1OZSA

C-domain of human cardiac troponin c in complex with the inhibitory region of human cardiac troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ozsA00
1BR1B 4HSZA 1FPWA 2GGZA 2JRFA 1OQPA 1YUSA 2KQ6A 2BCAA 2SCPA 3KEVA 1BOCA 4AQIA 2ZRTA 1DF0A 1GQMA 1YR5A 2F8PA 3DVMA 3EVVA 2ZNEA 3O2PA 1SKTA 1XK4A 3KHEA 3K21A 5CSJA 1XFXO 4DRWA 3H4SE 1KWOB 1DTLA 1SR6B 2KAVA 4MEWA 4YGBB 3DF0A 1SRAA 1HT9A 4YGCB 1S1EA 1NCXA 1DJYA 1K95A 3I5GB 3TDIA 1QJTA 1UURA 3C1VA 3EKHA 2WCEA 4OV2A 5DKNA 3SG4A 2KI4C 4FQOA 2M3WA 2MA2A 1IQ5A 2LLTA 1ZUZA 4NQGA 1NWDA 4OKHA 1S5GZ 2E6WA 4DUQA 2H2KA 1W7IB 2L2EA 4XJKB 1PK0D 1QLSA 1EH2A 1ZACA 1MHOA 2H61A 1WY9A 5AXIA 3O4YA 2ZKMX 2MHHA 1OSAA 3GK1A 3CLNA 4PE1A 1X02A 1K2HA 4MN0A 2L5XB 2OTGB 1A2XA 2WCFA 1G33A 1XO5A 1KWOC 1SR6C 4R1EA 2K7BA 2BE6A 1L7ZA 1PSRA 1DJXA 3PFVA 1J7QA 2G9BA 5HKZA 1JFJA 2KFHA 5KTYA 4HRHA 4GGFC 1AVSA 1V1FA 1B8LA 2FCEA 3WNXB 1RECA 3RLZA 1C07A 4MZJA 5KSZA 1H4BA 2GV5A 1RJVA 2LLSA 1K9UA 2F2OA 1B47A 1RFJA 2JU0A 3OB1B 1NIWA 1G4YR 4PE4A 1TOPA 1YRTB 3HX4A 1DF0B 2LVIA 2LMUA 4Q04A 1EG4A 1QV0A 2NCPA 3A4UB 1KFUS 3PM8A 4ORBB 4CPVA 2L98A 4JWQA 4N5XA 1DJHA 2LNKA 3WHTB 1QV1A 4CFQA 1QASA 3EK7A 3DF0B 1S36A 3SIBA 5GQQC 1NP8A 1CKKA 1UHKA 3TS5C 3FWCA 3SG7A 3O6BA 1M39A 1IWQA 1ALWA 2CXJA 2LANA 3PN7B 3I5IB 1SYMA 1S26D 1A4PA 3LL8B 1HQVA 1JC2A 1XFVO 3VRPA 3VRQA 3IQOA 4MBEA 1XFWO 4PE0A 4ZCVA 2LCPA 4GGFA 4D1EA 1BG1A 1VRKA 1L2OB 2JT3A 5HLVA 1CDPA 1TRFA 4PHKA 5G08A 4DIRA 1U5IB 1JF0A 1MXLC 1KFXL 1N2DA 1CFFA 5I2LA 1D1OA 2ZNDA 4AQJA 1XK4C 1KK8C 2HPSA 4PE7A 2LP2A 1M45A 2JNFA 4BY5A 4ICBA 2JXLA 2F2PA 5AEQA 2KFFA 2Y1NA 5BPJA 1MWNA 2BKIB 2JTTA 2PASA 1F70A 1R2UA 5HKYA 1IJ6A 1NCYA 3NSKA 1CFCA 3EK8A 2LHLA 3WHUB 4U8DA 2HQ8A 1BLQA 1F4QA 4PHMA 1YURA 1DGVA 2A4JA 1UUSA 2KI4B 2HQWA 2LC5A 1BF5A 1IQ3A 1DJWA 4QJ5B 2MBXA 2L4IA 2I94A 1CDNA 3SG2A 1B1GA 1KK7Y 2Y5IA 2KAYA 3SG5A 4MVFA 2O5GA 1YUUA 3EVRA 5PALA 1B9AA 2JT8A 1TNXA 2HF5A 1F54A 1J7RA 2PALA 1DGUA 1WLZA 2PSRA 1UHNA 3LK1A 5AFPA 1EG3A 3I5HC 4I5NB 2CNPA 2FOTA 2VRGA 1ZFSA 1F55A 1RROA 1WLMA 1B4CA 1A29A 4A4CA 1CFPA 1K94A 1NPQA 1IKUA 3E3RA 4GPLB 3DD4A 4M2PA 2NLNA 4ORAB 1M46A 1OMRA 2KAXA 5IBWA 2WORA 2I7AA 5I2OA 1NYAA 4NDDA 3MSEB 3SIAA 1JBAA 2K2FA 1TNQA 1GGWA 3PLFB 1TCFA 1QS7A 2Y1MA 1CMGA 3AKBA 3OP0A 2JOJA 1AP4A 1S5GY 1ZMZA 4IL1A 5ER4X 4F0ZB 4L9MA 1EJ3A 2LVVA 2K61A 4NDCA 3ZWHA 2K0JA 1TNWA 2KOTA 1KFXS 1NUBA 1NX3A 1J7OA 3TS5B 2LAPA 2BL0C 1QATA 2LM5A 4JPZB 4MRYA 1OE9B 2KQYA 4GGNA 2BBNA 4YI8A 3JVTC 2M97A 1PVBA 1CFDA 2NXQA 2FCDA 1TCOB 2BKHB 4E68A 3VRRA 1TN4A 4OVNF 1K9PA 2MLEC 3CS1A 1JF2A 1B8RA 2BE4A 2LP3A 2SASA 3FIAA 4C0KA 1IGVA 1JSAA 1QX7A 1XFZO 2K2AA 2JC2A 1AUIB 1LA0A 4MSPA 1YUTA 3RM1A 2KI6D 4P5OE 3SG6A 1KK8B 1XFYO 1DJZA 1KQMB 1LA3A 2BBMA 2LMTA 4YGAA 1Y0VH 1CDLA 2F33A 2KI6C 1BODA 2KYCA 3BUMB 1CLLA 2LVJA 1MXEA 3AKAA 1DMOA 1QVIZ 1CB1A 2NZ0A 1TTXA 1JFKA 4ETOA 2MLFC 2I2RE 5J3XA 2BECA 1QVIY 3EKJA 3KF9A 5D69A 2M0RA 1A03A 1N0YA 1PALA 4ORCB 5B8IB 2D8NA 4QJ3B 4YGEB 4OR9B 4OCIA 2Q91A 2KGRA 1S6CA 3CWGA 1K9KA 2KGBC 1G8IA 2PRUA 1M31A 2E30A 1H8BA 4C0LA 3I5HB 1KQMC 1NCZA 1OZSA 1FI6A 4PALA 2L50A 1IJ5A 2WCBA 1PRWA 1SY9A 1WRZA 2Y4QA 3FS7A 4BY4A 5I2QA 2FJUB 1AK8A 3EK4A 3D10A 3WXAA 1PSBA 1ALVA 2I18A 1QX5B 2K7OA 5AERA 5FYXA 2KSPA 3I5FB 5HKWA 4P2YB 2P6BB 4GUKA 1C7WA 2L0PA 1UP5A 2M9GA 2O60A 3VGOA 