1OZSA

C-domain of human cardiac troponin c in complex with the inhibitory region of human cardiac troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ozsA00
1DJIA 3PLFB 3I5FB 1OZSA 4JWQA 2AAOA 3DVKA 4CPVA 2FCDA 2K7CA 1NYAA 4MBEA 1M46A 3BUNB 1CLBA 2BECA 2KHNA 3JVTC 1SL9A 2L51A 2I18A 3BUXB 2NZ0A 2A4JA 2KI4B 1JUOA 1SY9A 1SRAA 3AKAA 1R6PA 2LP2A 1DTLA 1OQPA 3D0YB 1IQ3A 2HQWA 4FQOA 5JJGA 1K90D 1MR8A 1QLSA 1BJFA 4BY4A 2KOTA 3OP0A 5AEQA 1UWOA 2JT8A 1TOPA 1QS7A 1AK8A 2M29A 3I5GB 2WCFA 1OE9B 1N2DA 1GGWA 1QIWA 2LV7A 3VRNA 1Y1UA 2WNDA 1S6IA 4P2YB 3DVJA 1DJYA 2SASA 2EHBA 2ZN9A 3BOWB 4HRHA 2PMYA 4OVNF 5DKNA 2MBXA 1F54A 1S5GZ 3BUWB 3OX5A 1QVIZ 2FOTA 2JRFA 2H2KA 3TUYC 1JF2A 1OSAA 1FI5A 4Q04A 3GK4X 2BL0C 1QJTA 1NWDA 1YVHA 4PE1A 1PSBA 2KQYA 1J7RA 2WOSA 2KFHA 1J7OA 2G9BA 1MUXA 3VROA 1C7WA 1RECA 1X02A 3C1VA 3I5FC 2BCXA 4PHMA 4WRIA 2MAZA 1DGUA 2BBNA 1XFXO 2H61C 3CR2A 1Y1AA 2PSRA 2BCBA 1UHKA 2HETA 3CZTX 4L9MA 3CWGA 3WXAA 2K7OA 1FPWA 3TDZA 2OS8B 1PALA 1K93D 5HYDA 1KWOC 4M2OA 2WC8A 3AAJA 5I2OA 1HT9A 3DVMA 3JTDB 1MXLC 2LE9B 3KPXA 3O4YA 4GGNA 1C07A 1WRZA 2M7NA 2KFFA 3I5IC 4NDBA 5DKQA 4I5JA 2EC6C 4XJKB 3GK2A 1CTRA 3SG5A 1CKKA 3E3RA 4FTGA 2LUCA 1IKUA 1YURA 4QJ3B 1S3PA 1F4QA 2Q4UA 1NIWA 4PE4A 1QLKA 1CMGA 1IWQA 3DD4A 3BUMB 1KSOA 2BE6A 3EKHA 3SG2A 1FI6A 2NLNA 1L2OB 3AAKA 1QX5B 2KGBC 4WQ3A 2PVBA 3K21A 3NXAA 3LL8B 4MZKA 1SR6C 1YX7A 2LVKA 5HLVA 5CSFA 5AANA 2V53A 1DF0A 1XFYO 1BT6A 4MSPA 4GGFC 5ER4X 3MSEB 4JQ0D 5CSIA 1F55A 1EG3A 1AJ4A 2H61A 3GK1A 2F2OA 3PM8A 5D7FA 4BY5A 1F70A 2LMUA 2LP3A 1XO5A 2QPTA 1B1GA 2JWWA 5CSNA 4CLNA 1UURA 1YRTB 2EGDA 4PHNA 1KQMC 2OS8C 1WDCC 4IL1A 1SCMC 2I94A 5HKWA 1HQVA 4HRGA 3SIBA 2CXJA 4ZCVA 1QX2A 3JTDC 2LVIA 1IJ6A 2ZNEA 5I2LA 3HX4A 4PHKA 1H8BA 1ZACA 1NX3A 1TIZA 5HKZA 2KBIA 1D1OA 2ZRTA 1XK4C 1LXFC 1TNXA 2OPOA 1H4BA 1FF1A 3M0WA 3OX6A 3PFVA 1PK0D 2K0JA 2D8NA 3IQOA 4I5KA 3SJSA 3I5HB 2KYCA 2M8UA 2MRDA 2KBMA 1K2HA 4DRWA 1JFJA 1CM4A 3LLEA 3SG7A 3TDUA 1K9PA 2LM5A 1WLMA 3TZ1A 5F6TA 3EVUA 4I5LB 1ZUZA 3FS7A 2P6BB 1AHRA 1R2UA 4U8DA 1UP5A 2ISDA 1NCZA 4YGEB 1CFCA 1BLQA 1YRUB 1G8IA 1ALVA 1QIVA 3D10A 4MEWA 4PE7A 5FYXA 4CFQA 2Y1MA 3WHTB 4ORAB 3TS5C 1MQ1A 4YI9A 1PRWA 1SKTA 4GGFA 1AJ5A 3ZWHA 1NP8A 3PN7B 2Y4QA 1RWYA 1VRKA 2FJUB 2L2EA 3BUOB 2F3ZA 4DUQA 1JBAA 1NCXA 1G4YR 2WCBA 3SG6A 2MA2A 3PALA 1CB1A 1SCVA 2M0RA 3BYAA 1J7QA 3VRQA 4AOMA 1ZFSA 1DJWA 1JWDA 4NQGA 1Q80A 3CR5X 4PE0A 2ZRSA 2KFGA 1A75A 1KFXS 4P5OE 4OV2A 2JXCA 4GBAA 3O2PA 1KK8B 3SG4A 2LAPA 3OHMB 1K8UA 4MZLA 1XK4A 2IS9A 2Y1NA 3IF7A 1JSAA 1TRFA 1SBJA 2DOQA 2WCEA 1Y1XA 3EK8A 2HF5A 3SG3A 2OTGB 2JU0A 1NPQA 1RFJA 2K61A 2L4IA 3LCPC 2LHIA 4HSZA 4GUKA 4YGDB 2KSPA 2KI4C 2FCEA 4MVFA 2JTZA 4E68A 5AXIA 1DGVA 1PVAA 1J1EA 1G33A 1RJVA 4R1EA 1DMOA 1FBVA 1U5IB 2K2FA 1B7TY 1NSHA 1SNLA 1J7PA 2GGZA 5IBWA 1AVSA 4OCIA 4C0LA 2O60A 1TNWA 1M63B 4NDCA 3I5GC 2JT0A 4YI8A 1OMRA 3PATA 1NUBA 1E8AA 1UHJA 4AQIA 2M7LA 2CBLA 2LUXA 1MWNA 1TNPA 1DJXA 4XYNA 5D69A 4F0ZB 2MHHA 2JNFA 1ZMZA 2ZNDA 3NSIA 1KK7Y 2M49B 1NX0A 3PSRA 2KAXA 4GPLB 3FWCA 1BOCA 2LLTA 2LVVA 2M9GA 2L98A 3EK4A 1GJYA 3EKJA 3CLNA 3DVEA 2TN4A 1IH0A 1A4PA 1S1EA 1Y0VH 2L0PA 2LVJA 1QASA 3FIAA 3VGOA 3CGAA 2K8MB 2WORA 3LK0A 4GAOA 4ETOA 2LCPA 1BODA 1Y6WA 1F4OA 2MLFC 1IQ5A 3JVTB 1CNPA 1YR5A 2OTGC 1BG1A 5GQQC 1PSRA 2KAVA 5HLOA 1KSMA 1OMDA 1EXRA 2KGRA 1SW8A 2JZIA 1AUIB 1K9UA 2LC5A 5KSZA 4GNKB 3ICBA 2LLUA 2KYFA 4DS7A 4MN0A 1V1GA 3D0YA 1YX8A 2JQ6A 1B7TZ 3DF0B 4UPGA 2AUCA 2CNPA 4HREE 2NCPA 5PALA 4M2PA 1GQMA 1S26D 1EH2A 2F2PA 1QV0A 5I8NA 1CFPA 2BE4A 4YRUA 3H4SE 5B8IB 1CLLA 3ZNIA 1J1DA 4QJ4B 2BKHB 1EL4A 4OKHA 4YGAA 1NX2A 1PULA 4ICBA 1XFVO 2LMVA 3A8RA 1M39A 4NDDA 4CIDA 3O78A 1YVLA 3KHEA 1RROA 1YUUA 1S36A 3NSLA 1NCYA 2Q91A 1L2OC 3BOWA 2L4HA 3A4UB 2G2BA 1BR4B 5KU1A 2JPTA 1KK7Z 2RGIA 3NSKA 1DF0B 1DJGA 2BL0B 4N1GA 1XA5A 2AMIA 1AP4A 1UHHA 1OMVA 1SYMA 1KQVA 1PVBA 2GGMA 2M3WA 1LA3A 4C0JA 1EJ3A 5I2QA 4ORBB 1TCOB 3EVRA 1DJZA 1LKJA 4JPZB 1SL7A 1CLMA 1DT7B 1B4CA 2BCAA 2SCPA 1L7ZA 1B9AA 1LVCD 3VRPA 1JC2A 1EG4A 1KWOB 2CTNA 4N5XA 1K94A 1MF8B 4C0KA 2LNKA 3CTNA 1XYDA 1M31A 5CPVA 1C7VA 1RK9A 1RTP1 2MJWB 2E6WA 1U5IA 1TTXA 3AKBA 1QX7A 4USLA 3F45A 3I5IB 1NX1A 3FWBA 2EC6B 3GOFA 1J55A 4MRYA 5JOLA 2LLSA 3OB1B 3QRXA 1BR1B 4XJKA 1SK6D 2HPSA 3EK7A 3I5HC 2LHLA 3O6BA 4YGBB 5AERA 1F71A 4AQJA 1ODBA 2KDHA 1XFWO 4CFRA 1WY9A 1ZOTB 4OR9B 1B47A 2K7BA 2KQ6A 2M1UA 4PALA 1B8RA 4A4CA 5TNCA 2JC2A 1SR6B 1UHNA 1B8LA 2KI6D 4N1FA 1LINA 2E30A 1TCFA 2L5XB 3TDIA 1IG5A 1IJ5A 2QACA 4ORCB 1M45A 4PDZA 1XFZO 1YUTA 1SPYA 4A4BA 5G08A 4DIRA 2BBMA 1A2XA 1QTXA 2JTTA 2LMTA 1K9KA 2PALA 1WRLA 1LA0A 2NCOA 1JFKA 1FW4A 2JOJA 1CDNA 1CFFA 2R2IA 3PN7C 2CT9A 1N0YA 3EVVA 3NSOA 1JF0A 3IQQA 2NXQA 1GGZA 3KF9A 1KQMB 1CDPA 1CM1A 1SCMB 1OOJA 1WDCB 2F33A 2M97A 4YBHB 1F8HA 2ZFDA 1S6CA 1CFDA 2L50A 1A75B 2F8PA 1IGVA 5DKRA 2MLEC 1SL8A 1XVJA 4I5NB 1A29A 2LANA 3VRRA 3RLZA 1UHIA 1A03A 2JXLA 3DF0A 5CSJA 1KK8C 1KFUL 3BQ3A 1N65A 1SMGA 2ZN8A 5KTYA 2M1KB 2JNXA 1B8CA 3HCMA 4QJ5B 4PCWA 2KAYA 3CS1A 1DVIA 1QXPA 1WRKA 4M2QA 3RM1A 1ALWA 2HQ8A 1XFUO 1MHOA 2KI6C 4YGCB 3WHUB 4GFTA 2VRGA 2I7AA 2KNEA 2F3YA 4MRXA 3SIAA 2PRUA 1V1FA 3BXKA 1QV1A 1S6JA 1UUSA 2GV5A 1YUSA 2CCMA 2BKIB 1QATA 2COLB 2Y5IA 3CR4X 1MXEA 1TN4A 4MLWA 3TS5B 1WLZA 5BPJA 5J3XA 1DJHA 1CDMA 4D1EA 5K89A 3WNXB 2PASA 2ZKMX 3OB2B 4ZCUA 1BF5A 4PHJA 4DCKA 3KO0A 2O5GA 1K96A 2K7DA 1CMFA 1S5GY 4TNCA 5HKYA 1IRJA 1QVIY 4MZJA 1W7IB 1TNQA 4WQ2A 2JULA 1YTZC 3TUYB 1CDLA 2JT3A 1OZOA 5AFPA 1KCYA 1W7JB 1BMOA 2K2AA 2B1UA 1K95A 3LK1A 1BU3A 1KFUS 1KFXL 3KEVA 2I2RE 5ER5A
