3FIAA

Crystal structure of the eh 1 domain from human intersectin-1 protein. northeast structural genomics consortium target hr3646e.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
TPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin-1
publication title Crystal structure of the EH 1 domain from human intersectin-1 protein.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fiaA00
1YX7A 2KNEA 4GPLB 1JFKA 3CR4X 3SG3A 2H2KA 1QIVA 1OMDA 1UHHA 1K95A 1UHJA 2JU0A 1LINA 5D69A 2JXLA 5ER4X 5HKWA 4YGAA 4MZKA 3GOFA 4GGFA 2QPTA 4P5OE 1KSOA 1ZMZA 2L2EA 1FF1A 3BUMB 1BMOA 1K9PA 1NX3A 1QLKA 2BKHB 1JFJA 1RTP1 2ZN9A 3I5IB 2JZIA 1J7RA 2K61A 2SCPA 3ICBA 1XFYO 5DKRA 2FJUB 1SKTA 1FI5A 1A29A 2LHLA 1HQVA 1SCMB 1QV1A 1LKJA 4MEWA 1S26D 1DF0A 1OMRA 1UWOA 2BE4A 3O2PA 1IG5A 1MR8A 2WORA 3IF7A 3M0WA 4GAOA 3TS5B 1IGVA 3D10A 3KO0A 2JOJA 1M46A 3IQOA 1H8BA 2F2PA 3I5IC 1A75B 2LM5A 1QJTA 2COLB 2K2FA 3EVVA 4XJKB 2KFFA 2M9GA 1QASA 3PATA 2MLFC 1K8UA 4OKHA 3RM1A 3HCMA 1MUXA 1WY9A 3TS5C 3WHUB 1RROA 3AKAA 1MHOA 3OB2B 1IJ6A 1JUOA 1DJYA 2JXCA 2KBIA 2NCOA 3BXKA 4MBEA 2TN4A 2JRFA 2K7CA 3LL8B 4USLA 2JT8A 2I7AA 5KTYA 3EK8A 4U8DA 2HF5A 2JNXA 1SL9A 2K7DA 5CSJA 2WNDA 1M31A 1B9AA 2LV7A 2H61A 1EXRA 5TNCA 4TNCA 3WHTB 1KQMB 3EK4A 3KF9A 1CFFA 1RFJA 4GBAA 2LC5A 2MLEC 1MQ1A 2K7BA 2MJWB 1F8HA 3JTDC 1QXPA 1DJXA 1A4PA 1UHKA 2AMIA 3TDUA 2NCPA 1UHIA 1L7ZA 2LNKA 2NXQA 1RJVA 2M3WA 3O6BA 1OZSA 1S6JA 1EL4A 3DVEA 1DTLA 1MWNA 4WQ2A 1AUIB 4CLNA 2B1UA 2F2OA 2LHIA 2SASA 1SYMA 4IL1A 4HREE 1L2OC 1XFWO 2M7LA 3NSOA 1S1EA 5AXIA 1DJHA 2OS8C 1QLSA 1PALA 3TUYB 1ALWA 2L50A 3DD4A 4C0KA 3VRPA 1M63B 1K9KA 2BBNA 2Y1NA 1Y1XA 1WRKA 2PMYA 2KBMA 3NSIA 4YRUA 5HLVA 1Q80A 1AJ4A 1QVIZ 5HKYA 2G9BA 2BE6A 1KCYA 1YTZC 2BCXA 2MHHA 5J3XA 1TNPA 2ZNEA 3HX4A 5DKQA 1TCOB 1B7TZ 2O60A 4D1EA 1PULA 3BOWB 1LXFC 4PDZA 1NIWA 2QACA 1S6CA 1YVLA 4M2OA 4OR9B 1RECA 2KGBC 3D0YA 3NSLA 1G4YR 3EVUA 3OX6A 2CXJA 2MRDA 4GGFC 2PSRA 1OMVA 2KFHA 2NLNA 4WRIA 5I2OA 1XK4A 2LLUA 1C07A 4ORAB 1CFDA 3GK2A 3TDZA 5BPJA 1S3PA 4OVNF 2M7NA 1S36A 1XA5A 2JQ6A 4JPZB 1CDNA 2M97A 1QX2A 1M39A 2Q91A 1DJIA 1S5GZ 5AERA 1A2XA 3I5HC 4QJ5B 2F3ZA 2WCEA 3AAKA 2KDHA 3VRRA 1CNPA 4MRYA 3RLZA 1CDPA 4DIRA 3PM8A 1B8RA 1WDCB 4PE7A 5GQQC 2ZN8A 1QATA 1SW8A 3MSEB 1SK6D 1DGVA 2L0PA 3A8RA 3EKHA 2ZRSA 5CSNA 5ER5A 1CMGA 3VGOA 3DF0B 1B8CA 5AANA 1XFZO 2I94A 2K7OA 1XFVO 1DJZA 1SBJA 1YR5A 3JVTC 4BY5A 1KQVA 3BYAA 1SPYA 1ZUZA 1CM1A 1WDCC 1B47A 2ISDA 1NX1A 3PN7B 3LK1A 4QJ3B 1IJ5A 2KAXA 3BQ3A 2GGZA 1TIZA 4CFQA 2I18A 1DJGA 1UUSA 3NXAA 1J55A 4L9MA 1EG3A 1J1DA 4QJ4B 2R2IA 1E8AA 2P6BB 4ETOA 2H61C 2LLTA 1IWQA 5DKNA 4PCWA 1AP4A 1ALVA 4N5XA 2PALA 1R2UA 2KFGA 3PFVA 2M1KB 3PN7C 1EG4A 1AHRA 1KWOC 1WRLA 3CZTX 3LK0A 1BODA 4M2QA 5HKZA 5CSFA 4ICBA 2CTNA 3PSRA 1PSRA 1PRWA 4BY4A 1TNQA 2KI4B 4YGBB 2F33A 4MLWA 1N65A 2OPOA 3JTDB 1N0YA 1NUBA 4I5KA 1YRTB 2KSPA 3I5FB 3FIAA 3KHEA 1Y1UA 2DOQA 1MXLC 1JSAA 1QVIY 1BJFA 2Y5IA 1BR4B 3FS7A 2M1UA 2JTZA 4A4BA 2KI4C 2OTGC 3VRNA 4I5JA 1B7TY 1L2OB 1NP8A 2D8NA 3E3RA 1ODBA 1Y6WA 3I5FC 4PHJA 1XFXO 2OS8B 3OP0A 4OCIA 4GGNA 2GGMA 4PE0A 1BU3A 2ZKMX 3AKBA 2LMVA 4FTGA 1LVCD 1NX2A 2IS9A 5IBWA 2EGDA 3OX5A 1KSMA 2PRUA 2CT9A 4YBHB 1C7WA 1KK7Z 2LCPA 1PVBA 1U5IB 2FCDA 5F6TA 4MVFA 1XYDA 2LVIA 2LE9B 1A75A 1RWYA 1VRKA 3CR2A 1KFUL 2LVVA 4PHNA 4XJKA 2MA2A 1A03A 1W7IB 1CLLA 3BUOB 1DGUA 4PHMA 2AUCA 1TNXA 2O5GA 2BBMA 4MN0A 3VRQA 1GGWA 1IH0A 3BUWB 1S5GY 1EJ3A 1F4OA 1TN4A 4C0JA 1GGZA 3SG6A 1J7OA 3EK7A 2FCEA 3FWBA 1LA3A 2CNPA 3O78A 4CPVA 4DS7A 4MZJA 4ORBB 1CM4A 1SL7A 1QTXA 1NCZA 1K93D 1G8IA 2L5XB 1CB1A 2E6WA 1YURA 3CWGA 1WRZA 2JNFA 4YGDB 1N2DA 2JPTA 1KK8C 1YRUB 1BF5A 1NCYA 1X02A 4AQJA 1WLZA 1YVHA 1SR6C 5HYDA 3BUNB 1DF0B 3I5GC 3I5HB 1Y1AA 1NX0A 5FYXA 4C0LA 3SIAA 2M0RA 1F54A 4YGEB 2JTTA 2K8MB 3TDIA 1CKKA 2WCBA 1J7QA 1UP5A 2ZRTA 3DVKA 4FQOA 1SMGA 5CPVA 1YUUA 3NSKA 4A4CA 1DVIA 2BKIB 2L51A 1ZFSA 2AAOA 3JVTB 4AQIA 2KYCA 1FPWA 2VRGA 2EHBA 1CTRA 1QX5B 1F70A 2BCBA 3DVMA 1DMOA 2CBLA 1NPQA 2Y1MA 3WNXB 1QV0A 1YX8A 2F3YA 4N1FA 1FW4A 2KQYA 3F45A 1JBAA 1H4BA 1IKUA 1GQMA 2LAPA 3KPXA 2I2RE 2L4IA 1F4QA 1CDLA 5G08A 1KFUS 2JC2A 4WQ3A 1NWDA 4YI9A 2NZ0A 2M8UA 2LUXA 4MSPA 3OB1B 1G33A 2WOSA 1SL8A 1KFXL 1KWOB 1BR1B 1QS7A 2LMTA 3PALA 2E30A 5B8IB 1OQPA 2F8PA 2ZFDA 4PE4A 3ZNIA 4PALA 4MZLA 3BOWA 1W7JB 1KK7Y 1F71A 2KOTA 1LA0A 3CR5X 1CMFA 1SCVA 1MF8B 4CIDA 1SY9A 1B1GA 2JWWA 3K21A 2LUCA 1PSBA 2BECA 2LANA 1YUTA 1ZACA 3QRXA 1OE9B 3ZWHA 2LMUA 2OTGB 1MXEA 2M49B 4GFTA 1TRFA 4MRXA 5KU1A 4Q04A 4UPGA 2Q4UA 4CFRA 2HPSA 3H4SE 1K90D 1WLMA 2KAVA 4ZCUA 1EH2A 1SCMC 1K9UA 5JJGA 2EC6B 1IQ3A 3GK4X 3SJSA 1BOCA 4HRHA 4XYNA 1AJ5A 2RGIA 1CLBA 1TCFA 2L98A 1AK8A 1YUSA 2BL0B 4DCKA 2LVKA 1IRJA 4ZCVA 1NYAA 4YGCB 2KHNA 5K89A 2JULA 1R6PA 3LLEA 1IQ5A 4NDDA 4E68A 1CFPA 1SNLA 3A4UB 1JC2A 2EC6C 2HQWA 3DF0A 3SG2A 3TZ1A 1CDMA 2A4JA 2KQ6A 4OV2A 3C1VA 2LLSA 1FI6A 1QX7A 1TTXA 3VROA 2BL0C 2MAZA 3PLFB 4I5LB 1Y0VH 3EKJA 2M29A 5D7FA 1FBVA 5HLOA 4M2PA 1BT6A 3KEVA 1UURA 1XVJA 4DUQA 1DT7B 4JQ0D 1JWDA 3D0YB 3CS1A 2HETA 4P2YB 1UHNA 4AOMA 1PVAA 2PASA 3BUXB 1BLQA 2Y4QA 1S6IA 1BG1A 1HT9A 3SG4A 1KQMC 1B4CA 1QIWA 2FOTA 4YI8A 4ORCB 2KI6D 1PK0D 1KFXS 1OSAA 5AEQA 1M45A 4JWQA 1K2HA 4PE1A 1C7VA 2CCMA 2L4HA 1D1OA 2LVJA 2KI6C 1KK8B 2GV5A 1OOJA 3FWCA 2BCAA 3GK1A 3IQQA 2ZNDA 1SR6B 4R1EA 3DVJA 1XK4C 3I5GB 4DRWA 2K0JA 4I5NB 1DJWA 3WXAA 2KAYA 3O4YA 2JT3A 2WC8A 3SG7A 1ZOTB 4HSZA 1TNWA 1SRAA 2LP2A 2WCFA 4NDBA 4NDCA 1V1FA 2MBXA 2G2BA 5KSZA 2HQ8A 1TOPA 5I2QA 4F0ZB 1CLMA 3EVRA 3OHMB 1GJYA 1B8LA 5I2LA 3TUYC 1J1EA 5AFPA 1XFUO 2V53A 4N1GA 2PVBA 1F55A 1CFCA 3LCPC 1J7PA 3CTNA 4GNKB 5I8NA 4GUKA 1NCXA 3AAJA 1RK9A 4NQGA 1U5IA 1NSHA 3CLNA 2K2AA 4PHKA 3CGAA 4HRGA 3SIBA 1XO5A 2KGRA 1JF2A 5CSIA 2JT0A 3SG5A 5PALA 1K96A 2KYFA 1JF0A 2LP3A 1AVSA 1K94A 1OZOA 5JOLA 1V1GA
