3FIAA

Crystal structure of the eh 1 domain from human intersectin-1 protein. northeast structural genomics consortium target hr3646e.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
TPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Intersectin-1
publication title Crystal structure of the EH 1 domain from human intersectin-1 protein.
rcsb
source organism Homo sapiens
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fiaA00
5D69A 4R1EA 5HKYA 3OX6A 4Q04A 1RTP1 2JOJA 1KSOA 3WXAA 2JTTA 2LM5A 1C7WA 3BUOB 2LVJA 2M29A 3CLNA 3LCPC 3SG7A 1SMGA 1W7JB 1UHHA 1G8IA 1TNQA 1XFZO 4P2YB 3VRNA 4QJ5B 4M2PA 2MHHA 5I2QA 3SIBA 2KGBC 1S26D 4I5LB 1WDCC 3AAJA 2WOSA 3TUYB 4MZKA 3NSLA 2K8MB 1UHKA 3HCMA 1QS7A 4MN0A 2M7NA 2NLNA 1G33A 4GAOA 1YURA 3ICBA 4ZCVA 3ZNIA 4PHNA 1BOCA 1S36A 1QIVA 5I2OA 1CNPA 3CTNA 3EVRA 1JF0A 2K7BA 1F4QA 2A4JA 4GGFC 1LINA 1CFDA 1LA3A 1QXPA 5D7FA 1M39A 3CR2A 3ZWHA 1F70A 3E3RA 1BF5A 1GJYA 1M63B 4MEWA 4GUKA 2KGRA 4OVNF 1PVBA 1F71A 1KQVA 3DD4A 4YGAA 1X02A 3FWCA 1NIWA 1NYAA 2MLEC 4YRUA 1IGVA 1OMVA 3EKHA 3A8RA 2EGDA 3TZ1A 1YUSA 3I5HC 1LA0A 4GFTA 2Q91A 2EHBA 1GQMA 2K0JA 1DVIA 1WLMA 2NXQA 2QPTA 2B1UA 1ZMZA 3DF0B 1SRAA 2MAZA 4N1FA 1WLZA 2M9GA 1PULA 2P6BB 1KFXL 3I5FC 1PVAA 4WQ2A 4MRYA 2KAYA 2BCBA 1L2OB 1ZACA 1KWOC 1S6IA 3F45A 1SL8A 4DS7A 2LC5A 5DKRA 2ZRSA 2D8NA 1RFJA 2BL0C 1BR1B 1YTZC 1S5GY 4MZJA 4DCKA 1IH0A 1YX8A 3EK7A 3O2PA 4NQGA 5CSIA 1SCVA 1YUUA 3I5GC 1OE9B 4BY4A 4QJ3B 1EG3A 4CFRA 2L0PA 1DJYA 4JQ0D 1TOPA 2CCMA 2ZKMX 1QV0A 2KFGA 2LMTA 3CWGA 4PE4A 1QLKA 2BECA 2KNEA 4OV2A 4USLA 2HPSA 5I2LA 2MLFC 3D0YA 2KAXA 1H4BA 1DJHA 1TIZA 1WDCB 1LKJA 4XJKB 1JC2A 1BODA 3AKAA 2OPOA 1SNLA 1Y1XA 4ORAB 4PHJA 4XJKA 3FIAA 1Y0VH 1IQ3A 1K90D 3WNXB 4PCWA 3LLEA 1KFXS 2L51A 2LP2A 2JXLA 2LLSA 1PALA 2Y1MA 1SCMC 3DVEA 1NX0A 1E8AA 2F3ZA 3OB2B 4AQIA 3C1VA 2GV5A 2KQ6A 1IJ5A 2WORA 4YI8A 2ZNDA 3GK2A 1H8BA 4JWQA 1AK8A 1J1DA 2HETA 4U8DA 1AHRA 1ZUZA 1CM4A 5J3XA 2LAPA 1YR5A 4CIDA 2L2EA 1NX2A 4F0ZB 1B7TY 2M1UA 2Y5IA 5PALA 1D1OA 1WRLA 1ALWA 1DGVA 4PE0A 4OKHA 2BBMA 1M46A 4ZCUA 1XFXO 3I5FB 4DIRA 2I18A 3OHMB 1K9PA 1CLBA 4D1EA 4NDDA 1XO5A 1KWOB 2CBLA 2JT3A 1CFCA 2BBNA 1OMDA 1DT7B 3EKJA 1SL9A 3DVJA 2BL0B 2IS9A 1F55A 1IWQA 1V1FA 1CMFA 3GK4X 3I5GB 2F2OA 3IF7A 4CLNA 4HRGA 1IQ5A 2LMUA 2LUCA 1B4CA 1N2DA 3SIAA 1NSHA 1XK4C 3WHTB 1PK0D 4I5JA 1EL4A 2H61A 1NP8A 3JVTC 2QACA 1CB1A 1J7QA 1UP5A 5G08A 1UURA 1RJVA 1YUTA 1IG5A 4P5OE 1TRFA 1A03A 2Q4UA 1G4YR 1MWNA 2F33A 1XFWO 3EK4A 1LXFC 1B47A 5DKNA 4MBEA 2Y1NA 4N1GA 1R2UA 1KCYA 1RROA 4DUQA 2PSRA 1KFUL 1KSMA 2LNKA 1BU3A 2O60A 2M0RA 1SCMB 1CLLA 2OTGC 3BXKA 3RM1A 2NCOA 1KK7Y 3LL8B 1BMOA 5CPVA 3BOWB 1SL7A 1YVLA 2ZN8A 4TNCA 2KQYA 2LLTA 3RLZA 1CFFA 1XFVO 2NCPA 3VRQA 4AOMA 5B8IB 1JBAA 1K94A 1OZOA 4NDCA 1A29A 2SCPA 5GQQC 2F2PA 2BE4A 2CNPA 2LP3A 4QJ4B 1FW4A 3NSKA 1M45A 3I5IB 5AEQA 2CTNA 1Q80A 3DF0A 2JULA 1WRKA 5JJGA 1OOJA 1OSAA 4WRIA 3H4SE 4MSPA 2KFFA 1N0YA 2FCDA 3QRXA 2JXCA 1CTRA 1QX7A 4OCIA 5JOLA 3PFVA 4C0KA 1MUXA 2O5GA 2GGZA 2AAOA 1AVSA 3MSEB 1IKUA 2JT0A 1KFUS 1A75B 2AMIA 2LE9B 3K21A 1UHNA 1RECA 4FTGA 1UWOA 4MLWA 3PLFB 1J7OA 3SG6A 1QVIY 1Y1AA 2LV7A 3EK8A 2L4IA 2ZN9A 5TNCA 3WHUB 2M7LA 2E6WA 2K7OA 1WY9A 2JRFA 2KDHA 3TS5C 5CSNA 4E68A 2BCXA 2KI6C 3TDZA 5KSZA 4HRHA 1HQVA 1RWYA 3JVTB 1DJXA 1TTXA 1U5IB 4DRWA 1QV1A 3AAKA 1Y6WA 2CT9A 2L98A 2KAVA 3GK1A 2JZIA 1S1EA 5FYXA 1S5GZ 3PN7C 2G2BA 1F8HA 2Y4QA 1V1GA 1AP4A 3BUWB 3VRRA 2L4HA 1BLQA 2LCPA 3DVMA 2KYFA 1SK6D 2KOTA 3NXAA 2K2AA 2LUXA 2K7DA 1AJ5A 2LVKA 2OS8C 3EVVA 4JPZB 4GGFA 3CZTX 3CR5X 3VRPA 1MF8B 1EG4A 2LHLA 1JWDA 2EC6C 2JWWA 1K2HA 5DKQA 1J55A 2OTGB 2JNFA 2WCBA 5I8NA 1JFJA 1UHIA 1SPYA 2GGMA 1IJ6A 3KPXA 2PVBA 1CKKA 1TCFA 3OX5A 1PSRA 1W7IB 3OB1B 4ORBB 4C0JA 4L9MA 2LVVA 3I5HB 2F8PA 1JUOA 2FJUB 3EVUA 2L5XB 3A4UB 1KQMC 3VGOA 3IQOA 3NSOA 1BR4B 3CS1A 1DJIA 2JTZA 1K96A 4YGBB 1SBJA 2FOTA 1RK9A 3CR4X 1DTLA 2ZFDA 1CMGA 2LLUA 4FQOA 1SR6C 1B8CA 2LMVA 2HQWA 4M2QA 1FBVA 1K8UA 1DMOA 5HKWA 2HQ8A 1FF1A 1J1EA 2PMYA 1CDMA 1SW8A 2JC2A 3KO0A 1XFYO 4AQJA 1PRWA 3KEVA 1CDNA 1J7RA 2WC8A 4YBHB 1JSAA 1ALVA 2K2FA 1JF2A 1B7TZ 1F54A 1DF0B 1B9AA 1QX5B 2K7CA 1DF0A 1YX7A 4PDZA 3TS5B 5HLVA 3LK0A 2M8UA 4XYNA 3OP0A 1CDPA 1QX2A 4YGCB 5AFPA 1B1GA 2MA2A 2JQ6A 5HLOA 5IBWA 1ZFSA 1BG1A 2JPTA 1N65A 4A4BA 4MVFA 3PM8A 1C7VA 2ZRTA 2G9BA 3SG4A 3PN7B 2LHIA 4GGNA 4HSZA 4PALA 5KU1A 1R6PA 1PSBA 1DJZA 2WCEA 1A4PA 1BJFA 1QJTA 1DGUA 2KBMA 2OS8B 2R2IA 1S3PA 3BUXB 1MR8A 1LVCD 4GNKB 1EJ3A 2EC6B 4IL1A 2JNXA 4GBAA 2K61A 3O78A 2MBXA 2L50A 3BOWA 2SASA 4MZLA 1FPWA 1KK8C 2KI4C 1SYMA 5ER5A 4YGEB 5F6TA 3D10A 1SKTA 1IRJA 1K95A 2FCEA 2WCFA 2COLB 1XFUO 1KQMB 2H2KA 1YVHA 2JU0A 2F3YA 2MJWB 2I2RE 1YRTB 1F4OA 3JTDC 2PALA 1K9UA 1QLSA 2JT8A 1EXRA 2M97A 4M2OA 1QATA 3TDIA 4PHKA 1GGZA 1SY9A 1SR6B 1MQ1A 4ICBA 1KK7Z 1TNXA 3SJSA 4CPVA 1FI6A 1M31A 3NSIA 3PATA 2LVIA 2I7AA 1J7PA 1UUSA 1VRKA 2ISDA 2M49B 1A75A 1B8LA 5ER4X 1MXEA 1K93D 1EH2A 1Y1UA 1NWDA 2TN4A 2ZNEA 3IQQA 4ORCB 1DJGA 2KFHA 1CFPA 1HT9A 3SG2A 1S6JA 4CFQA 4GPLB 3BUMB 3SG3A 3FWBA 2RGIA 2DOQA 4OR9B 2HF5A 1XK4A 3VROA 5HKZA 4PHMA 4UPGA 4I5KA 1A2XA 1U5IA 5K89A 1QTXA 3CGAA 2BCAA 2H61C 2KHNA 2KSPA 4ETOA 3TUYC 3D0YB 3SG5A 1TNPA 1FI5A 1NCZA 1NPQA 2KI6D 2PRUA 2V53A 3O6BA 3PSRA 2WNDA 1S6CA 5AERA 3FS7A 1UHJA 1QVIZ 1K9KA 4PE1A 1NCYA 3LK1A 1OQPA 2E30A 4YGDB 1L7ZA 1YRUB 1ZOTB 3BQ3A 3BUNB 1NX1A 4A4CA 1C07A 2MRDA 1CLMA 1TCOB 1AJ4A 1WRZA 2I94A 2M1KB 3PALA 2LANA 4N5XA 5CSFA 3KHEA 1KK8B 1NX3A 2KI4B 3DVKA 1TNWA 2NZ0A 5HYDA 1OZSA 1BT6A 2BE6A 1TN4A 4NDBA 4MRXA 4YI9A 3M0WA 1OMRA 4PE7A 2KBIA 3AKBA 5KTYA 4C0LA 3GOFA 4HREE 2M3WA 3JTDB 1AUIB 1MHOA 1XYDA 2CXJA 3O4YA 1GGWA 1CDLA 5AXIA 5AANA 3HX4A 3TDUA 1QASA 2BKIB 5CSJA 1CM1A 1ODBA 3KF9A 3I5IC 4I5NB 5BPJA 2KYCA 1XA5A 1DJWA 1QIWA 2PASA 4WQ3A 2BKHB 1MXLC 2VRGA 1XVJA 1L2OC 1NUBA 1B8RA 3BYAA 4BY5A 2AUCA 1NCXA 1JFKA