chains in the Genus database with same CATH superfamily
3CZ2A 1DJIA 3PLFB 3I5FB 1OZSA 4JWQA 2AAOA 3DVKA 4CPVA 2FCDA 2K7CA 4FQTA 1NYAA 4MBEA 5DICA 1M46A 3BUNB 1CLBA 2BECA 2KHNA 3JVTC 3VB1A 1SL9A 2L51A 2I18A 3BUXB 3D74A 1OOGA 1DELA 2A4JA 2NZ0A 2KI4B 1JUOA 1SY9A 1SRAA 2K60A 3AKAA 1R6PA 2LP2A 1DTLA 1OQPA 3D0YB 1IQ3A 2HQWA 4FQOA 5JJGA 1K90D 1MR8A 1QLSA 1BJFA 4BY4A 1Z4HA 3SS5A 2KOTA 3OP0A 5AEQA 1UWOA 2JT8A 1TOPA 1QS7A 1AK8A 2M29A 3I5GB 2WCFA 1OE9B 1N2DA 1GGWA 1QIWA 2LV7A 3VRNA 1Y1UA 2WNDA 1S6IA 2WCKA 4P2YB 5FI6A 3DVJA 1DJYA 2SASA 2EHBA 1W9ZA 2ZN9A 3BOWB 2PMYA 4HRHA 4OVNF 5DKNA 2MBXA 1F54A 1S5GZ 3BUWB 3OX5A 1QVIZ 2FOTA 2JRFA 2H2KA 2WC6A 1JF2A 3TUYC 1OSAA 3DXLA 1FI5A 4Q04A 3BFHA 3GK4X 2BL0C 1QJTA 1NWDA 1YVHA 4PE1A 1PSBA 2KQYA 1J7RA 2WOSA 2KFHA 1J7OA 2G9BA 1MUXA 3VROA 3IVTA 1C7WA 1RECA 1X02A 3PM2A 3C1VA 3I5FC 2BCXA 4PHMA 4WRIA 2GTEA 1IIOA 2MAZA 1DGUA 2BBNA 1XFXO 2H61C 3CR2A 1Y1AA 2PSRA 3RZSA 5HKWA 2BCBA 1UHKA 2HETA 3CZTX 3D75A 4L9MA 5I94A 3CWGA 3WXAA 2K7OA 1FPWA 1GM0A 3FE9A 3TDZA 2OS8B 1PALA 1K93D 3B6XA 5HYDA 1KWOC 4M2OA 2WC8A 3AAJA 5I2OA 3SS4A 1HT9A 1Z2CB 3DVMA 3JTDB 1MXLC 2LE9B 3KPXA 3O4YA 4GGNA 1C07A 1WRZA 2M7NA 2KFFA 3I5IC 4NDBA 5DKQA 3SS3A 1T14A 4I5JA 2EC6C 4XJKB 3GK2A 1CTRA 3SG5A 1CKKA 3E3RA 4FTGA 2LUCA 3D78A 1IKUA 1YURA 4QJ3B 1S3PA 1F4QA 2Q4UA 1NIWA 4PE4A 1DEKA 1QLKA 1CMGA 1IWQA 3DD4A 3BUMB 1KSOA 2BE6A 3EKHA 3SG2A 1FI6A 2NLNA 1L2OB 3AAKA 1QX5B 2KGBC 4WQ3A 2PVBA 3K21A 3NXAA 3LL8B 4MZKA 1SR6C 3R1OA 1YX7A 2LVKA 5HLVA 5CSFA 2WCJA 5AANA 2V53A 1DF0A 1XFYO 1SSEB 1BT6A 4MSPA 4GGFC 5ER4X 3FE6A 2QEVA 3MSEB 4JQ0D 5CSIA 1F55A 1EG3A 1AJ4A 2H61A 3GK1A 2F2OA 3PM8A 5D7FA 4BY5A 1F70A 2LMUA 2LP3A 1XO5A 2QPTA 2WCMA 2JWWA 5CSNA 4CLNA 1UURA 1YRTB 2EGDA 4PHNA 1KQMC 2OS8C 1WDCC 3L4AA 1SCMC 2I94A 4IL1A 1HQVA 2H8VA 3UO9A 4HRGA 3SIBA 2CXJA 4ZCVA 1QX2A 3OBVA 3D76A 3DY9A 3JTDC 2LVIA 1IJ6A 2ZNEA 5I2LA 3HX4A 4PHKA 1H8BA 1ZACA 1NX3A 1TIZA 5HKZA 2KBIA 1D1OA 2ZRTA 1XK4C 1LXFC 1TNXA 2OPOA 4OZDA 1FF1A 3M0WA 3OX6A 3PFVA 1PK0D 1H4BA 2K0JA 2D8NA 3IQOA 4I5KA 3SJSA 3I5HB 2KYCA 2M8UA 2MRDA 2KBMA 1K2HA 4DRWA 1JFJA 4F7FA 1CM4A 3LLEA 3SG7A 3TDUA 1K9PA 2LM5A 1WLMA 3TZ1A 5F6TA 3EVUA 4I5LB 1ZUZA 3CZ1A 2P71A 3FS7A 2KLDA 2P6BB 1AHRA 1R2UA 4U8DA 2BNXA 1UP5A 2ISDA 1NCZA 4YGEB 1CFCA 1BLQA 1YRUB 1G8IA 1ALVA 1QIVA 3D10A 4MEWA 4PE7A 2L2CA 5FYXA 2Y1MA 4CFQA 3WHTB 4ORAB 3TS5C 1MQ1A 4YI9A 1PRWA 1SKTA 4GGFA 1AJ5A 1QWVA 3ZWHA 1NP8A 3PN7B 2Y4QA 2WCHA 1RWYA 1VRKA 2FJUB 2L2EA 4PT1A 3BUOB 2F3ZA 4DUQA 1JBAA 1NCXA 1G4YR 2WCBA 3SG6A 2MA2A 3PALA 1CB1A 1SCVA 2M0RA 3BYAA 3BJHA 1J7QA 3VRQA 4AOMA 1ZFSA 1DJWA 1JWDA 4NQGA 1Q80A 3CR5X 4PE0A 2ZRSA 2KFGA 3R1PA 2PQLA 1A75A 1KFXS 4P5OE 4OV2A 2JXCA 2P70A 2KPHA 1KK8B 2QEHA 3O2PA 2LAPA 4GBAA 3SG4A 5FI7A 3OHMB 1K8UA 1P28A 4MZLA 1XK4A 3D77A 2IS9A 2Y1NA 3IF7A 1JSAA 1TUJA 1TRFA 4KYNA 1SBJA 2DOQA 2WCEA 1Y1XA 3BFBA 3S0GA 3EK8A 2HF5A 3SG3A 2OTGB 2QEBA 2JU0A 1NPQA 1RFJA 2K61A 2L4IA 3LCPC 2LHIA 4HSZA 4GUKA 4YGDB 2KSPA 2KI4C 2FCEA 4MVFA 2JTZA 4E68A 5AXIA 1DGVA 1PVAA 1J1EA 1G33A 1RJVA 4R1EA 1DMOA 1FBVA 1U5IB 2K2FA 1B7TY 1NSHA 1SNLA 3R72A 1J7PA 2GGZA 5IBWA 1AVSA 4OCIA 4C0LA 2O60A 1TNWA 1M63B 4NDCA 3I5GC 2JT0A 4YI8A 1OMRA 3PJIA 3PATA 1NUBA 2ERBA 1E8AA 1UHJA 4AQIA 3R1VA 2CBLA 2LUXA 1MWNA 1TNPA 2M7LA 1DJXA 4XYNA 5D69A 4F0ZB 2MHHA 2JNFA 1ZMZA 3NHIA 2ZNDA 3NSIA 1KK7Y 2M49B 1NX0A 3PSRA 3K1EA 2KAXA 4GPLB 3FWCA 1BOCA 2LLTA 2LVVA 2M9GA 2L98A 3EK4A 1GJYA 1LS8A 1C3ZA 3EKJA 3CLNA 1OOFA 2TN4A 3DVEA 1A4PA 1S1EA 1Y0VH 2L0PA 3S0FA 3D73A 1IH0A 2LVJA 1QASA 3FIAA 3VGOA 3CGAA 2K8MB 4INXA 2WORA 3LK0A 4GAOA 4ETOA 2LCPA 3FE8A 1BODA 1Y6WA 1F4OA 2MLFC 1IQ5A 3B86A 3JVTB 1CNPA 1YR5A 2OTGC 1BG1A 5GQQC 1PSRA 2KAVA 5HLOA 1KSMA 1OMDA 1EXRA 2KGRA 1SW8A 2JZIA 1C3YA 1AUIB 1K9UA 2LC5A 3S0AA 3DYEA 5KSZA 4GNKB 1OW4A 3ICBA 2LLUA 2KYFA 4DS7A 4MN0A 1V1GA 3D0YA 3EG5B 1YX8A 2JQ6A 1B7TZ 3DF0B 4UPGA 2AUCA 2CNPA 4HREE 2NCPA 5PALA 4M2PA 1GQMA 3N7HA 1S26D 1EH2A 2F2PA 1QV0A 5I8NA 1CFPA 2BE4A 4YRUA 3H4SE 5B8IB 1CLLA 3ZNIA 1J1DA 4QJ4B 2BKHB 1EL4A 4OKHA 4YGAA 1NX2A 1PULA 4ICBA 1XFVO 2LMVA 3A8RA 1M39A 4NDDA 4CIDA 3O78A 1YVLA 3KHEA 1RROA 1YUUA 1S36A 3NSLA 1NCYA 2Q91A 1L2OC 3BOWA 2L4HA 3A4UB 2G2BA 1BR4B 2BAPA 5KU1A 2JPTA 1KK7Z 2RGIA 3NSKA 1DF0B 1DJGA 2BL0B 4N1GA 1XA5A 2AMIA 3B88A 1AP4A 2KLEA 1UHHA 5FI2A 1OMVA 1XFRA 4JD9A 1SYMA 1KQVA 1PVBA 2GGMA 3O4XA 2M3WA 1LA3A 4C0JA 3L4LA 1EJ3A 5I2QA 4ORBB 1TCOB 3EVRA 1DJZA 1LKJA 4JPZB 1SL7A 1CLMA 1DT7B 1B4CA 2BCAA 2SCPA 2PYQA 1L7ZA 1B9AA 1LVCD 4IJ7A 3VRPA 1JC2A 1EG4A 1KWOB 2CTNA 4N5XA 1K94A 1MF8B 4C0KA 1OOIX 2LNKA 3CTNA 1XYDA 1M31A 1TWOA 5CPVA 1C7VA 1RK9A 1RTP1 2MJWB 2E6WA 1U5IA 1TTXA 3AKBA 1QX7A 4USLA 3F45A 3I5IB 1NX1A 3FWBA 3DZTA 2QEOA 2EC6B 1TUZA 1J55A 3GOFA 4MRYA 5JOLA 2LLSA 3OB1B 3QRXA 1BR1B 4XJKA 1SK6D 2HPSA 3EK7A 3I5HC 2LHLA 3O6BA 4YGBB 5AERA 1F71A 1OOHA 1ODBA 4AQJA 2KDHA 2FJYA 3B87A 1XFWO 4CFRA 1WY9A 1ZOTB 4OR9B 1B47A 2K7BA 2KQ6A 2M1UA 4PALA 3CABA 1B8RA 5D3OA 4A4CA 5TNCA 2JC2A 1SR6B 1UHNA 1B8LA 2KI6D 4N1FA 1LINA 2E30A 1TCFA 2L5XB 3TDIA 1IG5A 1IJ5A 2QACA 4ORCB 1M45A 4PDZA 1XFZO 3QMEA 1YUTA 1SPYA 4A4BA 3NGVA 5G08A 4DIRA 2BBMA 1A2XA 1QTXA 2JTTA 2LMTA 1K9KA 2PALA 1WRLA 1LA0A 2NCOA 1JFKA 1FW4A 