chains in the Genus database with same CATH superfamily
1YX7A 2KNEA 3R1OA 5FI6A 4GPLB 1JFKA 3CR4X 2P70A 3SG3A 2H2KA 1QIVA 1OMDA 1UHHA 1K95A 1UHJA 2JU0A 1LINA 5D69A 2JXLA 5ER4X 5HKWA 4YGAA 1Z4HA 4MZKA 3GOFA 4GGFA 2QPTA 4P5OE 1KSOA 1ZMZA 2L2EA 3S0FA 1FF1A 3BUMB 1BMOA 1K9PA 1OW4A 1NX3A 1QLKA 2BKHB 1JFJA 1RTP1 2ZN9A 3I5IB 4INWA 2JZIA 1J7RA 2K61A 2SCPA 3DYEA 1XFYO 3ICBA 5DKRA 2FJUB 3BFHA 1SKTA 1FI5A 1GM0A 1A29A 2LHLA 3CYZA 1HQVA 1SCMB 1QV1A 1LKJA 4MEWA 1S26D 1DF0A 1OMRA 1UWOA 2BE4A 3O2PA 1IG5A 1MR8A 2WORA 3IF7A 3M0WA 4GAOA 3TS5B 2WCHA 3CZ0A 1IGVA 1Z2CB 3D10A 3KO0A 2JOJA 1M46A 3IQOA 1H8BA 2F2PA 3I5IC 1A75B 4OZDA 2LM5A 1QJTA 2COLB 2K2FA 3EVVA 4XJKB 2KFFA 2M9GA 3CZ1A 1QASA 1DELA 3CABA 3PATA 4F7FA 5D3OA 2MLFC 1K8UA 4OKHA 3RM1A 3HCMA 1MUXA 1WY9A 3K1EA 3TS5C 3WHUB 1RROA 3AKAA 1MHOA 3OB2B 1IJ6A 3B87A 1JUOA 1DJYA 2JXCA 2KBIA 2NCOA 3BXKA 4MBEA 2TN4A 2JRFA 2K7CA 3LL8B 4USLA 2JT8A 2I7AA 5KTYA 3EK8A 4U8DA 2HF5A 2JNXA 1SL9A 2K7DA 5CSJA 2WNDA 1M31A 1QWVA 1B9AA 3L47A 2LV7A 2H61A 1EXRA 5TNCA 4TNCA 3WHTB 1KQMB 3EK4A 3KF9A 1CFFA 1RFJA 4GBAA 2BAPA 2LC5A 1MQ1A 2MLEC 2K7BA 2MJWB 3UO9A 1F8HA 3JTDC 1QXPA 1DJXA 1A4PA 2ERBA 1UHKA 2AMIA 3TDUA 2NCPA 2KLEA 1UHIA 5FI7A 1L7ZA 2LNKA 2NXQA 1RJVA 2M3WA 3O6BA 1OZSA 1S6JA 1EL4A 3DVEA 3OGNA 1DTLA 1MWNA 4WQ2A 1AUIB 4CLNA 3CZ2A 2B1UA 3R1PA 2F2OA 2LHIA 2SASA 1SYMA 4IL1A 4HREE 1L2OC 1XFWO 2M7LA 1T14A 3NSOA 1S1EA 5AXIA 1DJHA 3FE8A 2OS8C 1QLSA 1PALA 4JKTA 2KLDA 3TUYB 1ALWA 2L50A 1DEKA 3DD4A 3N7HA 3VRPA 4C0KA 1M63B 1K9KA 2BBNA 2Y1NA 1Y1XA 1WRKA 2PMYA 2KBMA 3NSIA 4YRUA 5HLVA 1Q80A 1AJ4A 1QVIZ 5HKYA 2G9BA 2BE6A 1KCYA 1YTZC 2BCXA 3QMEA 2MHHA 5J3XA 1TNPA 2ZNEA 3HX4A 5DKQA 1TCOB 3RZSA 1B7TZ 2O60A 4D1EA 1PULA 3BOWB 1LXFC 4PDZA 1NIWA 2QACA 1P28A 1S6CA 1YVLA 3O4XA 4M2OA 4OR9B 2K60A 1RECA 2KGBC 3D0YA 3NSLA 1G4YR 3EVUA 3OX6A 2CXJA 2MRDA 4GGFC 3S0AA 2PSRA 1OMVA 2KFHA 2NLNA 3OBVA 4WRIA 5I2OA 1XK4A 2LLUA 3D74A 1C07A 4ORAB 1CFDA 3GK2A 3TDZA 5BPJA 1S3PA 4OVNF 2M7NA 5HL1A 1S36A 1XA5A 2JQ6A 4JPZB 1CDNA 2M97A 1QX2A 1M39A 2Q91A 1DJIA 1S5GZ 1C3ZA 5AERA 1A2XA 3I5HC 4QJ5B 2F3ZA 2WCEA 3AAKA 3FE9A 2KDHA 3VRRA 1CNPA 4MRYA 3RLZA 1CDPA 4DIRA 3PM8A 1B8RA 1WDCB 3DY9A 4PE7A 5GQQC 2ZN8A 1QATA 1SW8A 3MSEB 1SK6D 1DGVA 2L0PA 3A8RA 3EKHA 2QDIA 2ZRSA 4KYNA 5CSNA 5ER5A 3VGOA 3DF0B 3L4LA 1CMGA 1B8CA 5AANA 1XFZO 2I94A 2K7OA 1XFVO 1DJZA 1SBJA 1YR5A 3JVTC 4BY5A 1KQVA 3BYAA 1SPYA 1ZUZA 1CM1A 1WDCC 1B47A 2ISDA 1NX1A 3IVTA 3LK1A 3PN7B 2BNXA 4QJ3B 1IJ5A 2KAXA 3BQ3A 2GGZA 3SS4A 1TIZA 4CFQA 2I18A 1DJGA 1UUSA 3NXAA 1J55A 4L9MA 1EG3A 1J1DA 4QJ4B 2R2IA 1E8AA 2P6BB 4ETOA 2H61C 2LLTA 1IWQA 5DKNA 2L2CA 4PCWA 1AP4A 1ALVA 4N5XA 2PALA 1R2UA 2KFGA 3PFVA 2M1KB 3B86A 3D77A 3PN7C 1EG4A 1AHRA 1KWOC 1WRLA 3CZTX 3LK0A 3B7AA 1BODA 4M2QA 3Q8IA 5HKZA 2WCKA 4ICBA 2CTNA 3B6XA 1ORGA 3PSRA 1PSRA 5CSFA 1PRWA 2FJYA 1TNQA 4BY4A 2KI4B 4YGBB 2F33A 1TWOA 4MLWA 1N65A 2OPOA 3JTDB 1N0YA 1NUBA 2PYQA 1YRTB 4I5KA 2KSPA 3I5FB 3FIAA 3KHEA 3S0GA 1Y1UA 2DOQA 1MXLC 1JSAA 1QVIY 2QEOA 1BJFA 2Y5IA 1BR4B 3FS7A 2M1UA 2JTZA 4A4BA 2KI4C 2OTGC 3VRNA 3SS5A 4I5JA 1B7TY 2JPOA 1L2OB 1NP8A 2WCLA 2D8NA 3E3RA 1ODBA 1Y6WA 3I5FC 3V2LA 4PHJA 1XFXO 2OS8B 3NGVA 3OP0A 4OCIA 4GGNA 2GGMA 4PE0A 1BU3A 2ZKMX 3AKBA 2LMVA 4FTGA 1LVCD 1NX2A 2IS9A 5IBWA 2EGDA 3OX5A 1KSMA 2PRUA 2CT9A 4YBHB 1C7WA 1KK7Z 2LCPA 4FQTA 1PVBA 3BJHA 1U5IB 2FCDA 5F6TA 4MVFA 1XYDA 2LVIA 2LE9B 1A75A 1RWYA 1VRKA 3CR2A 3D75A 1KFUL 2LVVA 4PHNA 3D78A 2MA2A 4XJKA 1A03A 1C3YA 1W7IB 1CLLA 3BUOB 1DGUA 4PHMA 2AUCA 1TNXA 3R72A 2O5GA 4IJ7A 2BBMA 4MN0A 3VRQA 1GGWA 1IH0A 3BUWB 1S5GY 1EJ3A 1F4OA 1TN4A 2H8VA 4C0JA 1GGZA 3SG6A 1J7OA 3EK7A 2FCEA 3FWBA 1LA3A 2CNPA 3O78A 4INXA 4CPVA 4DS7A 4MZJA 4ORBB 1CM4A 1SL7A 1QTXA 1NCZA 5EL2A 1K93D 1G8IA 2L5XB 1CB1A 2E6WA 1YURA 3CWGA 1WRZA 2JNFA 5DICA 4YGDB 1N2DA 1TUJA 1KK8C 1YRUB 2JPTA 1BF5A 1NCYA 1X02A 4AQJA 1WLZA 1YVHA 1SR6C 5HYDA 1DC1A 3BUNB 1DF0B 3I5GC 3I5HB 1Y1AA 1NX0A 5FYXA 4C0LA 3SIAA 2M0RA 1F54A 4YGEB 2JTTA 2K8MB 3TDIA 1CKKA 2WCBA 1J7QA 1UP5A 2ZRTA 2P71A 3DVKA 1SMGA 4FQOA 1YUUA 5CPVA 3NSKA 4A4CA 1DVIA 2BKIB 2L51A 1ZFSA 2AAOA 2WCMA 3JVTB 4AQIA 3DXLA 2KYCA 3NHIA 2VRGA 2EHBA 1CTRA 1QX5B 1F70A 1FPWA 2BCBA 3DVMA 1DMOA 2CBLA 1NPQA 2Y1MA 3WNXB 1QV0A 1YX8A 2F3YA 4N1FA 1FW4A 2KQYA 3F45A 1JBAA 1H4BA 1IKUA 1GQMA 2LAPA 3KPXA 2I2RE 2L4IA 1F4QA 1CDLA 5G08A 1KFUS 2JC2A 4WQ3A 1NWDA 4YI9A 2NZ0A 2M8UA 2LUXA 4MSPA 3OB1B 1G33A 2WOSA 1SL8A 1KFXL 1KWOB 1BR1B 1QS7A 2LMTA 3PALA 2WC5A 2E30A 5B8IB 1OQPA 2F8PA 2ZFDA 4PE4A 3ZNIA 4PALA 4MZLA 3BOWA 1W7JB 1KK7Y 1F71A 2KOTA 1LA0A 3CR5X 3PM2A 1CMFA 1SCVA 1MF8B 4CIDA 1SY9A 3S0BA 1B1GA 2JWWA 3S0DA 3K21A 2LUCA 3VB1A 1PSBA 2BECA 2LANA 1YUTA 1ZACA 2YGUA 3QRXA 1OE9B 3ZWHA 2LMUA 3NHTA 2GTEA 2OTGB 1MXEA 2M49B 4GFTA 1TRFA 4MRXA 2PQLA 5KU1A 4Q04A 1OOHA 4UPGA 2Q4UA 4CFRA 2HPSA 3H4SE 1K90D 1WLMA 2KAVA 4ZCUA 1EH2A 1SCMC 1K9UA 5JJGA 2EC6B 1IQ3A 3GK4X 3SJSA 1BOCA 4HRHA 4XYNA 1AJ5A 2RGIA 1CLBA 1TCFA 2L98A 1AK8A 1YUSA 2BL0B 4DCKA 2LVKA 1IRJA 4ZCVA 1NYAA 4YGCB 2KHNA 5K89A 2JULA 