4I5JA

Pp2a pr70 holoenzyme
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
272
structure length
266
Chain Sequence
NHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A regulatory subunit B
publication title Structure of the Ca(2+)-dependent PP2A heterotrimer and insights into Cdc6 dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 266
sequence length 272
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF17958 EF-hand_13 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4i5jA02
1.10.238.220 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4i5jA01
1SCMB 1SCMC 2LLTA 1C7WA 3TDIA 1KK7Y 2WNDA 3GOFA 1N65A 3KO0A 2MRDA 1AJ5A 2KAYA 1IKUA 4GAOA 1UURA 3KEVA 1L2OB 4JWQA 1UHKA 2PMYA 1YTZC 1DGVA 1OOJA 2Y4QA 1PVBA 1OMVA 1RROA 2LVJA 4I5NB 3BUXB 5I8NA 1ZOTB 2LHLA 2KGRA 1XK4A 1KFXL 2KAVA 1F8HA 5AFPA 2LUXA 1CLMA 1IWQA 1WRLA 3I5IC 3I5IB 3LK1A 2LUCA 1WDCC 1WDCB 2I7AA 2KSPA 3SG6A 1WLZA 2MLFC 4YGDB 2WORA 1GGWA 2NZ0A 1Q80A 4ORCB 4CFQA 2WCBA 3HX4A 3IF7A 4CFRA 2GGMA 2K2AA 1SL8A 3EVRA 3LL8B 4PHNA 1IRJA 4HRHA 4YGEB 1CFPA 1WRKA 2LP2A 2GV5A 1KSOA 1B8RA 4JQ0D 1CNPA 1PRWA 4MBEA 2F2PA 3VGOA 4A4CA 4MN0A 5HKWA 3WXAA 1XK4C 1SY9A 2IS9A 1TOPA 2M8UA 3NSIA 2KGBC 1S5GZ 5J3XA 3SG2A 1TN4A 4PE1A 1CFCA 1HT9A 1UP5A 1MF8B 1KCYA 4TNCA 5IBWA 3D10A 3JTDB 2JNXA 3SIAA 1RFJA 2M1KB 1CFFA 2HF5A 3KF9A 4PALA 4DCKA 2LVVA 1SCVA 2LCPA 2M7NA 3NSOA 1NCYA 3DVKA 3DD4A 3BOWA 4AQIA 4YRUA 1OMDA 4PE0A 1W7JB 3TDUA 3A8RA 1B1GA 4ZCUA 4WQ2A 2KI6D 3WHTB 1ZMZA 1RWYA 2OS8C 1FI6A 1HQVA 1S1EA 2V53A 2G2BA 1Y0VH 3GK2A 1A75B 4D1EA 1JC2A 2EGDA 2KQYA 1JSAA 4R1EA 4PHMA 1IJ5A 1QX2A 2O5GA 1SR6C 3EVUA 4DIRA 2KOTA 2Y1NA 2BL0B 2BL0C 3BUWB 3OB1B 5F6TA 1NYAA 2LM5A 2K2FA 4MZKA 2CBLA 2LE9B 3GK4X 4YGAA 1K94A 1BG1A 2MJWB 1LVCD 1YUUA 3HCMA 4XJKA 3BOWB 3AKBA 4OR9B 1XVJA 3SG3A 4GFTA 1V1GA 2CT9A 4I5LB 1S5GY 1DGUA 1SPYA 1S6JA 2PVBA 4P5OE 3VRQA 4GPLB 1KWOB 2LC5A 3C1VA 1PSBA 4ICBA 4GBAA 3DVJA 1CLBA 1NX0A 1NCZA 2FCEA 3D0YA 1JFKA 1YX7A 3IQOA 5CSJA 1SYMA 3CWGA 2JT3A 1QV1A 1QASA 3K21A 3I5GC 3I5GB 1SW8A 4XJKB 1QATA 3O4YA 3OHMB 3SG7A 1QVIZ 2KFHA 4C0LA 4N5XA 2WCEA 1A2XA 1JFJA 1MR8A 1CM4A 1A03A 5HKYA 2M7LA 4GGNA 1MXEA 1NX2A 2RGIA 1S36A 2F8PA 1XFUO 3BUNB 1QIVA 1NX3A 4QJ3B 1W7IB 1AHRA 5ER5A 1B47A 5FYXA 2KYCA 3F45A 1CKKA 1LKJA 2M9GA 4CIDA 4MRXA 2LMUA 2F33A 3TUYC 1RECA 3D0YB 4DS7A 1OSAA 3WNXB 1DJIA 3I5HC 2AMIA 1IQ3A 1J7QA 1S26D 1C7VA 1H4BA 1BT6A 3PSRA 1GJYA 1UHHA 1K9PA 3E3RA 5KSZA 3TDZA 1J55A 1SL7A 1YRTB 2JRFA 1XA5A 3TZ1A 1MHOA 1MXLC 1DJWA 1CMGA 3H4SE 3OX6A 1IGVA 3IQQA 2L0PA 1QXPA 3SG4A 3FS7A 2BBMA 2M0RA 1PVAA 2KBMA 2M97A 1DVIA 1ZACA 2K61A 2PSRA 1SNLA 3O6BA 2COLB 3ICBA 2A4JA 2CCMA 2DOQA 1J1DA 2BCXA 3EK7A 1IJ6A 2ZRTA 1YUTA 2KBIA 1DTLA 1DJHA 2JPTA 1BR1B 2M49B 1LINA 2JT8A 1XFXO 2BBNA 1BJFA 2FCDA 2JNFA 1QVIY 4GGFC 5TNCA 1BLQA 4MLWA 2G9BA 4M2PA 2BCAA 4FTGA 5GQQC 1CM1A 1JUOA 3SJSA 1KK8B 1KK8C 1M63B 4YGBB 3SIBA 4ORBB 1BMOA 1TNXA 1TTXA 5I2QA 3MSEB 2K0JA 4FQOA 5DKQA 1PSRA 1JF2A 2E30A 1S3PA 1AJ4A 2EC6B 2EC6C 1TNPA 1OQPA 2ZN8A 4HREE 4P2YB 5I2LA 4NDCA 3I5FC 2CNPA 1DJYA 5BPJA 1SKTA 1CTRA 1MQ1A 5AANA 1SRAA 3AKAA 1Y1XA 3JVTB 3JVTC 1A4PA 1NIWA 3PM8A 1XFVO 5G08A 5KTYA 1E8AA 4BY5A 2K7DA 2JXLA 2K7OA 1A29A 3BQ3A 4IL1A 5PALA 3ZWHA 2H2KA 2QPTA 5KU1A 1XFYO 1QX7A 1BU3A 2L4IA 3PN7C 3FWCA 2OS8B 1CLLA 4MZLA 2R2IA 1EG4A 1WY9A 1SMGA 2LP3A 1FI5A 4DUQA 1QLSA 2LVIA 2FOTA 1SK6D 2ZFDA 1SR6B 1VRKA 1UUSA 4MRYA 4JPZB 4I5KA 1RJVA 3VRRA 2LHIA 1QJTA 4PE4A 4CLNA 4Q04A 1N0YA 2HQWA 3O2PA 2KFFA 1YX8A 4OKHA 2I94A 4BY4A 1XFWO 1PULA 2M1UA 5HKZA 1NPQA 2JTTA 2ZN9A 1KK7Z 2KYFA 4GUKA 1NSHA 3CR5X 2HPSA 2M3WA 1UHIA 2PALA 1AVSA 4I5JA 1K2HA 1AP4A 1F70A 2JTZA 3OX5A 4OVNF 3FIAA 1K90D 1J7PA 1EJ3A 2QACA 4WQ3A 2ZNDA 2ISDA 1QX5B 5ER4X 1JWDA 1UHNA 3LCPC 1SBJA 3SG5A 1KFUS 5CSFA 5AERA 2P6BB 1EL4A 5AXIA 2B1UA 3KPXA 4OCIA 1U5IA 4NDBA 5B8IB 4MEWA 3CTNA 3PALA 3RM1A 2BE6A 2D8NA 5AEQA 1ODBA 1QLKA 3BXKA 2NLNA 3EK8A 1NCXA 1CB1A 2KHNA 2LNKA 1DJXA 2MHHA 1WRZA 3GK1A 2NCPA 3EKHA 2F3YA 2CTNA 4GNKB 5D69A 4ETOA 3TUYB 1F4OA 5JOLA 4YI9A 3I5HB 5DKRA 2Y5IA 3LK0A 1F54A 1YVHA 5D7FA 4UPGA 1PALA 2JOJA 2KI4C 2KI4B 4N1FA 1UHJA 4GGFA 4USLA 3OP0A 1U5IB 3FWBA 1GGZA 2WC8A 1DJGA 5JJGA 1KSMA 3KHEA 3NSKA 3AAKA 1XFZO 2GGZA 3CR2A 2KQ6A 3OB2B 1K96A 1LXFC 1OMRA 3TS5C 3TS5B 2L98A 2K7BA 2VRGA 3LLEA 4PHJA 3VRNA 2LVKA 1FF1A 2WCFA 4C0JA 1L2OC 1QV0A 1KFUL 1LA0A 1ZFSA 2HETA 3DVMA 1M31A 2BE4A 1TNWA 2PASA 1PK0D 1BOCA 4MVFA 2BCBA 4YI8A 1Y1UA 4MZJA 2JU0A 1FW4A 2LV7A 3A4UB 3EK4A 4ZCVA 2I18A 1YURA 2TN4A 4OV2A 1IH0A 3PFVA 1ALVA 3NSLA 4C0KA 2ZRSA 1DT7B 1NWDA 1B7TZ 2JC2A 3CGAA 4L9MA 2L50A 4PE7A 2L51A 1CDPA 4PCWA 1S6IA 2MBXA 4CPVA 1F71A 4M2QA 1CFDA 1K9UA 3DF0A 2CXJA 3I5FB 5I2OA 4N1GA 2FJUB 2KDHA 1TNQA 4YGCB 2MAZA 1ZUZA 2OTGC 2OTGB 1CDNA 2KAXA 4F0ZB 1MWNA 1AK8A 4XYNA 2F3ZA 2I2RE 1KQVA 1NUBA 2MA2A 1OE9B 5HLVA 1WLMA 2K8MB 1YR5A 1M45A 3PATA 1H8BA 2EHBA 3PLFB 3QRXA 4AQJA 2ZKMX 1ALWA 2JXCA 3CLNA 1NX1A 2K7CA 1D1OA 2BECA 3PN7B 3VRPA 1KQMB 1A75A 1KQMC 1QS7A 1EH2A 1BF5A 1TRFA 2AAOA 2JULA 3JTDC 1J7OA 5HYDA 4PDZA 1BODA 1DJZA 2BKIB 2L4HA 1XO5A 3DF0B 4DRWA 1B9AA 1RK9A 3BYAA 5HLOA 3WHUB 1OZSA 1YVLA 4ORAB 4HSZA 4WRIA 3EKJA 3M0WA 3DVEA 1N2DA 1UWOA 2ZNEA 1CDLA 1EXRA 5CSIA 1J7RA 1EG3A 1M46A 1R6PA 1M39A 1SL9A 1G33A 1K95A 2SCPA 1JF0A 2KNEA 2H61A 1B7TY 2L5XB 1XYDA 2LLUA 1G8IA 2HQ8A 2LMVA 1FBVA 1DMOA 1JBAA 2JZIA 2JT0A 1CMFA 1C07A 1F55A 2Q91A 1RTP1 1QIWA 1S6CA 4MSPA 2OPOA 2WOSA 1TCOB 3RLZA 1G4YR 4PHKA 1AUIB 1IQ5A 5DKNA 4AOMA 1YRUB 3VROA 1B8CA 1CDMA 1QTXA 2JWWA 2KFGA 3CS1A 4HRGA 1DF0A 1NP8A 2E6WA 1BR4B 2LANA 1IG5A 2M29A 3EVVA 1TCFA 4E68A 2L2EA 4A4BA 3NXAA 4NDDA 1K8UA 1K9KA 1X02A 2PRUA 1K93D 2H61C 1Y1AA 1KFXS 4M2OA 1GQMA 1OZOA 3CZTX 1KWOC 3CR4X 2AUCA 2LLSA 4NQGA 3AAJA 1F4QA 1B8LA 5CSNA 4U8DA 1YUSA 2BKHB 2MLEC 2SASA 1LA3A 2NCOA 3O78A 2KI6C 4QJ4B 4QJ5B 5K89A 3BUOB 1R2UA 4YBHB 1DF0B 2F2OA 2Q4UA 3BUMB 2LMTA 2Y1MA 1J1EA 1B4CA 1MUXA 1L7ZA 2LAPA 1Y6WA 5CPVA 1FPWA 2JQ6A 2NXQA 2O60A 1TIZA 3ZNIA 1V1FA