chains in the Genus database with same CATH superfamily
1OOIX 3L4AA 5DICA 3FE6A 5D69A 1SSEB 4R1EA 5HKYA 3OX6A 4Q04A 1RTP1 2JOJA 1KSOA 3WXAA 2KLEA 2JTTA 2LM5A 1C7WA 3BUOB 2LVJA 2M29A 3CLNA 3LCPC 3SG7A 1SMGA 1W7JB 1UHHA 1G8IA 1TNQA 1XFZO 4P2YB 3VRNA 4QJ5B 4M2PA 2MHHA 2WCJA 5I2QA 3R72A 3SIBA 2KGBC 1S26D 4I5LB 3S0FA 1WDCC 3AAJA 2WOSA 3TUYB 4MZKA 3NSLA 2K8MB 1UHKA 3HCMA 1QS7A 3VB1A 4MN0A 2WCKA 2M7NA 2NLNA 3O4XA 1G33A 4GAOA 1GM0A 1YURA 4INXA 3ICBA 3EG5B 4ZCVA 3ZNIA 3S0BA 4PHNA 1BOCA 1S36A 1QIVA 5I2OA 1CNPA 3CTNA 3EVRA 1JF0A 2K7BA 1F4QA 2WC5A 2A4JA 3R1PA 4GGFC 1LINA 1CFDA 1LA3A 2P70A 1QXPA 5D7FA 1M39A 2FJYA 3CR2A 3ZWHA 1F70A 3E3RA 1BF5A 1GJYA 1M63B 4MEWA 4GUKA 4F7FA 2KGRA 1Z4HA 1PVBA 4OVNF 1F71A 3IVTA 1KQVA 3DD4A 3QMEA 4YGAA 1X02A 3FWCA 1NIWA 1NYAA 2MLEC 4YRUA 1IGVA 1OMVA 3EKHA 3A8RA 2EGDA 3TZ1A 1YUSA 3I5HC 1LA0A 2WCLA 4GFTA 2Q91A 3K1EA 2EHBA 1GQMA 2K0JA 1DVIA 1WLMA 2NXQA 2QPTA 3CDNA 2B1UA 1ZMZA 3DF0B 1SRAA 2MAZA 4N1FA 1OOHA 1WLZA 2M9GA 1PULA 2P6BB 1KFXL 3I5FC 1PVAA 4WQ2A 4MRYA 1P28A 2KAYA 2BCBA 1L2OB 2WCMA 1ZACA 1KWOC 1S6IA 3B88A 1SL8A 3F45A 2LC5A 4DS7A 5DKRA 2ZRSA 2D8NA 1RFJA 2BL0C 1BR1B 1YTZC 1S5GY 4MZJA 4DCKA 1IH0A 1YX8A 3EK7A 3O2PA 4NQGA 5CSIA 1SCVA 1YUUA 3I5GC 1OE9B 3RZSA 4BY4A 4QJ3B 1EG3A 3CZ1A 4CFRA 2L0PA 1DJYA 4JQ0D 3B6XA 1TOPA 2CCMA 5EL2A 2ZKMX 1QV0A 2KFGA 1C3ZA 2LMTA 3CWGA 4PE4A 1QLKA 2BECA 2KNEA 4OV2A 4USLA 2HPSA 3BFBA 2MLFC 5I2LA 3D0YA 2KAXA 3PJIA 1H4BA 1DJHA 1TIZA 1WDCB 1LKJA 4XJKB 1JC2A 1XFRA 1BODA 3AKAA 2OPOA 1SNLA 1Y1XA 4ORAB 4PHJA 3OGNA 4XJKA 3FIAA 1Y0VH 1IQ3A 1K90D 3WNXB 4PCWA 3LLEA 3SS3A 1KFXS 2L51A 2LP2A 2JXLA 2LLSA 3D73A 1PALA 2Y1MA 2ERBA 2P71A 1SCMC 3DVEA 1Z2CB 3D78A 1NX0A 1E8AA 2F3ZA 3OB2B 5D3OA 4AQIA 3C1VA 2GV5A 2KQ6A 1IJ5A 2WORA 4YI8A 2ZNDA 3GK2A 1H8BA 4JWQA 1AK8A 1J1DA 2HETA 4U8DA 1AHRA 1ZUZA 1CM4A 5J3XA 2LAPA 1YR5A 4CIDA 2L2EA 1NX2A 4F0ZB 1B7TY 4JKTA 2M1UA 2Y5IA 5PALA 1D1OA 1TUZA 1WRLA 2QEOA 3SS4A 1ALWA 1DGVA 4PE0A 4OKHA 2BBMA 3L47A 1M46A 4ZCUA 1OOFA 1XFXO 3I5FB 4DIRA 1DEKA 2I18A 3OHMB 1K9PA 3D76A 1CLBA 4D1EA 3DZTA 4NDDA 1XO5A 1KWOB 2CBLA 2JT3A 1CFCA 2BBNA 1OMDA 1DT7B 3EKJA 1SL9A 3DVJA 2BL0B 2IS9A 4IJ7A 3BFAA 1IIOA 1F55A 1IWQA 1V1FA 1CMFA 3GK4X 4OZDA 3I5GB 3S0GA 2F2OA 3IF7A 4CLNA 4HRGA 2K60A 1IQ5A 2LMUA 2LUCA 1B4CA 1N2DA 3SIAA 1NSHA 1XK4C 2QEVA 3WHTB 1PK0D 4I5JA 1EL4A 1T14A 2H61A 1NP8A 3JVTC 2QACA 1CB1A 1J7QA 1UP5A 5G08A 1UURA 1RJVA 1YUTA 1IG5A 4P5OE 1TRFA 3R1VA 1A03A 2Q4UA 1G4YR 1MWNA 2F33A 1XFWO 3BFHA 3EK4A 1LXFC 1B47A 5DKNA 4MBEA 2Y1NA 4N1GA 1R2UA 1KCYA 1RROA 4DUQA 2PSRA 1KFUL 1KSMA 2KPHA 2LNKA 1BU3A 2O60A 2M0RA 1SCMB 1CLLA 2OTGC 3BXKA 3RM1A 3CABA 2NCOA 1KK7Y 3LL8B 1BMOA 3NHIA 3BOWB 1DQEA 5CPVA 1SL7A 1YVLA 2ZN8A 4TNCA 2KQYA 2LLTA 3RLZA 1TUJA 1CFFA 1XFVO 2NCPA 3VRQA 4AOMA 5B8IB 1JBAA 1K94A 1OZOA 4NDCA 1A29A 2SCPA 5GQQC 3CYZA 2GTEA 2F2PA 2BE4A 2CNPA 2LP3A 4QJ4B 1DC1A 1FW4A 3NSKA 1M45A 3I5IB 5AEQA 2CTNA 1Q80A 3DF0A 2JULA 1WRKA 5JJGA 1OOJA 1OSAA 4WRIA 3H4SE 4MSPA 2KFFA 1N0YA 2FCDA 3QRXA 2JXCA 1CTRA 1QX7A 3D75A 4OCIA 3SS5A 5JOLA 3FE8A 3PFVA 3N7HA 3OBVA 2QDIA 4C0KA 1MUXA 2O5GA 2GGZA 1DELA 2QEBA 2AAOA 1AVSA 3MSEB 5FI6A 1IKUA 2L5YA 3L4LA 2JT0A 1KFUS 1A75B 2AMIA 2LE9B 3K21A 1UHNA 1RECA 4FTGA 1UWOA 4MLWA 3PLFB 1J7OA 3SG6A 1QVIY 1Y1AA 2LV7A 3EK8A 3S0EA 2L4IA 3DY9A 2ZN9A 5TNCA 3WHUB 2M7LA 2E6WA 3D77A 2K7OA 1WY9A 2JRFA 2KDHA 3TS5C 3CZ2A 5CSNA 4E68A 3B86A 2WCHA 2BCXA 2KI6C 3TDZA 5KSZA 4HRHA 1HQVA 1RWYA 3JVTB 1DJXA 1TTXA 1U5IB 4DRWA 1C3YA 1QV1A 3AAKA 1Y6WA 2CT9A 2L98A 2KAVA 2BAPA 3GK1A 2JZIA 1S1EA 5FYXA 1S5GZ 3PN7C 2G2BA 2PYQA 1F8HA 2Y4QA 1V1GA 1AP4A 3BUWB 3VRRA 2L4HA 1BLQA 2LCPA 3DVMA 2KYFA 5HL1A 1SK6D 2WC6A 2KOTA 3NXAA 2K2AA 2LUXA 2K7DA 1AJ5A 2LVKA 2OS8C 3EVVA 4JPZB 4GGFA 3CZTX 3CR5X 3VRPA 1MF8B 1EG4A 2LHLA 1JWDA 2EC6C 2JWWA 1K2HA 3UO9A 5DKQA 1J55A 2OTGB 2JNFA 2WCBA 5I8NA 1JFJA 1UHIA 1SPYA 2GGMA 1IJ6A 3KPXA 2PVBA 1CKKA 1TCFA 3OX5A 1PSRA 4FQTA 1W7IB 3OB1B 4ORBB 4C0JA 4L9MA 2LVVA 3I5HB 2F8PA 1JUOA 2FJUB 3S0AA 3EVUA 2L5XB 3A4UB 1KQMC 3VGOA 3IQOA 3NSOA 1BR4B 3CS1A 1DJIA 2JTZA 1K96A 3S0DA 4YGBB 1SBJA 2FOTA 1RK9A 3CR4X 1DTLA 2ZFDA 1CMGA 2LLUA 4FQOA 1SR6C 1B8CA 2LMVA 2HQWA 4M2QA 2BNXA 5FI7A 1FBVA 3NHTA 1K8UA 1DMOA 5HKWA 2HQ8A 1TWOA 1FF1A 1J1EA 2PMYA 1CDMA 1SW8A 2JC2A 3KO0A 1XFYO 4AQJA 1PRWA 3KEVA 1CDNA 1J7RA 2WC8A 4YBHB 1JSAA 1ALVA 2L2CA 2K2FA 1JF2A 1B7TZ 1F54A 1DF0B 1B9AA 1QX5B 2K7CA 1DF0A 1YX7A 4PDZA 3TS5B 4JD9A 2QEHA 5HLVA 3LK0A 2M8UA 4XYNA 3OP0A 1CDPA 1QX2A 4YGCB 5AFPA 1B1GA 2MA2A 2JQ6A 5HLOA 1OW4A 1ZFSA 5IBWA 1BG1A 2JPTA 1N65A 4A4BA 4MVFA 3B7AA 3PM8A 1C7VA 2JPOA 2G9BA 2H8VA 2ZRTA 3SG4A 3PN7B 2LHIA 4GGNA 4HSZA 4PALA 5KU1A 1R6PA 1PSBA 1ORGA 1DJZA 2WCEA 4INWA 1A4PA 1BJFA 1QJTA 1DGUA 2YGUA 2KBMA 2OS8B 2R2IA 1S3PA 3BUXB 1MR8A 3B87A 1LVCD 4GNKB 1EJ3A 2EC6B 4IL1A 2JNXA 4GBAA 2K61A 3O78A 2MBXA 1OOGA 2L50A 2SASA 3BOWA 4MZLA 1FPWA 1KK8C 2KI4C 1SYMA 3V2LA 5ER5A 3D74A 4YGEB 5F6TA 3D10A 1SKTA 1IRJA 1K95A 2FCEA 2WCFA 2COLB 1XFUO 1KQMB 