1R6PA 2WCJA 3LLEA 1IQ5A 4NDDA 4E68A 1CFPA 1SNLA 3A4UB 1JC2A 1OOFA 2EC6C 2HQWA 3DF0A 3SG2A 3TZ1A 1CDMA 2A4JA 2KQ6A 1DQEA 3C1VA 2LLSA 4OV2A 1FI6A 2QEVA 3FE6A 1QX7A 1TTXA 3VROA 2BL0C 3CDNA 2MAZA 3PLFB 4I5LB 1Y0VH 3EKJA 2M29A 5D7FA 1FBVA 5HLOA 4M2PA 1BT6A 3KEVA 1UURA 1XVJA 4DUQA 1DT7B 5I94A 3PJIA 4JQ0D 1JWDA 3D0YB 3CS1A 2HETA 3D76A 3L4AA 1UHNA 4P2YB 4AOMA 1PVAA 2PASA 3BUXB 1BLQA 1OOIX 2Y4QA 1S6IA 3UNWA 1BG1A 1HT9A 5FI2A 3SG4A 3S0EA 1KQMC 1B4CA 3EG5B 1QIWA 2FOTA 4YI8A 2WC6A 2KI6D 1PK0D 1KFXS 1OSAA 4ORCB 5AEQA 1M45A 4JWQA 1K2HA 4JD9A 4PE1A 1C7VA 2CCMA 2L4HA 1D1OA 1LS8A 2LVJA 2KI6C 1KK8B 2GV5A 1OOJA 3FWCA 2BCAA 3GK1A 3IQQA 2ZNDA 1SR6B 4R1EA 3DVJA 1XK4C 3I5GB 4DRWA 2K0JA 1XFRA 4I5NB 1DJWA 3WXAA 2KAYA 3R1VA 2KPHA 3O4YA 2JT3A 2WC8A 3SG7A 1ZOTB 4HSZA 3BFBA 1TNWA 2L5YA 4PT1A 1SRAA 2QEHA 2LP2A 2WCFA 4NDBA 4NDCA 1V1FA 1TUZA 2MBXA 2G2BA 5KSZA 2HQ8A 1TOPA 3SS3A 5I2QA 4F0ZB 1CLMA 3EVRA 3OHMB 1GJYA 1B8LA 5I2LA 3TUYC 1J1EA 5AFPA 1XFUO 2QEBA 2V53A 4N1GA 2PVBA 1F55A 3DZTA 3D73A 1SSEB 3CTNA 3LCPC 1CFCA 1J7PA 4GNKB 5I8NA 4GUKA 1NCXA 3AAJA 1RK9A 4NQGA 1U5IA 1NSHA 3CLNA 2K2AA 4PHKA 3CGAA 4HRGA 3SIBA 3BFAA 1XO5A 2KGRA 1JF2A 1OOGA 5CSIA 2JT0A 1W9ZA 3B88A 5PALA 3SG5A 1K96A 2KYFA 1JF0A 2LP3A 1AVSA 1K94A 1OZOA 5JOLA 1IIOA 1V1GA
chains in the Genus database with same CATH topology
1YX7A 2KNEA 4GPLB 1JFKA 3CR4X 3SG3A 2H2KA 1QIVA 1OMDA 1UHHA 1K95A 1UHJA 2JU0A 1LINA 5D69A 2JXLA 5ER4X 5HKWA 4YGAA 4MZKA 3GOFA 4GGFA 2QPTA 4P5OE 1KSOA 1ZMZA 2L2EA 1FF1A 3BUMB 1BMOA 1K9PA 1NX3A 1QLKA 2BKHB 1JFJA 1RTP1 2ZN9A 3I5IB 2JZIA 1J7RA 2K61A 2SCPA 3ICBA 1XFYO 5DKRA 2FJUB 1SKTA 1FI5A 1A29A 2LHLA 1HQVA 1SCMB 1QV1A 1LKJA 4MEWA 1S26D 1DF0A 1OMRA 1UWOA 2BE4A 3O2PA 1IG5A 1MR8A 2WORA 3IF7A 3M0WA 4GAOA 3TS5B 1IGVA 3D10A 3KO0A 2JOJA 1M46A 3IQOA 1H8BA 2F2PA 3I5IC 1A75B 2LM5A 1QJTA 2COLB 2K2FA 3EVVA 4XJKB 2KFFA 2M9GA 1QASA 3PATA 2MLFC 1K8UA 4OKHA 3RM1A 3HCMA 1MUXA 1WY9A 3TS5C 3WHUB 1RROA 3AKAA 1MHOA 3OB2B 1IJ6A 1JUOA 1DJYA 2JXCA 2KBIA 2NCOA 3BXKA 4MBEA 2TN4A 2JRFA 2K7CA 3LL8B 4USLA 2JT8A 2I7AA 5KTYA 3EK8A 4U8DA 2HF5A 2JNXA 1SL9A 2K7DA 5CSJA 2WNDA 1M31A 1B9AA 2LV7A 2H61A 1EXRA 5TNCA 4TNCA 3WHTB 1KQMB 3EK4A 3KF9A 1CFFA 1RFJA 4GBAA 2LC5A 2MLEC 1MQ1A 2K7BA 2MJWB 1F8HA 3JTDC 1QXPA 1DJXA 1A4PA 1UHKA 2AMIA 3TDUA 2NCPA 1UHIA 1L7ZA 2LNKA 2NXQA 1RJVA 2M3WA 3O6BA 1OZSA 1S6JA 1EL4A 3DVEA 1DTLA 1MWNA 4WQ2A 1AUIB 4CLNA 2B1UA 2F2OA 2LHIA 2SASA 1SYMA 4IL1A 4HREE 1L2OC 1XFWO 2M7LA 3NSOA 1S1EA 5AXIA 1DJHA 2OS8C 1QLSA 1PALA 3TUYB 1ALWA 2L50A 3DD4A 4C0KA 3VRPA 1M63B 1K9KA 2BBNA 2Y1NA 1Y1XA 1WRKA 2PMYA 2KBMA 3NSIA 4YRUA 5HLVA 1Q80A 1AJ4A 1QVIZ 5HKYA 2G9BA 2BE6A 1KCYA 1YTZC 2BCXA 2MHHA 5J3XA 1TNPA 2ZNEA 3HX4A 5DKQA 1TCOB 1B7TZ 2O60A 4D1EA 1PULA 3BOWB 1LXFC 4PDZA 1NIWA 2QACA 1S6CA 1YVLA 4M2OA 4OR9B 1RECA 2KGBC 3D0YA 3NSLA 1G4YR 3EVUA 3OX6A 2CXJA 2MRDA 4GGFC 2PSRA 1OMVA 2KFHA 2NLNA 4WRIA 5I2OA 1XK4A 2LLUA 1C07A 4ORAB 1CFDA 3GK2A 3TDZA 5BPJA 1S3PA 4OVNF 2M7NA 1S36A 1XA5A 2JQ6A 4JPZB 1CDNA 2M97A 1QX2A 1M39A 2Q91A 1DJIA 1S5GZ 5AERA 1A2XA 3I5HC 4QJ5B 2F3ZA 2WCEA 3AAKA 2KDHA 3VRRA 1CNPA 4MRYA 3RLZA 1CDPA 4DIRA 3PM8A 1B8RA 1WDCB 4PE7A 5GQQC 2ZN8A 1QATA 1SW8A 3MSEB 1SK6D 1DGVA 2L0PA 3A8RA 3EKHA 2ZRSA 5CSNA 5ER5A 1CMGA 3VGOA 3DF0B 1B8CA 5AANA 1XFZO 2I94A 2K7OA 1XFVO 1DJZA 1SBJA 1YR5A 3JVTC 4BY5A 1KQVA 3BYAA 1SPYA 1ZUZA 1CM1A 1WDCC 1B47A 2ISDA 1NX1A 3PN7B 3LK1A 4QJ3B 1IJ5A 2KAXA 3BQ3A 2GGZA 1TIZA 4CFQA 2I18A 1DJGA 1UUSA 3NXAA 1J55A 4L9MA 1EG3A 1J1DA 4QJ4B 2R2IA 1E8AA 2P6BB 4ETOA 2H61C 2LLTA 1IWQA 5DKNA 4PCWA 1AP4A 1ALVA 4N5XA 2PALA 1R2UA 2KFGA 3PFVA 2M1KB 3PN7C 1EG4A 1AHRA 1KWOC 1WRLA 3CZTX 3LK0A 1BODA 4M2QA 5HKZA 5CSFA 4ICBA 2CTNA 3PSRA 1PSRA 1PRWA 4BY4A 1TNQA 2KI4B 4YGBB 2F33A 4MLWA 1N65A 2OPOA 3JTDB 1N0YA 1NUBA 4I5KA 1YRTB 2KSPA 3I5FB 3FIAA 3KHEA 1Y1UA 2DOQA 1MXLC 1JSAA 1QVIY 1BJFA 2Y5IA 1BR4B 3FS7A 2M1UA 2JTZA 4A4BA 2KI4C 2OTGC 3VRNA 4I5JA 1B7TY 1L2OB 1NP8A 2D8NA 3E3RA 1ODBA 1Y6WA 3I5FC 4PHJA 1XFXO 2OS8B 3OP0A 4OCIA 4GGNA 2GGMA 4PE0A 1BU3A 2ZKMX 3AKBA 2LMVA 4FTGA 1LVCD 1NX2A 2IS9A 5IBWA 2EGDA 3OX5A 1KSMA 2PRUA 2CT9A 4YBHB 1C7WA 1KK7Z 2LCPA 1PVBA 1U5IB 2FCDA 5F6TA 4MVFA 1XYDA 2LVIA 2LE9B 1A75A 1RWYA 1VRKA 3CR2A 1KFUL 2LVVA 4PHNA 4XJKA 2MA2A 1A03A 1W7IB 1CLLA 3BUOB 1DGUA 4PHMA 2AUCA 1TNXA 2O5GA 2BBMA 4MN0A 3VRQA 1GGWA 1IH0A 3BUWB 1S5GY 1EJ3A 1F4OA 1TN4A 4C0JA 1GGZA 3SG6A 1J7OA 3EK7A 2FCEA 3FWBA 1LA3A 2CNPA 3O78A 4CPVA 4DS7A 4MZJA 4ORBB 1CM4A 1SL7A 1QTXA 1NCZA 1K93D 1G8IA 2L5XB 1CB1A 2E6WA 1YURA 3CWGA 1WRZA 2JNFA 4YGDB 1N2DA 2JPTA 1KK8C 1YRUB 1BF5A 1NCYA 1X02A 4AQJA 1WLZA 1YVHA 1SR6C 5HYDA 3BUNB 1DF0B 3I5GC 3I5HB 1Y1AA 1NX0A 5FYXA 4C0LA 3SIAA 2M0RA 1F54A 4YGEB 2JTTA 2K8MB 3TDIA 1CKKA 2WCBA 1J7QA 1UP5A 2ZRTA 3DVKA 4FQOA 1SMGA 5CPVA 1YUUA 3NSKA 4A4CA 1DVIA 2BKIB 2L51A 1ZFSA 2AAOA 3JVTB 4AQIA 2KYCA 1FPWA 2VRGA 2EHBA 1CTRA 1QX5B 1F70A 2BCBA 3DVMA 1DMOA 2CBLA 1NPQA 2Y1MA 3WNXB 1QV0A 1YX8A 2F3YA 4N1FA 1FW4A 2KQYA 3F45A 1JBAA 1H4BA 1IKUA 1GQMA 2LAPA 3KPXA 2I2RE 2L4IA 1F4QA 1CDLA 5G08A 1KFUS 2JC2A 4WQ3A 1NWDA 4YI9A 2NZ0A 2M8UA 2LUXA 4MSPA 3OB1B 1G33A 2WOSA 1SL8A 1KFXL 1KWOB 1BR1B 1QS7A 2LMTA 3PALA 2E30A 5B8IB 1OQPA 2F8PA 2ZFDA 4PE4A 3ZNIA 4PALA 4MZLA 3BOWA 1W7JB 1KK7Y 1F71A 2KOTA 1LA0A 3CR5X 1CMFA 1SCVA 1MF8B 4CIDA 1SY9A 1B1GA 2JWWA 3K21A 2LUCA 1PSBA 2BECA 2LANA 1YUTA 1ZACA 3QRXA 1OE9B 3ZWHA 2LMUA 2OTGB 1MXEA 2M49B 4GFTA 