1SL7A 4GNKB 1ODBA 2LUXA 1WRKA 3BUWB 1F4OA 3HCMA 1SCMC 1SCVA 2IS9A 5JJGA 1EL4A 2PVBA 2OPOA 1J55A 4CFRA 2LV7A 1RK9A 1SPYA 2R2IA 3BUNB 1UWOA 3LK0A 4USLA 1AJ4A 3LLEA 1FF1A 3JTDC 3OB2B 3IQQA 1YVLA 2AUCA 2WNDA 1B7TZ 1S6JA 2M49B 1XVJA 2KFGA 3BUXB 4MZLA 3CR5X 1BT6A 2L51A 2M29A 1SK6D 1Y1UA 1V1GA 4QJ4B 2BL0B 2OS8B 3SJSA 2LMVA 2LUCA 4M2OA 3NXAA 5K89A 4DS7A 2JQ6A 2TN4A 3D0YA 3VRNA 1OMVA 1DJIA 1Y6WA 5DKRA 3ZNIA 3I5FC 3JVTB 1W7JB 3TUYC 4CIDA 4PHJA 1UHJA 1QLKA 2G2BA 3CGAA 2LLUA 2MRDA 1S6IA 1YTZC 2BCXA 1FBVA 3O78A 5HYDA 5HLOA 4HRGA 1FW4A 1NX2A 3A8RA 3CTNA 2JWWA 1CNPA 1J1EA 2BCBA 1CTRA 3IF7A 1KSOA 1AJ5A 4YGDB 4HREE 3NSIA 1WDCC 5CSIA 5ER5A 1BMOA 4C0JA 1AHRA 1UHHA 3BOWA 2CTNA 1YX8A 5D7FA 1CM1A 4YBHB 2M7LA 1FI5A 1QX2A 3OX6A 4N1GA 3GK2A 2OS8C 1NX1A 2PMYA 4MZKA 1S3PA 1BJFA 2MJWB 1TNPA 3SG3A 3AAKA 2JXCA 2KDHA 1NX0A 1LVCD 2LVKA 3NSOA 1IH0A 3KO0A 2GGMA 3TDUA 3GOFA 2JPTA 2JTZA 1U5IA 1A75A 1MQ1A 1R6PA 1KQVA 5AANA 1DJGA 1RTP1 1CM4A 3F45A 4I5JA 1DVIA 1SBJA 4CLNA 1OOJA 1TIZA 1MUXA 3DVEA 1Y1XA 5DKQA 2KYFA 2AMIA 1CDMA 2JT0A 1UHIA 1BU3A 1QIWA 1M63B 2NCOA 1K96A 3BYAA 3I5GC 4XYNA 1OZOA 2M1KB 3D0YB 2KBIA 1J7PA 4A4BA 2KBMA 1QTXA 2ZRSA 1SNLA 5I8NA 1CLBA 1N65A 3AAJA 1GJYA 4TNCA 3EVUA 4DCKA 2EC6B 1IG5A 1MR8A 2JNXA 4JQ0D 1SW8A 2M1UA 2JZIA 5CSFA 2CCMA 3DVJA 1ZOTB 4GFTA 2HETA 1DT7B 1KSMA 2F3YA 3PALA 4I5KA 1J1DA 1SCMB 1K93D 1NSHA 4N1FA 1CLMA 1LKJA 2KHNA 2OTGC 1F8HA 1CMFA 1B8CA 2L4HA 2QPTA 3BOWB 2ISDA 3JTDB 5CPVA 1RWYA 2AAOA 1XFUO 4FTGA 3LCPC 1SL8A 2LE9B 2V53A 3BQ3A 3CR4X 3NSLA 1C7VA 2WOSA 1YX7A 2WC8A 4M2QA 1KCYA 2ZN9A 3PATA 3M0WA 3OX5A 4PDZA 1XYDA 5CSNA 1YRUB 5JOLA 3VROA 1WRLA 2MAZA 4YI9A 4YRUA 1YVHA 3TZ1A 2ZFDA 1BR4B 1QIVA 5KU1A 4WQ2A 2EGDA 2EC6C 2ZN8A 1PULA 4NDBA 1LXFC 1A75B 3TUYB 1K8UA 2CBLA 1Y1AA 2LHIA 3TDZA 4UPGA 2M8UA 1JUOA 3KPXA 1SMGA 3ICBA 4XJKA 4MLWA 2JULA 5F6TA 1GGZA 3FWBA 3BXKA 1XA5A 2CT9A 2RGIA 3PSRA 5TNCA 2M7NA 4GAOA 4MRXA 2KNEA 3QRXA 4GBAA 4PHNA 2B1UA 3PN7C 1WDCB 2K7DA 3I5IC 2QACA 2F3ZA 3BUOB 1JWDA 3GK4X 4WQ3A 1QXPA 4AOMA 2Q4UA 4PCWA 1K90D 1PVAA 1SL9A 2K7CA 2EHBA 1KK7Z 1B7TY 1Q80A 1EXRA 1KFUL 2K8MB 1E8AA 2DOQA 1MF8B 2COLB 2H61C 1IRJA 4I5LB 4WRIA 1L2OC 1LINA 3CZTX 3OHMB 1F71A 4ZCUA 1OMDA 3CR2A 3DVKA
chains in the Genus database with same CATH superfamily
1BR1B 4HSZA 1FPWA 2GGZA 2JRFA 4JKTA 1OQPA 1YUSA 2KQ6A 2BCAA 2SCPA 3KEVA 3D74A 1BOCA 4AQIA 2ZRTA 1DF0A 1GQMA 1YR5A 2F8PA 3DVMA 3EVVA 2ZNEA 3O2PA 1SKTA 1XK4A 3KHEA 3K21A 5CSJA 1OOIX 1XFXO 4DRWA 3H4SE 1KWOB 1DTLA 1SR6B 2KAVA 2PQLA 4MEWA 4YGBB 3DF0A 1SRAA 1HT9A 4YGCB 1S1EA 1NCXA 1DJYA 1K95A 2WCJA 3I5GB 3TDIA 3CDNA 1QJTA 1UURA 3C1VA 3D76A 3EKHA 2WCEA 4OV2A 1SSEB 5DKNA 3SG4A 2KI4C 4FQOA 3B7AA 2M3WA 2MA2A 1IQ5A 1OOHA 3OGNA 2LLTA 1ZUZA 4NQGA 1NWDA 4OKHA 1S5GZ 2E6WA 4DUQA 2H2KA 1W7IB 2L2EA 3NHTA 4XJKB 1PK0D 1QLSA 3Q8IA 1ZACA 1EH2A 1MHOA 2H61A 1WY9A 5AXIA 3L4LA 2ZKMX 2MHHA 3O4YA 3PM2A 1OSAA 3GK1A 3CLNA 3DY9A 1X02A 4PE1A 1K2HA 4MN0A 2L5XB 2OTGB 1A2XA 2WCFA 1G33A 1XO5A 1KWOC 1SR6C 4R1EA 2K7BA 2BE6A 1L7ZA 1PSRA 1DJXA 3PFVA 1J7QA 2G9BA 3SS3A 2FJYA 3FE8A 5HKZA 1JFJA 2KFHA 5KTYA 4HRHA 3IVTA 1AVSA 1V1FA 1B8LA 2FCEA 4GGFC 1RECA 3RLZA 3WNXB 1C07A 4MZJA 5KSZA 1H4BA 2GV5A 1RJVA 2LLSA 1K9UA 2F2OA 4F7FA 1B47A 1RFJA 2JU0A 3OB1B 1NIWA 1G4YR 4PE4A 1TOPA 1YRTB 3HX4A 1DF0B 2LVIA 3S0GA 2LMUA 4Q04A 1EG4A 