2H2KA 1YVHA 2JU0A 2F3YA 2MJWB 2I2RE 1YRTB 1F4OA 3JTDC 2PALA 1K9UA 1QLSA 2JT8A 1EXRA 2M97A 4M2OA 1QATA 3TDIA 4PHKA 1GGZA 1SY9A 1SR6B 1MQ1A 4ICBA 1KK7Z 1TNXA 3SJSA 4CPVA 1FI6A 1M31A 3NSIA 3PATA 2LVIA 2I7AA 4KYNA 1J7PA 1UUSA 1VRKA 2ISDA 2M49B 1A75A 1B8LA 5ER4X 1MXEA 1K93D 1EH2A 1Y1UA 1NWDA 2TN4A 2ZNEA 3IQQA 3CZ0A 4ORCB 1DJGA 2KFHA 1CFPA 1HT9A 3SG2A 1S6JA 4CFQA 4GPLB 3BUMB 3SG3A 3FWBA 2RGIA 2DOQA 4OR9B 2HF5A 1XK4A 3VROA 5HKZA 4PHMA 4UPGA 4I5KA 1A2XA 3BJHA 1U5IA 5K89A 1QTXA 3CGAA 2BCAA 2H61C 2KHNA 2KLDA 2KSPA 4ETOA 3TUYC 3D0YB 3DYEA 3SG5A 1QWVA 1TNPA 1FI5A 1NCZA 1NPQA 2KI6D 2PRUA 2V53A 3O6BA 3PM2A 3PSRA 2WNDA 1S6CA 4PT1A 5AERA 3FS7A 1UHJA 1QVIZ 1K9KA 4PE1A 3UNWA 1NCYA 3LK1A 1OQPA 5FI2A 2E30A 4YGDB 1L7ZA 1YRUB 1ZOTB 3BQ3A 3BUNB 1NX1A 4A4CA 1C07A 2MRDA 1CLMA 1TCOB 1AJ4A 1WRZA 2I94A 2M1KB 3PALA 2LANA 3FE9A 4N5XA 3Q8IA 5CSFA 3KHEA 1KK8B 1NX3A 2KI4B 3DVKA 1TNWA 1LS8A 2NZ0A 5HYDA 1OZSA 2PQLA 1BT6A 2BE6A 1TN4A 4NDBA 4MRXA 4YI9A 3M0WA 1OMRA 4PE7A 2KBIA 3AKBA 3R1OA 4C0LA 5KTYA 3GOFA 4HREE 2M3WA 3JTDB 1AUIB 1MHOA 1XYDA 2CXJA 3O4YA 1GGWA 1CDLA 5AXIA 5AANA 3HX4A 3TDUA 1QASA 2BKIB 5CSJA 1CM1A 1ODBA 3KF9A 5I94A 3I5IC 4I5NB 5BPJA 3NGVA 2KYCA 1XA5A 1DJWA 1QIWA 2PASA 4WQ3A 2BKHB 1MXLC 2VRGA 3DXLA 1XVJA 1L2OC 1NUBA 1B8RA 1W9ZA 3BYAA 4BY5A 2AUCA 1NCXA 1JFKA
chains in the Genus database with same CATH topology
5D69A 4R1EA 5HKYA 3OX6A 4Q04A 1RTP1 2JOJA 1KSOA 3WXAA 2JTTA 2LM5A 1C7WA 3BUOB 2LVJA 2M29A 3CLNA 3LCPC 3SG7A 1SMGA 1W7JB 1UHHA 1G8IA 1TNQA 1XFZO 4P2YB 3VRNA 4QJ5B 4M2PA 2MHHA 5I2QA 3SIBA 2KGBC 1S26D 4I5LB 1WDCC 3AAJA 2WOSA 3TUYB 4MZKA 3NSLA 2K8MB 1UHKA 3HCMA 1QS7A 4MN0A 2M7NA 2NLNA 1G33A 4GAOA 1YURA 3ICBA 4ZCVA 3ZNIA 4PHNA 1BOCA 1S36A 1QIVA 5I2OA 1CNPA 3CTNA 3EVRA 1JF0A 2K7BA 1F4QA 2A4JA 4GGFC 1LINA 1CFDA 1LA3A 1QXPA 5D7FA 1M39A 3CR2A 3ZWHA 1F70A 3E3RA 1BF5A 1GJYA 1M63B 4MEWA 4GUKA 2KGRA 4OVNF 1PVBA 1F71A 1KQVA 3DD4A 4YGAA 1X02A 3FWCA 1NIWA 1NYAA 2MLEC 4YRUA 1IGVA 1OMVA 3EKHA 3A8RA 2EGDA 3TZ1A 1YUSA 3I5HC 1LA0A 4GFTA 2Q91A 2EHBA 1GQMA 2K0JA 1DVIA 1WLMA 2NXQA 2QPTA 2B1UA 1ZMZA 3DF0B 1SRAA 2MAZA 4N1FA 1WLZA 2M9GA 1PULA 2P6BB 1KFXL 3I5FC 1PVAA 4WQ2A 4MRYA 2KAYA 2BCBA 1L2OB 1ZACA 1KWOC 1S6IA 3F45A 1SL8A 4DS7A 2LC5A 5DKRA 2ZRSA 2D8NA 1RFJA 2BL0C 1BR1B 1YTZC 1S5GY 4MZJA 4DCKA 1IH0A 1YX8A 3EK7A 3O2PA 4NQGA 5CSIA 1SCVA 1YUUA 3I5GC 1OE9B 4BY4A 4QJ3B 1EG3A 4CFRA 2L0PA 1DJYA 4JQ0D 1TOPA 2CCMA 2ZKMX 1QV0A 2KFGA 2LMTA 3CWGA 4PE4A 1QLKA 2BECA 2KNEA 4OV2A 4USLA 2HPSA 5I2LA 2MLFC 3D0YA 2KAXA 1H4BA 1DJHA 1TIZA 1WDCB 1LKJA 4XJKB 1JC2A 1BODA 3AKAA 2OPOA 1SNLA 1Y1XA 4ORAB 4PHJA 4XJKA 3FIAA 1Y0VH 1IQ3A 1K90D 3WNXB 4PCWA 3LLEA 1KFXS 2L51A 2LP2A 2JXLA 2LLSA 1PALA 2Y1MA 1SCMC 3DVEA 1NX0A 1E8AA 2F3ZA 3OB2B 4AQIA 3C1VA 2GV5A 2KQ6A 1IJ5A 2WORA 4YI8A 2ZNDA 3GK2A 1H8BA 4JWQA 1AK8A 1J1DA 2HETA 4U8DA 1AHRA 1ZUZA 1CM4A 5J3XA 2LAPA 1YR5A 4CIDA 2L2EA 1NX2A 4F0ZB 1B7TY 2M1UA 2Y5IA 5PALA 1D1OA 1WRLA 1ALWA 1DGVA 4PE0A 4OKHA 2BBMA 1M46A 4ZCUA 1XFXO 3I5FB 4DIRA 2I18A 3OHMB 1K9PA 1CLBA 4D1EA 4NDDA 1XO5A 1KWOB 2CBLA 2JT3A 1CFCA 2BBNA 1OMDA 1DT7B 3EKJA 1SL9A 3DVJA 2BL0B 2IS9A 1F55A 1IWQA 1V1FA 1CMFA 3GK4X 3I5GB 2F2OA 3IF7A 4CLNA 4HRGA 1IQ5A 2LMUA 2LUCA 1B4CA 1N2DA 3SIAA 1NSHA 1XK4C 3WHTB 1PK0D 4I5JA 1EL4A 2H61A 1NP8A 3JVTC 2QACA 1CB1A 1J7QA 1UP5A 5G08A 1UURA 1RJVA 1YUTA 1IG5A 4P5OE 1TRFA 1A03A 2Q4UA 1G4YR 1MWNA 2F33A 1XFWO 3EK4A 1LXFC 1B47A 5DKNA 4MBEA 2Y1NA 4N1GA 1R2UA 1KCYA 1RROA 4DUQA 2PSRA 1KFUL 1KSMA 2LNKA 1BU3A 2O60A 2M0RA 1SCMB 1CLLA 2OTGC 3BXKA 3RM1A 2NCOA 1KK7Y 3LL8B 1BMOA 5CPVA 3BOWB 1SL7A 1YVLA 2ZN8A 4TNCA 2KQYA 2LLTA 3RLZA 1CFFA 1XFVO 2NCPA 3VRQA 4AOMA 5B8IB 1JBAA 1K94A 1OZOA 4NDCA 1A29A 2SCPA 5GQQC 2F2PA 2BE4A 2CNPA 2LP3A 4QJ4B 1FW4A 3NSKA 1M45A 3I5IB 5AEQA 2CTNA 1Q80A 3DF0A 2JULA 1WRKA 5JJGA 1OOJA 1OSAA 4WRIA 3H4SE 4MSPA 2KFFA 1N0YA 2FCDA 3QRXA 2JXCA 1CTRA 1QX7A 4OCIA 5JOLA 3PFVA 4C0KA 1MUXA 2O5GA 2GGZA 2AAOA 1AVSA 3MSEB 1IKUA 2JT0A 1KFUS 1A75B 2AMIA 2LE9B 3K21A 1UHNA 1RECA 4FTGA 1UWOA 4MLWA 3PLFB 1J7OA 3SG6A 1QVIY 1Y1AA 2LV7A 3EK8A 2L4IA 2ZN9A 5TNCA 3WHUB 2M7LA 2E6WA 2K7OA 1WY9A 2JRFA 2KDHA 3TS5C 5CSNA 4E68A 2BCXA 2KI6C 3TDZA 5KSZA 4HRHA 1HQVA 1RWYA 3JVTB 1DJXA 1TTXA 1U5IB 4DRWA 1QV1A 3AAKA 1Y6WA 2CT9A 2L98A 2KAVA 3GK1A 2JZIA 1S1EA 5FYXA 1S5GZ 3PN7C 2G2BA 1F8HA 2Y4QA 1V1GA 1AP4A 3BUWB 3VRRA 2L4HA 1BLQA 2LCPA 3DVMA 2KYFA 1SK6D 2KOTA 3NXAA 2K2AA 2LUXA 2K7DA 1AJ5A 2LVKA 2OS8C 3EVVA 4JPZB 4GGFA 3CZTX 3CR5X 3VRPA 1MF8B 1EG4A 2LHLA 1JWDA 2EC6C 2JWWA 1K2HA 5DKQA 1J55A 2OTGB 2JNFA 2WCBA 5I8NA 1JFJA 1UHIA 1SPYA 2GGMA 1IJ6A 3KPXA 2PVBA 1CKKA 1TCFA 3OX5A 1PSRA 1W7IB 3OB1B 4ORBB 4C0JA 4L9MA 2LVVA 3I5HB 2F8PA 1JUOA 2FJUB 3EVUA 2L5XB 3A4UB 1KQMC 3VGOA 3IQOA 3NSOA 1BR4B 3CS1A 1DJIA 2JTZA 1K96A 4YGBB 1SBJA 2FOTA 1RK9A 3CR4X 1DTLA 2ZFDA 1CMGA 2LLUA 4FQOA 1SR6C 1B8CA 2LMVA 2HQWA 4M2QA 1FBVA 1K8UA 1DMOA 5HKWA 2HQ8A 1FF1A 1J1EA 2PMYA 1CDMA 1SW8A 2JC2A 3KO0A 1XFYO 4AQJA 1PRWA 3KEVA 1CDNA 1J7RA 2WC8A 4YBHB 1JSAA 1ALVA 2K2FA 1JF2A 1B7TZ 1F54A 1DF0B 1B9AA 1QX5B 2K7CA 1DF0A 1YX7A 4PDZA 3TS5B 5HLVA 3LK0A 2M8UA 4XYNA 3OP0A 1CDPA 1QX2A 4YGCB 5AFPA 1B1GA 2MA2A 2JQ6A 5HLOA 5IBWA 1ZFSA 1BG1A 2JPTA 1N65A 4A4BA 4MVFA 3PM8A 1C7VA 2ZRTA 2G9BA 3SG4A 3PN7B 2LHIA 4GGNA 4HSZA 4PALA 5KU1A 1R6PA 1PSBA 1DJZA 2WCEA 1A4PA 1BJFA 1QJTA 1DGUA 2KBMA 2OS8B 2R2IA 1S3PA 3BUXB 1MR8A 1LVCD 4GNKB 1EJ3A 2EC6B 4IL1A 2JNXA 4GBAA 2K61A 