1TRFA 4MRXA 5KU1A 4Q04A 4UPGA 2Q4UA 4CFRA 2HPSA 3H4SE 1K90D 1WLMA 2KAVA 4ZCUA 1EH2A 1SCMC 1K9UA 5JJGA 2EC6B 1IQ3A 3GK4X 3SJSA 1BOCA 4HRHA 4XYNA 1AJ5A 2RGIA 1CLBA 1TCFA 2L98A 1AK8A 1YUSA 2BL0B 4DCKA 2LVKA 1IRJA 4ZCVA 1NYAA 4YGCB 2KHNA 5K89A 2JULA 1R6PA 3LLEA 1IQ5A 4NDDA 4E68A 1CFPA 1SNLA 3A4UB 1JC2A 2EC6C 2HQWA 3DF0A 3SG2A 3TZ1A 1CDMA 2A4JA 2KQ6A 4OV2A 3C1VA 2LLSA 1FI6A 1QX7A 1TTXA 3VROA 2BL0C 2MAZA 3PLFB 4I5LB 1Y0VH 3EKJA 2M29A 5D7FA 1FBVA 5HLOA 4M2PA 1BT6A 3KEVA 1UURA 1XVJA 4DUQA 1DT7B 4JQ0D 1JWDA 3D0YB 3CS1A 2HETA 4P2YB 1UHNA 4AOMA 1PVAA 2PASA 3BUXB 1BLQA 2Y4QA 1S6IA 1BG1A 1HT9A 3SG4A 1KQMC 1B4CA 1QIWA 2FOTA 4YI8A 4ORCB 2KI6D 1PK0D 1KFXS 1OSAA 5AEQA 1M45A 4JWQA 1K2HA 4PE1A 1C7VA 2CCMA 2L4HA 1D1OA 2LVJA 2KI6C 1KK8B 2GV5A 1OOJA 3FWCA 2BCAA 3GK1A 3IQQA 2ZNDA 1SR6B 4R1EA 3DVJA 1XK4C 3I5GB 4DRWA 2K0JA 4I5NB 1DJWA 3WXAA 2KAYA 3O4YA 2JT3A 2WC8A 3SG7A 1ZOTB 4HSZA 1TNWA 1SRAA 2LP2A 2WCFA 4NDBA 4NDCA 1V1FA 2MBXA 2G2BA 5KSZA 2HQ8A 1TOPA 5I2QA 4F0ZB 1CLMA 3EVRA 3OHMB 1GJYA 1B8LA 5I2LA 3TUYC 1J1EA 5AFPA 1XFUO 2V53A 4N1GA 2PVBA 1F55A 1CFCA 3LCPC 1J7PA 3CTNA 4GNKB 5I8NA 4GUKA 1NCXA 3AAJA 1RK9A 4NQGA 1U5IA 1NSHA 3CLNA 2K2AA 4PHKA 3CGAA 4HRGA 3SIBA 1XO5A 2KGRA 1JF2A 5CSIA 2JT0A 3SG5A 5PALA 1K96A 2KYFA 1JF0A 2LP3A 1AVSA 1K94A 1OZOA 5JOLA 1V1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  2KNE A;  4GPL B;  1JFK A;  3CR4 X;  3SG3 A;  2H2K A;  1QIV A;  1OMD A;  1UHH A;  1K95 A;  1UHJ A;  2JU0 A;  1LIN A;  5D69 A;  2JXL A;  5ER4 X;  5HKW A;  4YGA A;  4MZK A;  3GOF A;  4GGF A;  2QPT A;  4P5O E;  1KSO A;  1ZMZ A;  2L2E A;  1FF1 A;  3BUM B;  1BMO A;  1K9P A;  1NX3 A;  1QLK A;  2BKH B;  1JFJ A;  1RTP 1;  2ZN9 A;  3I5I B;  2JZI A;  1J7R A;  2K61 A;  2SCP A;  3ICB A;  1XFY O;  5DKR A;  2FJU B;  1SKT A;  1FI5 A;  1A29 A;  2LHL A;  1HQV A;  1SCM B;  1QV1 A;  1LKJ A;  4MEW A;  1S26 D;  1DF0 A;  1OMR A;  1UWO A;  2BE4 A;  3O2P A;  1IG5 A;  1MR8 A;  2WOR A;  3IF7 A;  3M0W A;  4GAO A;  3TS5 B;  1IGV A;  3D10 A;  3KO0 A;  2JOJ A;  1M46 A;  3IQO A;  1H8B A;  2F2P A;  3I5I C;  1A75 B;  2LM5 A;  1QJT A;  2COL B;  2K2F A;  3EVV A;  4XJK B;  2KFF A;  2M9G A;  1QAS A;  3PAT A;  2MLF C;  1K8U A;  4OKH A;  3RM1 A;  3HCM A;  1MUX A;  1WY9 A;  3TS5 C;  3WHU B;  1RRO A;  3AKA A;  1MHO A;  3OB2 B;  1IJ6 A;  1JUO A;  1DJY A;  2JXC A;  2KBI A;  2NCO A;  3BXK A;  4MBE A;  2TN4 A;  2JRF A;  2K7C A;  3LL8 B;  4USL A;  2JT8 A;  2I7A A;  5KTY A;  3EK8 A;  4U8D A;  2HF5 A;  2JNX A;  1SL9 A;  2K7D A;  5CSJ A;  2WND A;  1M31 A;  1B9A A;  2LV7 A;  2H61 A;  1EXR A;  5TNC A;  4TNC A;  3WHT B;  1KQM B;  3EK4 A;  3KF9 A;  1CFF A;  1RFJ A;  4GBA A;  2LC5 A;  2MLE C;  1MQ1 A;  2K7B A;  2MJW B;  1F8H A;  3JTD C;  1QXP A;  1DJX A;  1A4P A;  1UHK A;  2AMI A;  3TDU A;  2NCP A;  1UHI A;  1L7Z A;  2LNK A;  2NXQ A;  1RJV A;  2M3W A;  3O6B A;  1OZS A;  1S6J A;  1EL4 A;  3DVE A;  1DTL A;  1MWN A;  4WQ2 A;  1AUI B;  4CLN A;  2B1U A;  2F2O A;  2LHI A;  2SAS A;  1SYM A;  4IL1 A;  4HRE E;  1L2O C;  1XFW O;  2M7L A;  3NSO A;  1S1E A;  5AXI A;  1DJH A;  2OS8 C;  1QLS A;  1PAL A;  3TUY B;  1ALW A;  2L50 A;  3DD4 A;  4C0K A;  3VRP A;  1M63 B;  1K9K A;  2BBN A;  2Y1N A;  1Y1X A;  1WRK A;  2PMY A;  2KBM A;  3NSI A;  4YRU A;  5HLV A;  1Q80 A;  1AJ4 A;  1QVI Z;  5HKY A;  2G9B A;  2BE6 A;  1KCY A;  1YTZ C;  2BCX A;  2MHH A;  5J3X A;  1TNP A;  2ZNE A;  3HX4 A;  5DKQ A;  1TCO B;  1B7T Z;  2O60 A;  4D1E A;  1PUL A;  3BOW B;  1LXF C;  4PDZ A;  1NIW A;  2QAC A;  1S6C A;  1YVL A;  4M2O A;  4OR9 B;  1REC A;  2KGB C;  3D0Y A;  3NSL A;  1G4Y R;  3EVU A;  3OX6 A;  2CXJ A;  2MRD A;  4GGF C;  2PSR A;  1OMV A;  2KFH A;  2NLN A;  4WRI A;  5I2O A;  1XK4 A;  2LLU A;  1C07 A;  4ORA B;  1CFD A;  3GK2 A;  3TDZ A;  5BPJ A;  1S3P A;  4OVN F;  2M7N A;  1S36 A;  1XA5 A;  2JQ6 A;  4JPZ B;  1CDN A;  2M97 A;  1QX2 A;  1M39 A;  2Q91 A;  1DJI A;  1S5G Z;  5AER A;  1A2X A;  3I5H C;  4QJ5 B;  2F3Z A;  2WCE A;  3AAK A;  2KDH A;  3VRR A;  1CNP A;  4MRY A;  3RLZ A;  1CDP A;  4DIR A;  3PM8 A;  1B8R A;  1WDC B;  4PE7 A;  5GQQ C;  2ZN8 A;  1QAT A;  1SW8 A;  3MSE B;  1SK6 D;  1DGV A;  2L0P A;  3A8R A;  3EKH A;  2ZRS A;  5CSN A;  5ER5 A;  1CMG A;  3VGO A;  3DF0 B;  1B8C A;  5AAN A;  1XFZ O;  2I94 A;  2K7O A;  1XFV O;  1DJZ A;  1SBJ A;  1YR5 A;  3JVT C;  4BY5 A;  1KQV A;  3BYA A;  1SPY A;  1ZUZ A;  1CM1 A;  1WDC C;  1B47 A;  2ISD A;  1NX1 A;  3PN7 B;  3LK1 A;  4QJ3 B;  1IJ5 A;  2KAX A;  3BQ3 A;  2GGZ A;  1TIZ A;  4CFQ A;  2I18 A;  1DJG A;  1UUS A;  3NXA A;  1J55 A;  4L9M A;  1EG3 A;  1J1D A;  4QJ4 B;  2R2I A;  1E8A A;  2P6B B;  4ETO A;  2H61 C;  2LLT A;  1IWQ A;  5DKN A;  4PCW A;  1AP4 A;  1ALV A;  4N5X A;  2PAL A;  1R2U A;  2KFG A;  3PFV A;  2M1K B;  3PN7 C;  1EG4 A;  1AHR A;  1KWO C;  1WRL A;  3CZT X;  3LK0 A;  1BOD A;  4M2Q A;  5HKZ A;  5CSF A;  4ICB A;  2CTN A;  3PSR A;  1PSR A;  1PRW A;  4BY4 A;  1TNQ A;  2KI4 B;  4YGB B;  2F33 A;  4MLW A;  1N65 A;  2OPO A;  3JTD B;  1N0Y A;  1NUB A;  4I5K A;  1YRT B;  2KSP A;  3I5F B;  3FIA A;  3KHE A;  1Y1U A;  2DOQ A;  1MXL C;  1JSA A;  1QVI Y;  1BJF A;  2Y5I A;  1BR4 B;  3FS7 A;  2M1U A;  2JTZ A;  4A4B A;  2KI4 C;  2OTG C;  3VRN A;  4I5J A;  1B7T Y;  1L2O B;  1NP8 A;  2D8N A;  3E3R A;  1ODB A;  1Y6W A;  3I5F C;  4PHJ A;  1XFX O;  2OS8 B;  3OP0 A;  4OCI A;  4GGN A;  2GGM A;  4PE0 A;  1BU3 A;  2ZKM