1QV0A 2NCPA 3A4UB 1KFUS 3PM8A 4ORBB 4CPVA 2L98A 4JWQA 2KPHA 1DJHA 2LNKA 2WCLA 4N5XA 3WHTB 2WCKA 1QV1A 4CFQA 1QASA 3EK7A 3R1VA 3DF0B 1DEKA 1S36A 3SIBA 5GQQC 1NP8A 1CKKA 1UHKA 3TS5C 3FWCA 3SG7A 3O6BA 1M39A 1IWQA 1ALWA 2CXJA 2LANA 3PN7B 2P70A 2BNXA 3I5IB 4IJ7A 1SYMA 1S26D 1A4PA 3LL8B 1HQVA 1JC2A 1XFVO 3OBVA 3VRPA 3VRQA 3IQOA 4MBEA 2L5YA 1XFWO 4PE0A 4ZCVA 2LCPA 3EG5B 4GGFA 3SS4A 4D1EA 1BG1A 1VRKA 1L2OB 2JT3A 5HLVA 1CDPA 1TRFA 4PHKA 5G08A 4INWA 4DIRA 1U5IB 1JF0A 1MXLC 1KFXL 2QEHA 1N2DA 3S0EA 1CFFA 5I2LA 1D1OA 2ZNDA 4AQJA 3CYZA 1XK4C 1KK8C 3V2LA 5FI2A 2HPSA 2KLEA 4PE7A 2LP2A 1M45A 2JNFA 4BY5A 4ICBA 3NGVA 2JXLA 2F2PA 5AEQA 2KFFA 2Y1NA 5BPJA 1MWNA 2BKIB 2JTTA 2PASA 1F70A 1R2UA 5HKYA 2QEVA 1IJ6A 1NCYA 3NSKA 1CFCA 3EK8A 2LHLA 3WHUB 4U8DA 2HQ8A 1BLQA 5HL1A 3BJHA 1F4QA 4PHMA 2YGUA 1YURA 1DGVA 2L2CA 2A4JA 1UUSA 2KI4B 2BAPA 2HQWA 2LC5A 1BF5A 1IQ3A 1DJWA 4QJ5B 2MBXA 2L4IA 2I94A 1CDNA 3FE9A 3SG2A 1B1GA 1KK7Y 2Y5IA 2KAYA 3SG5A 4MVFA 2O5GA 1YUUA 3EVRA 5PALA 1B9AA 2JT8A 4PT1A 1TNXA 2HF5A 1F54A 1J7RA 2PALA 1DGUA 1OOGA 1WLZA 1UHNA 2PSRA 3LK1A 5AFPA 1EG3A 3I5HC 4I5NB 2CNPA 3S0BA 2FOTA 2VRGA 1ZFSA 1F55A 1RROA 1WLMA 2WCHA 1B4CA 1IIOA 1A29A 1XFRA 3CZ2A 4A4CA 1CFPA 1K94A 1NPQA 1IKUA 3E3RA 4JD9A 4GPLB 3DD4A 4M2PA 2NLNA 4ORAB 1M46A 1OMRA 2KAXA 5IBWA 2WORA 2I7AA 5I2OA 1NYAA 3B6XA 4NDDA 3MSEB 3SIAA 1JBAA 2K2FA 1TNQA 1GGWA 3PLFB 1TCFA 1QS7A 2Y1MA 1CMGA 1Z2CB 3AKBA 3OP0A 2JOJA 1AP4A 1S5GY 1ZMZA 1T14A 4IL1A 5ER4X 4F0ZB 4L9MA 1EJ3A 2LVVA 2K61A 4NDCA 3ZWHA 2K0JA 1TNWA 2KOTA 1KFXS 1NUBA 1NX3A 1J7OA 3TS5B 3D75A 2LAPA 3B87A 2BL0C 1QATA 2LM5A 4JPZB 4MRYA 1OE9B 2KQYA 3PJIA 4GGNA 3D78A 2BBNA 4YI8A 3JVTC 2WCMA 2M97A 1PVBA 1CFDA 2NXQA 2FCDA 1TCOB 3CZ1A 2BKHB 4E68A 3VRRA 1TN4A 4OVNF 1K9PA 2MLEC 3CS1A 1JF2A 1B8RA 2BE4A 2LP3A 2SASA 3FIAA 4C0KA 1IGVA 1JSAA 1QX7A 1XFZO 2K2AA 2JC2A 1AUIB 1LA0A 3R72A 1YUTA 4MSPA 2KI6D 4P5OE 3RM1A 3SG6A 1KK8B 1XFYO 1DJZA 1KQMB 1LA3A 2BBMA 2LMTA 4YGAA 1Y0VH 1CDLA 2F33A 2KI6C 1BODA 3NHIA 2KYCA 3BUMB 1CLLA 2LVJA 1MXEA 3AKAA 2ERBA 1DMOA 1QVIZ 1CB1A 2NZ0A 1TTXA 1JFKA 1GM0A 4ETOA 2MLFC 2I2RE 5J3XA 2BECA 1QVIY 3EKJA 3KF9A 5D69A 2M0RA 1A03A 1N0YA 4OZDA 1PALA 4ORCB 5B8IB 2D8NA 4QJ3B 4YGEB 4OR9B 4OCIA 2Q91A 2KGRA 1S6CA 3CWGA 1K9KA 2KGBC 1G8IA 2PRUA 1M31A 2E30A 1H8BA 4C0LA 2P71A 3I5HB 1KQMC 3B86A 5FI6A 1NCZA 1OZSA 5I94A 1FI6A 2JPOA 2L50A 1IJ5A 4PALA 2WCBA 1PRWA 1SY9A 1WRZA 2Y4QA 3FS7A 4BY4A 5I2QA 2FJUB 1AK8A 3EK4A 2K60A 3D10A 5D3OA 3WXAA 1PSBA 1ALVA 2I18A 1QX5B 2K7OA 5AERA 5FYXA 2KSPA 3I5FB 5HKWA 4P2YB 2P6BB 4GUKA 1C7WA 2L0PA 1UP5A 2M9GA 2O60A 5DICA 1SL7A 3VGOA 4GNKB 1ODBA 2LUXA 3BFBA 1C3YA 3VB1A 1WRKA 3BUWB 1F4OA 3HCMA 1SCMC 1SCVA 2IS9A 5JJGA 1EL4A 2PVBA 2OPOA 1J55A 4CFRA 2LV7A 1RK9A 1SPYA 2R2IA 3BUNB 1UWOA 3LK0A 4USLA 1AJ4A 3LLEA 3QMEA 1FF1A 3JTDC 3OB2B 1LS8A 3S0AA 3IQQA 1YVLA 2AUCA 2WNDA 4FQTA 1B7TZ 1S6JA 2M49B 1XVJA 2KFGA 3BUXB 4MZLA 3BFHA 3CR5X 1BT6A 2L51A 2M29A 4KYNA 1SK6D 1Y1UA 1V1GA 4QJ4B 3RZSA 2BL0B 2OS8B 3SJSA 2LMVA 2LUCA 4M2OA 3NXAA 5K89A 4DS7A 2JQ6A 2TN4A 3D0YA 3VRNA 1OMVA 1DJIA 1Y6WA 3UO9A 5DKRA 3ZNIA 2WC6A 3I5FC 3JVTB 1DC1A 1W7JB 3K1EA 3TUYC 4CIDA 4PHJA 1UHJA 1QLKA 2G2BA 3CGAA 2LLUA 2MRDA 1S6IA 1YTZC 2BCXA 1FBVA 3O78A 5HYDA 5HLOA 3UNWA 4HRGA 1FW4A 1NX2A 3A8RA 3CTNA 2JWWA 1CNPA 1J1EA 5FI7A 2BCBA 4INXA 1CTRA 