3O78A 2MBXA 2L50A 3BOWA 2SASA 4MZLA 1FPWA 1KK8C 2KI4C 1SYMA 5ER5A 4YGEB 5F6TA 3D10A 1SKTA 1IRJA 1K95A 2FCEA 2WCFA 2COLB 1XFUO 1KQMB 2H2KA 1YVHA 2JU0A 2F3YA 2MJWB 2I2RE 1YRTB 1F4OA 3JTDC 2PALA 1K9UA 1QLSA 2JT8A 1EXRA 2M97A 4M2OA 1QATA 3TDIA 4PHKA 1GGZA 1SY9A 1SR6B 1MQ1A 4ICBA 1KK7Z 1TNXA 3SJSA 4CPVA 1FI6A 1M31A 3NSIA 3PATA 2LVIA 2I7AA 1J7PA 1UUSA 1VRKA 2ISDA 2M49B 1A75A 1B8LA 5ER4X 1MXEA 1K93D 1EH2A 1Y1UA 1NWDA 2TN4A 2ZNEA 3IQQA 4ORCB 1DJGA 2KFHA 1CFPA 1HT9A 3SG2A 1S6JA 4CFQA 4GPLB 3BUMB 3SG3A 3FWBA 2RGIA 2DOQA 4OR9B 2HF5A 1XK4A 3VROA 5HKZA 4PHMA 4UPGA 4I5KA 1A2XA 1U5IA 5K89A 1QTXA 3CGAA 2BCAA 2H61C 2KHNA 2KSPA 4ETOA 3TUYC 3D0YB 3SG5A 1TNPA 1FI5A 1NCZA 1NPQA 2KI6D 2PRUA 2V53A 3O6BA 3PSRA 2WNDA 1S6CA 5AERA 3FS7A 1UHJA 1QVIZ 1K9KA 4PE1A 1NCYA 3LK1A 1OQPA 2E30A 4YGDB 1L7ZA 1YRUB 1ZOTB 3BQ3A 3BUNB 1NX1A 4A4CA 1C07A 2MRDA 1CLMA 1TCOB 1AJ4A 1WRZA 2I94A 2M1KB 3PALA 2LANA 4N5XA 5CSFA 3KHEA 1KK8B 1NX3A 2KI4B 3DVKA 1TNWA 2NZ0A 5HYDA 1OZSA 1BT6A 2BE6A 1TN4A 4NDBA 4MRXA 4YI9A 3M0WA 1OMRA 4PE7A 2KBIA 3AKBA 5KTYA 4C0LA 3GOFA 4HREE 2M3WA 3JTDB 1AUIB 1MHOA 1XYDA 2CXJA 3O4YA 1GGWA 1CDLA 5AXIA 5AANA 3HX4A 3TDUA 1QASA 2BKIB 5CSJA 1CM1A 1ODBA 3KF9A 3I5IC 4I5NB 5BPJA 2KYCA 1XA5A 1DJWA 1QIWA 2PASA 4WQ3A 2BKHB 1MXLC 2VRGA 1XVJA 1L2OC 1NUBA 1B8RA 3BYAA 4BY5A 2AUCA 1NCXA 1JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D69 A;  4R1E A;  5HKY A;  3OX6 A;  4Q04 A;  1RTP 1;  2JOJ A;  1KSO A;  3WXA A;  2JTT A;  2LM5 A;  1C7W A;  3BUO B;  2LVJ A;  2M29 A;  3CLN A;  3LCP C;  3SG7 A;  1SMG A;  1W7J B;  1UHH A;  1G8I A;  1TNQ A;  1XFZ O;  4P2Y B;  3VRN A;  4QJ5 B;  4M2P A;  2MHH A;  5I2Q A;  3SIB A;  2KGB C;  1S26 D;  4I5L B;  1WDC C;  3AAJ A;  2WOS A;  3TUY B;  4MZK A;  3NSL A;  2K8M B;  1UHK A;  3HCM A;  1QS7 A;  4MN0 A;  2M7N A;  2NLN A;  1G33 A;  4GAO A;  1YUR A;  3ICB A;  4ZCV A;  3ZNI A;  4PHN A;  1BOC A;  1S36 A;  1QIV A;  5I2O A;  1CNP A;  3CTN A;  3EVR A;  1JF0 A;  2K7B A;  1F4Q A;  2A4J A;  4GGF C;  1LIN A;  1CFD A;  1LA3 A;  1QXP A;  5D7F A;  1M39 A;  3CR2 A;  3ZWH A;  1F70 A;  3E3R A;  1BF5 A;  1GJY A;  1M63 B;  4MEW A;  4GUK A;  2KGR A;  4OVN F;  1PVB A;  1F71 A;  1KQV A;  3DD4 A;  4YGA A;  1X02 A;  3FWC A;  1NIW A;  1NYA A;  2MLE C;  4YRU A;  1IGV A;  1OMV A;  3EKH A;  3A8R A;  2EGD A;  3TZ1 A;  1YUS A;  3I5H C;  1LA0 A;  4GFT A;  2Q91 A;  2EHB A;  1GQM A;  2K0J A;  1DVI A;  1WLM A;  2NXQ A;  2QPT A;  2B1U A;  1ZMZ A;  3DF0 B;  1SRA A;  2MAZ A;  4N1F A;  1WLZ A;  2M9G A;  1PUL A;  2P6B B;  1KFX L;  3I5F C;  1PVA A;  4WQ2 A;  4MRY A;  2KAY A;  2BCB A;  1L2O B;  1ZAC A;  1KWO C;  1S6I A;  3F45 A;  1SL8 A;  4DS7 A;  2LC5 A;  5DKR A;  2ZRS A;  2D8N A;  1RFJ A;  2BL0 C;  1BR1 B;  1YTZ C;  1S5G Y;  4MZJ A;  4DCK A;  1IH0 A;  1YX8 A;  3EK7 A;  3O2P A;  4NQG A;  5CSI A;  1SCV A;  1YUU A;  3I5G C;  1OE9 B;  4BY4 A;  4QJ3 B;  1EG3 A;  4CFR A;  2L0P A;  1DJY A;  4JQ0 D;  1TOP A;  2CCM A;  2ZKM X;  1QV0 A;  2KFG A;  2LMT A;  3CWG A;  4PE4 A;  1QLK A;  2BEC A;  2KNE A;  4OV2 A;  4USL A;  2HPS A;  5I2L A;  2MLF C;  3D0Y A;  2KAX A;  1H4B A;  1DJH A;  1TIZ A;  1WDC B;  1LKJ A;  4XJK B;  1JC2 A;  1BOD A;  3AKA A;  2OPO A;  1SNL A;  1Y1X A;  4ORA B;  4PHJ A;  4XJK A;  3FIA A;  1Y0V H;  1IQ3 A;  1K90 D;  3WNX B;  4PCW A;  3LLE A;  1KFX S;  2L51 A;  2LP2 A;  2JXL A;  2LLS A;  1PAL A;  2Y1M A;  1SCM C;  3DVE A;  1NX0 A;  1E8A A;  2F3Z A;  3OB2 B;  4AQI A;  3C1V A;  2GV5 A;  2KQ6 A;  1IJ5 A;  2WOR A;  4YI8 A;  2ZND A;  3GK2 A;  1H8B A;  4JWQ A;  1AK8 A;  1J1D A;  2HET A;  4U8D A;  1AHR A;  1ZUZ A;  1CM4 A;  5J3X A;  2LAP A;  1YR5 A;  4CID A;  2L2E A;  1NX2 A;  4F0Z B;  1B7T Y;  2M1U A;  2Y5I A;  5PAL A;  1D1O A;  1WRL A;  1ALW A;  1DGV A;  4PE0 A;  4OKH A;  2BBM A;  1M46 A;  4ZCU A;  1XFX O;  3I5F B;  4DIR A;  2I18 A;  3OHM B;  1K9P A;  1CLB A;  4D1E A;  4NDD A;  1XO5 A;  1KWO B;  2CBL A;  2JT3 A;  1CFC A;  2BBN A;  1OMD A;  1DT7 B;  3EKJ A;  1SL9 A;  3DVJ A;  2BL0 B;  2IS9 A;  1F55 A;  1IWQ A;  1V1F A;  1CMF A;  3GK4 X;  3I5G B;  2F2O A;  3IF7 A;  4CLN A;  4HRG A;  1IQ5 A;  2LMU A;  2LUC A;  1B4C A;  1N2D A;  3SIA A;  1NSH A;  1XK4 C;  3WHT B;  1PK0 D;  4I5J A;  1EL4 A;  2H61 A;  1NP8 A;  3JVT C;  2QAC A;  1CB1 A;  1J7Q A;  1UP5 A;  5G08 A;  1UUR A;  1RJV A;  1YUT A;  1IG5 A;  4P5O E;  1TRF A;  1A03 A;  2Q4U A;  1G4Y R;  1MWN A;  2F33 A;  1XFW O;  3EK4 A;  1LXF C;  1B47 A;  5DKN A;  4MBE A;  2Y1N A;  4N1G A;  1R2U A;  1KCY A;  1RRO A;  4DUQ A;  2PSR A;  1KFU L;  1KSM A;  2LNK A;  1BU3 A;  2O60 A;  2M0R A;  1SCM B;  1CLL A;  2OTG C;  3BXK A;  3RM1 A;  2NCO A;  1KK7 Y;  3LL8 B;  1BMO A;  5CPV A;  3BOW B;  1SL7 A;  1YVL A;  2ZN8 A;  4TNC A;  2KQY A;  2LLT A;  3RLZ A;  1CFF A;  1XFV O;  2NCP A;  3VRQ A;  4AOM A;  5B8I B;  1JBA A;  1K94 A;  1OZO A;  4NDC A;  1A29 A;  2SCP A;  5GQQ C;  2F2P A;  2BE4 A;  2CNP A;  2LP3 A;  4QJ4 B;  1FW4 A;  3NSK A;  1M45 A;  3I5I B;  5AEQ A;  2CTN A;  1Q80 A;  3DF0 A;  2JUL A;  1WRK A;  5JJG A;  1OOJ A;  1OSA A;  4WRI A;  3H4S E;  4MSP A;  2KFF A;  1N0Y A;  2FCD A;  3QRX A;  2JXC A;  1CTR A;  1QX7 A;  4OCI A;  5JOL A;  3PFV A;  4C0K A;  1MUX A;  2O5G A;  2GGZ A;  2AAO A;  1AVS A;  3MSE B;  1IKU A;  2JT0 A;  1KFU S;  1A75 B;  2AMI A;  2LE9 B;  3K21 A;  1UHN A;  1REC A;  4FTG A;  1UWO A;  4MLW A;  3PLF B;  1J7O A;  3SG6 A;  1QVI Y;  1Y1A A;  