chains in the Genus database with same CATH superfamily
1SCMB 1SCMC 2LLTA 3L4LA 1C7WA 3TDIA 1KK7Y 2WNDA 3B7AA 3GOFA 1N65A 3KO0A 2MRDA 1W9ZA 2BAPA 1AJ5A 2KAYA 3SS4A 1IKUA 4GAOA 5FI2A 1UURA 3KEVA 1L2OB 4JWQA 1UHKA 2PMYA 1YTZC 1DGVA 1OOJA 2Y4QA 1PVBA 1OMVA 1RROA 2LVJA 4I5NB 3BUXB 3FE6A 5I8NA 1ZOTB 2LHLA 2KGRA 1XK4A 1KFXL 2KAVA 2KLDA 1F8HA 3D74A 5AFPA 2LUXA 1CLMA 1IWQA 1WRLA 3I5IC 3I5IB 3LK1A 2LUCA 1WDCC 1WDCB 2I7AA 2KSPA 3L47A 3SG6A 1WLZA 2MLFC 2QDIA 2WORA 2FJYA 4YGDB 2NZ0A 3SS3A 1GGWA 2WC5A 1Q80A 4ORCB 4CFQA 2WCBA 3HX4A 3IF7A 4CFRA 2GGMA 2K2AA 1SL8A 2QEOA 3EVRA 3LL8B 1IRJA 4HRHA 4PHNA 4YGEB 1CFPA 1WRKA 1C3YA 2LP2A 2GV5A 1KSOA 1B8RA 3NHTA 4JQ0D 1CNPA 1PRWA 4MBEA 2F2PA 3VGOA 4A4CA 2WCMA 2WCJA 4MN0A 5HKWA 3WXAA 1XK4C 1SY9A 1Z4HA 2IS9A 1TOPA 3S0FA 2M8UA 2ERBA 3NSIA 3R72A 2KGBC 1S5GZ 5J3XA 3SG2A 1TN4A 4PE1A 1LS8A 1CFCA 1HT9A 1UP5A 1MF8B 1KCYA 1SSEB 4TNCA 5IBWA 3D10A 3JTDB 3S0DA 2JNXA 3SIAA 1RFJA 2M1KB 3BFAA 1CFFA 2HF5A 3KF9A 4PALA 4DCKA 3B86A 2LVVA 3L4AA 1SCVA 2LCPA 2M7NA 3NSOA 1NCYA 3DVKA 3DD4A 3BOWA 4AQIA 4YRUA 1OMDA 4PE0A 1W7JB 3TDUA 3A8RA 1B1GA 4ZCUA 4KYNA 2KI6D 4WQ2A 3WHTB 1ZMZA 1RWYA 2OS8C 1FI6A 1HQVA 3FE9A 3B87A 1S1EA 2V53A 2G2BA 1Y0VH 3GK2A 1A75B 4JKTA 4D1EA 1JC2A 2EGDA 2KQYA 1JSAA 4R1EA 4PHMA 1IJ5A 1QX2A 2O5GA 1SR6C 3EVUA 3CABA 2KOTA 4DIRA 2Y1NA 2BL0B 2BL0C 3BUWB 3OB1B 5F6TA 1NYAA 2LM5A 2K2FA 4MZKA 2CBLA 2LE9B 3GK4X 4YGAA 1K94A 1BG1A 2MJWB 2YGUA 5HL1A 1LVCD 1YUUA 3EG5B 3HCMA 4XJKA 3BOWB 3AKBA 4OR9B 1QWVA 1IIOA 1XVJA 3SG3A 4GFTA 1V1GA 2CT9A 4I5LB 1S5GY 5KU1A 1DGUA 1SPYA 1S6JA 2PVBA 4P5OE 3VRQA 4GPLB 1KWOB 2LC5A 1OW4A 3C1VA 1PSBA 3D77A 4ICBA 4GBAA 3DVJA 3IVTA 1CLBA 1NX0A 5FI7A 2L5YA 1NCZA 2FCEA 3D0YA 1JFKA 2PQLA 1YX7A 3IQOA 5CSJA 1SYMA 3CWGA 2JT3A 1QV1A 1QASA 1OOGA 3K21A 3I5GC 3I5GB 1SW8A 2KLEA 3D75A 4XJKB 1QATA 3O4YA 3OHMB 3SG7A 1QVIZ 2KFHA 4C0LA 1XFRA 4N5XA 2WCEA 1A2XA 1JFJA 1MR8A 1CM4A 1A03A 5HKYA 2M7LA 4GGNA 1MXEA 1NX2A 2RGIA 1S36A 2F8PA 1XFUO 3BUNB 1QIVA 1NX3A 4QJ3B 1W7IB 1AHRA 5ER5A 1B47A 5FYXA 2KYCA 3F45A 1CKKA 1LKJA 2M9GA 4CIDA 4MRXA 2H8VA 2F33A 2LMUA 3TUYC 1RECA 3D0YB 4DS7A 1OSAA 3WNXB 1DJIA 2WCHA 2AMIA 3I5HC 1IQ3A 1J7QA 1S26D 1C7VA 1H4BA 1BT6A 3PSRA 1GJYA 1UHHA 1K9PA 3E3RA 2WCLA 5KSZA 3NHIA 3TDZA 1J55A 1SL7A 1YRTB 2JRFA 1XA5A 3TZ1A 1MHOA 1MXLC 1DJWA 1CMGA 3H4SE 3OX6A 1IGVA 3IQQA 2L0PA 1QXPA 3SG4A 3FS7A 2BBMA 2M0RA 2QEHA 1PVAA 2KBMA 2M97A 1DVIA 1ZACA 2K61A 2PSRA 1SNLA 3O6BA 2COLB 3ICBA 2A4JA 2CCMA 2DOQA 1J1DA 2BCXA 2PYQA 3EK7A 1IJ6A 2ZRTA 5EL2A 3DYEA 3CZ1A 3V2LA 1YUTA 2KBIA 1P28A 1DTLA 1DJHA 2JPTA 1BR1B 2M49B 1LINA 2JT8A 1XFXO 2BBNA 1BJFA 2FCDA 2JNFA 1QVIY 4PT1A 4GGFC 5TNCA 1BLQA 4MLWA 2G9BA 3S0EA 4M2PA 2BCAA 4FTGA 5GQQC 3B6XA 1CM1A 1DEKA 1JUOA 3DY9A 3SJSA 1KK8B 1KK8C 1M63B 4YGBB 2BNXA 3SIBA 4ORBB 1BMOA 1TNXA 1TTXA 5I2QA 3MSEB 2K0JA 4FQOA 5DKQA 1PSRA 1JF2A 2E30A 1S3PA 1AJ4A 2EC6B 2EC6C 1TNPA 1OQPA 2ZN8A 4HREE 4P2YB 1DELA 5I2LA 4NDCA 3I5FC 2CNPA 1DJYA 5BPJA 1SKTA 1DQEA 1CTRA 1MQ1A 5AANA 1SRAA 3AKAA 1Y1XA 3JVTB 3JVTC 1A4PA 1NIWA 3PM8A 1XFVO 5G08A 5KTYA 1E8AA 4BY5A 2K7DA 2JXLA 4FQTA 2K7OA 1A29A 1TUJA 2P71A 3BQ3A 4IL1A 2H2KA 2QPTA 5PALA 1XFYO 3ZWHA 1QX7A 1BU3A 2L4IA 4INWA 3D76A 2QEVA 3FWCA 2OS8B 3CZ0A 1CLLA 3PN7C 4MZLA 2R2IA 1EG4A 1WY9A 1SMGA 2LP3A 1FI5A 5I94A 3CDNA 4DUQA 1QLSA 2LVIA 2FOTA 1SK6D 2ZFDA 3OBVA 1SR6B 1VRKA 1UUSA 4OZDA 4MRYA 4JPZB 2KPHA 4I5KA 1RJVA 3VRRA 1ORGA 2LHIA 1QJTA 4PE4A 4CLNA 4INXA 4Q04A 1N0YA 2HQWA 3O2PA 2KFFA 1YX8A 4OKHA 4F7FA 2I94A 4BY4A 1XFWO 1PULA 2M1UA 5HKZA 1TUZA 1NPQA 2JTTA 2ZN9A 1KK7Z 2KYFA 4GUKA 1NSHA 3CR5X 2HPSA 2M3WA 1UHIA 2PALA 1AVSA 4I5JA 1K2HA 1AP4A 1F70A 2JTZA 3OX5A 4OVNF 3FIAA 1K90D 1J7PA 1EJ3A 2QACA 4WQ3A 2ZNDA 2ISDA 1QX5B 5ER4X 1JWDA 1UHNA 3LCPC 2GTEA 1SBJA 1Z2CB 3SG5A 1KFUS 5CSFA 5AERA 2P6BB 2WC6A 1EL4A 3N7HA 5AXIA 2B1UA 5DICA 3KPXA 4OCIA 1U5IA 4NDBA 5B8IB 4MEWA 3CTNA 3PALA 3DZTA 3RM1A 2BE6A 2D8NA 5AEQA 1ODBA 1QLKA 3BXKA 3PJIA 2NLNA 3EK8A 1OOHA 1NCXA 1CB1A 2KHNA 3DXLA 2LNKA 1DJXA 2MHHA 1WRZA 3GK1A 2NCPA 3EKHA 2F3YA 2CTNA 4GNKB 5D69A 4ETOA 3TUYB 1F4OA 5JOLA 4YI9A 3I5HB 5DKRA 2Y5IA 3LK0A 3FE8A 1F54A 1YVHA 5D7FA 4UPGA 1PALA 2JOJA 2KI4C 2KI4B 4N1FA 1UHJA 4GGFA 1OOIX 4USLA 3OP0A 1U5IB 3FWBA 1GGZA 2WC8A 1DJGA 5JJGA 1KSMA 3KHEA 3NSKA 3Q8IA 3AAKA 1XFZO 2GGZA 3CR2A 2KQ6A 3OB2B 1K96A 1LXFC 1OMRA 3TS5C 3TS5B 2L98A 2K7BA 2VRGA 3LLEA 4PHJA 3VRNA 2LVKA 1FF1A 2WCFA 4IJ7A 4C0JA 1L2OC 1QV0A 1KFUL 1LA0A 1ZFSA 2HETA 3BJHA 3DVMA 1M31A 2BE4A 1TNWA 2PASA 1PK0D 1BOCA 4MVFA 2BCBA 4YI8A 1Y1UA 4JD9A 4MZJA 2JU0A 1FW4A 2LV7A 3A4UB 3EK4A 1DC1A 4ZCVA 2I18A 1YURA 2TN4A 4OV2A 1IH0A 3BFHA 3PFVA 1ALVA 3NSLA 4C0KA 3CZ2A 2ZRSA 1DT7B 1NWDA 1B7TZ 2JC2A 2WCKA 3CGAA 1GM0A 4L9MA 2L50A 4PE7A 2L51A 1CDPA 4PCWA 1S6IA 2MBXA 4CPVA 3PM2A 1F71A 4M2QA 1CFDA 1K9UA 3DF0A 3R1PA 2CXJA 3I5FB 5I2OA 4N1GA 2FJUB 2KDHA 1TNQA 4YGCB 2MAZA 1ZUZA 2OTGC 2OTGB 3R1VA 2KAXA 4F0ZB 1MWNA 1AK8A 4XYNA 2F3ZA 2I2RE 1CDNA 1KQVA 1NUBA 2MA2A 1OE9B 5HLVA 1WLMA 2K8MB 1YR5A 1M45A 