X;  3AKB A;  2LMV A;  4FTG A;  1LVC D;  1NX2 A;  2IS9 A;  5IBW A;  2EGD A;  3OX5 A;  1KSM A;  2PRU A;  2CT9 A;  4YBH B;  1C7W A;  1KK7 Z;  2LCP A;  1PVB A;  1U5I B;  2FCD A;  5F6T A;  4MVF A;  1XYD A;  2LVI A;  2LE9 B;  1A75 A;  1RWY A;  1VRK A;  3CR2 A;  1KFU L;  2LVV A;  4PHN A;  4XJK A;  2MA2 A;  1A03 A;  1W7I B;  1CLL A;  3BUO B;  1DGU A;  4PHM A;  2AUC A;  1TNX A;  2O5G A;  2BBM A;  4MN0 A;  3VRQ A;  1GGW A;  1IH0 A;  3BUW B;  1S5G Y;  1EJ3 A;  1F4O A;  1TN4 A;  4C0J A;  1GGZ A;  3SG6 A;  1J7O A;  3EK7 A;  2FCE A;  3FWB A;  1LA3 A;  2CNP A;  3O78 A;  4CPV A;  4DS7 A;  4MZJ A;  4ORB B;  1CM4 A;  1SL7 A;  1QTX A;  1NCZ A;  1K93 D;  1G8I A;  2L5X B;  1CB1 A;  2E6W A;  1YUR A;  3CWG A;  1WRZ A;  2JNF A;  4YGD B;  1N2D A;  2JPT A;  1KK8 C;  1YRU B;  1BF5 A;  1NCY A;  1X02 A;  4AQJ A;  1WLZ A;  1YVH A;  1SR6 C;  5HYD A;  3BUN B;  1DF0 B;  3I5G C;  3I5H B;  1Y1A A;  1NX0 A;  5FYX A;  4C0L A;  3SIA A;  2M0R A;  1F54 A;  4YGE B;  2JTT A;  2K8M B;  3TDI A;  1CKK A;  2WCB A;  1J7Q A;  1UP5 A;  2ZRT A;  3DVK A;  4FQO A;  1SMG A;  5CPV A;  1YUU A;  3NSK A;  4A4C A;  1DVI A;  2BKI B;  2L51 A;  1ZFS A;  2AAO A;  3JVT B;  4AQI A;  2KYC A;  1FPW A;  2VRG A;  2EHB A;  1CTR A;  1QX5 B;  1F70 A;  2BCB A;  3DVM A;  1DMO A;  2CBL A;  1NPQ A;  2Y1M A;  3WNX B;  1QV0 A;  1YX8 A;  2F3Y A;  4N1F A;  1FW4 A;  2KQY A;  3F45 A;  1JBA A;  1H4B A;  1IKU A;  1GQM A;  2LAP A;  3KPX A;  2I2R E;  2L4I A;  1F4Q A;  1CDL A;  5G08 A;  1KFU S;  2JC2 A;  4WQ3 A;  1NWD A;  4YI9 A;  2NZ0 A;  2M8U A;  2LUX A;  4MSP A;  3OB1 B;  1G33 A;  2WOS A;  1SL8 A;  1KFX L;  1KWO B;  1BR1 B;  1QS7 A;  2LMT A;  3PAL A;  2E30 A;  5B8I B;  1OQP A;  2F8P A;  2ZFD A;  4PE4 A;  3ZNI A;  4PAL A;  4MZL A;  3BOW A;  1W7J B;  1KK7 Y;  1F71 A;  2KOT A;  1LA0 A;  3CR5 X;  1CMF A;  1SCV A;  1MF8 B;  4CID A;  1SY9 A;  1B1G A;  2JWW A;  3K21 A;  2LUC A;  1PSB A;  2BEC A;  2LAN A;  1YUT A;  1ZAC A;  3QRX A;  1OE9 B;  3ZWH A;  2LMU A;  2OTG B;  1MXE A;  2M49 B;  4GFT A;  1TRF A;  4MRX A;  5KU1 A;  4Q04 A;  4UPG A;  2Q4U A;  4CFR A;  2HPS A;  3H4S E;  1K90 D;  1WLM A;  2KAV A;  4ZCU A;  1EH2 A;  1SCM C;  1K9U A;  5JJG A;  2EC6 B;  1IQ3 A;  3GK4 X;  3SJS A;  1BOC A;  4HRH A;  4XYN A;  1AJ5 A;  2RGI A;  1CLB A;  1TCF A;  2L98 A;  1AK8 A;  1YUS A;  2BL0 B;  4DCK A;  2LVK A;  1IRJ A;  4ZCV A;  1NYA A;  4YGC B;  2KHN A;  5K89 A;  2JUL A;  1R6P A;  3LLE A;  1IQ5 A;  4NDD A;  4E68 A;  1CFP A;  1SNL A;  3A4U B;  1JC2 A;  2EC6 C;  2HQW A;  3DF0 A;  3SG2 A;  3TZ1 A;  1CDM A;  2A4J A;  2KQ6 A;  4OV2 A;  3C1V A;  2LLS A;  1FI6 A;  1QX7 A;  1TTX A;  3VRO A;  2BL0 C;  2MAZ A;  3PLF B;  4I5L B;  1Y0V H;  3EKJ A;  2M29 A;  5D7F A;  1FBV A;  5HLO A;  4M2P A;  1BT6 A;  3KEV A;  1UUR A;  1XVJ A;  4DUQ A;  1DT7 B;  4JQ0 D;  1JWD A;  3D0Y B;  3CS1 A;  2HET A;  4P2Y B;  1UHN A;  4AOM A;  1PVA A;  2PAS A;  3BUX B;  1BLQ A;  2Y4Q A;  1S6I A;  1BG1 A;  1HT9 A;  3SG4 A;  1KQM C;  1B4C A;  1QIW A;  2FOT A;  4YI8 A;  4ORC B;  2KI6 D;  1PK0 D;  1KFX S;  1OSA A;  5AEQ A;  1M45 A;  4JWQ A;  1K2H A;  4PE1 A;  1C7V A;  2CCM A;  2L4H A;  1D1O A;  2LVJ A;  2KI6 C;  1KK8 B;  2GV5 A;  1OOJ A;  3FWC A;  2BCA A;  3GK1 A;  3IQQ A;  2ZND A;  1SR6 B;  4R1E A;  3DVJ A;  1XK4 C;  3I5G B;  4DRW A;  2K0J A;  4I5N B;  1DJW A;  3WXA A;  2KAY A;  3O4Y A;  2JT3 A;  2WC8 A;  3SG7 A;  1ZOT B;  4HSZ A;  1TNW A;  1SRA A;  2LP2 A;  2WCF A;  4NDB A;  4NDC A;  1V1F A;  2MBX A;  2G2B A;  5KSZ A;  2HQ8 A;  1TOP A;  5I2Q A;  4F0Z B;  1CLM A;  3EVR A;  3OHM B;  1GJY A;  1B8L A;  5I2L A;  3TUY C;  1J1E A;  5AFP A;  1XFU O;  2V53 A;  4N1G A;  2PVB A;  1F55 A;  1CFC A;  3LCP C;  1J7P A;  3CTN A;  4GNK B;  5I8N A;  4GUK A;  1NCX A;  3AAJ A;  1RK9 A;  4NQG A;  1U5I A;  1NSH A;  3CLN A;  2K2A A;  4PHK A;  3CGA A;  4HRG A;  3SIB A;  1XO5 A;  2KGR A;  1JF2 A;  5CSI A;  2JT0 A;  3SG5 A;  5PAL A;  1K96 A;  2KYF A;  1JF0 A;  2LP3 A;  1AVS A;  1K94 A;  1OZO A;  5JOL A;  1V1G A; 
#chains in the Genus database with same CATH topology
 1YX7 A;  2KNE A;  3R1O A;  5FI6 A;  4GPL B;  1JFK A;  3CR4 X;  2P70 A;  3SG3 A;  2H2K A;  1QIV A;  1OMD A;  1UHH A;  1K95 A;  1UHJ A;  2JU0 A;  1LIN A;  5D69 A;  2JXL A;  5ER4 X;  5HKW A;  4YGA A;  1Z4H A;  4MZK A;  3GOF A;  4GGF A;  2QPT A;  4P5O E;  1KSO A;  1ZMZ A;  2L2E A;  3S0F A;  1FF1 A;  3BUM B;  1BMO A;  1K9P A;  1OW4 A;  1NX3 A;  1QLK A;  2BKH B;  1JFJ A;  1RTP 1;  2ZN9 A;  3I5I B;  4INW A;  2JZI A;  1J7R A;  2K61 A;  2SCP A;  3DYE A;  1XFY O;  3ICB A;  5DKR A;  2FJU B;  3BFH A;  1SKT A;  1FI5 A;  1GM0 A;  1A29 A;  2LHL A;  3CYZ A;  1HQV A;  1SCM B;  1QV1 A;  1LKJ A;  4MEW A;  1S26 D;  1DF0 A;  1OMR A;  1UWO A;  2BE4 A;  3O2P A;  1IG5 A;  1MR8 A;  2WOR A;  3IF7 A;  3M0W A;  4GAO A;  3TS5 B;  2WCH A;  3CZ0 A;  1IGV A;  1Z2C B;  3D10 A;  3KO0 A;  2JOJ A;  1M46 A;  3IQO A;  1H8B A;  2F2P A;  3I5I C;  1A75 B;  4OZD A;  2LM5 A;  1QJT A;  2COL B;  2K2F A;  3EVV A;  4XJK B;  2KFF A;  2M9G A;  3CZ1 A;  1QAS A;  1DEL A;  3CAB A;  3PAT A;  4F7F A;  5D3O A;  2MLF C;  1K8U A;  4OKH A;  3RM1 A;  3HCM A;  1MUX A;  1WY9 A;  3K1E A;  3TS5 C;  3WHU B;  1RRO A;  3AKA A;  1MHO A;  3OB2 B;  1IJ6 A;  3B87 A;  1JUO A;  1DJY A;  2JXC A;  2KBI A;  2NCO A;  3BXK A;  4MBE A;  2TN4 A;  2JRF A;  2K7C A;  3LL8 B;  4USL A;  2JT8 A;  2I7A A;  5KTY A;  3EK8 