2JOJA 1CDNA 1CFFA 2R2IA 3PN7C 2CT9A 1N0YA 3EVVA 3NSOA 1JF0A 3IQQA 2NXQA 1GGZA 3KF9A 1KQMB 1CDPA 1CM1A 1SCMB 1OOJA 1WDCB 2F33A 2M97A 4YBHB 1F8HA 2ZFDA 1S6CA 1CFDA 2QDIA 2L50A 3Q8IA 3S0DA 2WC5A 1A75B 2F8PA 1IGVA 3CZ0A 5DKRA 2MLEC 1SL8A 1XVJA 4I5NB 1A29A 2LANA 3VRRA 3RLZA 1UHIA 1A03A 2JXLA 3DF0A 5CSJA 1KK8C 1KFUL 3BQ3A 1N65A 1SMGA 3V2LA 2ZN8A 5HL1A 5KTYA 2L5YA 2M1KB 2JNXA 3CDNA 1B8CA 3HCMA 4JKTA 4QJ5B 4PCWA 2KAYA 3CS1A 1DVIA 1QXPA 1WRKA 4M2QA 3RM1A 1B1GA 2WCLA 1ALWA 2HQ8A 1XFUO 1MHOA 2KI6C 4YGCB 3WHUB 4GFTA 2VRGA 2I7AA 2KNEA 2F3YA 4MRXA 5EL2A 3SIAA 2PRUA 1DC1A 1V1FA 3BXKA 1QV1A 1S6JA 1UUSA 3BFAA 2GV5A 3S0BA 1YUSA 2CCMA 2BKIB 3CYZA 1QATA 2COLB 2Y5IA 3CR4X 1MXEA 1TN4A 4MLWA 3NHTA 3TS5B 1WLZA 5BPJA 3B7AA 4INWA 5J3XA 1DJHA 1CDMA 2YGUA 4D1EA 5K89A 2JPOA 3WNXB 2PASA 3UNWA 2ZKMX 3OB2B 4ZCUA 1BF5A 4PHJA 3S0EA 3KO0A 2O5GA 1K96A 4DCKA 1DQEA 2K7DA 1CMFA 1S5GY 4TNCA 5HKYA 1IRJA 1QVIY 4MZJA 1ORGA 1W7IB 3OGNA 1TNQA 4WQ2A 2JULA 1YTZC 3TUYB 1CDLA 2JT3A 1OZOA 5AFPA 3L47A 1KCYA 1W7JB 1BMOA 2K2AA 2B1UA 1K95A 3LK1A 1BU3A 1KFUS 1KFXL 3KEVA 2I2RE 5ER5A
chains in the Genus database with same CATH topology
1DJIA 3PLFB 3I5FB 1OZSA 4JWQA 2AAOA 3DVKA 4CPVA 2FCDA 2K7CA 1NYAA 4MBEA 1M46A 3BUNB 1CLBA 2BECA 2KHNA 3JVTC 1SL9A 2L51A 2I18A 3BUXB 2NZ0A 2A4JA 2KI4B 1JUOA 1SY9A 1SRAA 3AKAA 1R6PA 2LP2A 1DTLA 1OQPA 3D0YB 1IQ3A 2HQWA 4FQOA 5JJGA 1K90D 1MR8A 1QLSA 1BJFA 4BY4A 2KOTA 3OP0A 5AEQA 1UWOA 2JT8A 1TOPA 1QS7A 1AK8A 2M29A 3I5GB 2WCFA 1OE9B 1N2DA 1GGWA 1QIWA 2LV7A 3VRNA 1Y1UA 2WNDA 1S6IA 4P2YB 3DVJA 1DJYA 2SASA 2EHBA 2ZN9A 3BOWB 4HRHA 2PMYA 4OVNF 5DKNA 2MBXA 1F54A 1S5GZ 3BUWB 3OX5A 1QVIZ 2FOTA 2JRFA 2H2KA 3TUYC 1JF2A 1OSAA 1FI5A 4Q04A 3GK4X 2BL0C 1QJTA 1NWDA 1YVHA 4PE1A 1PSBA 2KQYA 1J7RA 2WOSA 2KFHA 1J7OA 2G9BA 1MUXA 3VROA 1C7WA 1RECA 1X02A 3C1VA 3I5FC 2BCXA 4PHMA 4WRIA 2MAZA 1DGUA 2BBNA 1XFXO 2H61C 3CR2A 1Y1AA 2PSRA 2BCBA 1UHKA 2HETA 3CZTX 4L9MA 3CWGA 3WXAA 2K7OA 1FPWA 3TDZA 2OS8B 1PALA 1K93D 5HYDA 1KWOC 4M2OA 2WC8A 3AAJA 5I2OA 1HT9A 3DVMA 3JTDB 1MXLC 2LE9B 3KPXA 3O4YA 4GGNA 1C07A 1WRZA 2M7NA 2KFFA 3I5IC 4NDBA 5DKQA 4I5JA 2EC6C 4XJKB 3GK2A 1CTRA 3SG5A 1CKKA 3E3RA 4FTGA 2LUCA 1IKUA 1YURA 4QJ3B 1S3PA 1F4QA 2Q4UA 1NIWA 4PE4A 1QLKA 1CMGA 1IWQA 3DD4A 3BUMB 1KSOA 2BE6A 3EKHA 3SG2A 1FI6A 2NLNA 1L2OB 3AAKA 1QX5B 2KGBC 4WQ3A 2PVBA 3K21A 3NXAA 3LL8B 4MZKA 1SR6C 1YX7A 2LVKA 5HLVA 5CSFA 5AANA 2V53A 1DF0A 1XFYO 1BT6A 4MSPA 4GGFC 5ER4X 3MSEB 4JQ0D 5CSIA 1F55A 1EG3A 1AJ4A 2H61A 3GK1A 2F2OA 3PM8A 5D7FA 4BY5A 1F70A 2LMUA 2LP3A 1XO5A 2QPTA 1B1GA 2JWWA 5CSNA 4CLNA 1UURA 1YRTB 2EGDA 4PHNA 1KQMC 2OS8C 1WDCC 4IL1A 1SCMC 2I94A 5HKWA 1HQVA 4HRGA 3SIBA 2CXJA 4ZCVA 1QX2A 3JTDC 2LVIA 1IJ6A 2ZNEA 5I2LA 3HX4A 4PHKA 1H8BA 1ZACA 1NX3A 1TIZA 5HKZA 2KBIA 1D1OA 2ZRTA 1XK4C 1LXFC 1TNXA 2OPOA 1H4BA 1FF1A 3M0WA 3OX6A 3PFVA 1PK0D 2K0JA 2D8NA 3IQOA 4I5KA 3SJSA 3I5HB 2KYCA 2M8UA 2MRDA 2KBMA 1K2HA 4DRWA 1JFJA 1CM4A 3LLEA 3SG7A 3TDUA 1K9PA 2LM5A 1WLMA 3TZ1A 5F6TA 3EVUA 4I5LB 1ZUZA 3FS7A 2P6BB 1AHRA 1R2UA 4U8DA 1UP5A 2ISDA 1NCZA 4YGEB 1CFCA 1BLQA 1YRUB 1G8IA 1ALVA 1QIVA 3D10A 4MEWA 4PE7A 5FYXA 4CFQA 2Y1MA 3WHTB 4ORAB 3TS5C 1MQ1A 4YI9A 1PRWA 1SKTA 4GGFA 1AJ5A 3ZWHA 1NP8A 3PN7B 2Y4QA 1RWYA 1VRKA 2FJUB 2L2EA 3BUOB 2F3ZA 4DUQA 1JBAA 1NCXA 1G4YR 2WCBA 3SG6A 2MA2A 3PALA 1CB1A 1SCVA 2M0RA 3BYAA 1J7QA 3VRQA 4AOMA 1ZFSA 1DJWA 1JWDA 4NQGA 1Q80A 3CR5X 4PE0A 2ZRSA 2KFGA 1A75A 1KFXS 4P5OE 4OV2A 2JXCA 4GBAA 3O2PA 1KK8B 3SG4A 2LAPA 3OHMB 1K8UA 4MZLA 1XK4A 2IS9A 2Y1NA 3IF7A 1JSAA 1TRFA 1SBJA 2DOQA 2WCEA 1Y1XA 3EK8A 2HF5A 3SG3A 2OTGB 2JU0A 1NPQA 1RFJA 2K61A 2L4IA 3LCPC 2LHIA 4HSZA 4GUKA 4YGDB 2KSPA 2KI4C 2FCEA 4MVFA 2JTZA 4E68A 5AXIA 1DGVA 1PVAA 1J1EA 1G33A 1RJVA 4R1EA 1DMOA 1FBVA 1U5IB 2K2FA 1B7TY 1NSHA 1SNLA 1J7PA 2GGZA 5IBWA 1AVSA 4OCIA 4C0LA 2O60A 1TNWA 1M63B 4NDCA 3I5GC 2JT0A 4YI8A 1OMRA 3PATA 1NUBA 1E8AA 1UHJA 4AQIA 2M7LA 2CBLA 2LUXA 1MWNA 1TNPA 1DJXA 4XYNA 5D69A 4F0ZB 2MHHA 2JNFA 1ZMZA 2ZNDA 3NSIA 1KK7Y 2M49B 1NX0A 3PSRA 2KAXA 4GPLB 3FWCA 1BOCA 2LLTA 2LVVA 2M9GA 2L98A 3EK4A 1GJYA 3EKJA 3CLNA 3DVEA 2TN4A 1IH0A 1A4PA 1S1EA 1Y0VH 2L0PA 2LVJA 1QASA 3FIAA 3VGOA 3CGAA 2K8MB 2WORA 3LK0A 4GAOA 4ETOA 2LCPA 1BODA 1Y6WA 1F4OA 2MLFC 1IQ5A 3JVTB 1CNPA 1YR5A 2OTGC 1BG1A 5GQQC 1PSRA 2KAVA 5HLOA 1KSMA 1OMDA 1EXRA 2KGRA 1SW8A 2JZIA 1AUIB 1K9UA 2LC5A 5KSZA 4GNKB 3ICBA 2LLUA 2KYFA 4DS7A 4MN0A 1V1GA 3D0YA 1YX8A 2JQ6A 1B7TZ 3DF0B 4UPGA 2AUCA 2CNPA 4HREE 2NCPA 5PALA 4M2PA 1GQMA 1S26D 1EH2A 2F2PA 1QV0A 5I8NA 1CFPA 2BE4A 4YRUA 3H4SE 5B8IB 1CLLA 3ZNIA 1J1DA 4QJ4B 2BKHB 1EL4A 4OKHA 4YGAA 1NX2A 1PULA 4ICBA 1XFVO 2LMVA 3A8RA 1M39A 4NDDA 4CIDA 3O78A 1YVLA 3KHEA 1RROA 1YUUA 1S36A 3NSLA 1NCYA 2Q91A 1L2OC 3BOWA 2L4HA 3A4UB 2G2BA 1BR4B 5KU1A 2JPTA 1KK7Z 2RGIA 3NSKA 1DF0B 1DJGA 2BL0B 4N1GA 1XA5A 2AMIA 1AP4A 1UHHA 1OMVA 1SYMA 1KQVA 1PVBA 2GGMA 2M3WA 1LA3A 4C0JA 1EJ3A 5I2QA 4ORBB 1TCOB 3EVRA 1DJZA 1LKJA 4JPZB 1SL7A 1CLMA 1DT7B 1B4CA 2BCAA 2SCPA 1L7ZA 1B9AA 1LVCD 3VRPA 1JC2A 1EG4A 1KWOB 2CTNA 4N5XA 1K94A 1MF8B 4C0KA 2LNKA 3CTNA 1XYDA 1M31A 5CPVA 1C7VA 1RK9A 1RTP1 2MJWB 2E6WA 1U5IA 1TTXA 3AKBA 1QX7A 4USLA 3F45A 3I5IB 1NX1A 3FWBA 2EC6B 3GOFA 1J55A 4MRYA 5JOLA 2LLSA 3OB1B 3QRXA 1BR1B 4XJKA 1SK6D 2HPSA 3EK7A 3I5HC 2LHLA 3O6BA 4YGBB 5AERA 1F71A 4AQJA 1ODBA 2KDHA 1XFWO 4CFRA 1WY9A 1ZOTB 4OR9B 1B47A 2K7BA 2KQ6A 2M1UA 4PALA 1B8RA 