3PATA 3VB1A 2EHBA 1H8BA 3PLFB 3QRXA 3R1OA 2ZKMX 2L2CA 4AQJA 1ALWA 2JXCA 3CLNA 1NX1A 2K7CA 3UNWA 2BECA 1D1OA 3PN7B 3VRPA 3OGNA 1KQMB 1A75A 1KQMC 1QS7A 1EH2A 1BF5A 3O4XA 1TRFA 2AAOA 2JULA 3JTDC 1J7OA 1C3ZA 5HYDA 4PDZA 3S0AA 1BODA 3RZSA 1DJZA 2BKIB 2L4HA 1XO5A 3DF0B 4DRWA 3CYZA 1B9AA 1RK9A 3BYAA 5HLOA 3WHUB 1OZSA 1YVLA 4ORAB 4HSZA 4WRIA 3EKJA 3M0WA 3DVEA 1N2DA 1UWOA 2ZNEA 1CDLA 1EXRA 3K1EA 1J7RA 1EG3A 5CSIA 1M46A 1R6PA 3B88A 1M39A 1SL9A 1G33A 1K95A 2SCPA 1JF0A 2KNEA 2H61A 1B7TY 2L5XB 1XYDA 2LLUA 1G8IA 2HQ8A 2LMVA 1FBVA 1DMOA 1JBAA 2JZIA 2JT0A 1CMFA 1C07A 1F55A 2Q91A 1RTP1 1QIWA 1S6CA 4MSPA 2OPOA 2WOSA 1TCOB 3RLZA 3SS5A 2P70A 1G4YR 4PHKA 5D3OA 1AUIB 1IQ5A 5DKNA 4AOMA 3D73A 1YRUB 3VROA 1B8CA 1CDMA 1QTXA 2JWWA 2KFGA 3CS1A 4HRGA 1DF0A 1NP8A 2E6WA 1BR4B 2LANA 1IG5A 2M29A 3S0BA 3UO9A 1OOFA 3EVVA 1TCFA 4E68A 2L2EA 4A4BA 3NXAA 4NDDA 1K8UA 1X02A 1K9KA 2PRUA 1TWOA 1K93D 2H61C 1Y1AA 1KFXS 4M2OA 1GQMA 2K60A 1OZOA 3BFBA 3CZTX 1KWOC 3CR4X 1T14A 2AUCA 2LLSA 3AAJA 1F4QA 4NQGA 1B8LA 5CSNA 4U8DA 1YUSA 2BKHB 2MLEC 2SASA 3D78A 1LA3A 2JPOA 3S0GA 2NCOA 3O78A 2KI6C 4QJ4B 3NGVA 4QJ5B 5K89A 3BUOB 1R2UA 4YBHB 1DF0B 2F2OA 2Q4UA 2QEBA 2LMTA 3BUMB 3QMEA 2Y1MA 1J1EA 1B4CA 5FI6A 1MUXA 1L7ZA 2LAPA 1Y6WA 5CPVA 1FPWA 2JQ6A 2NXQA 2O60A 1TIZA 3ZNIA 1V1FA
chains in the Genus database with same CATH topology
1SCMB 1SCMC 2LLTA 1C7WA 3TDIA 1KK7Y 2WNDA 3GOFA 1N65A 3KO0A 2MRDA 1W9ZA 2BAPA 1AJ5A 2KAYA 3SS4A 1IKUA 4GAOA 5FI2A 1UURA 3KEVA 1L2OB 4JWQA 1UHKA 2PMYA 1YTZC 1DGVA 1OOJA 2Y4QA 1PVBA 1OMVA 1RROA 2LVJA 4I5NB 3BUXB 5I8NA 1ZOTB 2LHLA 2KGRA 1XK4A 1KFXL 2KAVA 1F8HA 2KLDA 5AFPA 2LUXA 1CLMA 1IWQA 1WRLA 3I5IC 3I5IB 3LK1A 2LUCA 1WDCC 1WDCB 2I7AA 2KSPA 3SG6A 1WLZA 2MLFC 4YGDB 2WORA 1GGWA 2NZ0A 3SS3A 1Q80A 4ORCB 4CFQA 2WCBA 3HX4A 3IF7A 4CFRA 2GGMA 2K2AA 1SL8A 3EVRA 3LL8B 4PHNA 1IRJA 4HRHA 4YGEB 1CFPA 1WRKA 2LP2A 2GV5A 1KSOA 1B8RA 4JQ0D 1CNPA 1PRWA 4MBEA 2F2PA 3VGOA 4A4CA 4MN0A 5HKWA 3WXAA 1XK4C 1SY9A 1Z4HA 2IS9A 1TOPA 2M8UA 3NSIA 2KGBC 1S5GZ 5J3XA 3SG2A 1TN4A 4PE1A 1CFCA 1HT9A 1UP5A 1MF8B 1KCYA 4TNCA 5IBWA 3D10A 3JTDB 2JNXA 3SIAA 1RFJA 2M1KB 1CFFA 2HF5A 3KF9A 4PALA 4DCKA 2LVVA 1SCVA 2LCPA 2M7NA 3NSOA 1NCYA 3DVKA 3DD4A 3BOWA 4AQIA 4YRUA 1OMDA 4PE0A 1W7JB 3TDUA 3A8RA 1B1GA 4ZCUA 4WQ2A 2KI6D 3WHTB 4KYNA 1ZMZA 1RWYA 2OS8C 1FI6A 1HQVA 1S1EA 2V53A 2G2BA 1Y0VH 3GK2A 1A75B 4D1EA 1JC2A 4JKTA 2EGDA 2KQYA 1JSAA 4R1EA 4PHMA 1IJ5A 1QX2A 2O5GA 1SR6C 3EVUA 4DIRA 2KOTA 2Y1NA 2BL0B 2BL0C 3BUWB 3OB1B 5F6TA 1NYAA 2LM5A 2K2FA 4MZKA 2CBLA 2LE9B 3GK4X 4YGAA 1K94A 1BG1A 2MJWB 2YGUA 5HL1A 1LVCD 1YUUA 3HCMA 3EG5B 4XJKA 3BOWB 3AKBA 4OR9B 1XVJA 3SG3A 4GFTA 1V1GA 2CT9A 4I5LB 1S5GY 1DGUA 1SPYA 1S6JA 2PVBA 4P5OE 3VRQA 4GPLB 1KWOB 2LC5A 3C1VA 1PSBA 4ICBA 4GBAA 3DVJA 3IVTA 1CLBA 1NX0A 5FI7A 2L5YA 1NCZA 2FCEA 3D0YA 1JFKA 1YX7A 3IQOA 5CSJA 1SYMA 3CWGA 2JT3A 1QV1A 1QASA 3K21A 3I5GC 3I5GB 1SW8A 2KLEA 4XJKB 1QATA 3O4YA 3OHMB 3SG7A 1QVIZ 2KFHA 4C0LA 4N5XA 2WCEA 1A2XA 1JFJA 1MR8A 1CM4A 1A03A 5HKYA 2M7LA 4GGNA 1MXEA 1NX2A 2RGIA 1S36A 2F8PA 1XFUO 3BUNB 1QIVA 1NX3A 4QJ3B 1W7IB 1AHRA 5ER5A 1B47A 5FYXA 2KYCA 3F45A 1CKKA 1LKJA 2M9GA 4CIDA 4MRXA 2LMUA 2F33A 3TUYC 1RECA 3D0YB 4DS7A 1OSAA 3WNXB 1DJIA 3I5HC 2AMIA 1IQ3A 1J7QA 1S26D 1C7VA 1H4BA 1BT6A 3PSRA 1GJYA 1UHHA 1K9PA 3E3RA 5KSZA 3TDZA 1J55A 1SL7A 1YRTB 2JRFA 1XA5A 3TZ1A 1MHOA 1MXLC 1DJWA 1CMGA 3H4SE 3OX6A 1IGVA 3IQQA 2L0PA 1QXPA 3SG4A 3FS7A 2BBMA 2M0RA 1PVAA 2KBMA 2M97A 1DVIA 1ZACA 2K61A 2PSRA 1SNLA 3O6BA 2COLB 3ICBA 2A4JA 2CCMA 2DOQA 1J1DA 2BCXA 3EK7A 1IJ6A 2ZRTA 1YUTA 2KBIA 1DTLA 1DJHA 2JPTA 1BR1B 2M49B 1LINA 2JT8A 1XFXO 2BBNA 1BJFA 2FCDA 2JNFA 1QVIY 4GGFC 5TNCA 1BLQA 4MLWA 2G9BA 4M2PA 2BCAA 4FTGA 5GQQC 1CM1A 1DEKA 1JUOA 3SJSA 1KK8B 1KK8C 1M63B 4YGBB 3SIBA 2BNXA 4ORBB 1BMOA 1TNXA 1TTXA 5I2QA 3MSEB 2K0JA 4FQOA 5DKQA 1PSRA 1JF2A 2E30A 1S3PA 1AJ4A 2EC6B 2EC6C 1TNPA 1OQPA 2ZN8A 4HREE 4P2YB 1DELA 5I2LA 4NDCA 3I5FC 2CNPA 1DJYA 5BPJA 1SKTA 1CTRA 1MQ1A 5AANA 1SRAA 3AKAA 1Y1XA 3JVTB 3JVTC 1A4PA 1NIWA 3PM8A 1XFVO 5G08A 5KTYA 1E8AA 4BY5A 2K7DA 2JXLA 2K7OA 1A29A 3BQ3A 4IL1A 5PALA 3ZWHA 2H2KA 2QPTA 5KU1A 1XFYO 1QX7A 1BU3A 2L4IA 3PN7C 3FWCA 2OS8B 1CLLA 4MZLA 2R2IA 1EG4A 1WY9A 1SMGA 2LP3A 1FI5A 5I94A 4DUQA 1QLSA 2LVIA 2FOTA 1SK6D 2ZFDA 3OBVA 1SR6B 1VRKA 1UUSA 4MRYA 4JPZB 4I5KA 1RJVA 3VRRA 2LHIA 1QJTA 4PE4A 4CLNA 4Q04A 1N0YA 2HQWA 3O2PA 2KFFA 1YX8A 4OKHA 2I94A 4BY4A 1XFWO 1PULA 2M1UA 5HKZA 1NPQA 2JTTA 2ZN9A 1KK7Z 2KYFA 4GUKA 1NSHA 3CR5X 2HPSA 2M3WA 1UHIA 2PALA 1AVSA 4I5JA 1K2HA 1AP4A 1F70A 2JTZA 3OX5A 4OVNF 3FIAA 1K90D 1J7PA 1EJ3A 2QACA 4WQ3A 2ZNDA 2ISDA 1QX5B 5ER4X 1JWDA 1UHNA 3LCPC 1SBJA 1Z2CB 3SG5A 1KFUS 5CSFA 5AERA 2P6BB 1EL4A 5AXIA 2B1UA 3KPXA 4OCIA 1U5IA 4NDBA 5B8IB 4MEWA 3CTNA 3PALA 3RM1A 2BE6A 2D8NA 5AEQA 1ODBA 1QLKA 3BXKA 2NLNA 3EK8A 1NCXA 1CB1A 2KHNA 2LNKA 1DJXA 2MHHA 1WRZA 3GK1A 2NCPA 3EKHA 2F3YA 2CTNA 4GNKB 5D69A 4ETOA 3TUYB 1F4OA 5JOLA 4YI9A 3I5HB 5DKRA 2Y5IA 3LK0A 1F54A 1YVHA 5D7FA 4UPGA 1PALA 2JOJA 2KI4C 2KI4B 4N1FA 1UHJA 4GGFA 4USLA 3OP0A 1U5IB 3FWBA 1GGZA 2WC8A 1DJGA 5JJGA 1KSMA 3KHEA 3NSKA 3AAKA 1XFZO 2GGZA 3CR2A 2KQ6A 3OB2B 1K96A 1LXFC 1OMRA 3TS5C 3TS5B 2L98A 2K7BA 2VRGA 3LLEA 4PHJA 3VRNA 2LVKA 1FF1A 2WCFA 4IJ7A 4C0JA 1L2OC 1QV0A 1KFUL 1LA0A 1ZFSA 2HETA 3DVMA 1M31A 2BE4A 1TNWA 2PASA 1PK0D 1BOCA 4MVFA 2BCBA 4YI8A 1Y1UA 4MZJA 2JU0A 1FW4A 2LV7A 3A4UB 3EK4A 1DC1A 4ZCVA 2I18A 1YURA 2TN4A 4OV2A 1IH0A 3PFVA 1ALVA 3NSLA 4C0KA 2ZRSA 1DT7B 1NWDA 1B7TZ 2JC2A 