAA 2M1UA 1TIZA 1RJVA 1CFCA 4GPLB 2KGRA 2L50A 1QASA 2L4HA 1J55A 5KTYA 3AAKA 3JTDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHK A;  2Y5I A;  3OX5 A;  2BEC A;  1J1E A;  1FI5 A;  1CMG A;  2JZI A;  1WRL A;  3KO0 A;  4PDZ A;  1KSM A;  3BUN B;  1G4Y R;  1YX8 A;  2WC8 A;  1XYD A;  2L0P A;  1PK0 D;  5HKW A;  2JOJ A;  2OS8 B;  1B8R A;  5FYX A;  4M2P A;  4PHN A;  3KF9 A;  1SRA A;  2BKH B;  1YUT A;  2NZ0 A;  1G33 A;  1UHJ A;  3NSK A;  1B47 A;  1SL7 A;  1C07 A;  2K2F A;  1BU3 A;  1W7J B;  1DJI A;  2SCP A;  5CSN A;  1K9U A;  1NX0 A;  3JVT B;  3LK1 A;  1D1O A;  1GGW A;  2FOT A;  1CNP A;  1NSH A;  4CID A;  2M29 A;  2OS8 C;  4XJK A;  4YGC B;  4OR9 B;  4M2O A;  1DF0 A;  5HLO A;  3WXA A;  1XVJ A;  2M49 B;  3EVV A;  5I2Q A;  1RK9 A;  4TNC A;  1RWY A;  2FCE A;  1SY9 A;  2JRF A;  1F55 A;  3LLE A;  2Y4Q A;  2JC2 A;  2JWW A;  3M0W A;  4MEW A;  1PVA A;  4N5X A;  4MRX A;  1L2O B;  4CLN A;  1BMO A;  2KI6 D;  1KWO B;  1K95 A;  1B9A A;  1Y1U A;  4PAL A;  1Y1X A;  3D0Y B;  1LA3 A;  1FF1 A;  2H2K A;  4QJ3 B;  2MHH A;  4OV2 A;  2E30 A;  1F8H A;  2KI4 B;  2A4J A;  2K8M B;  4ZCV A;  1L2O C;  3GK4 X;  3SG6 A;  4N1G A;  3CZT X;  1R2U A;  1AHR A;  3IF7 A;  1QVI Y;  2RGI A;  2BE6 A;  1F4Q A;  2CXJ A;  2BE4 A;  1A29 A;  1BR4 B;  3FWC A;  1UP5 A;  5ER4 X;  5F6T A;  1S26 D;  2KAX A;  2F3Z A;  2MAZ A;  2OTG B;  2M97 A;  1QX2 A;  1XFZ O;  1YX7 A;  1Y6W A;  1CLL A;  1PVB A;  2V53 A;  2IS9 A;  3PLF B;  4YI9 A;  1CMF A;  5DKN A;  1L7Z A;  1LXF C;  1QXP A;  1K2H A;  1OZS A;  1KK7 Y;  1SKT A;  2JT3 A;  3FS7 A;  1YR5 A;  3O4Y A;  3EKH A;  4PHJ A;  2OTG C;  2K61 A;  5AXI A;  3PAL A;  4DUQ A;  1UWO A;  3CLN A;  1OQP A;  1F71 A;  5D69 A;  4I5J A;  4IL1 A;  4MLW A;  1G8I A;  1YUR A;  2WCF A;  1XFX O;  3MSE B;  1SL9 A;  1S5G Z;  4BY4 A;  2BBM A;  1JFK A;  2BCB A;  4FTG A;  1J1D A;  1DJZ A;  4JPZ B;  1F70 A;  2F33 A;  4OVN F;  4Q04 A;  3VRR A;  2JT8 A;  3I5G B;  1S5G Y;  2KBM A;  1CDP A;  2LVV A;  1MHO A;  2KNE A;  3A8R A;  4P5O E;  2R2I A;  1XK4 C;  3KHE A;  3NSO A;  3I5F B;  1JWD A;  1ALV A;  3AKB A;  1A4P A;  1CKK A;  4HSZ A;  2KHN A;  1BG1 A;  1TRF A;  1KK8 C;  1KFX S;  3BXK A;  1MQ1 A;  5I8N A;  2PAL A;  2K7D A;  4GAO A;  3I5G C;  1K8U A;  2HET A;  1DJH A;  3A4U B;  3DVK A;  5CSF A;  4CFR A;  1ODB A;  2AUC A;  3I5F C;  1KFU S;  1TN4 A;  2CTN A;  2LCP A;  1KQM B;  4NDC A;  3OP0 A;  2KAY A;  3VRN A;  5DKR A;  5AEQ A;  5I2O A;  1C7V A;  2K7C A;  2SAS A;  1CDL A;  5HLV A;  2H61 C;  2Y1M A;  1DVI A;  2LHI A;  1X02 A;  4MBE A;  2FCD A;  1EJ3 A;  4M2Q A;  3VRO A;  4HRH A;  3SG5 A;  4AQJ A;  3TDI A;  4A4B A;  1JBA A;  1TOP A;  2ZKM X;  1IKU A;  1M63 B;  1KQM C;  3KPX A;  1FBV A;  3F45 A;  4NDD A;  1ZAC A;  4I5N B;  4D1E A;  3DVJ A;  4WQ2 A;  2HQW A;  1YRT B;  3OHM B;  1JFJ A;  1VRK A;  4FQO A;  2NLN A;  1DGU A;  2ZN8 A;  3CWG A;  3LL8 B;  3HX4 A;  1K9K A;  2JXC A;  3FIA A;  2K7O A;  2ZN9 A;  1CDM A;  4PE4 A;  1SK6 D;  5D7F A;  3I5H B;  1K96 A;  1NYA A;  1QLS A;  2JT0 A;  1A75 B;  3DVE A;  1SBJ A;  3GK2 A;  3QRX A;  1JUO A;  1WLM A;  1K90 D;  1GJY A;  1QIV A;  2ZFD A;  3ZNI A;  1MF8 B;  1UHN A;  1QV1 A;  4DIR A;  1QX5 B;  1H4B A;  1SCM B;  3OX6 A;  1DTL A;  3JVT C;  3BUO B;  3I5H C;  