4A4CA 5TNCA 2JC2A 1SR6B 1UHNA 1B8LA 2KI6D 4N1FA 1LINA 2E30A 1TCFA 2L5XB 3TDIA 1IG5A 1IJ5A 2QACA 4ORCB 1M45A 4PDZA 1XFZO 1YUTA 1SPYA 4A4BA 5G08A 4DIRA 2BBMA 1A2XA 1QTXA 2JTTA 2LMTA 1K9KA 2PALA 1WRLA 1LA0A 2NCOA 1JFKA 1FW4A 2JOJA 1CDNA 1CFFA 2R2IA 3PN7C 2CT9A 1N0YA 3EVVA 3NSOA 1JF0A 3IQQA 2NXQA 1GGZA 3KF9A 1KQMB 1CDPA 1CM1A 1SCMB 1OOJA 1WDCB 2F33A 2M97A 4YBHB 1F8HA 2ZFDA 1S6CA 1CFDA 2L50A 1A75B 2F8PA 1IGVA 5DKRA 2MLEC 1SL8A 1XVJA 4I5NB 1A29A 2LANA 3VRRA 3RLZA 1UHIA 1A03A 2JXLA 3DF0A 5CSJA 1KK8C 1KFUL 3BQ3A 1N65A 1SMGA 2ZN8A 5KTYA 2M1KB 2JNXA 1B8CA 3HCMA 4QJ5B 4PCWA 2KAYA 3CS1A 1DVIA 1QXPA 1WRKA 4M2QA 3RM1A 1ALWA 2HQ8A 1XFUO 1MHOA 2KI6C 4YGCB 3WHUB 4GFTA 2VRGA 2I7AA 2KNEA 2F3YA 4MRXA 3SIAA 2PRUA 1V1FA 3BXKA 1QV1A 1S6JA 1UUSA 2GV5A 1YUSA 2CCMA 2BKIB 1QATA 2COLB 2Y5IA 3CR4X 1MXEA 1TN4A 4MLWA 3TS5B 1WLZA 5BPJA 5J3XA 1DJHA 1CDMA 4D1EA 5K89A 3WNXB 2PASA 2ZKMX 3OB2B 4ZCUA 1BF5A 4PHJA 4DCKA 3KO0A 2O5GA 1K96A 2K7DA 1CMFA 1S5GY 4TNCA 5HKYA 1IRJA 1QVIY 4MZJA 1W7IB 1TNQA 4WQ2A 2JULA 1YTZC 3TUYB 1CDLA 2JT3A 1OZOA 5AFPA 1KCYA 1W7JB 1BMOA 2K2AA 2B1UA 1K95A 3LK1A 1BU3A 1KFUS 1KFXL 3KEVA 2I2RE 5ER5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  3PLF B;  3I5F B;  1OZS A;  4JWQ A;  2AAO A;  3DVK A;  4CPV A;  2FCD A;  2K7C A;  1NYA A;  4MBE A;  1M46 A;  3BUN B;  1CLB A;  2BEC A;  2KHN A;  3JVT C;  1SL9 A;  2L51 A;  2I18 A;  3BUX B;  2NZ0 A;  2A4J A;  2KI4 B;  1JUO A;  1SY9 A;  1SRA A;  3AKA A;  1R6P A;  2LP2 A;  1DTL A;  1OQP A;  3D0Y B;  1IQ3 A;  2HQW A;  4FQO A;  5JJG A;  1K90 D;  1MR8 A;  1QLS A;  1BJF A;  4BY4 A;  2KOT A;  3OP0 A;  5AEQ A;  1UWO A;  2JT8 A;  1TOP A;  1QS7 A;  1AK8 A;  2M29 A;  3I5G B;  2WCF A;  1OE9 B;  1N2D A;  1GGW A;  1QIW A;  2LV7 A;  3VRN A;  1Y1U A;  2WND A;  1S6I A;  4P2Y B;  3DVJ A;  1DJY A;  2SAS A;  2EHB A;  2ZN9 A;  3BOW B;  4HRH A;  2PMY A;  4OVN F;  5DKN A;  2MBX A;  1F54 A;  1S5G Z;  3BUW B;  3OX5 A;  1QVI Z;  2FOT A;  2JRF A;  2H2K A;  3TUY C;  1JF2 A;  1OSA A;  1FI5 A;  4Q04 A;  3GK4 X;  2BL0 C;  1QJT A;  1NWD A;  1YVH A;  4PE1 A;  1PSB A;  2KQY A;  1J7R A;  2WOS A;  2KFH A;  1J7O A;  2G9B A;  1MUX A;  3VRO A;  1C7W A;  1REC A;  1X02 A;  3C1V A;  3I5F C;  2BCX A;  4PHM A;  4WRI A;  2MAZ A;  1DGU A;  2BBN A;  1XFX O;  2H61 C;  3CR2 A;  1Y1A A;  2PSR A;  2BCB A;  1UHK A;  2HET A;  3CZT X;  4L9M A;  3CWG A;  3WXA A;  2K7O A;  1FPW A;  3TDZ A;  2OS8 B;  1PAL A;  1K93 D;  5HYD A;  1KWO C;  4M2O A;  2WC8 A;  3AAJ A;  5I2O A;  1HT9 A;  3DVM A;  3JTD B;  1MXL C;  2LE9 B;  3KPX A;  3O4Y A;  4GGN A;  1C07 A;  1WRZ A;  2M7N A;  2KFF A;  3I5I C;  4NDB A;  5DKQ A;  4I5J A;  2EC6 C;  4XJK B;  3GK2 A;  1CTR A;  3SG5 A;  1CKK A;  3E3R A;  4FTG A;  2LUC A;  1IKU A;  1YUR A;  4QJ3 B;  1S3P A;  1F4Q A;  2Q4U A;  1NIW A;  4PE4 A;  1QLK A;  1CMG A;  1IWQ A;  3DD4 A;  3BUM B;  1KSO A;  2BE6 A;  3EKH A;  3SG2 A;  1FI6 A;  2NLN A;  1L2O B;  3AAK A;  1QX5 B;  2KGB C;  4WQ3 A;  2PVB A;  3K21 A;  3NXA A;  3LL8 B;  4MZK A;  1SR6 C;  1YX7 A;  2LVK A;  5HLV A;  5CSF A;  5AAN A;  2V53 A;  1DF0 A;  1XFY O;  1BT6 A;  4MSP A;  4GGF C;  5ER4 X;  3MSE B;  4JQ0 D;  5CSI A;  1F55 A;  1EG3 A;  1AJ4 A;  2H61 A;  3GK1 A;  2F2O A;  3PM8 A;  5D7F A;  4BY5 A;  1F70 A;  2LMU A;  2LP3 A;  1XO5 A;  2QPT A;  1B1G A;  2JWW A;  5CSN A;  4CLN A;  1UUR A;  1YRT B;  2EGD A;  4PHN A;  1KQM C;  2OS8 C;  1WDC C;  4IL1 A;  1SCM C;  2I94 A;  5HKW A;  1HQV A;  4HRG A;  3SIB A;  2CXJ A;  4ZCV A;  1QX2 A;  3JTD C;  2LVI A;  1IJ6 A;  2ZNE A;  5I2L A;  3HX4 A;  4PHK A;  1H8B A;  1ZAC A;  1NX3 A;  1TIZ A;  5HKZ A;  2KBI A;  1D1O A;  2ZRT A;  1XK4 C;  1LXF C;  1TNX A;  2OPO A;  1H4B A;  1FF1 A;  3M0W A;  3OX6 A;  3PFV A;  1PK0 D;  2K0J A;  2D8N A;  3IQO A;  4I5K A;  3SJS A;  3I5H B;  2KYC A;  2M8U A;  2MRD A;  2KBM A;  1K2H A;  4DRW A;  1JFJ A;  1CM4 A;  3LLE A;  3SG7 A;  3TDU A;  1K9P A;  2LM5 A;  1WLM A;  3TZ1 A;  5F6T A;  3EVU A;  4I5L B;  1ZUZ A;  3FS7 A;  2P6B B;  1AHR A;  1R2U A;  4U8D A;  1UP5 A;  2ISD A;  1NCZ A;  4YGE B;  1CFC A;  1BLQ A;  1YRU B;  1G8I A;  1ALV A;  1QIV A;  3D10 A;  4MEW A;  4PE7 A;  5FYX A;  4CFQ A;  2Y1M A;  3WHT B;  4ORA B;  3TS5 C;  1MQ1 A;  4YI9 A;  1PRW A;  1SKT A;  4GGF A;  1AJ5 A;  3ZWH A;  1NP8 A;  3PN7 B;  2Y4Q A;  1RWY A;  1VRK A;  2FJU B;  2L2E A;  3BUO B;  2F3Z A;  4DUQ A;  1JBA A;  1NCX A;  1G4Y R;  2WCB A;  3SG6 A;  2MA2 A;  3PAL A;  1CB1 A;  1SCV A;  2M0R A;  3BYA A;  1J7Q A;  3VRQ A;  4AOM A;  1ZFS A;  1DJW A;  1JWD A;  4NQG A;  1Q80 A;  3CR5 X;  4PE0 A;  2ZRS A;  2KFG A;  1A75 A;  1KFX S;  4P5O E;  4OV2 A;  2JXC A;  4GBA A;  3O2P A;  1KK8 B;  3SG4 A;  2LAP A;  3OHM B;  1K8U A;  4MZL A;  1XK4 A;  2IS9 A;  2Y1N A;  3IF7 A;  1JSA A;  1TRF A;  1SBJ A;  2DOQ A;  2WCE A;  1Y1X A;  3EK8 A;  2HF5 A;  3SG3 A;  2OTG B;  2JU0 A;  1NPQ A;  1RFJ A;  2K61 A;  2L4I A;  3LCP C;  2LHI A;  4HSZ A;  4GUK A;  4YGD B;  2KSP A;  2KI4 C;  2FCE A;  4MVF A;  2JTZ A;  4E68 A;  5AXI A;  1DGV A;  1PVA A;  1J1E A;  1G33 A;  1RJV A;  4R1E A;  1DMO A;  1FBV A;  1U5I B;  2K2F A;  1B7T Y;  1NSH A;  1SNL A;  1J7P A;  2GGZ A;  5IBW A;  1AVS A;  4OCI A;  4C0L A;  2O60 A;  1TNW A;  1M63 B;  4NDC A;  3I5G C;  2JT0 A;  4YI8 A;  1OMR A;  3PAT A;  1NUB A;  1E8A A;  1UHJ A;  4AQI A;  2M7L A;  2CBL A;  2LUX A;  1MWN A;  1TNP A;  1DJX A;  4XYN A;  5D69 A;  4F0Z B;  2MHH A;  2JNF A;  1ZMZ A;  2ZND A;  3NSI A;  1KK7 Y;  2M49 B;  1NX0 A;  3PSR A;  2KAX A;  4GPL B;  3FWC A;  1BOC A;  2LLT A;  2LVV A;  2M9G A;  2L98 A;  3EK4 A;  1GJY A;  3EKJ A;  3CLN A;  3DVE A;  2TN4 A;  1IH0 A;  1A4P A;  1S1E A;  1Y0V H;  2L0P A;  2LVJ A;  1QAS A;  3FIA A;  3VGO A;  3CGA A;  2K8M B;  2WOR A;  3LK0 A;  4GAO A;  4ETO A;  2LCP A;  1BOD A;  1Y6W A;  1F4O A;  2MLF C;  1IQ5 A;  3JVT B;  1CNP A;  1YR5 A;  2OTG C;  1BG1 A;  5GQQ C;  1PSR A;  2KAV A;  5HLO A;  1KSM A;  1OMD A;  1EXR A;  2KGR A;  1SW8 A;  2JZI A;  1AUI B;  1K9U A;  2LC5 A;  5KSZ A;  4GNK B;  3ICB A;  2LLU A;  2KYF A;  4DS7 A;  4MN0 A;  1V1G A;  3D0Y A;  1YX8 A;  2JQ6 A;  1B7T Z;  3DF0 B;  4UPG A;  2AUC A;  2CNP A;  4HRE E;  2NCP A;  5PAL A;  4M2P A;  1GQM A;  1S26 D;  1EH2 A;  2F2P A;  1QV0 A;  5I8N A;  1CFP A;  2BE4 A;  4YRU A;  3H4S E;  5B8I B;  1CLL A;  3ZNI A;  1J1D A;  4QJ4 B;  2BKH B;  1EL4 A;  4OKH A;  4YGA A;  1NX2 A;  1PUL A;  4ICB A;  1XFV O;  2LMV A;  3A8R A;  1M39 A;  4NDD A;  4CID A;  3O78 A;  1YVL A;  3KHE A;  1RRO A;  1YUU A;  1S36 A;  3NSL A;  1NCY A;  2Q91 A;  1L2O C;  3BOW A;  2L4H A;  3A4U B;  2G2B A;  1BR4 B;  5KU1 A;  2JPT A;  1KK7 Z;  2RGI A;  3NSK A;  1DF0 B;  1DJG A;  2BL0 B;  4N1G A;  1XA5 A;  2AMI A;  1AP4 A;  1UHH A;  1OMV A;  1SYM A;  1KQV A;  1PVB A;  2GGM A;  2M3W A;  1LA3 A;  4C0J A;  1EJ3 A;  5I2Q A;  4ORB B;  1TCO B;  3EVR A;  1DJZ A;  1LKJ A;  4JPZ B;  1SL7 A;  1CLM A;  1DT7 B;  1B4C A;  2BCA A;  2SCP A;  1L7Z A;  1B9A A;  1LVC D;  3VRP A;  1JC2 A;  1EG4 A;  1KWO B;  2CTN A;  4N5X A;  1K94 A;  1MF8 B;  4C0K A;  2LNK A;  3CTN A;  1XYD A;  1M31 A;  5CPV A;  1C7V A;  1RK9 A;  1RTP 1;  2MJW B;  2E6W A;  1U5I A;  1TTX A;  3AKB A;  1QX7 A;  4USL A;  3F45 A;  3I5I B;  1NX1 A;  3FWB A;  2EC6 B;  3GOF A;  1J55 A;  4MRY A;  5JOL A;  2LLS A;  3OB1 B;  3QRX A;  1BR1 B;  4XJK A;  1SK6 D;  2HPS A;  3EK7 A;  3I5H C;  2LHL A;  3O6B A;  4YGB B;  5AER A;  1F71 A;  4AQJ A;  1ODB A;  2KDH A;  1XFW O;  4CFR A;  1WY9 A;  1ZOT B;  4OR9 B;  1B47 A;  2K7B A;  2KQ6 A;  2M1U A;  4PAL A;  1B8R A;  4A4C A;  5TNC A;  2JC2 A;  1SR6 B;  1UHN A;  1B8L A;  2KI6 D;  4N1F A;  1LIN A;  2E30 A;  1TCF A;  2L5X B;  3TDI A;  1IG5 A;  1IJ5 A;  2QAC A;  4ORC B;  1M45 A;  4PDZ A;  1XFZ O;  1YUT A;  1SPY A;  4A4B A;  5G08 A;  4DIR A;  2BBM A;  1A2X A;  1QTX A;  2JTT A;  2LMT A;  1K9K A;  2PAL A;  1WRL A;  1LA0 A;  2NCO A;  1JFK A;  1FW4 A;  2JOJ A;  1CDN A;  1CFF A;  2R2I A;  3PN7 C;  2CT9 A;  1N0Y A;  3EVV A;  3NSO A;  1JF0 A;  3IQQ A;  2NXQ A;  1GGZ A;  3KF9 A;  1KQM B;  1CDP A;  1CM1 A;  1SCM B;  1OOJ A;  1WDC B;  2F33 A;  2M97 A;  4YBH B;  1F8H A;  2ZFD A;  1S6C A;  1CFD A;  2L50 A;  1A75 B;  2F8P A;  1IGV A;  5DKR A;  2MLE C;  1SL8 A;  1XVJ A;  4I5N B;  1A29 A;  2LAN A;  3VRR A;  3RLZ A;  1UHI A;  1A03 A;  2JXL A;  3DF0 A;  5CSJ A;  1KK8 C;  1KFU L;  3BQ3 A;  1N65 A;  1SMG A;  2ZN8 A;  5KTY A;  2M1K B;  2JNX A;  1B8C A;  3HCM A;  4QJ5 B;  4PCW A;  2KAY A;  3CS1 A;  1DVI A;  1QXP A;  1WRK A;  4M2Q A;  3RM1 A;  1ALW A;  2HQ8 A;  1XFU O;  1MHO A;  2KI6 C;  4YGC B;  3WHU B;  4GFT A;  2VRG A;  2I7A A;  2KNE A;  2F3Y A;  4MRX A;  3SIA A;  2PRU A;  1V1F A;  3BXK A;  1QV1 A;  1S6J A;  1UUS A;  2GV5 A;  1YUS A;  2CCM A;  2BKI B;  1QAT A;  2COL B;  2Y5I A;  3CR4 X;  1MXE A;  1TN4 A;  4MLW A;  3TS5 B;  1WLZ A;  5BPJ A;  5J3X A;  1DJH A;  1CDM A;  4D1E A;  5K89 A;  3WNX B;  2PAS A;  2ZKM X;  3OB2 B;  4ZCU A;  1BF5 A;  4PHJ A;  4DCK A;  3KO0 A;  2O5G A;  1K96 A;  2K7D A;  1CMF A;  1S5G Y;  4TNC A;  5HKY A;  1IRJ A;  1QVI Y;  4MZJ A;  1W7I B;  1TNQ A;  4WQ2 A;  2JUL A;  1YTZ C;  3TUY B;  1CDL A;  2JT3 A;  1OZO A;  5AFP A;  1KCY A;  1W7J B;  1BMO A;  2K2A A;  2B1U A;  1K95 A;  3LK1 A;  1BU3 A;  1KFU S;  1KFX L;  3KEV A;  2I2R E;  5ER5 A; 
#chains in the Genus database with same CATH topology
 3CZ2 A;  1DJI A;  3PLF B;  3I5F B;  1OZS A;  4JWQ A;  2AAO A;  3DVK A;  4CPV A;  2FCD A;  2K7C A;  4FQT A;  1NYA A;  4MBE A;  5DIC A;  1M46 A;  3BUN B;  1CLB A;  2BEC A;  2KHN A;  3JVT C;  3VB1 A;  1SL9 A;  2L51 A;  2I18 A;  3BUX B;  3D74 A;  1OOG A;  1DEL A;  2A4J A;  2NZ0 A;  2KI4 B;  1JUO A;  1SY9 A;  1SRA A;  2K60 A;  3AKA A;  1R6P A;  2LP2 A;  1DTL A;  1OQP A;  3D0Y B;  1IQ3 A;  2HQW A;  4FQO A;  5JJG A;  1K90 D;  1MR8 A;  1QLS A;  1BJF A;  4BY4 A;  1Z4H A;  3SS5 A;  2KOT A;  3OP0 A;  5AEQ A;  1UWO A;  2JT8 A;  1TOP A;  1QS7 A;  1AK8 A;  2M29 A;  3I5G B;  2WCF A;  1OE9 B;  1N2D A;  1GGW A;  1QIW A;  2LV7 A;  3VRN A;  1Y1U A;  2WND A;  1S6I A;  2WCK A;  4P2Y B;  5FI6 A;  3DVJ A;  1DJY A;  2SAS A;  2EHB A;  1W9Z A;  2ZN9 A;  3BOW B;  2PMY A;  4HRH A;  4OVN F;  5DKN A;  2MBX A;  1F54 A;  1S5G Z;  3BUW B;  3OX5 A;  1QVI Z;  2FOT A;  2JRF A;  2H2K A;  2WC6 A;  1JF2 A;  3TUY C;  1OSA A;  3DXL A;  1FI5 A;  4Q04 A;  3BFH A;  3GK4 X;  2BL0 C;  1QJT A;  1NWD A;  1YVH A;  4PE1 A;  1PSB A;  2KQY A;  1J7R A;  2WOS A;  2KFH A;  1J7O A;  2G9B A;  1MUX A;  3VRO A;  3IVT A;  1C7W A;  1REC A;  1X02 A;  3PM2 A;  3C1V A;  3I5F C;  2BCX A;  4PHM A;  4WRI A;  2GTE A;  1IIO A;  2MAZ A;  1DGU A;  2BBN A;  1XFX O;  2H61 C;  3CR2 A;  1Y1A A;  2PSR A;  3RZS A;  5HKW A;  2BCB A;  1UHK A;  2HET A;  3CZT X;  3D75 A;  4L9M A;  5I94 A;  3CWG A;  3WXA