3CGAA 4L9MA 2L50A 4PE7A 2L51A 1CDPA 4PCWA 1S6IA 2MBXA 4CPVA 1F71A 3PM2A 4M2QA 1CFDA 1K9UA 3DF0A 2CXJA 3I5FB 5I2OA 4N1GA 2FJUB 2KDHA 1TNQA 4YGCB 2MAZA 1ZUZA 2OTGC 2OTGB 1CDNA 2KAXA 4F0ZB 1MWNA 1AK8A 4XYNA 2F3ZA 2I2RE 1KQVA 1NUBA 2MA2A 1OE9B 5HLVA 1WLMA 2K8MB 1YR5A 1M45A 3PATA 1H8BA 2EHBA 3PLFB 3QRXA 4AQJA 2ZKMX 1ALWA 2JXCA 3CLNA 1NX1A 2K7CA 1D1OA 2BECA 3UNWA 3PN7B 3VRPA 1KQMB 1A75A 1KQMC 1QS7A 1EH2A 1BF5A 3O4XA 1TRFA 2AAOA 2JULA 3JTDC 1J7OA 5HYDA 4PDZA 1BODA 1DJZA 2BKIB 2L4HA 1XO5A 3DF0B 4DRWA 1B9AA 1RK9A 3BYAA 5HLOA 3WHUB 1OZSA 1YVLA 4ORAB 4HSZA 4WRIA 3EKJA 3M0WA 3DVEA 1N2DA 1UWOA 2ZNEA 1CDLA 1EXRA 5CSIA 1J7RA 1EG3A 1M46A 1R6PA 1M39A 1SL9A 1G33A 1K95A 2SCPA 1JF0A 2KNEA 2H61A 1B7TY 2L5XB 1XYDA 2LLUA 1G8IA 2HQ8A 2LMVA 1FBVA 1DMOA 1JBAA 2JZIA 2JT0A 1CMFA 1C07A 1F55A 2Q91A 1RTP1 1QIWA 1S6CA 4MSPA 2OPOA 2WOSA 1TCOB 3RLZA 3SS5A 1G4YR 4PHKA 5D3OA 1AUIB 1IQ5A 5DKNA 4AOMA 1YRUB 3VROA 1B8CA 1CDMA 1QTXA 2JWWA 2KFGA 3CS1A 4HRGA 1DF0A 1NP8A 2E6WA 1BR4B 2LANA 1IG5A 2M29A 3UO9A 3EVVA 1TCFA 4E68A 2L2EA 4A4BA 3NXAA 4NDDA 1K8UA 1K9KA 1X02A 2PRUA 1K93D 2H61C 1Y1AA 1KFXS 4M2OA 1GQMA 2K60A 1OZOA 3CZTX 1KWOC 3CR4X 2AUCA 2LLSA 4NQGA 3AAJA 1F4QA 1B8LA 5CSNA 4U8DA 1YUSA 2BKHB 2MLEC 2SASA 1LA3A 2NCOA 3O78A 2KI6C 4QJ4B 4QJ5B 5K89A 3BUOB 1R2UA 4YBHB 1DF0B 2F2OA 2Q4UA 3BUMB 2LMTA 2Y1MA 1J1EA 1B4CA 5FI6A 1MUXA 1L7ZA 2LAPA 1Y6WA 5CPVA 1FPWA 2JQ6A 2NXQA 2O60A 1TIZA 3ZNIA 1V1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCM B;  1SCM C;  2LLT A;  1C7W A;  3TDI A;  1KK7 Y;  2WND A;  3GOF A;  1N65 A;  3KO0 A;  2MRD A;  1AJ5 A;  2KAY A;  1IKU A;  4GAO A;  1UUR A;  3KEV A;  1L2O B;  4JWQ A;  1UHK A;  2PMY A;  1YTZ C;  1DGV A;  1OOJ A;  2Y4Q A;  1PVB A;  1OMV A;  1RRO A;  2LVJ A;  4I5N B;  3BUX B;  5I8N A;  1ZOT B;  2LHL A;  2KGR A;  1XK4 A;  1KFX L;  2KAV A;  1F8H A;  5AFP A;  2LUX A;  1CLM A;  1IWQ A;  1WRL A;  3I5I C;  3I5I B;  3LK1 A;  2LUC A;  1WDC C;  1WDC B;  2I7A A;  2KSP A;  3SG6 A;  1WLZ A;  2MLF C;  4YGD B;  2WOR A;  1GGW A;  2NZ0 A;  1Q80 A;  4ORC B;  4CFQ A;  2WCB A;  3HX4 A;  3IF7 A;  4CFR A;  2GGM A;  2K2A A;  1SL8 A;  3EVR A;  3LL8 B;  4PHN A;  1IRJ A;  4HRH A;  4YGE B;  1CFP A;  1WRK A;  2LP2 A;  2GV5 A;  1KSO A;  1B8R A;  4JQ0 D;  1CNP A;  1PRW A;  4MBE A;  2F2P A;  3VGO A;  4A4C A;  4MN0 A;  5HKW A;  3WXA A;  1XK4 C;  1SY9 A;  2IS9 A;  1TOP A;  2M8U A;  3NSI A;  2KGB C;  1S5G Z;  5J3X A;  3SG2 A;  1TN4 A;  4PE1 A;  1CFC A;  1HT9 A;  1UP5 A;  1MF8 B;  1KCY A;  4TNC A;  5IBW A;  3D10 A;  3JTD B;  2JNX A;  3SIA A;  1RFJ A;  2M1K B;  1CFF A;  2HF5 A;  3KF9 A;  4PAL A;  4DCK A;  2LVV A;  1SCV A;  2LCP A;  2M7N A;  3NSO A;  1NCY A;  3DVK A;  3DD4 A;  3BOW A;  4AQI A;  4YRU A;  1OMD A;  4PE0 A;  1W7J B;  3TDU A;  3A8R A;  1B1G A;  4ZCU A;  4WQ2 A;  2KI6 D;  3WHT B;  1ZMZ A;  1RWY A;  2OS8 C;  1FI6 A;  1HQV A;  1S1E A;  2V53 A;  2G2B A;  1Y0V H;  3GK2 A;  1A75 B;  4D1E A;  1JC2 A;  2EGD A;  2KQY A;  1JSA A;  4R1E A;  4PHM A;  1IJ5 A;  1QX2 A;  2O5G A;  1SR6 C;  3EVU A;  4DIR A;  2KOT A;  2Y1N A;  2BL0 B;  2BL0 C;  3BUW B;  3OB1 B;  5F6T A;  1NYA A;  2LM5 A;  2K2F A;  4MZK A;  2CBL A;  2LE9 B;  3GK4 X;  4YGA A;  1K94 A;  1BG1 A;  2MJW B;  1LVC D;  1YUU A;  3HCM A;  4XJK A;  3BOW B;  3AKB A;  4OR9 B;  1XVJ A;  3SG3 A;  4GFT A;  1V1G A;  2CT9 A;  4I5L B;  1S5G Y;  1DGU A;  1SPY A;  1S6J A;  2PVB A;  4P5O E;  3VRQ A;  4GPL B;  1KWO B;  2LC5 A;  3C1V A;  1PSB A;  4ICB A;  4GBA A;  3DVJ A;  1CLB A;  1NX0 A;  1NCZ A;  2FCE A;  3D0Y A;  1JFK A;  1YX7 A;  3IQO A;  5CSJ A;  1SYM A;  3CWG A;  2JT3 A;  1QV1 A;  1QAS A;  3K21 A;  3I5G C;  3I5G B;  1SW8 A;  4XJK B;  1QAT A;  3O4Y A;  3OHM B;  3SG7 A;  1QVI Z;  2KFH A;  4C0L A;  4N5X A;  2WCE A;  1A2X A;  1JFJ A;  1MR8 A;  1CM4 A;  1A03 A;  5HKY A;  2M7L A;  4GGN A;  1MXE A;  1NX2 A;  2RGI A;  1S36 A;  2F8P A;  1XFU O;  3BUN B;  1QIV A;  1NX3 A;  4QJ3 B;  1W7I B;  1AHR A;  5ER5 A;  1B47 A;  5FYX A;  2KYC A;  3F45 A;  1CKK A;  1LKJ A;  2M9G A;  4CID A;  4MRX A;  2LMU A;  2F33 A;  3TUY C;  1REC A;  3D0Y B;  4DS7 A;  1OSA A;  3WNX B;  1DJI A;  3I5H C;  2AMI A;  1IQ3 A;  1J7Q A;  1S26 D;  1C7V A;  1H4B A;  1BT6 A;  3PSR A;  1GJY A;  1UHH A;  1K9P A;  3E3R A;  5KSZ A;  3TDZ A;  1J55 A;  1SL7 A;  1YRT B;  2JRF A;  1XA5 A;  3TZ1 A;  1MHO A;  1MXL C;  1DJW A;  1CMG A;  3H4S E;  3OX6 A;  1IGV A;  3IQQ A;  2L0P A;  1QXP A;  3SG4 A;  3FS7 A;  2BBM A;  2M0R A;  1PVA A;  2KBM A;  2M97 A;  1DVI A;  1ZAC A;  2K61 A;  2PSR A;  1SNL A;  3O6B A;  2COL B;  3ICB A;  2A4J A;  2CCM A;  2DOQ A;  1J1D A;  2BCX A;  3EK7 A;  1IJ6 A;  2ZRT A;  1YUT A;  2KBI A;  1DTL A;  1DJH A;  2JPT A;  1BR1 B;  2M49 B;  1LIN A;  2JT8 A;  1XFX O;  2BBN A;  1BJF A;  2FCD A;  2JNF A;  1QVI Y;  4GGF C;  5TNC A;  1BLQ A;  4MLW A;  2G9B A;  4M2P A;  2BCA A;  4FTG A;  5GQQ C;  1CM1 A;  1JUO A;  3SJS A;  1KK8 B;  1KK8 C;  1M63 B;  4YGB B;  3SIB A;  4ORB B;  1BMO A;  1TNX A;  1TTX A;  5I2Q A;  3MSE B;  2K0J A;  4FQO A;  5DKQ A;  1PSR A;  1JF2 A;  2E30 A;  1S3P A;  1AJ4 A;  2EC6 B;  2EC6 C;  1TNP A;  1OQP A;  2ZN8 A;  4HRE E;  4P2Y B;  5I2L A;  4NDC A;  3I5F C;  2CNP A;  1DJY A;  5BPJ A;  1SKT A;  1CTR A;  1MQ1 A;  5AAN A;  1SRA A;  3AKA A;  1Y1X A;  3JVT B;  3JVT C;  1A4P A;  1NIW A;  3PM8 A;  1XFV O;  5G08 A;  5KTY A;  1E8A A;  4BY5 A;  2K7D A;  2JXL A;  2K7O A;  1A29 A;  3BQ3 A;  4IL1 A;  5PAL A;  3ZWH A;  2H2K A;  2QPT A;  5KU1 A;  1XFY