3IF7A 1KSOA 1AJ5A 4YGDB 4HREE 3NSIA 1WDCC 2H8VA 5CSIA 5ER5A 1BMOA 4C0JA 1AHRA 1OOFA 1UHHA 3BOWA 2CTNA 1YX8A 5D7FA 1CM1A 4YBHB 2M7LA 1FI5A 1QX2A 1QWVA 3OX6A 3GK2A 4N1GA 2OS8C 1NX1A 2PMYA 4MZKA 1S3PA 1BJFA 2MJWB 1TNPA 3O4XA 3SG3A 3AAKA 2JXCA 2KDHA 3L4AA 1NX0A 1LVCD 2LVKA 3NSOA 1IH0A 3KO0A 2GGMA 3TDUA 3GOFA 3N7HA 2JPTA 2JTZA 3D77A 1U5IA 1A75A 2QEBA 1MQ1A 1R6PA 1KQVA 5AANA 1DJGA 1RTP1 1CM4A 3F45A 4I5JA 1DVIA 1SBJA 4CLNA 1OOJA 1TIZA 1MUXA 3DVEA 1Y1XA 5DKQA 2KYFA 2AMIA 1CDMA 2JT0A 1UHIA 1BU3A 1QIWA 1M63B 2NCOA 1K96A 3BYAA 3I5GC 3FE6A 4XYNA 3R1OA 1TUJA 1OW4A 1OZOA 2M1KB 3D0YB 2KBIA 3L47A 1J7PA 4A4BA 2KBMA 1QTXA 2ZRSA 1SNLA 5I8NA 1CLBA 1N65A 3AAJA 1GJYA 4TNCA 3EVUA 4DCKA 2EC6B 1IG5A 1MR8A 3SS5A 3R1PA 2JNXA 4JQ0D 1SW8A 3D73A 3DYEA 2M1UA 2JZIA 5CSFA 2CCMA 3DVJA 1TWOA 1ZOTB 3DZTA 4GFTA 2HETA 1DT7B 1KSMA 2F3YA 3PALA 4I5KA 1J1DA 1SCMB 1K93D 1NSHA 2PYQA 4N1FA 1CLMA 1LKJA 2KHNA 2OTGC 1F8HA 1CMFA 1B8CA 2L4HA 2QPTA 3BOWB 1ORGA 5EL2A 2ISDA 3JTDB 5CPVA 1RWYA 1Z4HA 2AAOA 1XFUO 4FTGA 3LCPC 1SL8A 2GTEA 2LE9B 2V53A 3BQ3A 3CR4X 3NSLA 1C7VA 2WOSA 3DXLA 1YX7A 2WC8A 4M2QA 1KCYA 2ZN9A 2QDIA 3B88A 3CZ0A 3PATA 3M0WA 3OX5A 4PDZA 1XYDA 5CSNA 1YRUB 5JOLA 3VROA 1WRLA 2QEOA 2MAZA 4YI9A 4YRUA 1YVHA 3TZ1A 2ZFDA 1BR4B 1DQEA 1QIVA 1W9ZA 5KU1A 3BFAA 4WQ2A 2EGDA 2EC6C 2ZN8A 1PULA 4NDBA 1LXFC 1A75B 3TUYB 1K8UA 2CBLA 1Y1AA 2LHIA 3TDZA 3S0DA 3CABA 2M8UA 4UPGA 1JUOA 3KPXA 1SMGA 3ICBA 4XJKA 4MLWA 2JULA 5F6TA 1GGZA 3FWBA 3BXKA 1XA5A 2CT9A 2RGIA 3PSRA 3S0FA 5TNCA 2M7NA 4GAOA 4MRXA 2KNEA 3QRXA 4GBAA 4PHNA 2B1UA 3PN7C 1WDCB 2K7DA 3I5IC 2QACA 2F3ZA 3BUOB 1C3ZA 1JWDA 3GK4X 4WQ3A 1QXPA 4AOMA 2KLDA 2Q4UA 1DELA 4PCWA 1P28A 1K90D 1PVAA 1SL9A 2K7CA 2EHBA 1KK7Z 2WC5A 1B7TY 1Q80A 1EXRA 1KFUL 2K8MB 1E8AA 2DOQA 1MF8B 2COLB 2H61C 1IRJA 4I5LB 4WRIA 1L2OC 1LINA 3CZTX 3OHMB 1F71A 4ZCUA 1OMDA 3CR2A 3DVKA 1TUZA
chains in the Genus database with same CATH topology
1BR1B 4HSZA 1FPWA 2GGZA 2JRFA 1OQPA 1YUSA 2KQ6A 2BCAA 2SCPA 3KEVA 1BOCA 4AQIA 2ZRTA 1DF0A 1GQMA 1YR5A 2F8PA 3DVMA 3EVVA 2ZNEA 3O2PA 1SKTA 1XK4A 3KHEA 3K21A 5CSJA 1XFXO 4DRWA 3H4SE 1KWOB 1DTLA 1SR6B 2KAVA 4MEWA 4YGBB 3DF0A 1SRAA 1HT9A 4YGCB 1S1EA 1NCXA 1DJYA 1K95A 3I5GB 3TDIA 1QJTA 1UURA 3C1VA 3EKHA 2WCEA 4OV2A 5DKNA 3SG4A 2KI4C 4FQOA 2M3WA 2MA2A 1IQ5A 2LLTA 1ZUZA 4NQGA 1NWDA 4OKHA 1S5GZ 2E6WA 4DUQA 2H2KA 1W7IB 2L2EA 4XJKB 1PK0D 1QLSA 1EH2A 1ZACA 1MHOA 2H61A 1WY9A 5AXIA 3O4YA 2ZKMX 2MHHA 1OSAA 3GK1A 3CLNA 4PE1A 1X02A 1K2HA 4MN0A 2L5XB 2OTGB 1A2XA 2WCFA 1G33A 1XO5A 1KWOC 1SR6C 4R1EA 2K7BA 2BE6A 1L7ZA 1PSRA 1DJXA 3PFVA 1J7QA 2G9BA 5HKZA 1JFJA 2KFHA 5KTYA 4HRHA 4GGFC 1AVSA 1V1FA 1B8LA 2FCEA 3WNXB 1RECA 3RLZA 1C07A 4MZJA 5KSZA 1H4BA 2GV5A 1RJVA 2LLSA 1K9UA 2F2OA 1B47A 1RFJA 2JU0A 3OB1B 1NIWA 1G4YR 4PE4A 1TOPA 1YRTB 3HX4A 1DF0B 2LVIA 2LMUA 4Q04A 1EG4A 1QV0A 2NCPA 3A4UB 1KFUS 3PM8A 4ORBB 4CPVA 2L98A 4JWQA 4N5XA 1DJHA 2LNKA 3WHTB 1QV1A 4CFQA 1QASA 3EK7A 3DF0B 1S36A 3SIBA 5GQQC 1NP8A 1CKKA 1UHKA 3TS5C 3FWCA 3SG7A 3O6BA 1M39A 1IWQA 1ALWA 2CXJA 2LANA 3PN7B 3I5IB 1SYMA 1S26D 1A4PA 3LL8B 1HQVA 1JC2A 1XFVO 3VRPA 3VRQA 3IQOA 4MBEA 1XFWO 4PE0A 4ZCVA 2LCPA 4GGFA 4D1EA 1BG1A 1VRKA 1L2OB 2JT3A 5HLVA 1CDPA 1TRFA 4PHKA 5G08A 4DIRA 1U5IB 1JF0A 1MXLC 1KFXL 1N2DA 1CFFA 5I2LA 1D1OA 2ZNDA 4AQJA 1XK4C 1KK8C 2HPSA 4PE7A 2LP2A 1M45A 