3TUY C;  1BT6 A;  5CSI A;  3D0Y A;  1N65 A;  2I18 A;  2LVJ A;  4WRI A;  5DKQ A;  1CDN A;  1NPQ A;  2EC6 B;  3SG7 A;  2F8P A;  1EH2 A;  1UHH A;  2KYF A;  4DCK A;  2BKI B;  3H4S E;  1WRK A;  2KSP A;  1SCM C;  1Q80 A;  3DF0 B;  4CPV A;  1QAT A;  2FJU B;  3BOW A;  4GUK A;  3PM8 A;  4ZCU A;  1REC A;  4JWQ A;  3RM1 A;  3TZ1 A;  2JTZ A;  2OPO A;  1MR8 A;  1H8B A;  2LVK A;  2LMU A;  2M3W A;  1QVI Z;  2TN4 A;  3CR4 X;  1MUX A;  1KSO A;  3CR5 X;  1HQV A;  3EVR A;  1KWO C;  1M39 A;  1TCF A;  3O2P A;  1QS7 A;  4PE7 A;  2COL B;  1DF0 B;  1NX3 A;  1OMD A;  1FI6 A;  1U5I A;  1BR1 B;  2BCA A;  1PUL A;  1WDC B;  1PRW A;  1NIW A;  2LP3 A;  2QPT A;  4DS7 A;  2KI4 C;  3O6B A;  3EK8 A;  4NQG A;  1K9P A;  2MRD A;  3WNX B;  3I5I B;  2JTT A;  1DJY A;  3PN7 B;  2DOQ A;  1KK7 Z;  1DGV A;  2JNX A;  1NCX A;  1WY9 A;  2LHL A;  1N0Y A;  1LKJ A;  3AKA A;  2GV5 A;  1B1G A;  2I2R E;  4YGD B;  1YVH A;  1BOD A;  1XK4 A;  2JNF A;  1CFF A;  3CTN A;  2M7N A;  5TNC A;  5HKY A;  1JC2 A;  4YRU A;  1K94 A;  5CPV A;  3AAJ A;  1DJX A;  1QLK A;  2LV7 A;  5AFP A;  2PRU A;  3C1V A;  2LMT A;  3I5I C;  1IGV A;  4GGF C;  4PE1 A;  3EK7 A;  3PN7 C;  3VGO A;  2JQ6 A;  3IQQ A;  1JF2 A;  3EVU A;  2M8U A;  1SMG A;  2LP2 A;  4MN0 A;  5JOL A;  2ZRS A;  4I5L B;  1CM1 A;  3OB2 B;  2JXL A;  1OE9 B;  1AK8 A;  3GK1 A;  4BY5 A;  4MRY A;  1ZFS A;  3BQ3 A;  4PE0 A;  2BBN A;  5AER A;  1EG3 A;  1OMR A;  2B1U A;  4MSP A;  4YGA A;  2Q91 A;  2MA2 A;  4PCW A;  4OCI A;  1Y1A A;  4PHK A;  1PAL A;  2L5X B;  4ORB B;  3PSR A;  4MVF A;  1RTP 1;  1BLQ A;  3EK4 A;  2PSR A;  2ZND A;  2D8N A;  5BPJ A;  2KI6 C;  1KQV A;  1N2D A;  2CT9 A;  3BUM B;  2WCB A;  1SNL A;  4C0J A;  2CNP A;  2LUC A;  3K21 A;  4L9M A;  4WQ3 A;  2LAP A;  1A03 A;  2Y1N A;  2Q4U A;  2JU0 A;  3DD4 A;  1AJ4 A;  2K7B A;  1DJW A;  1K93 D;  4GNK B;  1CTR A;  2LVI A;  1AJ5 A;  4QJ5 B;  5B8I B;  4P2Y B;  1AP4 A;  3GOF A;  1M31 A;  2G9B A;  1IH0 A;  1OOJ A;  1BOC A;  1TNW A;  1JSA A;  1UUS A;  1YTZ C;  2NCP A;  3SJS A;  2PAS A;  1SL8 A;  1TCO B;  1S3P A;  3FWB A;  1S1E A;  2I7A A;  3OB1 B;  1V1F A;  2LLT A;  3WHU B;  3KEV A;  2WND A;  1W7I B;  4E68 A;  3LCP C;  1MXE A;  2F2P A;  1SPY A;  4YGE B;  3NSL A;  3SG2 A;  1XFW O;  1TNP A;  2KDH A;  2KQY A;  3CGA A;  1AVS A;  4I5K A;  3EKJ A;  1GGZ A;  1QV0 A;  2QAC A;  1C7W A;  1XFV O;  1F54 A;  1IWQ A;  4OKH A;  4ETO A;  1DMO A;  1V1G A;  5CSJ A;  4GGN A;  2JPT A;  5KU1 A;  1SR6 B;  5I2L A;  2EGD A;  3CS1 A;  3SG4 A;  2KQ6 A;  1Y0V H;  2GGM A;  2LM5 A;  2O60 A;  5GQQ C;  3DF0 A;  3D10 A;  1KCY A;  4C0K A;  2HPS A;  4HRG A;  2BL0 B;  1KFX L;  2KFH A;  1ZUZ A;  2AAO A;  1LIN A;  2LMV A;  3TDZ A;  4PHM A;  1NCY A;  2PMY A;  1SR6 C;  1TNQ A;  4A4C A;  3NXA A;  3LK0 A;  3O78 A;  5JJG A;  2PVB A;  1F4O A;  2NXQ A;  1KFU L;  4MZJ A;  1JF0 A;  2EC6 C;  1B8L A;  2BL0 C;  2K0J A;  1XFY O;  4AOM A;  1UHI A;  2P6B B;  4XJK B;  3WHT B;  1XFU O;  2MLF C;  1SYM A;  4GGF A;  1E8A A;  1MXL C;  1UUR A;  1J7P A;  1QJT A;  1IQ5 A;  2L98 A;  2I94 A;  1CM4 A;  4ORA B;  2BCX A;  2KBI A;  3ICB A;  1ZOT B;  3VRQ A;  1ALW A;  4N1F A;  4USL A;  1LA0 A;  3BUW B;  2M7L A;  3HCM A;  1A2X A;  2VRG A;  2ZRT A;  1IQ3 A;  4YBH B;  4NDB A;  1CLM