O;  1QX7 A;  1BU3 A;  2L4I A;  3PN7 C;  3FWC A;  2OS8 B;  1CLL A;  4MZL A;  2R2I A;  1EG4 A;  1WY9 A;  1SMG A;  2LP3 A;  1FI5 A;  4DUQ A;  1QLS A;  2LVI A;  2FOT A;  1SK6 D;  2ZFD A;  1SR6 B;  1VRK A;  1UUS A;  4MRY A;  4JPZ B;  4I5K A;  1RJV A;  3VRR A;  2LHI A;  1QJT A;  4PE4 A;  4CLN A;  4Q04 A;  1N0Y A;  2HQW A;  3O2P A;  2KFF A;  1YX8 A;  4OKH A;  2I94 A;  4BY4 A;  1XFW O;  1PUL A;  2M1U A;  5HKZ A;  1NPQ A;  2JTT A;  2ZN9 A;  1KK7 Z;  2KYF A;  4GUK A;  1NSH A;  3CR5 X;  2HPS A;  2M3W A;  1UHI A;  2PAL A;  1AVS A;  4I5J A;  1K2H A;  1AP4 A;  1F70 A;  2JTZ A;  3OX5 A;  4OVN F;  3FIA A;  1K90 D;  1J7P A;  1EJ3 A;  2QAC A;  4WQ3 A;  2ZND A;  2ISD A;  1QX5 B;  5ER4 X;  1JWD A;  1UHN A;  3LCP C;  1SBJ A;  3SG5 A;  1KFU S;  5CSF A;  5AER A;  2P6B B;  1EL4 A;  5AXI A;  2B1U A;  3KPX A;  4OCI A;  1U5I A;  4NDB A;  5B8I B;  4MEW A;  3CTN A;  3PAL A;  3RM1 A;  2BE6 A;  2D8N A;  5AEQ A;  1ODB A;  1QLK A;  3BXK A;  2NLN A;  3EK8 A;  1NCX A;  1CB1 A;  2KHN A;  2LNK A;  1DJX A;  2MHH A;  1WRZ A;  3GK1 A;  2NCP A;  3EKH A;  2F3Y A;  2CTN A;  4GNK B;  5D69 A;  4ETO A;  3TUY B;  1F4O A;  5JOL A;  4YI9 A;  3I5H B;  5DKR A;  2Y5I A;  3LK0 A;  1F54 A;  1YVH A;  5D7F A;  4UPG A;  1PAL A;  2JOJ A;  2KI4 C;  2KI4 B;  4N1F A;  1UHJ A;  4GGF A;  4USL A;  3OP0 A;  1U5I B;  3FWB A;  1GGZ A;  2WC8 A;  1DJG A;  5JJG A;  1KSM A;  3KHE A;  3NSK A;  3AAK A;  1XFZ O;  2GGZ A;  3CR2 A;  2KQ6 A;  3OB2 B;  1K96 A;  1LXF C;  1OMR A;  3TS5 C;  3TS5 B;  2L98 A;  2K7B A;  2VRG A;  3LLE A;  4PHJ A;  3VRN A;  2LVK A;  1FF1 A;  2WCF A;  4C0J A;  1L2O C;  1QV0 A;  1KFU L;  1LA0 A;  1ZFS A;  2HET A;  3DVM A;  1M31 A;  2BE4 A;  1TNW A;  2PAS A;  1PK0 D;  1BOC A;  4MVF A;  2BCB A;  4YI8 A;  1Y1U A;  4MZJ A;  2JU0 A;  1FW4 A;  2LV7 A;  3A4U B;  3EK4 A;  4ZCV A;  2I18 A;  1YUR A;  2TN4 A;  4OV2 A;  1IH0 A;  3PFV A;  1ALV A;  3NSL A;  4C0K A;  2ZRS A;  1DT7 B;  1NWD A;  1B7T Z;  2JC2 A;  3CGA A;  4L9M A;  2L50 A;  4PE7 A;  2L51 A;  1CDP A;  4PCW A;  1S6I A;  2MBX A;  4CPV A;  1F71 A;  4M2Q A;  1CFD A;  1K9U A;  3DF0 A;  2CXJ A;  3I5F B;  5I2O A;  4N1G A;  2FJU B;  2KDH A;  1TNQ A;  4YGC B;  2MAZ A;  1ZUZ A;  2OTG C;  2OTG B;  1CDN A;  2KAX A;  4F0Z B;  1MWN A;  1AK8 A;  4XYN A;  2F3Z A;  2I2R E;  1KQV A;  1NUB A;  2MA2 A;  1OE9 B;  5HLV A;  1WLM A;  2K8M B;  1YR5 A;  1M45 A;  3PAT A;  1H8B A;  2EHB A;  3PLF B;  3QRX A;  4AQJ A;  2ZKM X;  1ALW A;  2JXC A;  3CLN A;  1NX1 A;  2K7C A;  1D1O A;  2BEC A;  3PN7 B;  3VRP A;  1KQM B;  1A75 A;  1KQM C;  1QS7 A;  1EH2 A;  1BF5 A;  1TRF A;  2AAO A;  2JUL A;  3JTD C;  1J7O A;  5HYD A;  4PDZ A;  1BOD A;  1DJZ A;  2BKI B;  2L4H A;  1XO5 A;  3DF0 B;  4DRW A;  1B9A A;  1RK9 A;  3BYA A;  5HLO A;  3WHU B;  1OZS A;  1YVL A;  4ORA B;  4HSZ A;  4WRI A;  3EKJ A;  3M0W A;  3DVE A;  1N2D A;  1UWO A;  2ZNE A;  1CDL A;  1EXR A;  5CSI A;  1J7R A;  1EG3 A;  1M46 A;  1R6P A;  1M39 A;  1SL9 A;  1G33 A;  1K95 A;  2SCP A;  1JF0 A;  2KNE A;  2H61 A;  1B7T Y;  2L5X B;  1XYD A;  2LLU A;  1G8I A;  2HQ8 A;  2LMV A;  1FBV A;  1DMO A;  1JBA A;  2JZI A;  2JT0 A;  1CMF A;  1C07 A;  1F55 A;  2Q91 A;  1RTP 1;  1QIW A;  1S6C A;  4MSP A;  2OPO A;  2WOS A;  1TCO B;  3RLZ A;  1G4Y R;  4PHK A;  1AUI B;  1IQ5 A;  5DKN A;  4AOM A;  1YRU B;  3VRO A;  1B8C A;  1CDM A;  1QTX A;  2JWW A;  2KFG A;  3CS1 A;  4HRG A;  1DF0 A;  1NP8 A;  2E6W A;  1BR4 B;  2LAN A;  1IG5 A;  2M29 A;  3EVV A;  1TCF A;  4E68 A;  2L2E A;  4A4B A;  3NXA A;  4NDD A;  1K8U A;  1K9K A;  1X02 A;  2PRU A;  1K93 D;  2H61 C;  1Y1A A;  1KFX S;  4M2O A;  1GQM A;  1OZO A;  3CZT X;  1KWO C;  3CR4 X;  2AUC A;  2LLS A;  4NQG A;  3AAJ A;  1F4Q A;  1B8L A;  5CSN A;  4U8D A;  1YUS A;  2BKH B;  2MLE C;  2SAS A;  1LA3 A;  2NCO A;  3O78 A;  2KI6 C;  4QJ4 B;  4QJ5 B;  5K89 A;  3BUO B;  1R2U A;  4YBH B;  1DF0 B;  2F2O A;  2Q4U A;  3BUM B;  2LMT A;  2Y1M A;  1J1E A;  1B4C A;  1MUX A;  1L7Z A;  2LAP A;  1Y6W A;  5CPV A;  1FPW A;  2JQ6 A;  2NXQ A;  2O60 A;  1TIZ A;  3ZNI A;  1V1F A; 
#chains in the Genus database with same CATH topology
 1SCM B;  1SCM C;  2LLT A;  3L4L A;  1C7W A;  3TDI A;  1KK7 Y;  2WND A;  3B7A A;  3GOF A;  1N65 A;  3KO0 A;  2MRD A;  1W9Z A;  2BAP A;  1AJ5 A;  2KAY A;  3SS4 A;  1IKU A;  4GAO A;  5FI2 A;  1UUR A;  3KEV A;  1L2O B;  4JWQ A;  1UHK A;  2PMY A;  1YTZ C;  1DGV A;  1OOJ A;  2Y4Q A;  1PVB A;  1OMV A;  1RRO A;  2LVJ A;  4I5N B;  3BUX B;  3FE6 A;  5I8N A;  1ZOT B;  2LHL A;  2KGR A;  1XK4 A;  1KFX L;  2KAV A;  2KLD A;  1F8H A;  3D74 A;  5AFP A;  2LUX A;  1CLM A;  1IWQ A;  1WRL A;  3I5I C;  3I5I B;  3LK1 A;  2LUC A;  1WDC C;  1WDC B;  2I7A A;  2KSP A;  3L47 A;  3SG6 A;  1WLZ A;  2MLF C;  2QDI A;  2WOR A;  2FJY A;  4YGD B;  2NZ0 A;  3SS3 A;  1GGW A;  2WC5 A;  1Q80 A;  4ORC B;  4CFQ A;  2WCB A;  3HX4 A;  3IF7 A;  4CFR A;  2GGM A;  2K2A A;  1SL8 A;  2QEO A;  3EVR A;  3LL8 B;  1IRJ A;  4HRH A;  4PHN A;  4YGE B;  1CFP A;  1WRK A;  1C3Y A;  2LP2 A;  2GV5 A;  1KSO A;  1B8R A;  3NHT A;  4JQ0 D;  1CNP A;  1PRW A;  4MBE A;  2F2P A;  3VGO A;  4A4C A;  2WCM A;  2WCJ A;  4MN0 A;  5HKW A;  3WXA A;  1XK4 C;  1SY9 A;  1Z4H A;  2IS9 A;  1TOP A;  3S0F A;  2M8U A;  2ERB A;  3NSI A;  3R72 A;  2KGB C;  1S5G Z;  5J3X A;  3SG2 A;  1TN4 A;  4PE1 A;  1LS8 A;  1CFC A;  1HT9 A;  1UP5 A;  1MF8 B;  1KCY A;  1SSE B;  4TNC A;  5IBW A;  3D10 A;  3JTD B;  3S0D A;  2JNX A;  3SIA A;  1RFJ A;  2M1K B;  3BFA A;  1CFF A;  