2JNFA 4BY5A 4ICBA 2JXLA 2F2PA 5AEQA 2KFFA 2Y1NA 5BPJA 1MWNA 2BKIB 2JTTA 2PASA 1F70A 1R2UA 5HKYA 1IJ6A 1NCYA 3NSKA 1CFCA 3EK8A 2LHLA 3WHUB 4U8DA 2HQ8A 1BLQA 1F4QA 4PHMA 1YURA 1DGVA 2A4JA 1UUSA 2KI4B 2HQWA 2LC5A 1BF5A 1IQ3A 1DJWA 4QJ5B 2MBXA 2L4IA 2I94A 1CDNA 3SG2A 1B1GA 1KK7Y 2Y5IA 2KAYA 3SG5A 4MVFA 2O5GA 1YUUA 3EVRA 5PALA 1B9AA 2JT8A 1TNXA 2HF5A 1F54A 1J7RA 2PALA 1DGUA 1WLZA 2PSRA 1UHNA 3LK1A 5AFPA 1EG3A 3I5HC 4I5NB 2CNPA 2FOTA 2VRGA 1ZFSA 1F55A 1RROA 1WLMA 1B4CA 1A29A 4A4CA 1CFPA 1K94A 1NPQA 1IKUA 3E3RA 4GPLB 3DD4A 4M2PA 2NLNA 4ORAB 1M46A 1OMRA 2KAXA 5IBWA 2WORA 2I7AA 5I2OA 1NYAA 4NDDA 3MSEB 3SIAA 1JBAA 2K2FA 1TNQA 1GGWA 3PLFB 1TCFA 1QS7A 2Y1MA 1CMGA 3AKBA 3OP0A 2JOJA 1AP4A 1S5GY 1ZMZA 4IL1A 5ER4X 4F0ZB 4L9MA 1EJ3A 2LVVA 2K61A 4NDCA 3ZWHA 2K0JA 1TNWA 2KOTA 1KFXS 1NUBA 1NX3A 1J7OA 3TS5B 2LAPA 2BL0C 1QATA 2LM5A 4JPZB 4MRYA 1OE9B 2KQYA 4GGNA 2BBNA 4YI8A 3JVTC 2M97A 1PVBA 1CFDA 2NXQA 2FCDA 1TCOB 2BKHB 4E68A 3VRRA 1TN4A 4OVNF 1K9PA 2MLEC 3CS1A 1JF2A 1B8RA 2BE4A 2LP3A 2SASA 3FIAA 4C0KA 1IGVA 1JSAA 1QX7A 1XFZO 2K2AA 2JC2A 1AUIB 1LA0A 4MSPA 1YUTA 3RM1A 2KI6D 4P5OE 3SG6A 1KK8B 1XFYO 1DJZA 1KQMB 1LA3A 2BBMA 2LMTA 4YGAA 1Y0VH 1CDLA 2F33A 2KI6C 1BODA 2KYCA 3BUMB 1CLLA 2LVJA 1MXEA 3AKAA 1DMOA 1QVIZ 1CB1A 2NZ0A 1TTXA 1JFKA 4ETOA 2MLFC 2I2RE 5J3XA 2BECA 1QVIY 3EKJA 3KF9A 5D69A 2M0RA 1A03A 1N0YA 1PALA 4ORCB 5B8IB 2D8NA 4QJ3B 4YGEB 4OR9B 4OCIA 2Q91A 2KGRA 1S6CA 3CWGA 1K9KA 2KGBC 1G8IA 2PRUA 1M31A 2E30A 1H8BA 4C0LA 3I5HB 1KQMC 1NCZA 1OZSA 1FI6A 4PALA 2L50A 1IJ5A 2WCBA 1PRWA 1SY9A 1WRZA 2Y4QA 3FS7A 4BY4A 5I2QA 2FJUB 1AK8A 3EK4A 3D10A 3WXAA 1PSBA 1ALVA 2I18A 1QX5B 2K7OA 5AERA 5FYXA 2KSPA 3I5FB 5HKWA 4P2YB 2P6BB 4GUKA 1C7WA 2L0PA 1UP5A 2M9GA 2O60A 3VGOA 1SL7A 4GNKB 1ODBA 2LUXA 1WRKA 3BUWB 1F4OA 3HCMA 1SCMC 1SCVA 2IS9A 5JJGA 1EL4A 2PVBA 2OPOA 1J55A 4CFRA 2LV7A 1RK9A 1SPYA 2R2IA 3BUNB 1UWOA 3LK0A 4USLA 1AJ4A 3LLEA 1FF1A 3JTDC 3OB2B 3IQQA 1YVLA 2AUCA 2WNDA 1B7TZ 1S6JA 2M49B 1XVJA 2KFGA 3BUXB 4MZLA 3CR5X 1BT6A 2L51A 2M29A 1SK6D 1Y1UA 1V1GA 4QJ4B 2BL0B 2OS8B 3SJSA 2LMVA 2LUCA 4M2OA 3NXAA 5K89A 4DS7A 2JQ6A 2TN4A 3D0YA 3VRNA 1OMVA 1DJIA 1Y6WA 5DKRA 3ZNIA 3I5FC 3JVTB 1W7JB 3TUYC 4CIDA 4PHJA 1UHJA 1QLKA 2G2BA 3CGAA 2LLUA 2MRDA 1S6IA 1YTZC 2BCXA 1FBVA 3O78A 5HYDA 5HLOA 4HRGA 1FW4A 1NX2A 3A8RA 3CTNA 2JWWA 1CNPA 1J1EA 2BCBA 1CTRA 3IF7A 1KSOA 1AJ5A 4YGDB 4HREE 3NSIA 1WDCC 5CSIA 5ER5A 1BMOA 4C0JA 1AHRA 1UHHA 3BOWA 2CTNA 1YX8A 5D7FA 1CM1A 4YBHB 2M7LA 1FI5A 1QX2A 3OX6A 4N1GA 3GK2A 2OS8C 1NX1A 2PMYA 4MZKA 1S3PA 1BJFA 2MJWB 1TNPA 3SG3A 3AAKA 2JXCA 2KDHA 1NX0A 1LVCD 2LVKA 3NSOA 1IH0A 3KO0A 2GGMA 3TDUA 3GOFA 2JPTA 2JTZA 1U5IA 1A75A 1MQ1A 1R6PA 1KQVA 5AANA 1DJGA 1RTP1 1CM4A 3F45A 4I5JA 1DVIA 1SBJA 4CLNA 1OOJA 1TIZA 1MUXA 3DVEA 1Y1XA 5DKQA 2KYFA 2AMIA 1CDMA 2JT0A 1UHIA 1BU3A 1QIWA 1M63B 2NCOA 1K96A 3BYAA 3I5GC 4XYNA 1OZOA 2M1KB 3D0YB 2KBIA 1J7PA 4A4BA 2KBMA 1QTXA 2ZRSA 1SNLA 5I8NA 1CLBA 1N65A 3AAJA 1GJYA 4TNCA 3EVUA 4DCKA 2EC6B 1IG5A 1MR8A 2JNXA 4JQ0D 1SW8A 2M1UA 2JZIA 5CSFA 2CCMA 3DVJA 1ZOTB 4GFTA 2HETA 1DT7B 1KSMA 2F3YA 3PALA 4I5KA 1J1DA 1SCMB 1K93D 1NSHA 4N1FA 1CLMA 1LKJA 2KHNA 2OTGC 1F8HA 1CMFA 1B8CA 2L4HA 2QPTA 3BOWB 2ISDA 3JTDB 5CPVA 1RWYA 2AAOA 1XFUO 4FTGA 3LCPC 1SL8A 2LE9B 2V53A 3BQ3A 3CR4X 3NSLA 1C7VA 2WOSA 1YX7A 2WC8A 4M2QA 