A;  1NCZ A;  2LLS A;  5KSZ A;  1B8C A;  1SCV A;  4U8D A;  2GGZ A;  1S36 A;  1WDC C;  3BOW B;  2KYC A;  1CB1 A;  1OSA A;  1XA5 A;  1S6C A;  2M0R A;  2KFG A;  2CCM A;  4ICB A;  2WCE A;  3CR2 A;  1ZMZ A;  2M1K B;  2LNK A;  1DT7 B;  2MJW B;  2JUL A;  2LAN A;  1IJ6 A;  3VRP A;  1BJF A;  1OZO A;  3BUX B;  3SIA A;  1U5I B;  1WRZ A;  4CFQ A;  1YVL A;  1J7O A;  1CLB A;  5IBW A;  3NSI A;  1GQM A;  5HYD A;  1NX2 A;  2EHB A;  4HRE E;  4QJ4 B;  5HKZ A;  2F2O A;  1TTX A;  2MLE C;  1NX1 A;  2H61 A;  3IQO A;  4MZK A;  1AUI B;  3SG3 A;  2AMI A;  3E3R A;  2CBL A;  1DJG A;  3SIB A;  2KGB C;  2F3Y A;  1TNX A;  2KAV A;  3PFV A;  2WOR A;  3DVM A;  1OMV A;  1FW4 A;  2E6W A;  1LVC D;  5ER5 A;  3PAT A;  3TDU A;  1IRJ A;  4AQI A;  2WOS A;  1CFP A;  1QIW A;  2LE9 B;  5PAL A;  2MBX A;  1B4C A;  1KK8 B;  1EG4 A;  5AAN A;  2L2E A;  1MWN A;  5J3X A;  2M9G A;  1BF5 A;  3BYA A;  2O5G A;  2NCO A;  1IG5 A;  1PSB A;  1J7Q A;  2L4I A;  1CFD A;  1YRU B;  4MZL A;  1J7R A;  4C0L A;  2LC5 A;  4DRW A;  4UPG A;  1FPW A;  3TS5 B;  1PSR A;  2ZNE A;  1M45 A;  4YGB B;  4F0Z B;  1EXR A;  1NP8 A;  4ORC B;  1YUS A;  1QTX A;  2K2A A;  1QX7 A;  2L51 A;  3ZWH A;  1S6J A;  2KFF A;  1NUB A;  1XO5 A;  5G08 A;  1R6P A;  1EL4 A;  1RRO A;  1HT9 A;  2HF5 A;  1WLZ A;  5K89 A;  4YI8 A;  4XYN A;  1YUU A;  3TUY B;  3JTD B;  2HQ8 A;  3TS5 C;  3RLZ A;  1IJ5 A;  1NWD A;  1B7T Z;  2G2B A;  2LUX A;  4GFT A;  4JQ0 D;  1S6I A;  1A75 A;  2KOT A;  2LLU A;  2ISD A;  4R1E A;  1RFJ A;  1M46 A;  1SW8 A;  1B7T Y;  4GBA A;  2M1U A;  1TIZ A;  1RJV A;  1CFC A;  4GPL B;  2KGR A;  2L50 A;  1QAS A;  2L4H A;  1J55 A;  5KTY A;  3AAK A;  3JTD C; 
#chains in the Genus database with same CATH topology
 1OOH A;  1UHK A;  2Y5I A;  3OX5 A;  2BEC A;  1J1E A;  1FI5 A;  1CMG A;  2JZI A;  1WRL A;  1DQE A;  3KO0 A;  1KSM A;  4PDZ A;  5FI2 A;  3BUN B;  1G4Y R;  1YX8 A;  2WC8 A;  1XYD A;  2L0P A;  1PK0 D;  3Q8I A;  5HKW A;  2JOJ A;  2OS8 B;  1B8R A;  5FYX A;  4M2P A;  3OGN A;  4PHN A;  3KF9 A;  1SRA A;  2BKH B;  3S0A A;  1YUT A;  2NZ0 A;  1G33 A;  1UHJ A;  3NSK A;  1B47 A;  1SL7 A;  1C07 A;  2K2F A;  1BU3 A;  1W7J B;  1DJI A;  2SCP A;  3SS4 A;  5CSN A;  1K9U A;  1NX0 A;  3JVT B;  3LK1 A;  1D1O A;  3NHI A;  4INW A;  1GGW A;  2FOT A;  1CNP A;  3PJI A;  1NSH A;  4CID A;  2M29 A;  2OS8 C;  2P71 A;  4XJK A;  4YGC B;  4OR9 B;  4M2O A;  1DF0 A;  5HLO A;  3WXA A;  3SS3 A;  1XVJ A;  2M49 B;  3EVV A;  5I2Q A;  1RK9 A;  4TNC A;  1RWY A;  2FCE A;  1SY9 A;  2JRF A;  1F55 A;  3LLE A;  3FE9 A;  2Y4Q A;  2JC2 A;  2JWW A;  3M0W A;  4MEW A;  1PVA A;  4N5X A;  4MRX A;  1L2O B;  4CLN A;  1BMO A;  2KI6 D;  1KWO B;  1K95 A;  1B9A A;  1Y1U A;  3FE6 A;  4PAL A;  1Y1X A;  3D0Y B;  1LA3 A;  1FF1 A;  2H2K A;  4QJ3 B;  3IVT A;  2MHH A;  4OV2 A;  2JPO A;  2E30 A;  1F8H A;  2KI4 B;  2WCJ A;  2A4J A;  2K8M B;  3R1V A;  4ZCV A;  1L2O C;  3B88 A;  1OOI X;  2GTE A;  3D77 A;  3GK4 X;  3SG6 A;  4N1G A;  3CZT X;  1R2U A;  1AHR A;  3IF7 A;  1QVI Y;  2RGI A;  2BE6 A;  1F4Q A;  2CXJ A;  5FI7 A;  1A29 A;  1BR4 B;  2BE4 A;  3FWC A;  1UP5 A;  5ER4 X;  5F6T A;  1S26 D;  2KAX A;  3L47 A;  2F3Z A;  2MAZ A;  2OTG B;  2M97 A;  1QX2 A;  1XFZ O;  4JKT A;  3RZS A;  3D74 A;  1YX7 A;  