A;  4U8D A;  2HF5 A;  2JNX A;  1SL9 A;  2K7D A;  5CSJ A;  2WND A;  1M31 A;  1QWV A;  1B9A A;  3L47 A;  2LV7 A;  2H61 A;  1EXR A;  5TNC A;  4TNC A;  3WHT B;  1KQM B;  3EK4 A;  3KF9 A;  1CFF A;  1RFJ A;  4GBA A;  2BAP A;  2LC5 A;  1MQ1 A;  2MLE C;  2K7B A;  2MJW B;  3UO9 A;  1F8H A;  3JTD C;  1QXP A;  1DJX A;  1A4P A;  2ERB A;  1UHK A;  2AMI A;  3TDU A;  2NCP A;  2KLE A;  1UHI A;  5FI7 A;  1L7Z A;  2LNK A;  2NXQ A;  1RJV A;  2M3W A;  3O6B A;  1OZS A;  1S6J A;  1EL4 A;  3DVE A;  3OGN A;  1DTL A;  1MWN A;  4WQ2 A;  1AUI B;  4CLN A;  3CZ2 A;  2B1U A;  3R1P A;  2F2O A;  2LHI A;  2SAS A;  1SYM A;  4IL1 A;  4HRE E;  1L2O C;  1XFW O;  2M7L A;  1T14 A;  3NSO A;  1S1E A;  5AXI A;  1DJH A;  3FE8 A;  2OS8 C;  1QLS A;  1PAL A;  4JKT A;  2KLD A;  3TUY B;  1ALW A;  2L50 A;  1DEK A;  3DD4 A;  3N7H A;  3VRP A;  4C0K A;  1M63 B;  1K9K A;  2BBN A;  2Y1N A;  1Y1X A;  1WRK A;  2PMY A;  2KBM A;  3NSI A;  4YRU A;  5HLV A;  1Q80 A;  1AJ4 A;  1QVI Z;  5HKY A;  2G9B A;  2BE6 A;  1KCY A;  1YTZ C;  2BCX A;  3QME A;  2MHH A;  5J3X A;  1TNP A;  2ZNE A;  3HX4 A;  5DKQ A;  1TCO B;  3RZS A;  1B7T Z;  2O60 A;  4D1E A;  1PUL A;  3BOW B;  1LXF C;  4PDZ A;  1NIW A;  2QAC A;  1P28 A;  1S6C A;  1YVL A;  3O4X A;  4M2O A;  4OR9 B;  2K60 A;  1REC A;  2KGB C;  3D0Y A;  3NSL A;  1G4Y R;  3EVU A;  3OX6 A;  2CXJ A;  2MRD A;  4GGF C;  3S0A A;  2PSR A;  1OMV A;  2KFH A;  2NLN A;  3OBV A;  4WRI A;  5I2O A;  1XK4 A;  2LLU A;  3D74 A;  1C07 A;  4ORA B;  1CFD A;  3GK2 A;  3TDZ A;  5BPJ A;  1S3P A;  4OVN F;  2M7N A;  5HL1 A;  1S36 A;  1XA5 A;  2JQ6 A;  4JPZ B;  1CDN A;  2M97 A;  1QX2 A;  1M39 A;  2Q91 A;  1DJI A;  1S5G Z;  1C3Z A;  5AER A;  1A2X A;  3I5H C;  4QJ5 B;  2F3Z A;  2WCE A;  3AAK A;  3FE9 A;  2KDH A;  3VRR A;  1CNP A;  4MRY A;  3RLZ A;  1CDP A;  4DIR A;  3PM8 A;  1B8R A;  1WDC B;  3DY9 A;  4PE7 A;  5GQQ C;  2ZN8 A;  1QAT A;  1SW8 A;  3MSE B;  1SK6 D;  1DGV A;  2L0P A;  3A8R A;  3EKH A;  2QDI A;  2ZRS A;  4KYN A;  5CSN A;  5ER5 A;  3VGO A;  3DF0 B;  3L4L A;  1CMG A;  1B8C A;  5AAN A;  1XFZ O;  2I94 A;  2K7O A;  1XFV O;  1DJZ A;  1SBJ A;  1YR5 A;  3JVT C;  4BY5 A;  1KQV A;  3BYA A;  1SPY A;  1ZUZ A;  1CM1 A;  1WDC C;  1B47 A;  2ISD A;  1NX1 A;  3IVT A;  3LK1 A;  3PN7 B;  2BNX A;  4QJ3 B;  1IJ5 A;  2KAX A;  3BQ3 A;  2GGZ A;  3SS4 A;  1TIZ A;  4CFQ A;  2I18 A;  1DJG A;  1UUS A;  3NXA A;  1J55 A;  4L9M A;  1EG3 A;  1J1D A;  4QJ4 B;  2R2I A;  1E8A A;  2P6B B;  4ETO A;  2H61 C;  2LLT A;  1IWQ A;  5DKN A;  2L2C A;  4PCW A;  1AP4 A;  1ALV A;  4N5X A;  2PAL A;  1R2U A;  2KFG A;  3PFV A;  2M1K B;  3B86 A;  3D77 A;  3PN7 C;  1EG4 A;  1AHR A;  1KWO C;  1WRL A;  3CZT X;  3LK0 A;  3B7A A;  1BOD A;  4M2Q A;  3Q8I A;  5HKZ A;  2WCK A;  4ICB A;  2CTN A;  3B6X A;  1ORG A;  3PSR A;  1PSR A;  5CSF A;  1PRW A;  2FJY A;  1TNQ A;  4BY4 A;  2KI4 B;  4YGB B;  2F33 A;  1TWO A;  4MLW A;  1N65 A;  2OPO A;  3JTD B;  1N0Y A;  1NUB A;  2PYQ A;  1YRT B;  4I5K A;  2KSP A;  3I5F B;  3FIA A;  3KHE A;  3S0G A;  1Y1U A;  2DOQ A;  1MXL C;  1JSA A;  1QVI Y;  2QEO A;  1BJF A;  2Y5I A;  1BR4 B;  3FS7 A;  2M1U A;  2JTZ A;  4A4B A;  2KI4 C;  2OTG C;  3VRN A;  3SS5 A;  4I5J A;  1B7T Y;  2JPO A;  1L2O B;  1NP8 A;  2WCL A;  2D8N A;  3E3R A;  1ODB A;  1Y6W A;  3I5F C;  3V2L A;  4PHJ A;  1XFX O;  2OS8 B;  3NGV A;  3OP0 A;  4OCI A;  4GGN A;  2GGM A;  4PE0 A;  1BU3 A;  2ZKM X;  3AKB A;  2LMV A;  4FTG A;  1LVC D;  1NX2 A;  2IS9 A;  5IBW A;  2EGD A;  3OX5 A;  1KSM A;  2PRU A;  2CT9 A;  4YBH B;  1C7W A;  1KK7 Z;  2LCP A;  4FQT A;  1PVB A;  3BJH A;  1U5I B;  2FCD A;  5F6T A;  4MVF A;  1XYD A;  2LVI A;  2LE9 B;  1A75 A;  1RWY A;  1VRK A;  3CR2 A;  3D75 A;  1KFU L;  2LVV A;  4PHN A;  3D78 A;  2MA2 A;  4XJK A;  1A03 A;  1C3Y A;  1W7I B;  1CLL A;  3BUO B;  1DGU A;  4PHM A;  2AUC A;  1TNX A;  3R72 A;  2O5G A;  4IJ7 A;  2BBM A;  4MN0 A;  3VRQ A;  1GGW A;  1IH0 A;  3BUW B;  1S5G Y;  1EJ3 A;  1F4O A;  1TN4 A;  2H8V A;  4C0J A;  1GGZ A;  3SG6 A;  1J7O A;  3EK7 A;  2FCE A;  3FWB A;  1LA3 A;  2CNP A;  3O78 A;  4INX A;  4CPV A;  4DS7 A;  4MZJ A;  4ORB B;  1CM4 A;  1SL7 A;  1QTX A;  1NCZ A;  5EL2 A;  1K93 D;  1G8I A;  2L5X B;  1CB1 A;  2E6W A;  1YUR A;  3CWG A;  1WRZ A;  2JNF A;  5DIC A;  4YGD B;  1N2D A;  1TUJ A;  1KK8 C;  1YRU B;  2JPT A;  1BF5 A;  1NCY A;  1X02 A;  4AQJ A;  1WLZ A;  1YVH A;  1SR6 C;  5HYD A;  1DC1 A;  3BUN B;  1DF0 B;  3I5G C;  3I5H B;  1Y1A A;  1NX0 A;  5FYX A;  4C0L A;  3SIA A;  2M0R A;  1F54 A;  4YGE B;  2JTT A;  2K8M B;  3TDI A;  1CKK A;  2WCB A;  1J7Q A;  1UP5 A;  2ZRT A;  2P71 A;  3DVK A;  1SMG A;  4FQO A;  1YUU A;  5CPV A;  3NSK A;  4A4C A;  1DVI A;  2BKI B;  2L51 A;  1ZFS A;  2AAO A;  2WCM A;  3JVT B;  4AQI A;  3DXL A;  2KYC A;  3NHI A;  2VRG A;  2EHB A;  1CTR A;  1QX5 B;  1F70 A;  1FPW A;  2BCB A;  3DVM A;  1DMO A;  2CBL A;  1NPQ A;  2Y1M A;  3WNX B;  1QV0 A;  1YX8 A;  2F3Y A;  4N1F A;  1FW4 A;  2KQY A;  3F45 A;  1JBA A;  1H4B A;  1IKU A;  1GQM A;  2LAP A;  3KPX A;  2I2R E;  2L4I A;  1F4Q A;  1CDL A;  5G08 A;  1KFU S;  2JC2 A;  4WQ3 A;  1NWD A;  4YI9 A;  2NZ0 A;  2M8U A;  2LUX A;  4MSP A;  3OB1 B;  1G33 A;  2WOS A;  1SL8 A;  1KFX L;  1KWO B;  1BR1 B;  1QS7 A;  2LMT A;  3PAL A;  2WC5 A;  2E30 A;  5B8I B;  1OQP A;  2F8P A;  2ZFD A;  4PE4 A;  3ZNI A;  4PAL A;  4MZL A;  3BOW A;  1W7J B;  1KK7 Y;  1F71 A;  2KOT