2LV7 A;  3EK8 A;  2L4I A;  2ZN9 A;  5TNC A;  3WHU B;  2M7L A;  2E6W A;  2K7O A;  1WY9 A;  2JRF A;  2KDH A;  3TS5 C;  5CSN A;  4E68 A;  2BCX A;  2KI6 C;  3TDZ A;  5KSZ A;  4HRH A;  1HQV A;  1RWY A;  3JVT B;  1DJX A;  1TTX A;  1U5I B;  4DRW A;  1QV1 A;  3AAK A;  1Y6W A;  2CT9 A;  2L98 A;  2KAV A;  3GK1 A;  2JZI A;  1S1E A;  5FYX A;  1S5G Z;  3PN7 C;  2G2B A;  1F8H A;  2Y4Q A;  1V1G A;  1AP4 A;  3BUW B;  3VRR A;  2L4H A;  1BLQ A;  2LCP A;  3DVM A;  2KYF A;  1SK6 D;  2KOT A;  3NXA A;  2K2A A;  2LUX A;  2K7D A;  1AJ5 A;  2LVK A;  2OS8 C;  3EVV A;  4JPZ B;  4GGF A;  3CZT X;  3CR5 X;  3VRP A;  1MF8 B;  1EG4 A;  2LHL A;  1JWD A;  2EC6 C;  2JWW A;  1K2H A;  5DKQ A;  1J55 A;  2OTG B;  2JNF A;  2WCB A;  5I8N A;  1JFJ A;  1UHI A;  1SPY A;  2GGM A;  1IJ6 A;  3KPX A;  2PVB A;  1CKK A;  1TCF A;  3OX5 A;  1PSR A;  1W7I B;  3OB1 B;  4ORB B;  4C0J A;  4L9M A;  2LVV A;  3I5H B;  2F8P A;  1JUO A;  2FJU B;  3EVU A;  2L5X B;  3A4U B;  1KQM C;  3VGO A;  3IQO A;  3NSO A;  1BR4 B;  3CS1 A;  1DJI A;  2JTZ A;  1K96 A;  4YGB B;  1SBJ A;  2FOT A;  1RK9 A;  3CR4 X;  1DTL A;  2ZFD A;  1CMG A;  2LLU A;  4FQO A;  1SR6 C;  1B8C A;  2LMV A;  2HQW A;  4M2Q A;  1FBV A;  1K8U A;  1DMO A;  5HKW A;  2HQ8 A;  1FF1 A;  1J1E A;  2PMY A;  1CDM A;  1SW8 A;  2JC2 A;  3KO0 A;  1XFY O;  4AQJ A;  1PRW A;  3KEV A;  1CDN A;  1J7R A;  2WC8 A;  4YBH B;  1JSA A;  1ALV A;  2K2F A;  1JF2 A;  1B7T Z;  1F54 A;  1DF0 B;  1B9A A;  1QX5 B;  2K7C A;  1DF0 A;  1YX7 A;  4PDZ A;  3TS5 B;  5HLV A;  3LK0 A;  2M8U A;  4XYN A;  3OP0 A;  1CDP A;  1QX2 A;  4YGC B;  5AFP A;  1B1G A;  2MA2 A;  2JQ6 A;  5HLO A;  5IBW A;  1ZFS A;  1BG1 A;  2JPT A;  1N65 A;  4A4B A;  4MVF A;  3PM8 A;  1C7V A;  2ZRT A;  2G9B A;  3SG4 A;  3PN7 B;  2LHI A;  4GGN A;  4HSZ A;  4PAL A;  5KU1 A;  1R6P A;  1PSB A;  1DJZ A;  2WCE A;  1A4P A;  1BJF A;  1QJT A;  1DGU A;  2KBM A;  2OS8 B;  2R2I A;  1S3P A;  3BUX B;  1MR8 A;  1LVC D;  4GNK B;  1EJ3 A;  2EC6 B;  4IL1 A;  2JNX A;  4GBA A;  2K61 A;  3O78 A;  2MBX A;  2L50 A;  3BOW A;  2SAS A;  4MZL A;  1FPW A;  1KK8 C;  2KI4 C;  1SYM A;  5ER5 A;  4YGE B;  5F6T A;  3D10 A;  1SKT A;  1IRJ A;  1K95 A;  2FCE A;  2WCF A;  2COL B;  1XFU O;  1KQM B;  2H2K A;  1YVH A;  2JU0 A;  2F3Y A;  2MJW B;  2I2R E;  1YRT B;  1F4O A;  3JTD C;  2PAL A;  1K9U A;  1QLS A;  2JT8 A;  1EXR A;  2M97 A;  4M2O A;  1QAT A;  3TDI A;  4PHK A;  1GGZ A;  1SY9 A;  1SR6 B;  1MQ1 A;  4ICB A;  1KK7 Z;  1TNX A;  3SJS A;  4CPV A;  1FI6 A;  1M31 A;  3NSI A;  3PAT A;  2LVI A;  2I7A A;  1J7P A;  1UUS A;  1VRK A;  2ISD A;  2M49 B;  1A75 A;  1B8L A;  5ER4 X;  1MXE A;  1K93 D;  1EH2 A;  1Y1U A;  1NWD A;  2TN4 A;  2ZNE A;  3IQQ A;  4ORC B;  1DJG A;  2KFH A;  1CFP A;  1HT9 A;  3SG2 A;  1S6J A;  4CFQ A;  4GPL B;  3BUM B;  3SG3 A;  3FWB A;  2RGI A;  2DOQ A;  4OR9 B;  2HF5 A;  1XK4 A;  3VRO A;  5HKZ A;  4PHM A;  4UPG A;  4I5K A;  1A2X A;  1U5I A;  5K89 A;  1QTX A;  3CGA A;  2BCA A;  2H61 C;  2KHN A;  2KSP A;  4ETO A;  3TUY C;  3D0Y B;  3SG5 A;  1TNP A;  1FI5 A;  1NCZ A;  1NPQ A;  2KI6 D;  2PRU A;  2V53 A;  3O6B A;  3PSR A;  2WND A;  1S6C A;  5AER A;  3FS7 A;  1UHJ A;  1QVI Z;  1K9K A;  4PE1 A;  1NCY A;  3LK1 A;  1OQP A;  2E30 A;  4YGD B;  1L7Z A;  1YRU B;  1ZOT B;  3BQ3 A;  3BUN B;  1NX1 A;  4A4C A;  1C07 A;  2MRD A;  1CLM A;  1TCO B;  1AJ4 A;  1WRZ A;  2I94 A;  2M1K B;  3PAL A;  2LAN A;  4N5X A;  5CSF A;  3KHE A;  1KK8 B;  1NX3 A;  2KI4 B;  3DVK A;  1TNW A;  2NZ0 A;  5HYD A;  1OZS A;  1BT6 A;  2BE6 A;  1TN4 A;  4NDB A;  4MRX A;  4YI9 A;  3M0W A;  1OMR A;  4PE7 A;  2KBI A;  3AKB A;  5KTY A;  4C0L A;  3GOF A;  4HRE E;  2M3W A;  3JTD B;  1AUI B;  1MHO A;  1XYD A;  2CXJ A;  3O4Y A;  1GGW A;  1CDL A;  5AXI A;  5AAN A;  3HX4 A;  3TDU A;  1QAS A;  2BKI B;  5CSJ A;  1CM1 A;  1ODB A;  3KF9 A;  3I5I C;  4I5N B;  5BPJ A;  2KYC A;  1XA5 A;  1DJW A;  1QIW A;  2PAS A;  4WQ3 A;  2BKH B;  1MXL C;  2VRG A;  1XVJ A;  1L2O C;  1NUB A;  1B8R A;  3BYA A;  4BY5 A;  2AUC A;  1NCX A;  1JFK A; 
#chains in the Genus database with same CATH topology
 1OOI X;  3L4A A;  5DIC A;  3FE6 A;  5D69 A;  1SSE B;  4R1E A;  5HKY A;  3OX6 A;  4Q04 A;  1RTP 1;  2JOJ A;  1KSO A;  3WXA A;  2KLE A;  2JTT A;  2LM5 A;  1C7W A;  3BUO B;  2LVJ A;  2M29 A;  3CLN A;  3LCP C;  3SG7 A;  1SMG A;  1W7J B;  1UHH A;  1G8I A;  1TNQ A;  1XFZ O;  4P2Y B;  3VRN A;  4QJ5 B;  4M2P A;  2MHH A;  2WCJ A;  5I2Q A;  3R72 A;  3SIB A;  2KGB C;  1S26 D;  4I5L B;  3S0F A;  1WDC C;  3AAJ A;  2WOS A;  3TUY B;  4MZK A;  3NSL A;  2K8M B;  1UHK A;  3HCM A;  1QS7 A;  3VB1 A;  4MN0 A;  2WCK A;  2M7N A;  2NLN A;  3O4X A;  1G33 A;  4GAO A;  1GM0 A;  1YUR A;  4INX A;  3ICB A;  3EG5 B;  4ZCV A;  3ZNI A;  3S0B A;  4PHN A;  1BOC A;  1S36 A;  1QIV A;  5I2O A;  1CNP A;  3CTN A;  3EVR A;  1JF0 A;  2K7B A;  1F4Q A;  2WC5 A;  2A4J A;  3R1P A;  4GGF C;  1LIN A;  1CFD A;  1LA3 A;  2P70 A;  1QXP A;  5D7F A;  1M39 A;  2FJY A;  3CR2 A;  3ZWH A;  1F70 A;  3E3R A;  1BF5 A;  1GJY A;  1M63 B;  4MEW A;  4GUK A;  4F7F A;  2KGR A;  1Z4H A;  1PVB A;  4OVN F;  1F71 A;  3IVT A;  1KQV A;  3DD4 A;  3QME A;  4YGA A;  1X02 A;  3FWC A;  1NIW A;  1NYA A;  2MLE C;  4YRU A;  1IGV A;  1OMV A;  3EKH A;  3A8R A;  2EGD A;  3TZ1 A;  1YUS A;  3I5H C;  1LA0 A;  2WCL A;  4GFT A;  2Q91 A;  3K1E A;  2EHB A;  1GQM A;  2K0J A;  1DVI A;  1WLM A;  2NXQ A;  2QPT