1Y6W A;  1CLL A;  1PVB A;  2V53 A;  3DXL A;  2IS9 A;  3PLF B;  4YI9 A;  1CMF A;  2WCK A;  5DKN A;  1L7Z A;  1LXF C;  1QXP A;  1K2H A;  1OZS A;  1KK7 Y;  1SKT A;  2JT3 A;  3FS7 A;  1YR5 A;  3L4A A;  3EKH A;  3O4Y A;  4PHJ A;  2OTG C;  1DEK A;  2K61 A;  5AXI A;  3PAL A;  4DUQ A;  1UWO A;  3CLN A;  1OQP A;  1F71 A;  1C3Z A;  5D69 A;  4I5J A;  4IL1 A;  1OOG A;  4MLW A;  4OZD A;  1G8I A;  3CZ1 A;  1YUR A;  2WCF A;  1XFX O;  5DIC A;  3MSE B;  2BNX A;  1SL9 A;  1S5G Z;  4BY4 A;  3K1E A;  2BBM A;  1JFK A;  2BCB A;  2WC6 A;  1J1D A;  3O4X A;  1DJZ A;  4FTG A;  4JPZ B;  1F70 A;  2F33 A;  4OVN F;  4Q04 A;  3VRR A;  2JT8 A;  3I5G B;  1S5G Y;  2KBM A;  1CDP A;  2LVV A;  1MHO A;  2KNE A;  3A8R A;  4P5O E;  2R2I A;  1XK4 C;  3KHE A;  3NSO A;  3I5F B;  1JWD A;  1ALV A;  1TUJ A;  1A4P A;  3AKB A;  1CKK A;  4HSZ A;  2KHN A;  3V2L A;  1BG1 A;  2KPH A;  1TRF A;  1KK8 C;  1KFX S;  3BXK A;  1MQ1 A;  4PT1 A;  2PAL A;  5I8N A;  2K7D A;  4GAO A;  3I5G C;  1K8U A;  3D76 A;  2L5Y A;  2HET A;  1DJH A;  3A4U B;  3DVK A;  5FI6 A;  5CSF A;  4CFR A;  1ODB A;  2AUC A;  3I5F C;  1KFU S;  1TN4 A;  4FQT A;  2CTN A;  2LCP A;  1KQM B;  4NDC A;  3OP0 A;  2KAY A;  3VRN A;  5DKR A;  5AEQ A;  5I2O A;  1C7V A;  2K7C A;  2SAS A;  1CDL A;  5HLV A;  2H61 C;  2Y1M A;  1DVI A;  2LHI A;  3CDN A;  1X02 A;  4MBE A;  2FCD A;  1EJ3 A;  4M2Q A;  3VRO A;  4HRH A;  3SG5 A;  4AQJ A;  3TDI A;  2KLD A;  4A4B A;  3CYZ A;  1JBA A;  1TOP A;  2ZKM X;  1IKU A;  1M63 B;  1KQM C;  3KPX A;  1FBV A;  3F45 A;  4NDD A;  1ZAC A;  4I5N B;  4D1E A;  3DVJ A;  3D75 A;  4WQ2 A;  2HQW A;  1YRT B;  3OHM B;  1JFJ A;  1VRK A;  4FQO A;  2NLN A;  1DGU A;  2ZN8 A;  3CAB A;  3CWG A;  3LL8 B;  3HX4 A;  1K9K A;  2JXC A;  3FIA A;  2K7O A;  2L2C A;  2ZN9 A;  1CDM A;  4PE4 A;  1SK6 D;  5D7F A;  3D73 A;  3I5H B;  1K96 A;  1NYA A;  1QLS A;  3S0E A;  3L4L A;  2JT0 A;  1A75 B;  3DVE A;  1OW4 A;  1SBJ A;  3GK2 A;  3S0D A;  3QRX A;  1JUO A;  1WLM A;  1K90 D;  1GJY A;  1QIV A;  2K60 A;  2ZFD A;  3ZNI A;  1MF8 B;  2BAP A;  1UHN A;  1QV1 A;  4DIR A;  1QX5 B;  1C3Y A;  1H4B A;  3UO9 A;  1SCM B;  3OX6 A;  1DTL A;  3JVT C;  3BUO B;  3I5H C;  3TUY C;  1BT6 A;  5CSI A;  3D0Y A;  1N65 A;  2I18 A;  2LVJ A;  4WRI A;  5DKQ A;  1CDN A;  1NPQ A;  2EC6 B;  3SG7 A;  2F8P A;  1EH2 A;  1UHH A;  2KYF A;  4DCK A;  2BKI B;  3H4S E;  1WRK A;  2KSP A;  1SCM C;  1Q80 A;  3DF0 B;  4CPV A;  1QAT A;  2FJU B;  2WCM A;  3BJH A;  3BOW A;  4GUK A;  3PM8 A;  4ZCU A;  1REC A;  4JWQ A;  3RM1 A;  3TZ1 A;  2JTZ A;  2OPO A;  1MR8 A;  1H8B A;  2LVK A;  2LMU A;  2M3W A;  1QVI Z;  2TN4 A;  3CR4 X;  1MUX A;  1KSO A;  3CR5 X;  1HQV A;  3EVR A;  1KWO C;  1M39 A;  1TCF A;  3O2P A;  1QS7 A;  4PE7 A;  2COL B;  1DF0 B;  1NX3 A;  1OMD A;  1FI6 A;  1U5I A;  1BR1 B;  1GM0 A;  2BCA A;  1PUL A;  1WDC B;  1PRW A;  1NIW A;  2LP3 A;  2QPT A;  2WC5 A;  2KI4 C;  4DS7 A;  3O6B A;  3EK8 A;  3DYE A;  4NQG A;  1K9P A;  2MRD A;  3WNX B;  3I5I B;  2JTT A;  1DJY A;  3PN7 B;  2QEV A;  2DOQ A;  1KK7 Z;  1DGV A;  2JNX A;  1NCX A;  1WY9 A;  2LHL A;  1N0Y A;  1LKJ A;  3AKA A;  2GV5 A;  1B1G A;  2I2R E;  4YGD B;  1YVH A;  3B87 A;  5D3O A;  1BOD A;  1XK4 A;  2JNF A;  1CFF A;  3CTN A;  2M7N A;  5TNC