2HF5 A;  3KF9 A;  4PAL A;  4DCK A;  3B86 A;  2LVV A;  3L4A A;  1SCV A;  2LCP A;  2M7N A;  3NSO A;  1NCY A;  3DVK A;  3DD4 A;  3BOW A;  4AQI A;  4YRU A;  1OMD A;  4PE0 A;  1W7J B;  3TDU A;  3A8R A;  1B1G A;  4ZCU A;  4KYN A;  2KI6 D;  4WQ2 A;  3WHT B;  1ZMZ A;  1RWY A;  2OS8 C;  1FI6 A;  1HQV A;  3FE9 A;  3B87 A;  1S1E A;  2V53 A;  2G2B A;  1Y0V H;  3GK2 A;  1A75 B;  4JKT A;  4D1E A;  1JC2 A;  2EGD A;  2KQY A;  1JSA A;  4R1E A;  4PHM A;  1IJ5 A;  1QX2 A;  2O5G A;  1SR6 C;  3EVU A;  3CAB A;  2KOT A;  4DIR A;  2Y1N A;  2BL0 B;  2BL0 C;  3BUW B;  3OB1 B;  5F6T A;  1NYA A;  2LM5 A;  2K2F A;  4MZK A;  2CBL A;  2LE9 B;  3GK4 X;  4YGA A;  1K94 A;  1BG1 A;  2MJW B;  2YGU A;  5HL1 A;  1LVC D;  1YUU A;  3EG5 B;  3HCM A;  4XJK A;  3BOW B;  3AKB A;  4OR9 B;  1QWV A;  1IIO A;  1XVJ A;  3SG3 A;  4GFT A;  1V1G A;  2CT9 A;  4I5L B;  1S5G Y;  5KU1 A;  1DGU A;  1SPY A;  1S6J A;  2PVB A;  4P5O E;  3VRQ A;  4GPL B;  1KWO B;  2LC5 A;  1OW4 A;  3C1V A;  1PSB A;  3D77 A;  4ICB A;  4GBA A;  3DVJ A;  3IVT A;  1CLB A;  1NX0 A;  5FI7 A;  2L5Y A;  1NCZ A;  2FCE A;  3D0Y A;  1JFK A;  2PQL A;  1YX7 A;  3IQO A;  5CSJ A;  1SYM A;  3CWG A;  2JT3 A;  1QV1 A;  1QAS A;  1OOG A;  3K21 A;  3I5G C;  3I5G B;  1SW8 A;  2KLE A;  3D75 A;  4XJK B;  1QAT A;  3O4Y A;  3OHM B;  3SG7 A;  1QVI Z;  2KFH A;  4C0L A;  1XFR A;  4N5X A;  2WCE A;  1A2X A;  1JFJ A;  1MR8 A;  1CM4 A;  1A03 A;  5HKY A;  2M7L A;  4GGN A;  1MXE A;  1NX2 A;  2RGI A;  1S36 A;  2F8P A;  1XFU O;  3BUN B;  1QIV A;  1NX3 A;  4QJ3 B;  1W7I B;  1AHR A;  5ER5 A;  1B47 A;  5FYX A;  2KYC A;  3F45 A;  1CKK A;  1LKJ A;  2M9G A;  4CID A;  4MRX A;  2H8V A;  2F33 A;  2LMU A;  3TUY C;  1REC A;  3D0Y B;  4DS7 A;  1OSA A;  3WNX B;  1DJI A;  2WCH A;  2AMI A;  3I5H C;  1IQ3 A;  1J7Q A;  1S26 D;  1C7V A;  1H4B A;  1BT6 A;  3PSR A;  1GJY A;  1UHH A;  1K9P A;  3E3R A;  2WCL A;  5KSZ A;  3NHI A;  3TDZ A;  1J55 A;  1SL7 A;  1YRT B;  2JRF A;  1XA5 A;  3TZ1 A;  1MHO A;  1MXL C;  1DJW A;  1CMG A;  3H4S E;  3OX6 A;  1IGV A;  3IQQ A;  2L0P A;  1QXP A;  3SG4 A;  3FS7 A;  2BBM A;  2M0R A;  2QEH A;  1PVA A;  2KBM A;  2M97 A;  1DVI A;  1ZAC A;  2K61 A;  2PSR A;  1SNL A;  3O6B A;  2COL B;  3ICB A;  2A4J A;  2CCM A;  2DOQ A;  1J1D A;  2BCX A;  2PYQ A;  3EK7 A;  1IJ6 A;  2ZRT A;  5EL2 A;  3DYE A;  3CZ1 A;  3V2L A;  1YUT A;  2KBI A;  1P28 A;  1DTL A;  1DJH A;  2JPT A;  1BR1 B;  2M49 B;  1LIN A;  2JT8 A;  1XFX O;  2BBN A;  1BJF A;  2FCD A;  2JNF A;  1QVI Y;  4PT1 A;  4GGF C;  5TNC A;  1BLQ A;  4MLW A;  2G9B A;  3S0E A;  4M2P A;  2BCA A;  4FTG A;  5GQQ C;  3B6X A;  1CM1 A;  1DEK A;  1JUO A;  3DY9 A;  3SJS A;  1KK8 B;  1KK8 C;  1M63 B;  4YGB B;  2BNX A;  3SIB A;  4ORB B;  1BMO A;  1TNX A;  1TTX A;  5I2Q A;  3MSE B;  2K0J A;  4FQO A;  5DKQ A;  1PSR A;  1JF2 A;  2E30 A;  1S3P A;  1AJ4 A;  2EC6 B;  2EC6 C;  1TNP A;  1OQP A;  2ZN8 A;  4HRE E;  4P2Y B;  1DEL A;  5I2L A;  4NDC A;  3I5F C;  2CNP A;  1DJY A;  5BPJ A;  1SKT A;  1DQE A;  1CTR A;  1MQ1 A;  5AAN A;  1SRA A;  3AKA A;  1Y1X A;  3JVT B;  3JVT C;  1A4P A;  1NIW A;  3PM8 A;  1XFV O;  5G08 A;  5KTY A;  1E8A A;  4BY5 A;  2K7D A;  2JXL A;  4FQT A;  2K7O A;  1A29 A;  1TUJ A;  2P71 A;  3BQ3 A;  4IL1 A;  2H2K A;  2QPT A;  5PAL A;  1XFY O;  3ZWH A;  1QX7 A;  1BU3 A;  2L4I A;  4INW A;  3D76 A;  2QEV A;  3FWC A;  2OS8 B;  3CZ0 A;  1CLL A;  3PN7 C;  4MZL A;  2R2I A;  1EG4 A;  1WY9 A;  1SMG A;  2LP3 A;  1FI5 A;  5I94 A;  3CDN A;  4DUQ A;  1QLS A;  2LVI A;  2FOT A;  1SK6 D;  2ZFD A;  3OBV A;  1SR6 B;  1VRK A;  1UUS A;  4OZD A;  4MRY A;  4JPZ B;  2KPH A;  4I5K A;  1RJV A;  3VRR A;  1ORG A;  2LHI A;  1QJT A;  4PE4 A;  4CLN A;  4INX A;  4Q04 A;  1N0Y A;  2HQW A;  3O2P A;  2KFF A;  1YX8 A;  4OKH A;  4F7F A;  2I94 A;  4BY4 A;  1XFW O;  1PUL A;  2M1U A;  5HKZ A;  1TUZ A;  1NPQ A;  2JTT A;  2ZN9 A;  1KK7 Z;  2KYF A;  4GUK A;  1NSH A;  3CR5 X;  2HPS A;  2M3W A;  1UHI A;  2PAL A;  1AVS A;  4I5J A;  1K2H A;  1AP4 A;  1F70 A;  2JTZ A;  3OX5 A;  4OVN F;  3FIA A;  1K90 D;  1J7P A;  1EJ3 A;  2QAC A;  4WQ3 A;  2ZND A;  2ISD A;  1QX5 B;  5ER4 X;  1JWD A;  1UHN A;  3LCP C;  2GTE A;  1SBJ A;  1Z2C B;  3SG5 A;  1KFU S;  5CSF A;  5AER A;  2P6B B;  2WC6 A;  1EL4 A;  3N7H A;  5AXI A;  2B1U A;  5DIC A;  3KPX A;  4OCI A;  1U5I A;  4NDB A;  5B8I B;  4MEW A;  3CTN A;  3PAL A;  3DZT A;  3RM1 A;  2BE6 A;  2D8N A;  5AEQ A;  1ODB A;  1QLK A;  3BXK A;  3PJI A;  2NLN A;  3EK8 A;  1OOH A;  1NCX A;  1CB1 A;  2KHN A;  3DXL A;  2LNK A;  1DJX A;  2MHH A;  1WRZ A;  3GK1 A;  2NCP A;  3EKH A;  2F3Y A;  2CTN A;  4GNK B;  5D69 A;  4ETO A;  3TUY B;  1F4O A;  5JOL A;  4YI9 A;  3I5H B;  5DKR A;  2Y5I A;  3LK0 A;  3FE8 A;  1F54 A;  1YVH A;  5D7F A;  4UPG A;  1PAL A;  2JOJ A;  2KI4 C;  2KI4 B;  4N1F A;  1UHJ A;  4GGF A;  1OOI X;  4USL A;  3OP0 A;  1U5I B;  3FWB A;  1GGZ A;  2WC8 A;  1DJG A;  5JJG A;  1KSM A;  3KHE A;  3NSK A;  3Q8I A;  3AAK A;  1XFZ O;  2GGZ A;  3CR2 A;  2KQ6 A;  3OB2 B;  1K96 A;  1LXF C;  1OMR A;  3TS5 C;  3TS5 B;  2L98 A;  2K7B A;  2VRG A;  3LLE A;  4PHJ A;  3VRN A;  2LVK A;  1FF1 A;  2WCF A;  4IJ7 A;  4C0J A;  1L2O C;  1QV0 A;  1KFU L;  1LA0 A;  1ZFS A;  2HET A;  3BJH A;  3DVM A;  1M31 A;  2BE4 A;  1TNW A;  2PAS A;  1PK0 D;  1BOC A;  4MVF A;  2BCB A;  4YI8 A;  1Y1U A;  4JD9 A;  4MZJ A;  2JU0 A;  1FW4 A;  2LV7 A;  3A4U B;  3EK4 A;  1DC1 A;  4ZCV A;  2I18 A;  1YUR A;  2TN4 A;  4OV2 A;  1IH0 A;  3BFH A;  3PFV A;  