A;  3CDN A;  2B1U A;  1ZMZ A;  3DF0 B;  1SRA A;  2MAZ A;  4N1F A;  1OOH A;  1WLZ A;  2M9G A;  1PUL A;  2P6B B;  1KFX L;  3I5F C;  1PVA A;  4WQ2 A;  4MRY A;  1P28 A;  2KAY A;  2BCB A;  1L2O B;  2WCM A;  1ZAC A;  1KWO C;  1S6I A;  3B88 A;  1SL8 A;  3F45 A;  2LC5 A;  4DS7 A;  5DKR A;  2ZRS A;  2D8N A;  1RFJ A;  2BL0 C;  1BR1 B;  1YTZ C;  1S5G Y;  4MZJ A;  4DCK A;  1IH0 A;  1YX8 A;  3EK7 A;  3O2P A;  4NQG A;  5CSI A;  1SCV A;  1YUU A;  3I5G C;  1OE9 B;  3RZS A;  4BY4 A;  4QJ3 B;  1EG3 A;  3CZ1 A;  4CFR A;  2L0P A;  1DJY A;  4JQ0 D;  3B6X A;  1TOP A;  2CCM A;  5EL2 A;  2ZKM X;  1QV0 A;  2KFG A;  1C3Z A;  2LMT A;  3CWG A;  4PE4 A;  1QLK A;  2BEC A;  2KNE A;  4OV2 A;  4USL A;  2HPS A;  3BFB A;  2MLF C;  5I2L A;  3D0Y A;  2KAX A;  3PJI A;  1H4B A;  1DJH A;  1TIZ A;  1WDC B;  1LKJ A;  4XJK B;  1JC2 A;  1XFR A;  1BOD A;  3AKA A;  2OPO A;  1SNL A;  1Y1X A;  4ORA B;  4PHJ A;  3OGN A;  4XJK A;  3FIA A;  1Y0V H;  1IQ3 A;  1K90 D;  3WNX B;  4PCW A;  3LLE A;  3SS3 A;  1KFX S;  2L51 A;  2LP2 A;  2JXL A;  2LLS A;  3D73 A;  1PAL A;  2Y1M A;  2ERB A;  2P71 A;  1SCM C;  3DVE A;  1Z2C B;  3D78 A;  1NX0 A;  1E8A A;  2F3Z A;  3OB2 B;  5D3O A;  4AQI A;  3C1V A;  2GV5 A;  2KQ6 A;  1IJ5 A;  2WOR A;  4YI8 A;  2ZND A;  3GK2 A;  1H8B A;  4JWQ A;  1AK8 A;  1J1D A;  2HET A;  4U8D A;  1AHR A;  1ZUZ A;  1CM4 A;  5J3X A;  2LAP A;  1YR5 A;  4CID A;  2L2E A;  1NX2 A;  4F0Z B;  1B7T Y;  4JKT A;  2M1U A;  2Y5I A;  5PAL A;  1D1O A;  1TUZ A;  1WRL A;  2QEO A;  3SS4 A;  1ALW A;  1DGV A;  4PE0 A;  4OKH A;  2BBM A;  3L47 A;  1M46 A;  4ZCU A;  1OOF A;  1XFX O;  3I5F B;  4DIR A;  1DEK A;  2I18 A;  3OHM B;  1K9P A;  3D76 A;  1CLB A;  4D1E A;  3DZT A;  4NDD A;  1XO5 A;  1KWO B;  2CBL A;  2JT3 A;  1CFC A;  2BBN A;  1OMD A;  1DT7 B;  3EKJ A;  1SL9 A;  3DVJ A;  2BL0 B;  2IS9 A;  4IJ7 A;  3BFA A;  1IIO A;  1F55 A;  1IWQ A;  1V1F A;  1CMF A;  3GK4 X;  4OZD A;  3I5G B;  3S0G A;  2F2O A;  3IF7 A;  4CLN A;  4HRG A;  2K60 A;  1IQ5 A;  2LMU A;  2LUC A;  1B4C A;  1N2D A;  3SIA A;  1NSH A;  1XK4 C;  2QEV A;  3WHT B;  1PK0 D;  4I5J A;  1EL4 A;  1T14 A;  2H61 A;  1NP8 A;  3JVT C;  2QAC A;  1CB1 A;  1J7Q A;  1UP5 A;  5G08 A;  1UUR A;  1RJV A;  1YUT A;  1IG5 A;  4P5O E;  1TRF A;  3R1V A;  1A03 A;  2Q4U A;  1G4Y R;  1MWN A;  2F33 A;  1XFW O;  3BFH A;  3EK4 A;  1LXF C;  1B47 A;  5DKN A;  4MBE A;  2Y1N A;  4N1G A;  1R2U A;  1KCY A;  1RRO A;  4DUQ A;  2PSR A;  1KFU L;  1KSM A;  2KPH A;  2LNK A;  1BU3 A;  2O60 A;  2M0R A;  1SCM B;  1CLL A;  2OTG C;  3BXK A;  3RM1 A;  3CAB A;  2NCO A;  1KK7 Y;  3LL8 B;  1BMO A;  3NHI A;  3BOW B;  1DQE A;  5CPV A;  1SL7 A;  1YVL A;  2ZN8 A;  4TNC A;  2KQY A;  2LLT A;  3RLZ A;  1TUJ A;  1CFF A;  1XFV O;  2NCP A;  3VRQ A;  4AOM A;  5B8I B;  1JBA A;  1K94 A;  1OZO A;  4NDC A;  1A29 A;  2SCP A;  5GQQ C;  3CYZ A;  2GTE A;  2F2P A;  2BE4 A;  2CNP A;  2LP3 A;  4QJ4 B;  1DC1 A;  1FW4 A;  3NSK A;  1M45 A;  3I5I B;  5AEQ A;  2CTN A;  1Q80 A;  3DF0 A;  2JUL A;  1WRK A;  5JJG A;  1OOJ A;  1OSA A;  4WRI A;  3H4S E;  4MSP A;  2KFF A;  1N0Y A;  2FCD A;  3QRX A;  2JXC A;  1CTR A;  1QX7 A;  3D75 A;  4OCI A;  3SS5 A;  5JOL A;  3FE8 A;  3PFV A;  3N7H A;  3OBV A;  2QDI A;  4C0K A;  1MUX A;  2O5G A;  2GGZ A;  1DEL A;  2QEB A;  2AAO A;  1AVS A;  3MSE B;  5FI6 A;  1IKU A;  2L5Y A;  3L4L A;  2JT0 A;  1KFU S;  1A75 B;  2AMI A;  2LE9 B;  3K21 A;  1UHN A;  1REC A;  4FTG A;  1UWO A;  4MLW A;  3PLF B;  1J7O A;  3SG6 A;  1QVI Y;  1Y1A A;  2LV7 A;  3EK8 A;  3S0E A;  2L4I A;  3DY9 A;  2ZN9 A;  5TNC A;  3WHU B;  2M7L A;  2E6W A;  3D77 A;  2K7O A;  1WY9 A;  2JRF A;  2KDH A;  3TS5 C;  3CZ2 A;  5CSN A;  4E68 A;  3B86 A;  2WCH A;  2BCX A;  2KI6 C;  3TDZ A;  5KSZ A;  4HRH A;  1HQV A;  1RWY A;  3JVT B;  1DJX A;  1TTX A;  1U5I B;  4DRW A;  1C3Y A;  1QV1 A;  3AAK A;  1Y6W A;  2CT9 A;  2L98 A;  2KAV A;  2BAP A;  3GK1 A;  2JZI A;  1S1E A;  5FYX A;  1S5G Z;  3PN7 C;  2G2B A;  2PYQ A;  1F8H A;  2Y4Q A;  1V1G A;  1AP4 A;  3BUW B;  3VRR A;  2L4H A;  1BLQ A;  2LCP A;  3DVM A;  2KYF A;  5HL1 A;  1SK6 D;  2WC6 A;  2KOT A;  3NXA A;  2K2A A;  2LUX A;  2K7D A;  1AJ5 A;  2LVK A;  2OS8 C;  3EVV A;  4JPZ B;  4GGF A;  3CZT X;  3CR5 X;  3VRP A;  1MF8 B;  1EG4 A;  2LHL A;  1JWD A;  2EC6 C;  2JWW A;  1K2H A;  3UO9 A;  5DKQ A;  1J55 A;  2OTG B;  2JNF A;  2WCB A;  5I8N A;  1JFJ A;  1UHI A;  1SPY A;  2GGM A;  1IJ6 A;  3KPX A;  2PVB A;  1CKK A;  1TCF A;  3OX5 A;  1PSR A;  4FQT A;  1W7I B;  3OB1 B;  4ORB B;  4C0J A;  4L9M A;  2LVV A;  3I5H B;  2F8P A;  1JUO A;  2FJU B;  3S0A A;  3EVU A;  2L5X B;  3A4U B;  1KQM C;  3VGO A;  3IQO A;  3NSO A;  1BR4 B;  3CS1 A;  1DJI A;  2JTZ A;  1K96 A;  3S0D A;  4YGB B;  1SBJ A;  2FOT A;  1RK9 A;  3CR4 X;  1DTL A;  2ZFD A;  1CMG A;  2LLU A;  4FQO A;  1SR6 C;  1B8C A;  2LMV A;  2HQW A;  4M2Q A;  2BNX A;  5FI7 A;  1FBV A;  3NHT A;  1K8U A;  1DMO A;  5HKW A;  2HQ8 A;  1TWO A;  1FF1 A;  1J1E A;  2PMY A;  1CDM A;  1SW8 A;  2JC2 A;  3KO0 A;  1XFY O;  4AQJ A;  1PRW A;  3KEV A;  1CDN A;  1J7R A;  2WC8 A;  4YBH B;  1JSA A;  1ALV A;  2L2C A;  2K2F A;  1JF2 A;  1B7T Z;  1F54 A;  1DF0 B;  1B9A A;  1QX5 B;  2K7C A;  1DF0 A;  1YX7 A;  4PDZ A;  3TS5 B;  4JD9 A;  2QEH A;  5HLV A;  3LK0 A;  2M8U A;  4XYN A;  3OP0 A;  1CDP A;  1QX2 A;  4YGC B;  5AFP A;  1B1G A;  2MA2 A;  2JQ6 A;  5HLO A;  1OW4 A;  1ZFS A;  5IBW A;  