1KCYA 2ZN9A 3PATA 3M0WA 3OX5A 4PDZA 1XYDA 5CSNA 1YRUB 5JOLA 3VROA 1WRLA 2MAZA 4YI9A 4YRUA 1YVHA 3TZ1A 2ZFDA 1BR4B 1QIVA 5KU1A 4WQ2A 2EGDA 2EC6C 2ZN8A 1PULA 4NDBA 1LXFC 1A75B 3TUYB 1K8UA 2CBLA 1Y1AA 2LHIA 3TDZA 4UPGA 2M8UA 1JUOA 3KPXA 1SMGA 3ICBA 4XJKA 4MLWA 2JULA 5F6TA 1GGZA 3FWBA 3BXKA 1XA5A 2CT9A 2RGIA 3PSRA 5TNCA 2M7NA 4GAOA 4MRXA 2KNEA 3QRXA 4GBAA 4PHNA 2B1UA 3PN7C 1WDCB 2K7DA 3I5IC 2QACA 2F3ZA 3BUOB 1JWDA 3GK4X 4WQ3A 1QXPA 4AOMA 2Q4UA 4PCWA 1K90D 1PVAA 1SL9A 2K7CA 2EHBA 1KK7Z 1B7TY 1Q80A 1EXRA 1KFUL 2K8MB 1E8AA 2DOQA 1MF8B 2COLB 2H61C 1IRJA 4I5LB 4WRIA 1L2OC 1LINA 3CZTX 3OHMB 1F71A 4ZCUA 1OMDA 3CR2A 3DVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR1 B;  4HSZ A;  1FPW A;  2GGZ A;  2JRF A;  1OQP A;  1YUS A;  2KQ6 A;  2BCA A;  2SCP A;  3KEV A;  1BOC A;  4AQI A;  2ZRT A;  1DF0 A;  1GQM A;  1YR5 A;  2F8P A;  3DVM A;  3EVV A;  2ZNE A;  3O2P A;  1SKT A;  1XK4 A;  3KHE A;  3K21 A;  5CSJ A;  1XFX O;  4DRW A;  3H4S E;  1KWO B;  1DTL A;  1SR6 B;  2KAV A;  4MEW A;  4YGB B;  3DF0 A;  1SRA A;  1HT9 A;  4YGC B;  1S1E A;  1NCX A;  1DJY A;  1K95 A;  3I5G B;  3TDI A;  1QJT A;  1UUR A;  3C1V A;  3EKH A;  2WCE A;  4OV2 A;  5DKN A;  3SG4 A;  2KI4 C;  4FQO A;  2M3W A;  2MA2 A;  1IQ5 A;  2LLT A;  1ZUZ A;  4NQG A;  1NWD A;  4OKH A;  1S5G Z;  2E6W A;  4DUQ A;  2H2K A;  1W7I B;  2L2E A;  4XJK B;  1PK0 D;  1QLS A;  1EH2 A;  1ZAC A;  1MHO A;  2H61 A;  1WY9 A;  5AXI A;  3O4Y A;  2ZKM X;  2MHH A;  1OSA A;  3GK1 A;  3CLN A;  4PE1 A;  1X02 A;  1K2H A;  4MN0 A;  2L5X B;  2OTG B;  1A2X A;  2WCF A;  1G33 A;  1XO5 A;  1KWO C;  1SR6 C;  4R1E A;  2K7B A;  2BE6 A;  1L7Z A;  1PSR A;  1DJX A;  3PFV A;  1J7Q A;  2G9B A;  5HKZ A;  1JFJ A;  2KFH A;  5KTY A;  4HRH A;  4GGF C;  1AVS A;  1V1F A;  1B8L A;  2FCE A;  3WNX B;  1REC A;  3RLZ A;  1C07 A;  4MZJ A;  5KSZ A;  1H4B A;  2GV5 A;  1RJV A;  2LLS A;  1K9U A;  2F2O A;  1B47 A;  1RFJ A;  2JU0 A;  3OB1 B;  1NIW A;  1G4Y R;  4PE4 A;  1TOP A;  1YRT B;  3HX4 A;  1DF0 B;  2LVI A;  2LMU A;  4Q04 A;  1EG4 A;  1QV0 A;  2NCP A;  3A4U B;  1KFU S;  3PM8 A;  4ORB B;  4CPV A;  2L98 A;  4JWQ A;  4N5X A;  1DJH A;  2LNK A;  3WHT B;  1QV1 A;  4CFQ A;  1QAS A;  3EK7 A;  3DF0 B;  1S36 A;  3SIB A;  5GQQ C;  1NP8 A;  1CKK A;  1UHK A;  3TS5 C;  3FWC A;  3SG7 A;  3O6B A;  1M39 A;  1IWQ A;  1ALW A;  2CXJ A;  2LAN A;  3PN7 B;  3I5I B;  1SYM A;  1S26 D;  1A4P A;  3LL8 B;  1HQV A;  1JC2 A;  1XFV O;  3VRP A;  3VRQ A;  3IQO A;  4MBE A;  1XFW O;  4PE0 A;  4ZCV A;  2LCP A;  4GGF A;  4D1E A;  1BG1 A;  1VRK A;  1L2O B;  2JT3 A;  5HLV A;  1CDP A;  1TRF A;  4PHK A;  5G08 A;  4DIR A;  1U5I B;  1JF0 A;  1MXL C;  1KFX L;  1N2D A;  1CFF A;  5I2L A;  1D1O A;  2ZND A;  4AQJ A;  1XK4 C;  1KK8 C;  2HPS A;  4PE7 A;  2LP2 A;  1M45 A;  2JNF A;  4BY5 A;  4ICB A;  2JXL A;  2F2P A;  5AEQ A;  2KFF A;  2Y1N A;  5BPJ A;  1MWN A;  2BKI B;  2JTT A;  2PAS A;  1F70 A;  1R2U A;  5HKY A;  1IJ6 A;  1NCY A;  3NSK A;  1CFC A;  3EK8 A;  2LHL A;  3WHU B;  4U8D A;  2HQ8 A;  1BLQ A;  1F4Q A;  4PHM A;  1YUR A;  1DGV A;  2A4J A;  1UUS A;  2KI4 B;  2HQW A;  2LC5 A;  1BF5 A;  1IQ3 A;  1DJW A;  4QJ5 B;  2MBX A;  2L4I A;  2I94 A;  1CDN A;  3SG2 A;  1B1G A;  1KK7 Y;  2Y5I A;  2KAY A;  3SG5 A;  4MVF A;  2O5G A;  1YUU A;  3EVR A;  5PAL A;  1B9A A;  