A;  1LA0 A;  3CR5 X;  3PM2 A;  1CMF A;  1SCV A;  1MF8 B;  4CID A;  1SY9 A;  3S0B A;  1B1G A;  2JWW A;  3S0D A;  3K21 A;  2LUC A;  3VB1 A;  1PSB A;  2BEC A;  2LAN A;  1YUT A;  1ZAC A;  2YGU A;  3QRX A;  1OE9 B;  3ZWH A;  2LMU A;  3NHT A;  2GTE A;  2OTG B;  1MXE A;  2M49 B;  4GFT A;  1TRF A;  4MRX A;  2PQL A;  5KU1 A;  4Q04 A;  1OOH A;  4UPG A;  2Q4U A;  4CFR A;  2HPS A;  3H4S E;  1K90 D;  1WLM A;  2KAV A;  4ZCU A;  1EH2 A;  1SCM C;  1K9U A;  5JJG A;  2EC6 B;  1IQ3 A;  3GK4 X;  3SJS A;  1BOC A;  4HRH A;  4XYN A;  1AJ5 A;  2RGI A;  1CLB A;  1TCF A;  2L98 A;  1AK8 A;  1YUS A;  2BL0 B;  4DCK A;  2LVK A;  1IRJ A;  4ZCV A;  1NYA A;  4YGC B;  2KHN A;  5K89 A;  2JUL A;  1R6P A;  2WCJ A;  3LLE A;  1IQ5 A;  4NDD A;  4E68 A;  1CFP A;  1SNL A;  3A4U B;  1JC2 A;  1OOF A;  2EC6 C;  2HQW A;  3DF0 A;  3SG2 A;  3TZ1 A;  1CDM A;  2A4J A;  2KQ6 A;  1DQE A;  3C1V A;  2LLS A;  4OV2 A;  1FI6 A;  2QEV A;  3FE6 A;  1QX7 A;  1TTX A;  3VRO A;  2BL0 C;  3CDN A;  2MAZ A;  3PLF B;  4I5L B;  1Y0V H;  3EKJ A;  2M29 A;  5D7F A;  1FBV A;  5HLO A;  4M2P A;  1BT6 A;  3KEV A;  1UUR A;  1XVJ A;  4DUQ A;  1DT7 B;  5I94 A;  3PJI A;  4JQ0 D;  1JWD A;  3D0Y B;  3CS1 A;  2HET A;  3D76 A;  3L4A A;  1UHN A;  4P2Y B;  4AOM A;  1PVA A;  2PAS A;  3BUX B;  1BLQ A;  1OOI X;  2Y4Q A;  1S6I A;  3UNW A;  1BG1 A;  1HT9 A;  5FI2 A;  3SG4 A;  3S0E A;  1KQM C;  1B4C A;  3EG5 B;  1QIW A;  2FOT A;  4YI8 A;  2WC6 A;  2KI6 D;  1PK0 D;  1KFX S;  1OSA A;  4ORC B;  5AEQ A;  1M45 A;  4JWQ A;  1K2H A;  4JD9 A;  4PE1 A;  1C7V A;  2CCM A;  2L4H A;  1D1O A;  1LS8 A;  2LVJ A;  2KI6 C;  1KK8 B;  2GV5 A;  1OOJ A;  3FWC A;  2BCA A;  3GK1 A;  3IQQ A;  2ZND A;  1SR6 B;  4R1E A;  3DVJ A;  1XK4 C;  3I5G B;  4DRW A;  2K0J A;  1XFR A;  4I5N B;  1DJW A;  3WXA A;  2KAY A;  3R1V A;  2KPH A;  3O4Y A;  2JT3 A;  2WC8 A;  3SG7 A;  1ZOT B;  4HSZ A;  3BFB A;  1TNW A;  2L5Y A;  4PT1 A;  1SRA A;  2QEH A;  2LP2 A;  2WCF A;  4NDB A;  4NDC A;  1V1F A;  1TUZ A;  2MBX A;  2G2B A;  5KSZ A;  2HQ8 A;  1TOP A;  3SS3 A;  5I2Q A;  4F0Z B;  1CLM A;  3EVR A;  3OHM B;  1GJY A;  1B8L A;  5I2L A;  3TUY C;  1J1E A;  5AFP A;  1XFU O;  2QEB A;  2V53 A;  4N1G A;  2PVB A;  1F55 A;  3DZT A;  3D73 A;  1SSE B;  3CTN A;  3LCP C;  1CFC A;  1J7P A;  4GNK B;  5I8N A;  4GUK A;  1NCX A;  3AAJ A;  1RK9 A;  4NQG A;  1U5I A;  1NSH A;  3CLN A;  2K2A A;  4PHK A;  3CGA A;  4HRG A;  3SIB A;  3BFA A;  1XO5 A;  2KGR A;  1JF2 A;  1OOG A;  5CSI A;  2JT0 A;  1W9Z A;  3B88 A;  5PAL A;  3SG5 A;  1K96 A;  2KYF A;  1JF0 A;  2LP3 A;  1AVS A;  1K94 A;  1OZO A;  5JOL A;  1IIO A;  1V1G A; 
#chains in the Genus database with same CATH homology
 1YX7 A;  2KNE A;  4GPL B;  1JFK A;  3CR4 X;  3SG3 A;  2H2K A;  1QIV A;  1OMD A;  1UHH A;  1K95 A;  1UHJ A;  2JU0 A;  1LIN A;  5D69 A;  2JXL A;  5ER4 X;  5HKW A;  4YGA A;  4MZK A;  3GOF A;  4GGF A;  2QPT A;  4P5O E;  1KSO A;  1ZMZ A;  2L2E A;  1FF1 A;  3BUM B;  1BMO A;  1K9P A;  1NX3 A;  1QLK A;  2BKH B;  1JFJ A;  1RTP 1;  2ZN9 A;  3I5I B;  2JZI A;  1J7R A;  2K61 A;  2SCP A;  3ICB A;  1XFY O;  5DKR A;  2FJU B;  1SKT A;  1FI5 A;  1A29 A;  2LHL A;  1HQV A;  1SCM B;  1QV1 A;  1LKJ A;  4MEW A;  1S26 D;  1DF0 A;  1OMR A;  1UWO A;  2BE4 A;  3O2P A;  1IG5 A;  1MR8 A;  2WOR A;  3IF7 A;  3M0W A;  4GAO A;  3TS5 B;  1IGV A;  3D10 A;  3KO0 A;  2JOJ A;  1M46 A;  3IQO A;  1H8B A;  2F2P A;  3I5I C;  1A75 B;  2LM5 A;  1QJT A;  2COL B;  2K2F A;  3EVV A;  4XJK B;  2KFF A;  2M9G A;  1QAS A;  3PAT A;  2MLF C;  1K8U A;  4OKH A;  3RM1 A;  3HCM A;  1MUX A;  1WY9 A;  3TS5 C;  3WHU B;  1RRO A;  3AKA A;  1MHO A;  3OB2 B;  1IJ6 A;  1JUO A;  1DJY A;  2JXC A;  2KBI A;  2NCO A;  3BXK A;  4MBE A;  2TN4 A;  2JRF A;  2K7C A;  3LL8 B;  4USL A;  2JT8 A;  2I7A A;  5KTY A;  3EK8 A;  4U8D A;  2HF5 A;  2JNX A;  1SL9 A;  2K7D A;  5CSJ A;  2WND A;  1M31 A;  1B9A A;  2LV7 A;  2H61 A;  1EXR A;  5TNC A;  4TNC A;  3WHT B;  1KQM B;  3EK4 A;  3KF9 A;  1CFF A;  1RFJ A;  4GBA A;  2LC5 A;  2MLE C;  1MQ1 A;  2K7B A;  2MJW B;  1F8H A;  3JTD C;  1QXP A;  1DJX A;  1A4P A;  1UHK A;  2AMI A;  3TDU A;  2NCP A;  1UHI A;  1L7Z A;  2LNK A;  2NXQ A;  1RJV A;  2M3W A;  3O6B A;  1OZS A;  1S6J A;  1EL4 A;  3DVE A;  1DTL A;  1MWN A;  4WQ2 A;  1AUI B;  4CLN A;  2B1U A;  2F2O A;  2LHI A;  2SAS A;  1SYM A;  4IL1 A;  4HRE E;  1L2O C;  1XFW O;  2M7L A;  3NSO A;  1S1E A;  5AXI A;  1DJH A;  2OS8 C;  1QLS A;  1PAL A;  3TUY B;  1ALW A;  2L50 A;  3DD4 A;  4C0K A;  3VRP A;  1M63 B;  1K9K A;  2BBN A;  2Y1N A;  1Y1X A;  1WRK A;  2PMY A;  2KBM A;  3NSI A;  4YRU A;  5HLV A;  1Q80 A;  1AJ4 A;  1QVI Z;  5HKY A;  2G9B A;  2BE6 A;  1KCY A;  1YTZ C;  2BCX A;  2MHH A;  5J3X A;  1TNP A;  2ZNE A;  3HX4 A;  5DKQ A;  1TCO B;  1B7T Z;  2O60 A;  4D1E A;  1PUL A;  3BOW B;  1LXF C;  4PDZ A;  1NIW A;  2QAC A;  1S6C A;  1YVL A;  4M2O A;  4OR9 B;  1REC A;  2KGB C;  3D0Y A;  3NSL A;  1G4Y R;  3EVU A;  3OX6 A;  2CXJ A;  2MRD A;  4GGF C;  2PSR A;  1OMV A;  2KFH A;  2NLN A;  4WRI A;  5I2O A;  1XK4 A;  2LLU A;  1C07 A;  4ORA B;  1CFD A;  3GK2 A;  3TDZ A;  5BPJ A;  1S3P A;  4OVN F;  2M7N A;  1S36 A;  1XA5 A;  2JQ6 A;  4JPZ B;  1CDN A;  2M97 A;  1QX2 A;  1M39 A;  2Q91 A;  1DJI A;  1S5G Z;  5AER A;  1A2X A;  3I5H C;  4QJ5 B;  2F3Z A;  2WCE A;  3AAK A;  2KDH A;  3VRR A;  1CNP A;  4MRY A;  3RLZ A;  1CDP A;  4DIR A;  3PM8 A;  1B8R