A;  5HKY A;  1JC2 A;  4YRU A;  1K94 A;  5CPV A;  3AAJ A;  1DJX A;  1QLK A;  2LV7 A;  5AFP A;  2PRU A;  3C1V A;  2LMT A;  3I5I C;  1IGV A;  4GGF C;  1OOF A;  4PE1 A;  1DEL A;  3EK7 A;  3PN7 C;  3VGO A;  2JQ6 A;  3IQQ A;  1JF2 A;  3UNW A;  3EVU A;  2M8U A;  1SMG A;  2LP2 A;  4MN0 A;  5JOL A;  2ZRS A;  4I5L B;  1CM1 A;  3SS5 A;  3OB2 B;  2JXL A;  1OE9 B;  3EG5 B;  3GK1 A;  1AK8 A;  4BY5 A;  4MRY A;  3VB1 A;  1ZFS A;  3BQ3 A;  4F7F A;  3D78 A;  4PE0 A;  2BBN A;  5AER A;  1EG3 A;  1OMR A;  2B1U A;  3DZT A;  4MSP A;  4YGA A;  2Q91 A;  2MA2 A;  3N7H A;  4PCW A;  4OCI A;  1XFR A;  1Y1A A;  1PAL A;  1T14 A;  2L5X B;  4ORB B;  4PHK A;  3PSR A;  4MVF A;  1RTP 1;  1BLQ A;  1Z4H A;  3EK4 A;  2PSR A;  2ZND A;  2D8N A;  5BPJ A;  2KI6 C;  2P70 A;  3BFB A;  1N2D A;  1KQV A;  2CT9 A;  3BUM B;  2WCB A;  2WCH A;  1SNL A;  4C0J A;  2CNP A;  2LUC A;  3K21 A;  4L9M A;  4WQ3 A;  1DC1 A;  2LAP A;  1A03 A;  2PYQ A;  2Y1N A;  2Q4U A;  2JU0 A;  3QME A;  3DD4 A;  1AJ4 A;  2K7B A;  1DJW A;  1K93 D;  1W9Z A;  1CTR A;  4GNK B;  2LVI A;  3FE8 A;  1AJ5 A;  4QJ5 B;  5B8I B;  4P2Y B;  1AP4 A;  3GOF A;  1M31 A;  2G9B A;  5EL2 A;  1OOJ A;  1IH0 A;  1BOC A;  1TNW A;  1JSA A;  1UUS A;  1YTZ C;  2NCP A;  3SJS A;  2PAS A;  1SL8 A;  1TCO B;  2QEB A;  1S3P A;  3FWB A;  1S1E A;  2I7A A;  3OB1 B;  1V1F A;  2LLT A;  3B86 A;  3WHU B;  3KEV A;  2WND A;  1W7I B;  4E68 A;  3R72 A;  3LCP C;  1MXE A;  2F2P A;  1SPY A;  4YGE B;  3NSL A;  3SG2 A;  1XFW O;  1TNP A;  2KDH A;  2KQY A;  2QEO A;  1AVS A;  3CGA A;  4I5K A;  3EKJ A;  1GGZ A;  1QV0 A;  2QAC A;  1C7W A;  1XFV O;  1F54 A;  1IWQ A;  4OKH A;  4ETO A;  1Z2C B;  1V1G A;  5CSJ A;  4GGN A;  2JPT A;  5KU1 A;  1DMO A;  1SR6 B;  5I2L A;  3BFH A;  2EGD A;  3CS1 A;  3SG4 A;  2KQ6 A;  1Y0V H;  2GGM A;  2LM5 A;  2O60 A;  5GQQ C;  3DF0 A;  3D10 A;  1KCY A;  4C0K A;  2HPS A;  1SSE B;  4HRG A;  2BL0 B;  1KFX L;  2KFH A;  5HL1 A;  1ZUZ A;  2AAO A;  3DY9 A;  1LIN A;  3NGV A;  2LMV A;  3TDZ A;  4PHM A;  1NCY A;  2PMY A;  1SR6 C;  1TNQ A;  4A4C A;  3NXA A;  3LK0 A;  3O78 A;  2H8V A;  5JJG A;  3NHT A;  2PVB A;  1F4O A;  2NXQ A;  1KFU L;  4MZJ A;  1JF0 A;  2EC6 C;  1B8L A;  2BL0 C;  2K0J A;  1XFY O;  4AOM A;  1UHI A;  2P6B B;  4XJK B;  3WHT B;  1XFU O;  2MLF C;  1SYM A;  4GGF A;  1E8A A;  1MXL C;  1UUR A;  1J7P A;  4INX A;  1QJT A;  1IQ5 A;  2L98 A;  2I94 A;  1CM4 A;  4ORA B;  3B6X A;  2BCX A;  2KBI A;  3ICB A;  1ZOT B;  3VRQ A;  1ALW A;  4N1F A;  4USL A;  1LA0 A;  3BUW B;  2M7L A;  3HCM A;  1A2X A;  2VRG A;  2ZRT A;  1IQ3 A;  4YBH B;  4NDB A;  1CLM A;  1NCZ A;  2LLS A;  5KSZ A;  1B8C A;  1SCV A;  4U8D A;  2GGZ A;  1S36 A;  1WDC C;  3BOW B;  2KYC A;  3CZ2 A;  1CB1 A;  1OSA A;  1XA5 A;  1S6C A;  2M0R A;  3R1O A;  2QDI A;  2KFG A;  2CCM A;  4ICB A;  2QEH A;  1TWO A;  2WCE A;  3CR2 A;  1ZMZ A;  2M1K B;  2LNK A;  1DT7 B;  2MJW B;  2JUL A;  3OBV A;  2LAN A;  1IJ6 A;  3VRP A;  1BJF A;  1OZO A;  3B7A A;  3BUX B;  4JD9 A;  4IJ7 A;  1U5I B;  1WRZ A;  3SIA A;  4CFQ A;  1TUZ A;  1YVL A;  1J7O A;  3BFA A;  1CLB A;  5IBW A;  1QWV A;  3NSI A;  1GQM A;  5HYD A;  1NX2 A;  2EHB A;  4HRE E;  4QJ4 B;  2KLE A;  5HKZ A;  2F2O A;  1TTX A;  2MLE C;  1NX1 A;  2H61 A;  3IQO A;  