1ALV A;  3NSL A;  4C0K A;  3CZ2 A;  2ZRS A;  1DT7 B;  1NWD A;  1B7T Z;  2JC2 A;  2WCK A;  3CGA A;  1GM0 A;  4L9M A;  2L50 A;  4PE7 A;  2L51 A;  1CDP A;  4PCW A;  1S6I A;  2MBX A;  4CPV A;  3PM2 A;  1F71 A;  4M2Q A;  1CFD A;  1K9U A;  3DF0 A;  3R1P A;  2CXJ A;  3I5F B;  5I2O A;  4N1G A;  2FJU B;  2KDH A;  1TNQ A;  4YGC B;  2MAZ A;  1ZUZ A;  2OTG C;  2OTG B;  3R1V A;  2KAX A;  4F0Z B;  1MWN A;  1AK8 A;  4XYN A;  2F3Z A;  2I2R E;  1CDN A;  1KQV A;  1NUB A;  2MA2 A;  1OE9 B;  5HLV A;  1WLM A;  2K8M B;  1YR5 A;  1M45 A;  3PAT A;  3VB1 A;  2EHB A;  1H8B A;  3PLF B;  3QRX A;  3R1O A;  2ZKM X;  2L2C A;  4AQJ A;  1ALW A;  2JXC A;  3CLN A;  1NX1 A;  2K7C A;  3UNW A;  2BEC A;  1D1O A;  3PN7 B;  3VRP A;  3OGN A;  1KQM B;  1A75 A;  1KQM C;  1QS7 A;  1EH2 A;  1BF5 A;  3O4X A;  1TRF A;  2AAO A;  2JUL A;  3JTD C;  1J7O A;  1C3Z A;  5HYD A;  4PDZ A;  3S0A A;  1BOD A;  3RZS A;  1DJZ A;  2BKI B;  2L4H A;  1XO5 A;  3DF0 B;  4DRW A;  3CYZ A;  1B9A A;  1RK9 A;  3BYA A;  5HLO A;  3WHU B;  1OZS A;  1YVL A;  4ORA B;  4HSZ A;  4WRI A;  3EKJ A;  3M0W A;  3DVE A;  1N2D A;  1UWO A;  2ZNE A;  1CDL A;  1EXR A;  3K1E A;  1J7R A;  1EG3 A;  5CSI A;  1M46 A;  1R6P A;  3B88 A;  1M39 A;  1SL9 A;  1G33 A;  1K95 A;  2SCP A;  1JF0 A;  2KNE A;  2H61 A;  1B7T Y;  2L5X B;  1XYD A;  2LLU A;  1G8I A;  2HQ8 A;  2LMV A;  1FBV A;  1DMO A;  1JBA A;  2JZI A;  2JT0 A;  1CMF A;  1C07 A;  1F55 A;  2Q91 A;  1RTP 1;  1QIW A;  1S6C A;  4MSP A;  2OPO A;  2WOS A;  1TCO B;  3RLZ A;  3SS5 A;  2P70 A;  1G4Y R;  4PHK A;  5D3O A;  1AUI B;  1IQ5 A;  5DKN A;  4AOM A;  3D73 A;  1YRU B;  3VRO A;  1B8C A;  1CDM A;  1QTX A;  2JWW A;  2KFG A;  3CS1 A;  4HRG A;  1DF0 A;  1NP8 A;  2E6W A;  1BR4 B;  2LAN A;  1IG5 A;  2M29 A;  3S0B A;  3UO9 A;  1OOF A;  3EVV A;  1TCF A;  4E68 A;  2L2E A;  4A4B A;  3NXA A;  4NDD A;  1K8U A;  1X02 A;  1K9K A;  2PRU A;  1TWO A;  1K93 D;  2H61 C;  1Y1A A;  1KFX S;  4M2O A;  1GQM A;  2K60 A;  1OZO A;  3BFB A;  3CZT X;  1KWO C;  3CR4 X;  1T14 A;  2AUC A;  2LLS A;  3AAJ A;  1F4Q A;  4NQG A;  1B8L A;  5CSN A;  4U8D A;  1YUS A;  2BKH B;  2MLE C;  2SAS A;  3D78 A;  1LA3 A;  2JPO A;  3S0G A;  2NCO A;  3O78 A;  2KI6 C;  4QJ4 B;  3NGV A;  4QJ5 B;  5K89 A;  3BUO B;  1R2U A;  4YBH B;  1DF0 B;  2F2O A;  2Q4U A;  2QEB A;  2LMT A;  3BUM B;  3QME A;  2Y1M A;  1J1E A;  1B4C A;  5FI6 A;  1MUX A;  1L7Z A;  2LAP A;  1Y6W A;  5CPV A;  1FPW A;  2JQ6 A;  2NXQ A;  2O60 A;  1TIZ A;  3ZNI A;  1V1F A; 
#chains in the Genus database with same CATH homology
 1SCM B;  1SCM C;  2LLT A;  1C7W A;  3TDI A;  1KK7 Y;  2WND A;  3GOF A;  1N65 A;  3KO0 A;  2MRD A;  1W9Z A;  2BAP A;  1AJ5 A;  2KAY A;  3SS4 A;  1IKU A;  4GAO A;  5FI2 A;  1UUR A;  3KEV A;  1L2O B;  4JWQ A;  1UHK A;  2PMY A;  1YTZ C;  1DGV A;  1OOJ A;  2Y4Q A;  1PVB A;  1OMV A;  1RRO A;  2LVJ A;  4I5N B;  3BUX B;  5I8N A;  1ZOT B;  2LHL A;  2KGR A;  1XK4 A;  1KFX L;  2KAV A;  1F8H A;  2KLD A;  5AFP A;  2LUX A;  1CLM A;  1IWQ A;  1WRL A;  3I5I C;  3I5I B;  3LK1 A;  2LUC A;  1WDC C;  1WDC B;  2I7A A;  2KSP A;  3SG6 A;  1WLZ A;  2MLF C;  4YGD B;  2WOR A;  1GGW A;  2NZ0 A;  3SS3 A;  1Q80 A;  4ORC B;  4CFQ A;  2WCB A;  3HX4 A;  3IF7 A;  4CFR A;  2GGM A;  2K2A A;  1SL8 A;  3EVR A;  3LL8 B;  4PHN A;  1IRJ A;  4HRH A;  4YGE B;  1CFP A;  1WRK A;  2LP2 A;  2GV5 A;  1KSO A;  1B8R A;  4JQ0 D;  1CNP A;  1PRW A;  4MBE A;  2F2P A;  3VGO A;  4A4C A;  4MN0 A;  5HKW A;  3WXA A;  1XK4 C;  1SY9 A;  1Z4H A;  2IS9 A;  1TOP A;  2M8U A;  3NSI A;  2KGB C;  1S5G Z;  5J3X A;  3SG2 A;  1TN4 A;  4PE1 A;  1CFC A;  1HT9 A;  1UP5 A;  1MF8 B;  1KCY A;  4TNC A;  5IBW A;  3D10 A;  3JTD B;  2JNX A;  3SIA A;  1RFJ A;  2M1K B;  1CFF A;  2HF5 A;  3KF9 A;  4PAL A;  4DCK A;  2LVV A;  1SCV A;  2LCP A;  2M7N A;  3NSO A;  1NCY A;  3DVK A;  3DD4 A;  3BOW A;  4AQI A;  4YRU A;  1OMD A;  4PE0 A;  1W7J B;  3TDU A;  3A8R A;  1B1G A;  4ZCU A;  4WQ2 A;  2KI6 D;  3WHT B;  4KYN A;  1ZMZ A;  1RWY A;  2OS8 C;  1FI6 A;  1HQV A;  1S1E A;  2V53 A;  2G2B A;  1Y0V H;  3GK2 A;  1A75 B;  4D1E A;  1JC2 A;  4JKT A;  2EGD A;  2KQY A;  1JSA A;  4R1E A;  4PHM A;  1IJ5 A;  1QX2 A;  2O5G A;  1SR6 C;  3EVU A;  4DIR A;  2KOT A;  2Y1N A;  2BL0 B;  2BL0 C;  3BUW B;  3OB1 B;  5F6T A;  1NYA A;  2LM5 A;  2K2F A;  4MZK A;  2CBL A;  2LE9 B;  3GK4 X;  4YGA A;  1K94 A;  1BG1 A;  2MJW B;  2YGU A;  5HL1 A;  1LVC D;  1YUU A;  3HCM A;  3EG5 B;  4XJK A;  3BOW B;  3AKB A;  4OR9 B;  1XVJ A;  3SG3 A;  4GFT A;  1V1G A;  2CT9 A;  4I5L B;  1S5G Y;  1DGU A;  1SPY A;  1S6J A;  2PVB A;  4P5O E;  3VRQ A;  4GPL B;  1KWO B;  2LC5 A;  3C1V A;  1PSB A;  4ICB A;  4GBA A;  3DVJ A;  3IVT A;  1CLB A;  1NX0 A;  5FI7 A;  2L5Y A;  1NCZ A;  2FCE A;  3D0Y A;  1JFK A;  1YX7 A;  3IQO A;  5CSJ A;  1SYM A;  3CWG A;  2JT3 A;  1QV1 A;  1QAS A;  3K21 A;  3I5G C;  3I5G B;  1SW8 A;  2KLE A;  4XJK B;  1QAT A;  3O4Y A;  3OHM B;  3SG7 A;  1QVI Z;  2KFH A;  4C0L A;  4N5X A;  2WCE A;  1A2X A;  1JFJ A;  1MR8 A;  1CM4 A;  1A03 A;  5HKY A;  2M7L A;  4GGN A;  1MXE A;  1NX2 A;  2RGI A;  1S36 A;  2F8P A;  1XFU O;  3BUN B;  1QIV A;  1NX3 A;  4QJ3 B;  1W7I B;  1AHR A;  5ER5 A;  1B47 A;  5FYX A;  2KYC A;  3F45 A;  1CKK A;  1LKJ A;  2M9G A;  4CID A;  4MRX A;  2LMU A;  2F33 A;  3TUY C;  1REC A;  3D0Y B;  4DS7 A;  1OSA A;  3WNX B;  1DJI A;  3I5H C;  2AMI A;  1IQ3 A;  1J7Q A;  1S26 D;  1C7V A;  1H4B A;  1BT6 A;  3PSR A;  1GJY A;  1UHH A;  1K9P A;  3E3R A;  5KSZ A;  3TDZ A;  1J55 A;  1SL7 A;  1YRT B;  2JRF A;  1XA5 A;  3TZ1 A;  1MHO A;  1MXL C;  1DJW A;  1CMG A;  3H4S E;  3OX6 A;  1IGV A;  3IQQ A;  2L0P A;  1QXP A;  3SG4 A;  3FS7 A;  2BBM A;  2M0R A;  1PVA A;  2KBM A;  2M97 A;  1DVI A;  1ZAC A;  2K61 A;  2PSR A;  1SNL A;  3O6B A;  2COL B;  3ICB A;  2A4J A;  2CCM A;  2DOQ A;  1J1D A;  2BCX A;  3EK7 A;  1IJ6 A;  2ZRT A;  1YUT A;  2KBI A;  1DTL A;  1DJH A;  2JPT A;  1BR1 B;  2M49 B;  1LIN A;  2JT8 A;  1XFX O;  2BBN A;  1BJF A;  2FCD A;  2JNF A;  1QVI Y;  4GGF C;  5TNC A;  1BLQ A;  4MLW A;  2G9B A;  4M2P A;  2BCA A;  4FTG A;  5GQQ C;  1CM1 A;  1DEK A;  1JUO A;  3SJS A;  1KK8 B;  1KK8 C;  1M63 B;  4YGB B;  3SIB A;  2BNX A;  4ORB B;  1BMO A;  1TNX A;  1TTX A;  5I2Q A;  3MSE B;  2K0J A;  4FQO A;  5DKQ A;  1PSR A;  1JF2 A;  2E30 A;  1S3P A;  1AJ4 A;  2EC6 B;  2EC6 C;  1TNP A;  1OQP A;  2ZN8 A;  4HRE E;  4P2Y B;  1DEL A;  5I2L A;  4NDC A;  3I5F C;  2CNP A;  1DJY A;  5BPJ A;  1SKT A;  1CTR A;  1MQ1 A;  5AAN A;  1SRA A;  3AKA A;  1Y1X A;  3JVT B;  3JVT C;  1A4P A;  1NIW A;  3PM8 A;  1XFV O;  5G08 A;  5KTY A;  1E8A A;  4BY5 A;  2K7D A;  2JXL A;  2K7O A;  1A29 A;  3BQ3 A;  4IL1 A;  5PAL A;  3ZWH A;  2H2K A;  2QPT A;  5KU1 A;  1XFY O;  1QX7 A;  1BU3 A;  2L4I A;  3PN7 C;  3FWC A;  2OS8 B;  1CLL A;  4MZL A;  2R2I A;  1EG4 A;  1WY9 A;  1SMG A;  2LP3 A;  1FI5 A;  5I94 A;  4DUQ A;  1QLS A;  2LVI A;  2FOT A;  1SK6 D;  2ZFD A;  3OBV A;  1SR6 B;  1VRK A;  1UUS A;  4MRY A;  4JPZ B;  4I5K A;  1RJV A;  3VRR A;  2LHI A;  1QJT A;  4PE4 A;  4CLN A;  4Q04 A;  1N0Y A;  2HQW A;  3O2P A;  2KFF A;  1YX8 A;  4OKH A;  2I94 A;  4BY4 A;  1XFW O;  1PUL A;  2M1U A;  5HKZ A;  1NPQ A;  2JTT A;  2ZN9 A;  1KK7 Z;  2KYF A;  4GUK A;  1NSH A;  3CR5 X;  2HPS A;  2M3W A;  1UHI A;  2PAL A;  1AVS A;  4I5J A;  1K2H A;  1AP4 A;  1F70 A;  2JTZ A;  3OX5 A;  4OVN F;  3FIA A;  1K90 D;  1J7P A;  1EJ3 A;  2QAC A;  4WQ3 A;  2ZND A;  2ISD A;  1QX5 B;  5ER4 X;  1JWD A;  1UHN A;  3LCP C;  1SBJ A;  1Z2C B;  3SG5 A;  1KFU S;  5CSF A;  5AER A;  2P6B B;  1EL4 A;  5AXI A;  2B1U A;  3KPX A;  4OCI A;  1U5I A;  4NDB A;  5B8I B;  4MEW A;  3CTN A;  3PAL A;  3RM1 A;  2BE6 A;  2D8N A;  5AEQ A;  1ODB A;  1QLK A;  3BXK A;  2NLN A;  3EK8 A;  1NCX A;  1CB1 A;  2KHN A;  2LNK A;  1DJX A;  2MHH A;  1WRZ A;  3GK1 A;  2NCP A;  3EKH A;  2F3Y A;  2CTN A;  4GNK B;  5D69 A;  4ETO A;  3TUY B;  1F4O A;  5JOL A;  4YI9 A;  3I5H B;  5DKR A;  2Y5I A;  3LK0 A;  1F54 A;  1YVH A;  5D7F A;  4UPG A;  1PAL A;  2JOJ A;  2KI4 C;  2KI4 B;  4N1F A;  1UHJ A;  4GGF A;  4USL A;  3OP0 A;  1U5I B;  3FWB A;  1GGZ A;  2WC8 A;  1DJG A;  5JJG A;  1KSM A;  3KHE A;  3NSK A;  3AAK A;  1XFZ O;  2GGZ A;  3CR2 A;  2KQ6 A;  3OB2 B;  1K96 A;  1LXF C;  1OMR A;  3TS5 C;  3TS5 B;  2L98 A;  2K7B A;  2VRG A;  3LLE A;  4PHJ A;  3VRN A;  2LVK A;  1FF1 A;  2WCF A;  4IJ7 A;  4C0J A;  1L2O C;  1QV0 A;  1KFU L;  1LA0 A;  1ZFS A;  2HET A;  3DVM A;  1M31 A;  2BE4 A;  1TNW A;  2PAS A;  1PK0 D;  1BOC A;  4MVF A;  2BCB A;  4YI8 A;  1Y1U A;  4MZJ A;  2JU0 A;  1FW4 A;  2LV7 A;  3A4U B;  3EK4 A;  1DC1 A;  4ZCV A;  2I18 A;  1YUR A;  2TN4 A;  4OV2 A;  1IH0 A;  3PFV A;  1ALV A;  3NSL A;  4C0K A;  2ZRS A;  1DT7 B;  1NWD A;  1B7T Z;  2JC2 A;  3CGA A;  4L9M A;  2L50 A;  4PE7 A;  2L51 A;  1CDP A;  4PCW A;  1S6I A;  2MBX A;  4CPV A;  1F71 A;  3PM2 A;  4M2Q A;  1CFD A;  1K9U A;  3DF0 A;  2CXJ A;  3I5F B;  5I2O A;  4N1G A;  2FJU B;  2KDH A;  1TNQ A;  4YGC B;  2MAZ A;  1ZUZ A;  2OTG C;  2OTG B;  1CDN A;  2KAX A;  4F0Z B;  1MWN A;  1AK8 A;  4XYN A;  2F3Z A;  2I2R E;  1KQV A;  1NUB A;  2MA2 A;  1OE9 B;  5HLV A;  1WLM A;  2K8M B;  1YR5 A;  1M45 A;  3PAT A;  1H8B A;  2EHB A;  3PLF B;  3QRX A;  4AQJ A;  2ZKM X;  1ALW A;  2JXC A;  3CLN A;  1NX1 A;  2K7C A;  1D1O A;  2BEC A;  3UNW A;  3PN7 B;  3VRP A;  1KQM B;  1A75 A;  1KQM C;  1QS7 A;  1EH2 A;  1BF5 A;  3O4X A;  1TRF A;  2AAO A;  2JUL A;  3JTD C;  1J7O A;  5HYD A;  4PDZ A;  1BOD A;  1DJZ A;  2BKI B;  2L4H A;  1XO5 A;  3DF0 B;  4DRW A;  1B9A A;  1RK9 A;  3BYA A;  5HLO A;  3WHU B;  1OZS A;  1YVL A;  4ORA B;  4HSZ A;  4WRI A;  3EKJ A;  3M0W A;  3DVE A;  1N2D A;  1UWO A;  2ZNE A;  1CDL A;  1EXR A;  5CSI A;  1J7R A;  1EG3 A;  1M46 A;  1R6P A;  1M39 A;  1SL9 A;  1G33 A;  1K95 A;  2SCP A;  1JF0 A;  2KNE A;  2H61 A;  1B7T Y;  2L5X B;  1XYD A;  2LLU A;  1G8I A;  2HQ8 A;  2LMV A;  1FBV A;  1DMO A;  1JBA A;  2JZI A;  2JT0 A;  1CMF A;  1C07 A;  1F55 A;  2Q91 A;  1RTP 1;  1QIW A;  1S6C A;  4MSP A;  2OPO A;  2WOS A;  1TCO B;  3RLZ A;  3SS5 A;  1G4Y R;  4PHK A;  5D3O A;  1AUI B;  1IQ5 A;  5DKN A;  4AOM A;  1YRU B;  3VRO A;  1B8C A;  1CDM A;  1QTX A;  2JWW A;  2KFG A;  3CS1 A;  4HRG A;  1DF0 A;  1NP8 A;  2E6W A;  1BR4 B;  2LAN A;  1IG5 A;  2M29 A;  3UO9 A;  3EVV A;  1TCF A;  4E68 A;  2L2E A;  4A4B A;  3NXA A;  4NDD A;  1K8U A;  1K9K A;  1X02 A;  2PRU A;  1K93 D;  2H61 C;  1Y1A A;  1KFX S;  4M2O A;  1GQM A;  2K60 A;  1OZO A;  3CZT X;  1KWO C;  3CR4 X;  2AUC A;  2LLS A;  4NQG A;  3AAJ A;  1F4Q A;  1B8L A;  5CSN A;  4U8D A;  1YUS A;  2BKH B;  2MLE C;  2SAS A;  1LA3 A;  2NCO A;  3O78 A;  2KI6 C;  4QJ4 B;  4QJ5 B;  5K89 A;  3BUO B;  1R2U A;  4YBH B;  1DF0 B;  2F2O A;  2Q4U A;  3BUM B;  2LMT A;  2Y1M A;  1J1E A;  1B4C A;  5FI6 A;  1MUX A;  1L7Z A;  2LAP A;  1Y6W A;  5CPV A;  1FPW A;  2JQ6 A;  2NXQ A;  2O60 A;  1TIZ A;  3ZNI A;  1V1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...