1BG1 A;  2JPT A;  1N65 A;  4A4B A;  4MVF A;  3B7A A;  3PM8 A;  1C7V A;  2JPO A;  2G9B A;  2H8V A;  2ZRT A;  3SG4 A;  3PN7 B;  2LHI A;  4GGN A;  4HSZ A;  4PAL A;  5KU1 A;  1R6P A;  1PSB A;  1ORG A;  1DJZ A;  2WCE A;  4INW A;  1A4P A;  1BJF A;  1QJT A;  1DGU A;  2YGU A;  2KBM A;  2OS8 B;  2R2I A;  1S3P A;  3BUX B;  1MR8 A;  3B87 A;  1LVC D;  4GNK B;  1EJ3 A;  2EC6 B;  4IL1 A;  2JNX A;  4GBA A;  2K61 A;  3O78 A;  2MBX A;  1OOG A;  2L50 A;  2SAS A;  3BOW A;  4MZL A;  1FPW A;  1KK8 C;  2KI4 C;  1SYM A;  3V2L A;  5ER5 A;  3D74 A;  4YGE B;  5F6T A;  3D10 A;  1SKT A;  1IRJ A;  1K95 A;  2FCE A;  2WCF A;  2COL B;  1XFU O;  1KQM B;  2H2K A;  1YVH A;  2JU0 A;  2F3Y A;  2MJW B;  2I2R E;  1YRT B;  1F4O A;  3JTD C;  2PAL A;  1K9U A;  1QLS A;  2JT8 A;  1EXR A;  2M97 A;  4M2O A;  1QAT A;  3TDI A;  4PHK A;  1GGZ A;  1SY9 A;  1SR6 B;  1MQ1 A;  4ICB A;  1KK7 Z;  1TNX A;  3SJS A;  4CPV A;  1FI6 A;  1M31 A;  3NSI A;  3PAT A;  2LVI A;  2I7A A;  4KYN A;  1J7P A;  1UUS A;  1VRK A;  2ISD A;  2M49 B;  1A75 A;  1B8L A;  5ER4 X;  1MXE A;  1K93 D;  1EH2 A;  1Y1U A;  1NWD A;  2TN4 A;  2ZNE A;  3IQQ A;  3CZ0 A;  4ORC B;  1DJG A;  2KFH A;  1CFP A;  1HT9 A;  3SG2 A;  1S6J A;  4CFQ A;  4GPL B;  3BUM B;  3SG3 A;  3FWB A;  2RGI A;  2DOQ A;  4OR9 B;  2HF5 A;  1XK4 A;  3VRO A;  5HKZ A;  4PHM A;  4UPG A;  4I5K A;  1A2X A;  3BJH A;  1U5I A;  5K89 A;  1QTX A;  3CGA A;  2BCA A;  2H61 C;  2KHN A;  2KLD A;  2KSP A;  4ETO A;  3TUY C;  3D0Y B;  3DYE A;  3SG5 A;  1QWV A;  1TNP A;  1FI5 A;  1NCZ A;  1NPQ A;  2KI6 D;  2PRU A;  2V53 A;  3O6B A;  3PM2 A;  3PSR A;  2WND A;  1S6C A;  4PT1 A;  5AER A;  3FS7 A;  1UHJ A;  1QVI Z;  1K9K A;  4PE1 A;  3UNW A;  1NCY A;  3LK1 A;  1OQP A;  5FI2 A;  2E30 A;  4YGD B;  1L7Z A;  1YRU B;  1ZOT B;  3BQ3 A;  3BUN B;  1NX1 A;  4A4C A;  1C07 A;  2MRD A;  1CLM A;  1TCO B;  1AJ4 A;  1WRZ A;  2I94 A;  2M1K B;  3PAL A;  2LAN A;  3FE9 A;  4N5X A;  3Q8I A;  5CSF A;  3KHE A;  1KK8 B;  1NX3 A;  2KI4 B;  3DVK A;  1TNW A;  1LS8 A;  2NZ0 A;  5HYD A;  1OZS A;  2PQL A;  1BT6 A;  2BE6 A;  1TN4 A;  4NDB A;  4MRX A;  4YI9 A;  3M0W A;  1OMR A;  4PE7 A;  2KBI A;  3AKB A;  3R1O A;  4C0L A;  5KTY A;  3GOF A;  4HRE E;  2M3W A;  3JTD B;  1AUI B;  1MHO A;  1XYD A;  2CXJ A;  3O4Y A;  1GGW A;  1CDL A;  5AXI A;  5AAN A;  3HX4 A;  3TDU A;  1QAS A;  2BKI B;  5CSJ A;  1CM1 A;  1ODB A;  3KF9 A;  5I94 A;  3I5I C;  4I5N B;  5BPJ A;  3NGV A;  2KYC A;  1XA5 A;  1DJW A;  1QIW A;  2PAS A;  4WQ3 A;  2BKH B;  1MXL C;  2VRG A;  3DXL A;  1XVJ A;  1L2O C;  1NUB A;  1B8R A;  1W9Z A;  3BYA A;  4BY5 A;  2AUC A;  1NCX A;  1JFK A; 
#chains in the Genus database with same CATH homology
 5D69 A;  4R1E A;  5HKY A;  3OX6 A;  4Q04 A;  1RTP 1;  2JOJ A;  1KSO A;  3WXA A;  2JTT A;  2LM5 A;  1C7W A;  3BUO B;  2LVJ A;  2M29 A;  3CLN A;  3LCP C;  3SG7 A;  1SMG A;  1W7J B;  1UHH A;  1G8I A;  1TNQ A;  1XFZ O;  4P2Y B;  3VRN A;  4QJ5 B;  4M2P A;  2MHH A;  5I2Q A;  3SIB A;  2KGB C;  1S26 D;  4I5L B;  1WDC C;  3AAJ A;  2WOS A;  3TUY B;  4MZK A;  3NSL A;  2K8M B;  1UHK A;  3HCM A;  1QS7 A;  4MN0 A;  2M7N A;  2NLN A;  1G33 A;  4GAO A;  1YUR A;  3ICB A;  4ZCV A;  3ZNI A;  4PHN A;  1BOC A;  1S36 A;  1QIV A;  5I2O A;  1CNP A;  3CTN A;  3EVR A;  1JF0 A;  2K7B A;  1F4Q A;  2A4J A;  4GGF C;  1LIN A;  1CFD A;  1LA3 A;  1QXP A;  5D7F A;  1M39 A;  3CR2 A;  3ZWH A;  1F70 A;  3E3R A;  1BF5 A;  1GJY A;  1M63 B;  4MEW A;  4GUK A;  2KGR A;  4OVN F;  1PVB A;  1F71 A;  1KQV A;  3DD4 A;  4YGA A;  1X02 A;  3FWC A;  1NIW A;  1NYA A;  2MLE C;  4YRU A;  1IGV A;  1OMV A;  3EKH A;  3A8R A;  2EGD A;  3TZ1 A;  1YUS A;  3I5H C;  1LA0 A;  4GFT A;  2Q91 A;  2EHB A;  1GQM A;  2K0J A;  1DVI A;  1WLM A;  2NXQ A;  2QPT A;  2B1U A;  1ZMZ A;  3DF0 B;  1SRA A;  2MAZ A;  4N1F A;  1WLZ A;  2M9G A;  1PUL A;  2P6B B;  1KFX L;  3I5F C;  1PVA A;  4WQ2 A;  4MRY A;  2KAY A;  2BCB A;  1L2O B;  1ZAC A;  1KWO C;  1S6I A;  3F45 A;  1SL8 A;  4DS7 A;  2LC5 A;  5DKR A;  2ZRS A;  2D8N A;  1RFJ A;  2BL0 C;  1BR1 B;  1YTZ C;  1S5G Y;  4MZJ A;  4DCK A;  1IH0 A;  1YX8 A;  3EK7 A;  3O2P A;  4NQG A;  5CSI A;  1SCV A;  1YUU A;  3I5G C;  1OE9 B;  4BY4 A;  4QJ3 B;  1EG3 A;  4CFR A;  2L0P A;  1DJY A;  4JQ0 D;  1TOP A;  2CCM A;  2ZKM X;  1QV0 A;  2KFG A;  2LMT A;  3CWG A;  4PE4 A;  1QLK A;  2BEC A;  2KNE A;  4OV2 A;  4USL A;  2HPS A;  5I2L A;  2MLF C;  3D0Y A;  2KAX A;  1H4B A;  1DJH A;  1TIZ A;  1WDC B;  1LKJ A;  4XJK B;  1JC2 A;  1BOD A;  3AKA A;  2OPO A;  1SNL A;  1Y1X A;  4ORA B;  4PHJ A;  4XJK A;  3FIA A;  1Y0V H;  1IQ3 A;  1K90 D;  3WNX B;  4PCW A;  3LLE A;  1KFX S;  2L51 A;  2LP2 A;  2JXL A;  2LLS A;  1PAL A;  2Y1M A;  1SCM C;  3DVE A;  1NX0 A;  1E8A A;  2F3Z A;  3OB2 B;  4AQI A;  3C1V A;  2GV5 A;  2KQ6 A;  1IJ5 A;  2WOR A;  4YI8 A;  2ZND A;  3GK2 A;  1H8B A;  4JWQ A;  1AK8 A;  1J1D A;  2HET A;  4U8D A;  1AHR A;  1ZUZ A;  1CM4 A;  5J3X A;  2LAP A;  1YR5 A;  4CID A;  2L2E A;  1NX2 A;  4F0Z B;  1B7T Y;  2M1U A;  2Y5I A;  5PAL A;  1D1O A;  1WRL A;  1ALW A;  1DGV A;  4PE0 A;  4OKH A;  2BBM A;  1M46 A;  4ZCU A;  1XFX O;  3I5F B;  4DIR A;  2I18 A;  3OHM B;  1K9P A;  1CLB A;  4D1E A;  4NDD A;  1XO5 A;  1KWO B;  2CBL A;  2JT3 A;  1CFC A;  2BBN A;  1OMD A;  1DT7 B;  3EKJ A;  1SL9 A;  3DVJ A;  2BL0 B;  2IS9 A;  1F55 A;  1IWQ A;  1V1F A;  1CMF A;  3GK4 X;  3I5G B;  2F2O A;  3IF7 