A;  2K7O A;  1FPW A;  1GM0 A;  3FE9 A;  3TDZ A;  2OS8 B;  1PAL A;  1K93 D;  3B6X A;  5HYD A;  1KWO C;  4M2O A;  2WC8 A;  3AAJ A;  5I2O A;  3SS4 A;  1HT9 A;  1Z2C B;  3DVM A;  3JTD B;  1MXL C;  2LE9 B;  3KPX A;  3O4Y A;  4GGN A;  1C07 A;  1WRZ A;  2M7N A;  2KFF A;  3I5I C;  4NDB A;  5DKQ A;  3SS3 A;  1T14 A;  4I5J A;  2EC6 C;  4XJK B;  3GK2 A;  1CTR A;  3SG5 A;  1CKK A;  3E3R A;  4FTG A;  2LUC A;  3D78 A;  1IKU A;  1YUR A;  4QJ3 B;  1S3P A;  1F4Q A;  2Q4U A;  1NIW A;  4PE4 A;  1DEK A;  1QLK A;  1CMG A;  1IWQ A;  3DD4 A;  3BUM B;  1KSO A;  2BE6 A;  3EKH A;  3SG2 A;  1FI6 A;  2NLN A;  1L2O B;  3AAK A;  1QX5 B;  2KGB C;  4WQ3 A;  2PVB A;  3K21 A;  3NXA A;  3LL8 B;  4MZK A;  1SR6 C;  3R1O A;  1YX7 A;  2LVK A;  5HLV A;  5CSF A;  2WCJ A;  5AAN A;  2V53 A;  1DF0 A;  1XFY O;  1SSE B;  1BT6 A;  4MSP A;  4GGF C;  5ER4 X;  3FE6 A;  2QEV A;  3MSE B;  4JQ0 D;  5CSI A;  1F55 A;  1EG3 A;  1AJ4 A;  2H61 A;  3GK1 A;  2F2O A;  3PM8 A;  5D7F A;  4BY5 A;  1F70 A;  2LMU A;  2LP3 A;  1XO5 A;  2QPT A;  2WCM A;  2JWW A;  5CSN A;  4CLN A;  1UUR A;  1YRT B;  2EGD A;  4PHN A;  1KQM C;  2OS8 C;  1WDC C;  3L4A A;  1SCM C;  2I94 A;  4IL1 A;  1HQV A;  2H8V A;  3UO9 A;  4HRG A;  3SIB A;  2CXJ A;  4ZCV A;  1QX2 A;  3OBV A;  3D76 A;  3DY9 A;  3JTD C;  2LVI A;  1IJ6 A;  2ZNE A;  5I2L A;  3HX4 A;  4PHK A;  1H8B A;  1ZAC A;  1NX3 A;  1TIZ A;  5HKZ A;  2KBI A;  1D1O A;  2ZRT A;  1XK4 C;  1LXF C;  1TNX A;  2OPO A;  4OZD A;  1FF1 A;  3M0W A;  3OX6 A;  3PFV A;  1PK0 D;  1H4B A;  2K0J A;  2D8N A;  3IQO A;  4I5K A;  3SJS A;  3I5H B;  2KYC A;  2M8U A;  2MRD A;  2KBM A;  1K2H A;  4DRW A;  1JFJ A;  4F7F A;  1CM4 A;  3LLE A;  3SG7 A;  3TDU A;  1K9P A;  2LM5 A;  1WLM A;  3TZ1 A;  5F6T A;  3EVU A;  4I5L B;  1ZUZ A;  3CZ1 A;  2P71 A;  3FS7 A;  2KLD A;  2P6B B;  1AHR A;  1R2U A;  4U8D A;  2BNX A;  1UP5 A;  2ISD A;  1NCZ A;  4YGE B;  1CFC A;  1BLQ A;  1YRU B;  1G8I A;  1ALV A;  1QIV A;  3D10 A;  4MEW A;  4PE7 A;  2L2C A;  5FYX A;  2Y1M A;  4CFQ A;  3WHT B;  4ORA B;  3TS5 C;  1MQ1 A;  4YI9 A;  1PRW A;  1SKT A;  4GGF A;  1AJ5 A;  1QWV A;  3ZWH A;  1NP8 A;  3PN7 B;  2Y4Q A;  2WCH A;  1RWY A;  1VRK A;  2FJU B;  2L2E A;  4PT1 A;  3BUO B;  2F3Z A;  4DUQ A;  1JBA A;  1NCX A;  1G4Y R;  2WCB A;  3SG6 A;  2MA2 A;  3PAL A;  1CB1 A;  1SCV A;  2M0R A;  3BYA A;  3BJH A;  1J7Q A;  3VRQ A;  4AOM A;  1ZFS A;  1DJW A;  1JWD A;  4NQG A;  1Q80 A;  3CR5 X;  4PE0 A;  2ZRS A;  2KFG A;  3R1P A;  2PQL A;  1A75 A;  1KFX S;  4P5O E;  4OV2 A;  2JXC A;  2P70 A;  2KPH A;  1KK8 B;  2QEH A;  3O2P A;  2LAP A;  4GBA A;  3SG4 A;  5FI7 A;  3OHM B;  1K8U A;  1P28 A;  4MZL A;  1XK4 A;  3D77 A;  2IS9 A;  2Y1N A;  3IF7 A;  1JSA A;  1TUJ A;  1TRF A;  4KYN A;  1SBJ A;  2DOQ A;  2WCE A;  1Y1X A;  3BFB A;  3S0G A;  3EK8 A;  2HF5 A;  3SG3 A;  2OTG B;  2QEB A;  2JU0 A;  1NPQ A;  1RFJ A;  2K61 A;  2L4I A;  3LCP C;  2LHI A;  4HSZ A;  4GUK A;  4YGD B;  2KSP A;  2KI4 C;  2FCE A;  4MVF A;  2JTZ A;  4E68 A;  5AXI A;  1DGV A;  1PVA A;  1J1E A;  1G33 A;  1RJV A;  4R1E A;  1DMO A;  1FBV A;  1U5I B;  2K2F A;  1B7T Y;  1NSH A;  1SNL A;  3R72 A;  1J7P A;  2GGZ A;  5IBW A;  1AVS A;  4OCI A;  4C0L A;  2O60 A;  1TNW A;  1M63 B;  4NDC A;  3I5G C;  2JT0 A;  4YI8 A;  1OMR A;  3PJI A;  3PAT A;  1NUB A;  2ERB A;  1E8A A;  1UHJ A;  4AQI A;  3R1V A;  2CBL A;  2LUX A;  1MWN A;  1TNP A;  2M7L A;  1DJX A;  4XYN A;  5D69 A;  4F0Z B;  2MHH A;  2JNF A;  1ZMZ A;  3NHI A;  2ZND A;  3NSI A;  1KK7 Y;  2M49 B;  1NX0 A;  3PSR A;  3K1E A;  2KAX A;  4GPL B;  3FWC A;  1BOC A;  2LLT A;  2LVV A;  2M9G A;  2L98 A;  3EK4 A;  1GJY A;  1LS8 A;  1C3Z A;  3EKJ A;  3CLN A;  1OOF A;  2TN4 A;  3DVE A;  1A4P A;  1S1E A;  1Y0V H;  2L0P A;  3S0F A;  3D73 A;  1IH0 A;  2LVJ A;  1QAS A;  3FIA A;  3VGO A;  3CGA A;  2K8M B;  4INX A;  2WOR A;  3LK0 A;  4GAO A;  4ETO A;  2LCP A;  3FE8 A;  1BOD A;  1Y6W A;  1F4O A;  2MLF C;  1IQ5 A;  3B86 A;  3JVT B;  1CNP A;  1YR5 A;  2OTG C;  1BG1 A;  5GQQ C;  1PSR A;  2KAV A;  5HLO A;  1KSM A;  1OMD A;  1EXR A;  2KGR A;  1SW8 A;  2JZI A;  1C3Y A;  1AUI B;  1K9U A;  2LC5 A;  3S0A A;  3DYE A;  5KSZ A;  4GNK B;  1OW4 A;  3ICB A;  2LLU A;  2KYF A;  4DS7 A;  4MN0 A;  1V1G A;  3D0Y A;  3EG5 B;  1YX8 A;  2JQ6 A;  1B7T Z;  3DF0 B;  4UPG A;  2AUC A;  2CNP A;  4HRE E;  2NCP A;  5PAL A;  4M2P A;  1GQM A;  3N7H A;  1S26 D;  1EH2 A;  2F2P A;  1QV0 A;  5I8N A;  1CFP A;  2BE4 A;  4YRU A;  3H4S E;  5B8I B;  1CLL A;  3ZNI A;  1J1D A;  4QJ4 B;  2BKH B;  1EL4 A;  4OKH A;  4YGA A;  1NX2 A;  1PUL A;  4ICB A;  1XFV O;  2LMV A;  3A8R A;  1M39 A;  4NDD A;  4CID A;  3O78 A;  1YVL A;  3KHE A;  1RRO A;  1YUU A;  1S36 A;  3NSL A;  1NCY A;  2Q91 A;  1L2O C;  3BOW A;  2L4H A;  3A4U B;  2G2B A;  1BR4 B;  2BAP A;  5KU1 A;  2JPT A;  1KK7 Z;  2RGI A;  3NSK A;  1DF0 B;  1DJG A;  2BL0 B;  4N1G A;  1XA5 A;  2AMI A;  3B88 A;  1AP4 A;  2KLE A;  1UHH A;  5FI2 A;  1OMV A;  1XFR A;  4JD9 A;  1SYM A;  1KQV A;  1PVB A;  2GGM A;  3O4X A;  2M3W A;  1LA3 A;  4C0J A;  3L4L A;  1EJ3 A;  5I2Q A;  4ORB B;  1TCO B;  3EVR A;  1DJZ A;  1LKJ A;  4JPZ B;  1SL7 A;  1CLM A;  1DT7 B;  1B4C A;  2BCA A;  2SCP A;  2PYQ A;  1L7Z A;  1B9A A;  1LVC D;  4IJ7 A;  3VRP A;  1JC2 A;  1EG4 A;  1KWO B;  2CTN A;  4N5X A;  1K94 A;  1MF8 B;  4C0K A;  1OOI X;  2LNK A;  3CTN A;  1XYD A;  