4MZK A;  1AUI B;  3SG3 A;  2AMI A;  3E3R A;  2CBL A;  1DJG A;  3SIB A;  2KGB C;  2F3Y A;  1TNX A;  2KAV A;  4KYN A;  3PFV A;  2WOR A;  3DVM A;  1OMV A;  1FW4 A;  2E6W A;  1LVC D;  3PM2 A;  5ER5 A;  1IIO A;  3PAT A;  1P28 A;  2ERB A;  3TDU A;  3S0G A;  1IRJ A;  4AQI A;  2WOS A;  1CFP A;  1QIW A;  2LE9 B;  5PAL A;  2MBX A;  1B4C A;  1KK8 B;  1EG4 A;  5AAN A;  2L2E A;  1MWN A;  5J3X A;  2M9G A;  1BF5 A;  3BYA A;  2O5G A;  2NCO A;  1IG5 A;  1PSB A;  1J7Q A;  2L4I A;  1CFD A;  1YRU B;  4MZL A;  1ORG A;  5I94 A;  1J7R A;  4C0L A;  2LC5 A;  4DRW A;  4UPG A;  1FPW A;  3TS5 B;  1PSR A;  2ZNE A;  1M45 A;  4YGB B;  4F0Z B;  1EXR A;  1NP8 A;  4ORC B;  1YUS A;  1QTX A;  2K2A A;  1QX7 A;  3CZ0 A;  2L51 A;  3ZWH A;  1S6J A;  3S0B A;  2KFF A;  1NUB A;  3R1P A;  1XO5 A;  5G08 A;  1R6P A;  1EL4 A;  1RRO A;  1HT9 A;  2HF5 A;  1WLZ A;  2YGU A;  4YI8 A;  5K89 A;  3S0F A;  4XYN A;  1YUU A;  2PQL A;  3JTD B;  2HQ8 A;  3TS5 C;  3RLZ A;  3TUY B;  1LS8 A;  1IJ5 A;  1NWD A;  1B7T Z;  2G2B A;  2LUX A;  4GFT A;  4JQ0 D;  1S6I A;  2FJY A;  1A75 A;  2KOT A;  2LLU A;  2WCL A;  4R1E A;  1RFJ A;  2ISD A;  1M46 A;  1SW8 A;  1B7T Y;  4GBA A;  2M1U A;  1TIZ A;  1RJV A;  1CFC A;  4GPL B;  2KGR A;  2L50 A;  1QAS A;  2L4H A;  1J55 A;  5KTY A;  3AAK A;  3JTD C; 
#chains in the Genus database with same CATH homology
 1UHK A;  2Y5I A;  3OX5 A;  2BEC A;  1J1E A;  1FI5 A;  1CMG A;  2JZI A;  1WRL A;  3KO0 A;  4PDZ A;  1KSM A;  5FI2 A;  3BUN B;  1G4Y R;  1YX8 A;  2WC8 A;  1XYD A;  2L0P A;  1PK0 D;  5HKW A;  2JOJ A;  2OS8 B;  1B8R A;  5FYX A;  4M2P A;  4PHN A;  3KF9 A;  1SRA A;  2BKH B;  1YUT A;  2NZ0 A;  1G33 A;  1UHJ A;  3NSK A;  1B47 A;  1SL7 A;  1C07 A;  2K2F A;  1BU3 A;  1W7J B;  1DJI A;  2SCP A;  3SS4 A;  5CSN A;  1K9U A;  1NX0 A;  3JVT B;  3LK1 A;  1D1O A;  1GGW A;  2FOT A;  1CNP A;  1NSH A;  4CID A;  2M29 A;  2OS8 C;  4XJK A;  4YGC B;  4OR9 B;  4M2O A;  1DF0 A;  5HLO A;  3WXA A;  3SS3 A;  1XVJ A;  2M49 B;  3EVV A;  5I2Q A;  1RK9 A;  4TNC A;  1RWY A;  2FCE A;  1SY9 A;  2JRF A;  1F55 A;  3LLE A;  2Y4Q A;  2JC2 A;  2JWW A;  3M0W A;  4MEW A;  1PVA A;  4N5X A;  4MRX A;  1L2O B;  4CLN A;  1BMO A;  2KI6 D;  1KWO B;  1K95 A;  1B9A A;  1Y1U A;  4PAL A;  1Y1X A;  3D0Y B;  1LA3 A;  1FF1 A;  2H2K A;  4QJ3 B;  3IVT A;  2MHH A;  4OV2 A;  2E30 A;  1F8H A;  2KI4 B;  2A4J A;  2K8M B;  4ZCV A;  1L2O C;  3GK4 X;  3SG6 A;  4N1G A;  3CZT X;  1R2U A;  1AHR A;  3IF7 A;  1QVI Y;  2RGI A;  2BE6 A;  1F4Q A;  2CXJ A;  5FI7 A;  2BE4 A;  1A29 A;  1BR4 B;  3FWC A;  1UP5 A;  5ER4 X;  5F6T A;  1S26 D;  2KAX A;  2F3Z A;  2MAZ A;  2OTG B;  2M97 A;  1QX2 A;  1XFZ O;  4JKT A;  1YX7 A;  1Y6W A;  1CLL A;  1PVB A;  2V53 A;  2IS9 A;  3PLF B;  4YI9 A;  1CMF A;  5DKN A;  1L7Z A;  1LXF C;  1QXP A;  1K2H A;  1OZS A;  1KK7 Y;  1SKT A;  2JT3 A;  3FS7 A;  1YR5 A;  3O4Y A;  3EKH A;  4PHJ A;  2OTG C;  1DEK A;  2K61 A;  5AXI A;  3PAL A;  4DUQ A;  1UWO A;  3CLN A;  1OQP A;  1F71 A;  5D69 A;  4I5J A;  4IL1 A;  4MLW A;  1G8I A;  1YUR A;  2WCF A;  1XFX O;  3MSE B;  2BNX A;  1SL9 A;  1S5G Z;  4BY4 A;  2BBM A;  1JFK A;  2BCB A;  4FTG A;  1J1D A;  3O4X A;  1DJZ A;  4JPZ B;  1F70 A;  2F33 A;  4OVN F;  4Q04 A;  3VRR A;  2JT8 A;  3I5G