2JT8 A;  1TNX A;  2HF5 A;  1F54 A;  1J7R A;  2PAL A;  1DGU A;  1WLZ A;  2PSR A;  1UHN A;  3LK1 A;  5AFP A;  1EG3 A;  3I5H C;  4I5N B;  2CNP A;  2FOT A;  2VRG A;  1ZFS A;  1F55 A;  1RRO A;  1WLM A;  1B4C A;  1A29 A;  4A4C A;  1CFP A;  1K94 A;  1NPQ A;  1IKU A;  3E3R A;  4GPL B;  3DD4 A;  4M2P A;  2NLN A;  4ORA B;  1M46 A;  1OMR A;  2KAX A;  5IBW A;  2WOR A;  2I7A A;  5I2O A;  1NYA A;  4NDD A;  3MSE B;  3SIA A;  1JBA A;  2K2F A;  1TNQ A;  1GGW A;  3PLF B;  1TCF A;  1QS7 A;  2Y1M A;  1CMG A;  3AKB A;  3OP0 A;  2JOJ A;  1AP4 A;  1S5G Y;  1ZMZ A;  4IL1 A;  5ER4 X;  4F0Z B;  4L9M A;  1EJ3 A;  2LVV A;  2K61 A;  4NDC A;  3ZWH A;  2K0J A;  1TNW A;  2KOT A;  1KFX S;  1NUB A;  1NX3 A;  1J7O A;  3TS5 B;  2LAP A;  2BL0 C;  1QAT A;  2LM5 A;  4JPZ B;  4MRY A;  1OE9 B;  2KQY A;  4GGN A;  2BBN A;  4YI8 A;  3JVT C;  2M97 A;  1PVB A;  1CFD A;  2NXQ A;  2FCD A;  1TCO B;  2BKH B;  4E68 A;  3VRR A;  1TN4 A;  4OVN F;  1K9P A;  2MLE C;  3CS1 A;  1JF2 A;  1B8R A;  2BE4 A;  2LP3 A;  2SAS A;  3FIA A;  4C0K A;  1IGV A;  1JSA A;  1QX7 A;  1XFZ O;  2K2A A;  2JC2 A;  1AUI B;  1LA0 A;  4MSP A;  1YUT A;  3RM1 A;  2KI6 D;  4P5O E;  3SG6 A;  1KK8 B;  1XFY O;  1DJZ A;  1KQM B;  1LA3 A;  2BBM A;  2LMT A;  4YGA A;  1Y0V H;  1CDL A;  2F33 A;  2KI6 C;  1BOD A;  2KYC A;  3BUM B;  1CLL A;  2LVJ A;  1MXE A;  3AKA A;  1DMO A;  1QVI Z;  1CB1 A;  2NZ0 A;  1TTX A;  1JFK A;  4ETO A;  2MLF C;  2I2R E;  5J3X A;  2BEC A;  1QVI Y;  3EKJ A;  3KF9 A;  5D69 A;  2M0R A;  1A03 A;  1N0Y A;  1PAL A;  4ORC B;  5B8I B;  2D8N A;  4QJ3 B;  4YGE B;  4OR9 B;  4OCI A;  2Q91 A;  2KGR A;  1S6C A;  3CWG A;  1K9K A;  2KGB C;  1G8I A;  2PRU A;  1M31 A;  2E30 A;  1H8B A;  4C0L A;  3I5H B;  1KQM C;  1NCZ A;  1OZS A;  1FI6 A;  4PAL A;  2L50 A;  1IJ5 A;  2WCB A;  1PRW A;  1SY9 A;  1WRZ A;  2Y4Q A;  3FS7 A;  4BY4 A;  5I2Q A;  2FJU B;  1AK8 A;  3EK4 A;  3D10 A;  3WXA A;  1PSB A;  1ALV A;  2I18 A;  1QX5 B;  2K7O A;  5AER A;  5FYX A;  2KSP A;  3I5F B;  5HKW A;  4P2Y B;  2P6B B;  4GUK A;  1C7W A;  2L0P A;  1UP5 A;  2M9G A;  2O60 A;  3VGO A;  1SL7 A;  4GNK B;  1ODB A;  2LUX A;  1WRK A;  3BUW B;  1F4O A;  3HCM A;  1SCM C;  1SCV A;  2IS9 A;  5JJG A;  1EL4 A;  2PVB A;  2OPO A;  1J55 A;  4CFR A;  2LV7 A;  1RK9 A;  1SPY A;  2R2I A;  3BUN B;  1UWO A;  3LK0 A;  4USL A;  1AJ4 A;  3LLE A;  1FF1 A;  3JTD C;  3OB2 B;  3IQQ A;  1YVL A;  2AUC A;  2WND A;  1B7T Z;  1S6J A;  2M49 B;  1XVJ A;  2KFG A;  3BUX B;  4MZL A;  3CR5 X;  1BT6 A;  2L51 A;  2M29 A;  1SK6 D;  1Y1U A;  1V1G A;  4QJ4 B;  2BL0 B;  2OS8 B;  3SJS A;  2LMV A;  2LUC A;  4M2O A;  3NXA A;  5K89 A;  4DS7 A;  2JQ6 A;  2TN4 A;  3D0Y A;  3VRN A;  1OMV A;  1DJI A;  1Y6W A;  5DKR A;  3ZNI A;  3I5F C;  3JVT B;  1W7J B;  3TUY C;  4CID A;  4PHJ A;  1UHJ A;  1QLK A;  2G2B A;  3CGA A;  2LLU A;  2MRD A;  1S6I A;  1YTZ C;  2BCX A;  1FBV A;  3O78 A;  5HYD A;  5HLO A;  4HRG A;  1FW4 A;  1NX2 A;  3A8R A;  3CTN A;  2JWW A;  1CNP A;  1J1E A;  2BCB A;  1CTR A;  3IF7 A;  1KSO A;  1AJ5 A;  4YGD B;  4HRE E;  3NSI A;  1WDC C;  5CSI A;  5ER5 A;  1BMO A;  4C0J A;  1AHR A;  1UHH A;  3BOW A;  2CTN A;  1YX8 A;  5D7F A;  1CM1 A;  4YBH B;  2M7L A;  1FI5 A;  1QX2 A;  3OX6 A;  4N1G A;  3GK2 A;  2OS8 C;  1NX1 A;  2PMY A;  4MZK A;  1S3P A;  1BJF A;  2MJW B;  1TNP