A;  1WDC B;  4PE7 A;  5GQQ C;  2ZN8 A;  1QAT A;  1SW8 A;  3MSE B;  1SK6 D;  1DGV A;  2L0P A;  3A8R A;  3EKH A;  2ZRS A;  5CSN A;  5ER5 A;  1CMG A;  3VGO A;  3DF0 B;  1B8C A;  5AAN A;  1XFZ O;  2I94 A;  2K7O A;  1XFV O;  1DJZ A;  1SBJ A;  1YR5 A;  3JVT C;  4BY5 A;  1KQV A;  3BYA A;  1SPY A;  1ZUZ A;  1CM1 A;  1WDC C;  1B47 A;  2ISD A;  1NX1 A;  3PN7 B;  3LK1 A;  4QJ3 B;  1IJ5 A;  2KAX A;  3BQ3 A;  2GGZ A;  1TIZ A;  4CFQ A;  2I18 A;  1DJG A;  1UUS A;  3NXA A;  1J55 A;  4L9M A;  1EG3 A;  1J1D A;  4QJ4 B;  2R2I A;  1E8A A;  2P6B B;  4ETO A;  2H61 C;  2LLT A;  1IWQ A;  5DKN A;  4PCW A;  1AP4 A;  1ALV A;  4N5X A;  2PAL A;  1R2U A;  2KFG A;  3PFV A;  2M1K B;  3PN7 C;  1EG4 A;  1AHR A;  1KWO C;  1WRL A;  3CZT X;  3LK0 A;  1BOD A;  4M2Q A;  5HKZ A;  5CSF A;  4ICB A;  2CTN A;  3PSR A;  1PSR A;  1PRW A;  4BY4 A;  1TNQ A;  2KI4 B;  4YGB B;  2F33 A;  4MLW A;  1N65 A;  2OPO A;  3JTD B;  1N0Y A;  1NUB A;  4I5K A;  1YRT B;  2KSP A;  3I5F B;  3FIA A;  3KHE A;  1Y1U A;  2DOQ A;  1MXL C;  1JSA A;  1QVI Y;  1BJF A;  2Y5I A;  1BR4 B;  3FS7 A;  2M1U A;  2JTZ A;  4A4B A;  2KI4 C;  2OTG C;  3VRN A;  4I5J A;  1B7T Y;  1L2O B;  1NP8 A;  2D8N A;  3E3R A;  1ODB A;  1Y6W A;  3I5F C;  4PHJ A;  1XFX O;  2OS8 B;  3OP0 A;  4OCI A;  4GGN A;  2GGM A;  4PE0 A;  1BU3 A;  2ZKM X;  3AKB A;  2LMV A;  4FTG A;  1LVC D;  1NX2 A;  2IS9 A;  5IBW A;  2EGD A;  3OX5 A;  1KSM A;  2PRU A;  2CT9 A;  4YBH B;  1C7W A;  1KK7 Z;  2LCP A;  1PVB A;  1U5I B;  2FCD A;  5F6T A;  4MVF A;  1XYD A;  2LVI A;  2LE9 B;  1A75 A;  1RWY A;  1VRK A;  3CR2 A;  1KFU L;  2LVV A;  4PHN A;  4XJK A;  2MA2 A;  1A03 A;  1W7I B;  1CLL A;  3BUO B;  1DGU A;  4PHM A;  2AUC A;  1TNX A;  2O5G A;  2BBM A;  4MN0 A;  3VRQ A;  1GGW A;  1IH0 A;  3BUW B;  1S5G Y;  1EJ3 A;  1F4O A;  1TN4 A;  4C0J A;  1GGZ A;  3SG6 A;  1J7O A;  3EK7 A;  2FCE A;  3FWB A;  1LA3 A;  2CNP A;  3O78 A;  4CPV A;  4DS7 A;  4MZJ A;  4ORB B;  1CM4 A;  1SL7 A;  1QTX A;  1NCZ A;  1K93 D;  1G8I A;  2L5X B;  1CB1 A;  2E6W A;  1YUR A;  3CWG A;  1WRZ A;  2JNF A;  4YGD B;  1N2D A;  2JPT A;  1KK8 C;  1YRU B;  1BF5 A;  1NCY A;  1X02 A;  4AQJ A;  1WLZ A;  1YVH A;  1SR6 C;  5HYD A;  3BUN B;  1DF0 B;  3I5G C;  3I5H B;  1Y1A A;  1NX0 A;  5FYX A;  4C0L A;  3SIA A;  2M0R A;  1F54 A;  4YGE B;  2JTT A;  2K8M B;  3TDI A;  1CKK A;  2WCB A;  1J7Q A;  1UP5 A;  2ZRT A;  3DVK A;  4FQO A;  1SMG A;  5CPV A;  1YUU A;  3NSK A;  4A4C A;  1DVI A;  2BKI B;  2L51 A;  1ZFS A;  2AAO A;  3JVT B;  4AQI A;  2KYC A;  1FPW A;  2VRG A;  2EHB A;  1CTR A;  1QX5 B;  1F70 A;  2BCB A;  3DVM A;  1DMO A;  2CBL A;  1NPQ A;  2Y1M A;  3WNX B;  1QV0 A;  1YX8 A;  2F3Y A;  4N1F A;  1FW4 A;  2KQY A;  3F45 A;  1JBA A;  1H4B A;  1IKU A;  1GQM A;  2LAP A;  3KPX A;  2I2R E;  2L4I A;  1F4Q A;  1CDL A;  5G08 A;  1KFU S;  2JC2 A;  4WQ3 A;  1NWD A;  4YI9 A;  2NZ0 A;  2M8U A;  2LUX A;  4MSP A;  3OB1 B;  1G33 A;  2WOS A;  1SL8 A;  1KFX L;  1KWO B;  1BR1 B;  1QS7 A;  2LMT A;  3PAL A;  2E30 A;  5B8I B;  1OQP A;  2F8P A;  2ZFD A;  4PE4 A;  3ZNI A;  4PAL A;  4MZL A;  3BOW A;  1W7J B;  1KK7 Y;  1F71 A;  2KOT A;  1LA0 A;  3CR5 X;  1CMF A;  1SCV A;  1MF8 B;  4CID A;  1SY9 A;  1B1G A;  2JWW A;  3K21 A;  2LUC A;  1PSB A;  2BEC A;  2LAN A;  1YUT A;  1ZAC A;  3QRX A;  1OE9 B;  3ZWH A;  2LMU A;  2OTG B;  1MXE A;  2M49 B;  4GFT A;  1TRF A;  4MRX A;  5KU1 A;  4Q04 A;  4UPG A;  2Q4U A;  4CFR A;  2HPS A;  3H4S E;  1K90 D;  1WLM A;  2KAV A;  4ZCU A;  1EH2 A;  1SCM C;  1K9U A;  5JJG A;  2EC6 B;  1IQ3 A;  3GK4 X;  3SJS A;  1BOC A;  4HRH A;  4XYN A;  1AJ5 A;  2RGI A;  1CLB A;  1TCF A;  2L98 A;  1AK8 A;  1YUS A;  2BL0 B;  4DCK A;  2LVK A;  1IRJ A;  4ZCV A;  1NYA A;  4YGC B;  2KHN A;  5K89 A;  2JUL A;  1R6P A;  3LLE A;  1IQ5 A;  4NDD A;  4E68 A;  1CFP A;  1SNL A;  3A4U B;  1JC2 A;  2EC6 C;  2HQW A;  3DF0 A;  3SG2 A;  3TZ1 A;  1CDM A;  2A4J A;  2KQ6 A;  4OV2 A;  3C1V A;  2LLS A;  1FI6 A;  1QX7 A;  1TTX A;  3VRO A;  2BL0 C;  2MAZ A;  3PLF B;  4I5L B;  1Y0V H;  3EKJ A;  2M29 A;  5D7F A;  1FBV A;  5HLO A;  4M2P A;  1BT6 A;  3KEV A;  1UUR A;  1XVJ A;  4DUQ A;  1DT7 B;  4JQ0 D;  1JWD A;  3D0Y B;  3CS1 A;  2HET A;  4P2Y B;  1UHN A;  4AOM A;  1PVA A;  2PAS A;  3BUX B;  1BLQ A;  2Y4Q A;  1S6I A;  1BG1 A;  1HT9 A;  3SG4 A;  1KQM C;  1B4C A;  1QIW A;  2FOT A;  4YI8 A;  4ORC B;  2KI6 D;  1PK0 D;  1KFX S;  1OSA A;  5AEQ A;  1M45 A;  4JWQ A;  1K2H A;  4PE1 A;  1C7V A;  2CCM A;  2L4H A;  1D1O A;  2LVJ A;  2KI6 C;  1KK8 B;  2GV5 A;  1OOJ A;  3FWC A;  2BCA A;  3GK1 A;  3IQQ A;  2ZND A;  1SR6 B;  4R1E A;  3DVJ A;  1XK4 C;  3I5G B;  4DRW A;  2K0J A;  4I5N B;  1DJW A;  3WXA A;  2KAY A;  3O4Y A;  2JT3 A;  2WC8 A;  3SG7 A;  1ZOT B;  4HSZ A;  1TNW A;  1SRA A;  2LP2 A;  2WCF A;  4NDB A;  4NDC A;  1V1F A;  2MBX A;  2G2B A;  5KSZ A;  2HQ8 A;  1TOP A;  5I2Q A;  4F0Z B;  1CLM A;  3EVR A;  3OHM B;  1GJY A;  1B8L A;  5I2L A;  3TUY C;  1J1E A;  5AFP A;  1XFU O;  2V53 A;  4N1G A;  2PVB A;  1F55 A;  1CFC A;  3LCP C;  1J7P A;  3CTN A;  4GNK B;  5I8N A;  4GUK A;  1NCX A;  3AAJ A;  1RK9 A;  4NQG A;  1U5I A;  1NSH A;  3CLN A;  2K2A A;  4PHK A;  3CGA A;  4HRG A;  3SIB A;  1XO5 A;  2KGR A;  1JF2 A;  5CSI A;  2JT0 A;  3SG5 A;  5PAL A;  1K96 A;  2KYF A;  1JF0 A;  2LP3 A;  1AVS A;  1K94 A;  1OZO A;  5JOL A;  1V1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...