1M31 A;  1TWO A;  5CPV A;  1C7V A;  1RK9 A;  1RTP 1;  2MJW B;  2E6W A;  1U5I A;  1TTX A;  3AKB A;  1QX7 A;  4USL A;  3F45 A;  3I5I B;  1NX1 A;  3FWB A;  3DZT A;  2QEO A;  2EC6 B;  1TUZ A;  1J55 A;  3GOF A;  4MRY A;  5JOL A;  2LLS A;  3OB1 B;  3QRX A;  1BR1 B;  4XJK A;  1SK6 D;  2HPS A;  3EK7 A;  3I5H C;  2LHL A;  3O6B A;  4YGB B;  5AER A;  1F71 A;  1OOH A;  1ODB A;  4AQJ A;  2KDH A;  2FJY A;  3B87 A;  1XFW O;  4CFR A;  1WY9 A;  1ZOT B;  4OR9 B;  1B47 A;  2K7B A;  2KQ6 A;  2M1U A;  4PAL A;  3CAB A;  1B8R A;  5D3O A;  4A4C A;  5TNC A;  2JC2 A;  1SR6 B;  1UHN A;  1B8L A;  2KI6 D;  4N1F A;  1LIN A;  2E30 A;  1TCF A;  2L5X B;  3TDI A;  1IG5 A;  1IJ5 A;  2QAC A;  4ORC B;  1M45 A;  4PDZ A;  1XFZ O;  3QME A;  1YUT A;  1SPY A;  4A4B A;  3NGV A;  5G08 A;  4DIR A;  2BBM A;  1A2X A;  1QTX A;  2JTT A;  2LMT A;  1K9K A;  2PAL A;  1WRL A;  1LA0 A;  2NCO A;  1JFK A;  1FW4 A;  2JOJ A;  1CDN A;  1CFF A;  2R2I A;  3PN7 C;  2CT9 A;  1N0Y A;  3EVV A;  3NSO A;  1JF0 A;  3IQQ A;  2NXQ A;  1GGZ A;  3KF9 A;  1KQM B;  1CDP A;  1CM1 A;  1SCM B;  1OOJ A;  1WDC B;  2F33 A;  2M97 A;  4YBH B;  1F8H A;  2ZFD A;  1S6C A;  1CFD A;  2QDI A;  2L50 A;  3Q8I A;  3S0D A;  2WC5 A;  1A75 B;  2F8P A;  1IGV A;  3CZ0 A;  5DKR A;  2MLE C;  1SL8 A;  1XVJ A;  4I5N B;  1A29 A;  2LAN A;  3VRR A;  3RLZ A;  1UHI A;  1A03 A;  2JXL A;  3DF0 A;  5CSJ A;  1KK8 C;  1KFU L;  3BQ3 A;  1N65 A;  1SMG A;  3V2L A;  2ZN8 A;  5HL1 A;  5KTY A;  2L5Y A;  2M1K B;  2JNX A;  3CDN A;  1B8C A;  3HCM A;  4JKT A;  4QJ5 B;  4PCW A;  2KAY A;  3CS1 A;  1DVI A;  1QXP A;  1WRK A;  4M2Q A;  3RM1 A;  1B1G A;  2WCL A;  1ALW A;  2HQ8 A;  1XFU O;  1MHO A;  2KI6 C;  4YGC B;  3WHU B;  4GFT A;  2VRG A;  2I7A A;  2KNE A;  2F3Y A;  4MRX A;  5EL2 A;  3SIA A;  2PRU A;  1DC1 A;  1V1F A;  3BXK A;  1QV1 A;  1S6J A;  1UUS A;  3BFA A;  2GV5 A;  3S0B A;  1YUS A;  2CCM A;  2BKI B;  3CYZ A;  1QAT A;  2COL B;  2Y5I A;  3CR4 X;  1MXE A;  1TN4 A;  4MLW A;  3NHT A;  3TS5 B;  1WLZ A;  5BPJ A;  3B7A A;  4INW A;  5J3X A;  1DJH A;  1CDM A;  2YGU A;  4D1E A;  5K89 A;  2JPO A;  3WNX B;  2PAS A;  3UNW A;  2ZKM X;  3OB2 B;  4ZCU A;  1BF5 A;  4PHJ A;  3S0E A;  3KO0 A;  2O5G A;  1K96 A;  4DCK A;  1DQE A;  2K7D A;  1CMF A;  1S5G Y;  4TNC A;  5HKY A;  1IRJ A;  1QVI Y;  4MZJ A;  1ORG A;  1W7I B;  3OGN A;  1TNQ A;  4WQ2 A;  2JUL A;  1YTZ C;  3TUY B;  1CDL A;  2JT3 A;  1OZO A;  5AFP A;  3L47 A;  1KCY A;  1W7J B;  1BMO A;  2K2A A;  2B1U A;  1K95 A;  3LK1 A;  1BU3 A;  1KFU S;  1KFX L;  3KEV A;  2I2R E;  5ER5 A; 
#chains in the Genus database with same CATH homology
 1DJI A;  3PLF B;  3I5F B;  1OZS A;  4JWQ A;  2AAO A;  3DVK A;  4CPV A;  2FCD A;  2K7C A;  1NYA A;  4MBE A;  1M46 A;  3BUN B;  1CLB A;  2BEC A;  2KHN A;  3JVT C;  1SL9 A;  2L51 A;  2I18 A;  3BUX B;  2NZ0 A;  2A4J A;  2KI4 B;  1JUO A;  1SY9 A;  1SRA A;  3AKA A;  1R6P A;  2LP2 A;  1DTL A;  1OQP A;  3D0Y B;  1IQ3 A;  2HQW A;  4FQO A;  5JJG A;  1K90 D;  1MR8 A;  1QLS A;  1BJF A;  4BY4 A;  2KOT A;  3OP0 A;  5AEQ A;  1UWO A;  2JT8 A;  1TOP A;  1QS7 A;  1AK8 A;  2M29 A;  3I5G B;  2WCF A;  1OE9 B;  1N2D A;  1GGW A;  1QIW A;  2LV7 A;  3VRN A;  1Y1U A;  2WND A;  1S6I A;  4P2Y B;  3DVJ A;  1DJY A;  2SAS A;  2EHB A;  2ZN9 A;  3BOW B;  4HRH A;  2PMY A;  4OVN F;  5DKN A;  2MBX A;  1F54 A;  1S5G Z;  3BUW B;  3OX5 A;  1QVI Z;  2FOT A;  2JRF A;  2H2K A;  3TUY C;  1JF2 A;  1OSA A;  1FI5 A;  4Q04 A;  3GK4 X;  2BL0 C;  1QJT A;  1NWD A;  1YVH A;  4PE1 A;  1PSB A;  2KQY A;  1J7R A;  2WOS A;  2KFH A;  1J7O A;  2G9B A;  1MUX A;  3VRO A;  1C7W A;  1REC A;  1X02 A;  3C1V A;  3I5F C;  2BCX A;  4PHM A;  4WRI A;  2MAZ A;  1DGU A;  2BBN A;  1XFX O;  2H61 C;  3CR2 A;  1Y1A A;  2PSR A;  2BCB A;  1UHK A;  2HET A;  3CZT X;  4L9M A;  3CWG A;  3WXA A;  2K7O A;  1FPW A;  3TDZ A;  2OS8 B;  1PAL A;  1K93 D;  5HYD A;  1KWO C;  4M2O A;  2WC8 A;  3AAJ A;  5I2O A;  1HT9 A;  3DVM A;  3JTD B;  1MXL C;  2LE9 B;  3KPX A;  3O4Y A;  4GGN A;  1C07 A;  1WRZ A;  2M7N A;  2KFF A;  3I5I C;  4NDB A;  5DKQ A;  4I5J A;  2EC6 C;  4XJK B;  3GK2 A;  1CTR A;  3SG5 A;  1CKK A;  3E3R A;  4FTG A;  2LUC A;  1IKU A;  1YUR A;  4QJ3 B;  1S3P A;  1F4Q A;  2Q4U A;  1NIW A;  4PE4 A;  1QLK A;  1CMG A;  1IWQ A;  3DD4 A;  3BUM B;  1KSO A;  2BE6 A;  3EKH A;  3SG2 A;  1FI6 A;  2NLN A;  1L2O B;  3AAK A;  1QX5 B;  2KGB C;  4WQ3 A;  2PVB A;  3K21 A;  3NXA A;  3LL8 B;  4MZK A;  1SR6 C;  1YX7 A;  2LVK A;  5HLV A;  5CSF A;  5AAN A;  2V53 A;  1DF0 A;  1XFY O;  1BT6 A;  4MSP A;  4GGF C;  5ER4 X;  3MSE B;  4JQ0 D;  5CSI A;  1F55 A;  1EG3 A;  1AJ4 A;  2H61 A;  3GK1 A;  2F2O A;  3PM8 A;  5D7F A;  4BY5 A;  1F70 A;  2LMU A;  2LP3 A;  1XO5 A;  2QPT A;  1B1G A;  2JWW A;  5CSN A;  4CLN A;  1UUR A;  1YRT B;  2EGD A;  4PHN A;  1KQM C;  2OS8 C;  1WDC C;  4IL1 A;  1SCM C;  2I94 A;  5HKW A;  1HQV A;  4HRG A;  3SIB A;  2CXJ A;  4ZCV A;  1QX2 A;  3JTD C;  2LVI A;  1IJ6 A;  2ZNE A;  5I2L A;  3HX4 A;  4PHK A;  1H8B A;  1ZAC A;  1NX3 A;  1TIZ A;  5HKZ A;  2KBI A;  1D1O A;  2ZRT A;  1XK4 C;  1LXF C;  1TNX A;  2OPO A;  1H4B A;  1FF1 A;  3M0W A;  3OX6 A;  3PFV A;  1PK0 D;  2K0J A;  2D8N A;  3IQO A;  4I5K A;  3SJS A;  3I5H B;  2KYC A;  2M8U A;  2MRD A;  2KBM A;  1K2H A;  4DRW A;  1JFJ A;  1CM4 A;  3LLE A;  3SG7 A;  3TDU A;  1K9P A;  2LM5 A;  1WLM A;  3TZ1 A;  