A;  4CLN A;  4HRG A;  1IQ5 A;  2LMU A;  2LUC A;  1B4C A;  1N2D A;  3SIA A;  1NSH A;  1XK4 C;  3WHT B;  1PK0 D;  4I5J A;  1EL4 A;  2H61 A;  1NP8 A;  3JVT C;  2QAC A;  1CB1 A;  1J7Q A;  1UP5 A;  5G08 A;  1UUR A;  1RJV A;  1YUT A;  1IG5 A;  4P5O E;  1TRF A;  1A03 A;  2Q4U A;  1G4Y R;  1MWN A;  2F33 A;  1XFW O;  3EK4 A;  1LXF C;  1B47 A;  5DKN A;  4MBE A;  2Y1N A;  4N1G A;  1R2U A;  1KCY A;  1RRO A;  4DUQ A;  2PSR A;  1KFU L;  1KSM A;  2LNK A;  1BU3 A;  2O60 A;  2M0R A;  1SCM B;  1CLL A;  2OTG C;  3BXK A;  3RM1 A;  2NCO A;  1KK7 Y;  3LL8 B;  1BMO A;  5CPV A;  3BOW B;  1SL7 A;  1YVL A;  2ZN8 A;  4TNC A;  2KQY A;  2LLT A;  3RLZ A;  1CFF A;  1XFV O;  2NCP A;  3VRQ A;  4AOM A;  5B8I B;  1JBA A;  1K94 A;  1OZO A;  4NDC A;  1A29 A;  2SCP A;  5GQQ C;  2F2P A;  2BE4 A;  2CNP A;  2LP3 A;  4QJ4 B;  1FW4 A;  3NSK A;  1M45 A;  3I5I B;  5AEQ A;  2CTN A;  1Q80 A;  3DF0 A;  2JUL A;  1WRK A;  5JJG A;  1OOJ A;  1OSA A;  4WRI A;  3H4S E;  4MSP A;  2KFF A;  1N0Y A;  2FCD A;  3QRX A;  2JXC A;  1CTR A;  1QX7 A;  4OCI A;  5JOL A;  3PFV A;  4C0K A;  1MUX A;  2O5G A;  2GGZ A;  2AAO A;  1AVS A;  3MSE B;  1IKU A;  2JT0 A;  1KFU S;  1A75 B;  2AMI A;  2LE9 B;  3K21 A;  1UHN A;  1REC A;  4FTG A;  1UWO A;  4MLW A;  3PLF B;  1J7O A;  3SG6 A;  1QVI Y;  1Y1A A;  2LV7 A;  3EK8 A;  2L4I A;  2ZN9 A;  5TNC A;  3WHU B;  2M7L A;  2E6W A;  2K7O A;  1WY9 A;  2JRF A;  2KDH A;  3TS5 C;  5CSN A;  4E68 A;  2BCX A;  2KI6 C;  3TDZ A;  5KSZ A;  4HRH A;  1HQV A;  1RWY A;  3JVT B;  1DJX A;  1TTX A;  1U5I B;  4DRW A;  1QV1 A;  3AAK A;  1Y6W A;  2CT9 A;  2L98 A;  2KAV A;  3GK1 A;  2JZI A;  1S1E A;  5FYX A;  1S5G Z;  3PN7 C;  2G2B A;  1F8H A;  2Y4Q A;  1V1G A;  1AP4 A;  3BUW B;  3VRR A;  2L4H A;  1BLQ A;  2LCP A;  3DVM A;  2KYF A;  1SK6 D;  2KOT A;  3NXA A;  2K2A A;  2LUX A;  2K7D A;  1AJ5 A;  2LVK A;  2OS8 C;  3EVV A;  4JPZ B;  4GGF A;  3CZT X;  3CR5 X;  3VRP A;  1MF8 B;  1EG4 A;  2LHL A;  1JWD A;  2EC6 C;  2JWW A;  1K2H A;  5DKQ A;  1J55 A;  2OTG B;  2JNF A;  2WCB A;  5I8N A;  1JFJ A;  1UHI A;  1SPY A;  2GGM A;  1IJ6 A;  3KPX A;  2PVB A;  1CKK A;  1TCF A;  3OX5 A;  1PSR A;  1W7I B;  3OB1 B;  4ORB B;  4C0J A;  4L9M A;  2LVV A;  3I5H B;  2F8P A;  1JUO A;  2FJU B;  3EVU A;  2L5X B;  3A4U B;  1KQM C;  3VGO A;  3IQO A;  3NSO A;  1BR4 B;  3CS1 A;  1DJI A;  2JTZ A;  1K96 A;  4YGB B;  1SBJ A;  2FOT A;  1RK9 A;  3CR4 X;  1DTL A;  2ZFD A;  1CMG A;  2LLU A;  4FQO A;  1SR6 C;  1B8C A;  2LMV A;  2HQW A;  4M2Q A;  1FBV A;  1K8U A;  1DMO A;  5HKW A;  2HQ8 A;  1FF1 A;  1J1E A;  2PMY A;  1CDM A;  1SW8 A;  2JC2 A;  3KO0 A;  1XFY O;  4AQJ A;  1PRW A;  3KEV A;  1CDN A;  1J7R A;  2WC8 A;  4YBH B;  1JSA A;  1ALV A;  2K2F A;  1JF2 A;  1B7T Z;  1F54 A;  1DF0 B;  1B9A A;  1QX5 B;  2K7C A;  1DF0 A;  1YX7 A;  4PDZ A;  3TS5 B;  5HLV A;  3LK0 A;  2M8U A;  4XYN A;  3OP0 A;  1CDP A;  1QX2 A;  4YGC B;  5AFP A;  1B1G A;  2MA2 A;  2JQ6 A;  5HLO A;  5IBW A;  1ZFS A;  1BG1 A;  2JPT A;  1N65 A;  4A4B A;  4MVF A;  3PM8 A;  1C7V A;  2ZRT A;  2G9B A;  3SG4 A;  3PN7 B;  2LHI A;  4GGN A;  4HSZ A;  4PAL A;  5KU1 A;  1R6P A;  1PSB A;  1DJZ A;  2WCE A;  1A4P A;  1BJF A;  1QJT A;  1DGU A;  2KBM A;  2OS8 B;  2R2I A;  1S3P A;  3BUX B;  1MR8 A;  1LVC D;  4GNK B;  1EJ3 A;  2EC6 B;  4IL1 A;  2JNX A;  4GBA A;  2K61 A;  3O78 A;  2MBX A;  2L50 A;  3BOW A;  2SAS A;  4MZL A;  1FPW A;  1KK8 C;  2KI4 C;  1SYM A;  5ER5 A;  4YGE B;  5F6T A;  3D10 A;  1SKT A;  1IRJ A;  1K95 A;  2FCE A;  2WCF A;  2COL B;  1XFU O;  1KQM B;  2H2K A;  1YVH A;  2JU0 A;  2F3Y A;  2MJW B;  2I2R E;  1YRT B;  1F4O A;  3JTD C;  2PAL A;  1K9U A;  1QLS A;  2JT8 A;  1EXR A;  2M97 A;  4M2O A;  1QAT A;  3TDI A;  4PHK A;  1GGZ A;  1SY9 A;  1SR6 B;  1MQ1 A;  4ICB A;  1KK7 Z;  1TNX A;  3SJS A;  4CPV A;  1FI6 A;  1M31 A;  3NSI A;  3PAT A;  2LVI A;  2I7A A;  1J7P A;  1UUS A;  1VRK A;  2ISD A;  2M49 B;  1A75 A;  1B8L A;  5ER4 X;  1MXE A;  1K93 D;  1EH2 A;  1Y1U A;  1NWD A;  2TN4 A;  2ZNE A;  3IQQ A;  4ORC B;  1DJG A;  2KFH A;  1CFP A;  1HT9 A;  3SG2 A;  1S6J A;  4CFQ A;  4GPL B;  3BUM B;  3SG3 A;  3FWB A;  2RGI A;  2DOQ A;  4OR9 B;  2HF5 A;  1XK4 A;  3VRO A;  5HKZ A;  4PHM A;  4UPG A;  4I5K A;  1A2X A;  1U5I A;  5K89 A;  1QTX A;  3CGA A;  2BCA A;  2H61 C;  2KHN A;  2KSP A;  4ETO A;  3TUY C;  3D0Y B;  3SG5 A;  1TNP A;  1FI5 A;  1NCZ A;  1NPQ A;  2KI6 D;  2PRU A;  2V53 A;  3O6B A;  3PSR A;  2WND A;  1S6C A;  5AER A;  3FS7 A;  1UHJ A;  1QVI Z;  1K9K A;  4PE1 A;  1NCY A;  3LK1 A;  1OQP A;  2E30 A;  4YGD B;  1L7Z A;  1YRU B;  1ZOT B;  3BQ3 A;  3BUN B;  1NX1 A;  4A4C A;  1C07 A;  2MRD A;  1CLM A;  1TCO B;  1AJ4 A;  1WRZ A;  2I94 A;  2M1K B;  3PAL A;  2LAN A;  4N5X A;  5CSF A;  3KHE A;  1KK8 B;  1NX3 A;  2KI4 B;  3DVK A;  1TNW A;  2NZ0 A;  5HYD A;  1OZS A;  1BT6 A;  2BE6 A;  1TN4 A;  4NDB A;  4MRX A;  4YI9 A;  3M0W A;  1OMR A;  4PE7 A;  2KBI A;  3AKB A;  5KTY A;  4C0L A;  3GOF A;  4HRE E;  2M3W A;  3JTD B;  1AUI B;  1MHO A;  1XYD A;  2CXJ A;  3O4Y A;  1GGW A;  1CDL A;  5AXI A;  5AAN A;  3HX4 A;  3TDU A;  1QAS A;  2BKI B;  5CSJ A;  1CM1 A;  1ODB A;  3KF9 A;  3I5I C;  4I5N B;  5BPJ A;  2KYC A;  1XA5 A;  1DJW A;  1QIW A;  2PAS A;  4WQ3 A;  2BKH B;  1MXL C;  2VRG A;  1XVJ A;  1L2O C;  1NUB A;  1B8R A;  3BYA A;  4BY5 A;  2AUC A;  1NCX A;  1JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...