B;  1S5G Y;  2KBM A;  1CDP A;  2LVV A;  1MHO A;  2KNE A;  3A8R A;  4P5O E;  2R2I A;  1XK4 C;  3KHE A;  3NSO A;  3I5F B;  1JWD A;  1ALV A;  3AKB A;  1A4P A;  1CKK A;  4HSZ A;  2KHN A;  1BG1 A;  1TRF A;  1KK8 C;  1KFX S;  3BXK A;  1MQ1 A;  5I8N A;  2PAL A;  2K7D A;  4GAO A;  3I5G C;  1K8U A;  2L5Y A;  2HET A;  1DJH A;  3A4U B;  3DVK A;  5FI6 A;  5CSF A;  4CFR A;  1ODB A;  2AUC A;  3I5F C;  1KFU S;  1TN4 A;  2CTN A;  2LCP A;  1KQM B;  4NDC A;  3OP0 A;  2KAY A;  3VRN A;  5DKR A;  5AEQ A;  5I2O A;  1C7V A;  2K7C A;  2SAS A;  1CDL A;  5HLV A;  2H61 C;  2Y1M A;  1DVI A;  2LHI A;  1X02 A;  4MBE A;  2FCD A;  1EJ3 A;  4M2Q A;  3VRO A;  4HRH A;  3SG5 A;  4AQJ A;  3TDI A;  2KLD A;  4A4B A;  1JBA A;  1TOP A;  2ZKM X;  1IKU A;  1M63 B;  1KQM C;  3KPX A;  1FBV A;  3F45 A;  4NDD A;  1ZAC A;  4I5N B;  4D1E A;  3DVJ A;  4WQ2 A;  2HQW A;  1YRT B;  3OHM B;  1JFJ A;  1VRK A;  4FQO A;  2NLN A;  1DGU A;  2ZN8 A;  3CWG A;  3LL8 B;  3HX4 A;  1K9K A;  2JXC A;  3FIA A;  2K7O A;  2ZN9 A;  1CDM A;  4PE4 A;  1SK6 D;  5D7F A;  3I5H B;  1K96 A;  1NYA A;  1QLS A;  2JT0 A;  1A75 B;  3DVE A;  1SBJ A;  3GK2 A;  3QRX A;  1JUO A;  1WLM A;  1K90 D;  1GJY A;  1QIV A;  2ZFD A;  3ZNI A;  2K60 A;  1MF8 B;  2BAP A;  1UHN A;  1QV1 A;  4DIR A;  1QX5 B;  1H4B A;  3UO9 A;  1SCM B;  3OX6 A;  1DTL A;  3JVT C;  3BUO B;  3I5H C;  3TUY C;  1BT6 A;  5CSI A;  3D0Y A;  1N65 A;  2I18 A;  2LVJ A;  4WRI A;  5DKQ A;  1CDN A;  1NPQ A;  2EC6 B;  3SG7 A;  2F8P A;  1EH2 A;  1UHH A;  2KYF A;  4DCK A;  2BKI B;  3H4S E;  1WRK A;  2KSP A;  1SCM C;  1Q80 A;  3DF0 B;  4CPV A;  1QAT A;  2FJU B;  3BOW A;  4GUK A;  3PM8 A;  4ZCU A;  1REC A;  4JWQ A;  3RM1 A;  3TZ1 A;  2JTZ A;  2OPO A;  1MR8 A;  1H8B A;  2LVK A;  2LMU A;  2M3W A;  1QVI Z;  2TN4 A;  3CR4 X;  1MUX A;  1KSO A;  3CR5 X;  1HQV A;  3EVR A;  1KWO C;  1M39 A;  1TCF A;  3O2P A;  1QS7 A;  4PE7 A;  2COL B;  1DF0 B;  1NX3 A;  1OMD A;  1FI6 A;  1U5I A;  1BR1 B;  2BCA A;  1PUL A;  1WDC B;  1PRW A;  1NIW A;  2LP3 A;  2QPT A;  4DS7 A;  2KI4 C;  3O6B A;  3EK8 A;  4NQG A;  1K9P A;  2MRD A;  3WNX B;  3I5I B;  2JTT A;  1DJY A;  3PN7 B;  2DOQ A;  1KK7 Z;  1DGV A;  2JNX A;  1NCX A;  1WY9 A;  2LHL A;  1N0Y A;  1LKJ A;  3AKA A;  2GV5 A;  1B1G A;  2I2R E;  4YGD B;  1YVH A;  5D3O A;  1BOD A;  1XK4 A;  2JNF A;  1CFF A;  3CTN A;  2M7N A;  5TNC A;  5HKY A;  1JC2 A;  4YRU A;  1K94 A;  5CPV A;  3AAJ A;  1DJX A;  1QLK A;  2LV7 A;  5AFP A;  2PRU A;  3C1V A;  2LMT A;  3I5I C;  1IGV A;  4GGF C;  4PE1 A;  3EK7 A;  3PN7 C;  1DEL A;  3VGO A;  2JQ6 A;  3IQQ A;  1JF2 A;  3UNW A;  3EVU A;  2M8U A;  1SMG A;  2LP2 A;  4MN0 A;  5JOL A;  2ZRS A;  4I5L B;  1CM1 A;  3SS5 A;  3OB2 B;  2JXL A;  1OE9 B;  1AK8 A;  3GK1 A;  3EG5 B;  4BY5 A;  4MRY A;  1ZFS A;  3BQ3 A;  4PE0 A;  2BBN A;  5AER A;  1EG3 A;  1OMR A;  2B1U A;  4MSP A;  4YGA A;  2Q91 A;  2MA2 A;  4PCW A;  4OCI A;  1Y1A A;  4PHK A;  1PAL A;  2L5X B;  4ORB B;  3PSR A;  4MVF A;  1RTP 1;  1BLQ A;  1Z4H A;  3EK4 A;  2PSR A;  2ZND A;  2D8N A;  5BPJ A;  2KI6 C;  1KQV A;  1N2D A;  2CT9 A;  3BUM B;  2WCB A;  1SNL A;  4C0J A;  2CNP A;  2LUC A;  3K21 A;  4L9M A;  4WQ3 A;  1DC1 A;  2LAP A;  1A03 A;  2Y1N A;  2Q4U A;  2JU0 A;  3DD4 A;  1AJ4 A;  