5F6T A;  3EVU A;  4I5L B;  1ZUZ A;  3FS7 A;  2P6B B;  1AHR A;  1R2U A;  4U8D A;  1UP5 A;  2ISD A;  1NCZ A;  4YGE B;  1CFC A;  1BLQ A;  1YRU B;  1G8I A;  1ALV A;  1QIV A;  3D10 A;  4MEW A;  4PE7 A;  5FYX A;  4CFQ A;  2Y1M A;  3WHT B;  4ORA B;  3TS5 C;  1MQ1 A;  4YI9 A;  1PRW A;  1SKT A;  4GGF A;  1AJ5 A;  3ZWH A;  1NP8 A;  3PN7 B;  2Y4Q A;  1RWY A;  1VRK A;  2FJU B;  2L2E A;  3BUO B;  2F3Z A;  4DUQ A;  1JBA A;  1NCX A;  1G4Y R;  2WCB A;  3SG6 A;  2MA2 A;  3PAL A;  1CB1 A;  1SCV A;  2M0R A;  3BYA A;  1J7Q A;  3VRQ A;  4AOM A;  1ZFS A;  1DJW A;  1JWD A;  4NQG A;  1Q80 A;  3CR5 X;  4PE0 A;  2ZRS A;  2KFG A;  1A75 A;  1KFX S;  4P5O E;  4OV2 A;  2JXC A;  4GBA A;  3O2P A;  1KK8 B;  3SG4 A;  2LAP A;  3OHM B;  1K8U A;  4MZL A;  1XK4 A;  2IS9 A;  2Y1N A;  3IF7 A;  1JSA A;  1TRF A;  1SBJ A;  2DOQ A;  2WCE A;  1Y1X A;  3EK8 A;  2HF5 A;  3SG3 A;  2OTG B;  2JU0 A;  1NPQ A;  1RFJ A;  2K61 A;  2L4I A;  3LCP C;  2LHI A;  4HSZ A;  4GUK A;  4YGD B;  2KSP A;  2KI4 C;  2FCE A;  4MVF A;  2JTZ A;  4E68 A;  5AXI A;  1DGV A;  1PVA A;  1J1E A;  1G33 A;  1RJV A;  4R1E A;  1DMO A;  1FBV A;  1U5I B;  2K2F A;  1B7T Y;  1NSH A;  1SNL A;  1J7P A;  2GGZ A;  5IBW A;  1AVS A;  4OCI A;  4C0L A;  2O60 A;  1TNW A;  1M63 B;  4NDC A;  3I5G C;  2JT0 A;  4YI8 A;  1OMR A;  3PAT A;  1NUB A;  1E8A A;  1UHJ A;  4AQI A;  2M7L A;  2CBL A;  2LUX A;  1MWN A;  1TNP A;  1DJX A;  4XYN A;  5D69 A;  4F0Z B;  2MHH A;  2JNF A;  1ZMZ A;  2ZND A;  3NSI A;  1KK7 Y;  2M49 B;  1NX0 A;  3PSR A;  2KAX A;  4GPL B;  3FWC A;  1BOC A;  2LLT A;  2LVV A;  2M9G A;  2L98 A;  3EK4 A;  1GJY A;  3EKJ A;  3CLN A;  3DVE A;  2TN4 A;  1IH0 A;  1A4P A;  1S1E A;  1Y0V H;  2L0P A;  2LVJ A;  1QAS A;  3FIA A;  3VGO A;  3CGA A;  2K8M B;  2WOR A;  3LK0 A;  4GAO A;  4ETO A;  2LCP A;  1BOD A;  1Y6W A;  1F4O A;  2MLF C;  1IQ5 A;  3JVT B;  1CNP A;  1YR5 A;  2OTG C;  1BG1 A;  5GQQ C;  1PSR A;  2KAV A;  5HLO A;  1KSM A;  1OMD A;  1EXR A;  2KGR A;  1SW8 A;  2JZI A;  1AUI B;  1K9U A;  2LC5 A;  5KSZ A;  4GNK B;  3ICB A;  2LLU A;  2KYF A;  4DS7 A;  4MN0 A;  1V1G A;  3D0Y A;  1YX8 A;  2JQ6 A;  1B7T Z;  3DF0 B;  4UPG A;  2AUC A;  2CNP A;  4HRE E;  2NCP A;  5PAL A;  4M2P A;  1GQM A;  1S26 D;  1EH2 A;  2F2P A;  1QV0 A;  5I8N A;  1CFP A;  2BE4 A;  4YRU A;  3H4S E;  5B8I B;  1CLL A;  3ZNI A;  1J1D A;  4QJ4 B;  2BKH B;  1EL4 A;  4OKH A;  4YGA A;  1NX2 A;  1PUL A;  4ICB A;  1XFV O;  2LMV A;  3A8R A;  1M39 A;  4NDD A;  4CID A;  3O78 A;  1YVL A;  3KHE A;  1RRO A;  1YUU A;  1S36 A;  3NSL A;  1NCY A;  2Q91 A;  1L2O C;  3BOW A;  2L4H A;  3A4U B;  2G2B A;  1BR4 B;  5KU1 A;  2JPT A;  1KK7 Z;  2RGI A;  3NSK A;  1DF0 B;  1DJG A;  2BL0 B;  4N1G A;  1XA5 A;  2AMI A;  1AP4 A;  1UHH A;  1OMV A;  1SYM A;  1KQV A;  1PVB A;  2GGM A;  2M3W A;  1LA3 A;  4C0J A;  1EJ3 A;  5I2Q A;  4ORB B;  1TCO B;  3EVR A;  1DJZ A;  1LKJ A;  4JPZ B;  1SL7 A;  1CLM A;  1DT7 B;  1B4C A;  2BCA A;  2SCP A;  1L7Z A;  1B9A A;  1LVC D;  3VRP A;  1JC2 A;  1EG4 A;  1KWO B;  2CTN A;  4N5X A;  1K94 A;  1MF8 B;  4C0K A;  2LNK A;  3CTN A;  1XYD A;  1M31 A;  5CPV A;  1C7V A;  1RK9 A;  1RTP 1;  2MJW B;  2E6W A;  1U5I A;  1TTX A;  3AKB A;  1QX7 A;  4USL A;  3F45 A;  3I5I B;  1NX1 A;  3FWB A;  2EC6 B;  3GOF A;  1J55 A;  4MRY A;  5JOL A;  2LLS A;  3OB1 B;  3QRX A;  1BR1 B;  4XJK A;  1SK6 D;  2HPS A;  3EK7 A;  3I5H C;  2LHL A;  3O6B A;  4YGB B;  5AER A;  1F71 A;  4AQJ A;  1ODB A;  2KDH A;  1XFW O;  4CFR A;  1WY9 A;  1ZOT B;  4OR9 B;  1B47 A;  2K7B A;  2KQ6 A;  2M1U A;  4PAL A;  1B8R A;  4A4C A;  5TNC A;  2JC2 A;  1SR6 B;  1UHN A;  1B8L A;  2KI6 D;  4N1F A;  1LIN A;  2E30 A;  1TCF A;  2L5X B;  3TDI A;  1IG5 A;  1IJ5 A;  2QAC A;  4ORC B;  1M45 A;  4PDZ A;  1XFZ O;  1YUT A;  1SPY A;  4A4B A;  5G08 A;  4DIR A;  2BBM A;  1A2X A;  1QTX A;  2JTT A;  2LMT A;  1K9K A;  2PAL A;  1WRL A;  1LA0 A;  2NCO A;  1JFK A;  1FW4 A;  2JOJ A;  1CDN A;  1CFF A;  2R2I A;  3PN7 C;  2CT9 A;  1N0Y A;  3EVV A;  3NSO A;  1JF0 A;  3IQQ A;  2NXQ A;  1GGZ A;  3KF9 A;  1KQM B;  1CDP A;  1CM1 A;  1SCM B;  1OOJ A;  1WDC B;  2F33 A;  2M97 A;  4YBH B;  1F8H A;  2ZFD A;  1S6C A;  1CFD A;  2L50 A;  1A75 B;  2F8P A;  1IGV A;  5DKR A;  2MLE C;  1SL8 A;  1XVJ A;  4I5N B;  1A29 A;  2LAN A;  3VRR A;  3RLZ A;  1UHI A;  1A03 A;  2JXL A;  3DF0 A;  5CSJ A;  1KK8 C;  1KFU L;  3BQ3 A;  1N65 A;  1SMG A;  2ZN8 A;  5KTY A;  2M1K B;  2JNX A;  1B8C A;  3HCM A;  4QJ5 B;  4PCW A;  2KAY A;  3CS1 A;  1DVI A;  1QXP A;  1WRK A;  4M2Q A;  3RM1 A;  1ALW A;  2HQ8 A;  1XFU O;  1MHO A;  2KI6 C;  4YGC B;  3WHU B;  4GFT A;  2VRG A;  2I7A A;  2KNE A;  2F3Y A;  4MRX A;  3SIA A;  2PRU A;  1V1F A;  3BXK A;  1QV1 A;  1S6J A;  1UUS A;  2GV5 A;  1YUS A;  2CCM A;  2BKI B;  1QAT A;  2COL B;  2Y5I A;  3CR4 X;  1MXE A;  1TN4 A;  4MLW A;  3TS5 B;  1WLZ A;  5BPJ A;  5J3X A;  1DJH A;  1CDM A;  4D1E A;  5K89 A;  3WNX B;  2PAS A;  2ZKM X;  3OB2 B;  4ZCU A;  1BF5 A;  4PHJ A;  4DCK A;  3KO0 A;  2O5G A;  1K96 A;  2K7D A;  1CMF A;  1S5G Y;  4TNC A;  5HKY A;  1IRJ A;  1QVI Y;  4MZJ A;  1W7I B;  1TNQ A;  4WQ2 A;  2JUL A;  1YTZ C;  3TUY B;  1CDL A;  2JT3 A;  1OZO A;  5AFP A;  1KCY A;  1W7J B;  1BMO A;  2K2A A;  2B1U A;  1K95 A;  3LK1 A;  1BU3 A;  1KFU S;  1KFX L;  3KEV A;  2I2R E;  5ER5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...