2K7B A;  1DJW A;  1K93 D;  4GNK B;  1CTR A;  1W9Z A;  2LVI A;  1AJ5 A;  4QJ5 B;  5B8I B;  4P2Y B;  1AP4 A;  3GOF A;  1M31 A;  2G9B A;  1IH0 A;  1OOJ A;  1BOC A;  1TNW A;  1JSA A;  1UUS A;  1YTZ C;  2NCP A;  3SJS A;  2PAS A;  1SL8 A;  1TCO B;  1S3P A;  3FWB A;  1S1E A;  2I7A A;  3OB1 B;  1V1F A;  2LLT A;  3WHU B;  3KEV A;  2WND A;  1W7I B;  4E68 A;  3LCP C;  1MXE A;  2F2P A;  1SPY A;  4YGE B;  3NSL A;  3SG2 A;  1XFW O;  1TNP A;  2KDH A;  2KQY A;  3CGA A;  1AVS A;  4I5K A;  3EKJ A;  1GGZ A;  1QV0 A;  2QAC A;  1C7W A;  1XFV O;  1F54 A;  1IWQ A;  4OKH A;  4ETO A;  1DMO A;  1V1G A;  5CSJ A;  4GGN A;  2JPT A;  5KU1 A;  1Z2C B;  1SR6 B;  5I2L A;  2EGD A;  3CS1 A;  3SG4 A;  2KQ6 A;  1Y0V H;  2GGM A;  2LM5 A;  2O60 A;  5GQQ C;  3DF0 A;  3D10 A;  1KCY A;  4C0K A;  2HPS A;  4HRG A;  2BL0 B;  1KFX L;  2KFH A;  5HL1 A;  1ZUZ A;  2AAO A;  1LIN A;  2LMV A;  3TDZ A;  4PHM A;  1NCY A;  2PMY A;  1SR6 C;  1TNQ A;  4A4C A;  3NXA A;  3LK0 A;  3O78 A;  5JJG A;  2PVB A;  1F4O A;  2NXQ A;  1KFU L;  4MZJ A;  1JF0 A;  2EC6 C;  1B8L A;  2BL0 C;  2K0J A;  1XFY O;  4AOM A;  1UHI A;  2P6B B;  4XJK B;  3WHT B;  1XFU O;  2MLF C;  1SYM A;  4GGF A;  1E8A A;  1MXL C;  1UUR A;  1J7P A;  1QJT A;  1IQ5 A;  2L98 A;  2I94 A;  1CM4 A;  4ORA B;  2BCX A;  2KBI A;  3ICB A;  1ZOT B;  3VRQ A;  1ALW A;  4N1F A;  4USL A;  1LA0 A;  3BUW B;  2M7L A;  3HCM A;  1A2X A;  2VRG A;  2ZRT A;  1IQ3 A;  4YBH B;  4NDB A;  1CLM A;  1NCZ A;  2LLS A;  5KSZ A;  1B8C A;  1SCV A;  4U8D A;  2GGZ A;  1S36 A;  1WDC C;  3BOW B;  2KYC A;  1CB1 A;  1OSA A;  1XA5 A;  1S6C A;  2M0R A;  2KFG A;  2CCM A;  4ICB A;  2WCE A;  3CR2 A;  1ZMZ A;  2M1K B;  2LNK A;  1DT7 B;  2MJW B;  2JUL A;  3OBV A;  2LAN A;  1IJ6 A;  3VRP A;  1BJF A;  1OZO A;  3BUX B;  3SIA A;  1U5I B;  1WRZ A;  4CFQ A;  4IJ7 A;  1YVL A;  1J7O A;  1CLB A;  5IBW A;  3NSI A;  1GQM A;  5HYD A;  1NX2 A;  2EHB A;  4HRE E;  4QJ4 B;  5HKZ A;  2KLE A;  2F2O A;  1TTX A;  2MLE C;  1NX1 A;  2H61 A;  3IQO A;  4MZK A;  1AUI B;  3SG3 A;  2AMI A;  3E3R A;  2CBL A;  1DJG A;  3SIB A;  2KGB C;  2F3Y A;  1TNX A;  2KAV A;  4KYN A;  3PFV A;  2WOR A;  3DVM A;  1OMV A;  1FW4 A;  2E6W A;  1LVC D;  5ER5 A;  3PM2 A;  3PAT A;  3TDU A;  1IRJ A;  4AQI A;  2WOS A;  1CFP A;  1QIW A;  2LE9 B;  5PAL A;  2MBX A;  1B4C A;  1KK8 B;  1EG4 A;  5AAN A;  2L2E A;  1MWN A;  5J3X A;  2M9G A;  1BF5 A;  3BYA A;  2O5G A;  2NCO A;  1IG5 A;  1PSB A;  1J7Q A;  2L4I A;  1CFD A;  1YRU B;  4MZL A;  5I94 A;  1J7R A;  4C0L A;  2LC5 A;  4DRW A;  4UPG A;  1FPW A;  3TS5 B;  1PSR A;  2ZNE A;  1M45 A;  4YGB B;  4F0Z B;  1EXR A;  1NP8 A;  4ORC B;  1YUS A;  1QTX A;  2K2A A;  1QX7 A;  2L51 A;  3ZWH A;  1S6J A;  2KFF A;  1NUB A;  1XO5 A;  5G08 A;  1R6P A;  1EL4 A;  1RRO A;  1HT9 A;  2HF5 A;  1WLZ A;  5K89 A;  4YI8 A;  2YGU A;  4XYN A;  1YUU A;  3TUY B;  3JTD B;  2HQ8 A;  3TS5 C;  3RLZ A;  1IJ5 A;  1NWD A;  1B7T Z;  2G2B A;  2LUX A;  4GFT A;  4JQ0 D;  1S6I A;  1A75 A;  2KOT A;  2LLU A;  2ISD A;  4R1E A;  1RFJ A;  1M46 A;  1SW8 A;  1B7T Y;  4GBA A;  2M1U A;  1TIZ A;  1RJV A;  1CFC A;  4GPL B;  2KGR A;  2L50 A;  1QAS A;  2L4H A;  1J55 A;  5KTY A;  3AAK A;  3JTD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...