A;  3SG3 A;  3AAK A;  2JXC A;  2KDH A;  1NX0 A;  1LVC D;  2LVK A;  3NSO A;  1IH0 A;  3KO0 A;  2GGM A;  3TDU A;  3GOF A;  2JPT A;  2JTZ A;  1U5I A;  1A75 A;  1MQ1 A;  1R6P A;  1KQV A;  5AAN A;  1DJG A;  1RTP 1;  1CM4 A;  3F45 A;  4I5J A;  1DVI A;  1SBJ A;  4CLN A;  1OOJ A;  1TIZ A;  1MUX A;  3DVE A;  1Y1X A;  5DKQ A;  2KYF A;  2AMI A;  1CDM A;  2JT0 A;  1UHI A;  1BU3 A;  1QIW A;  1M63 B;  2NCO A;  1K96 A;  3BYA A;  3I5G C;  4XYN A;  1OZO A;  2M1K B;  3D0Y B;  2KBI A;  1J7P A;  4A4B A;  2KBM A;  1QTX A;  2ZRS A;  1SNL A;  5I8N A;  1CLB A;  1N65 A;  3AAJ A;  1GJY A;  4TNC A;  3EVU A;  4DCK A;  2EC6 B;  1IG5 A;  1MR8 A;  2JNX A;  4JQ0 D;  1SW8 A;  2M1U A;  2JZI A;  5CSF A;  2CCM A;  3DVJ A;  1ZOT B;  4GFT A;  2HET A;  1DT7 B;  1KSM A;  2F3Y A;  3PAL A;  4I5K A;  1J1D A;  1SCM B;  1K93 D;  1NSH A;  4N1F A;  1CLM A;  1LKJ A;  2KHN A;  2OTG C;  1F8H A;  1CMF A;  1B8C A;  2L4H A;  2QPT A;  3BOW B;  2ISD A;  3JTD B;  5CPV A;  1RWY A;  2AAO A;  1XFU O;  4FTG A;  3LCP C;  1SL8 A;  2LE9 B;  2V53 A;  3BQ3 A;  3CR4 X;  3NSL A;  1C7V A;  2WOS A;  1YX7 A;  2WC8 A;  4M2Q A;  1KCY A;  2ZN9 A;  3PAT A;  3M0W A;  3OX5 A;  4PDZ A;  1XYD A;  5CSN A;  1YRU B;  5JOL A;  3VRO A;  1WRL A;  2MAZ A;  4YI9 A;  4YRU A;  1YVH A;  3TZ1 A;  2ZFD A;  1BR4 B;  1QIV A;  5KU1 A;  4WQ2 A;  2EGD A;  2EC6 C;  2ZN8 A;  1PUL A;  4NDB A;  1LXF C;  1A75 B;  3TUY B;  1K8U A;  2CBL A;  1Y1A A;  2LHI A;  3TDZ A;  4UPG A;  2M8U A;  1JUO A;  3KPX A;  1SMG A;  3ICB A;  4XJK A;  4MLW A;  2JUL A;  5F6T A;  1GGZ A;  3FWB A;  3BXK A;  1XA5 A;  2CT9 A;  2RGI A;  3PSR A;  5TNC A;  2M7N A;  4GAO A;  4MRX A;  2KNE A;  3QRX A;  4GBA A;  4PHN A;  2B1U A;  3PN7 C;  1WDC B;  2K7D A;  3I5I C;  2QAC A;  2F3Z A;  3BUO B;  1JWD A;  3GK4 X;  4WQ3 A;  1QXP A;  4AOM A;  2Q4U A;  4PCW A;  1K90 D;  1PVA A;  1SL9 A;  2K7C A;  2EHB A;  1KK7 Z;  1B7T Y;  1Q80 A;  1EXR A;  1KFU L;  2K8M B;  1E8A A;  2DOQ A;  1MF8 B;  2COL B;  2H61 C;  1IRJ A;  4I5L B;  4WRI A;  1L2O C;  1LIN A;  3CZT X;  3OHM B;  1F71 A;  4ZCU A;  1OMD A;  3CR2 A;  3DVK A; 
#chains in the Genus database with same CATH topology
 1BR1 B;  4HSZ A;  1FPW A;  2GGZ A;  2JRF A;  4JKT A;  1OQP A;  1YUS A;  2KQ6 A;  2BCA A;  2SCP A;  3KEV A;  3D74 A;  1BOC A;  4AQI A;  2ZRT A;  1DF0 A;  1GQM A;  1YR5 A;  2F8P A;  3DVM A;  3EVV A;  2ZNE A;  3O2P A;  1SKT A;  1XK4 A;  3KHE A;  3K21 A;  5CSJ A;  1OOI X;  1XFX O;  4DRW A;  3H4S E;  1KWO B;  1DTL A;  1SR6 B;  2KAV A;  2PQL A;  4MEW A;  4YGB B;  3DF0 A;  1SRA A;  1HT9 A;  4YGC B;  1S1E A;  1NCX A;  1DJY A;  1K95 A;  2WCJ A;  3I5G B;  3TDI A;  3CDN A;  1QJT A;  1UUR A;  3C1V A;  3D76 A;  3EKH A;  2WCE A;  4OV2 A;  1SSE B;  5DKN A;  3SG4 A;  2KI4 C;  4FQO A;  3B7A A;  2M3W A;  2MA2 A;  1IQ5 A;  1OOH A;  3OGN A;  2LLT A;  1ZUZ A;  4NQG A;  1NWD A;  4OKH A;  1S5G Z;  2E6W A;  4DUQ A;  2H2K A;  1W7I B;  2L2E A;  3NHT A;  4XJK B;  1PK0 D;  1QLS A;  3Q8I A;  1ZAC A;  1EH2 A;  1MHO A;  2H61 A;  1WY9 A;  5AXI A;  3L4L A;  2ZKM X;  2MHH A;  3O4Y A;  3PM2 A;  1OSA A;  3GK1 A;  3CLN A;  3DY9 A;  1X02 A;  4PE1 A;  1K2H A;  4MN0 A;  2L5X B;  2OTG B;  1A2X A;  2WCF A;  1G33 A;  1XO5 A;  1KWO C;  1SR6 C;  4R1E A;  2K7B A;  2BE6 A;  1L7Z A;  1PSR A;  1DJX A;  3PFV A;  1J7Q A;  2G9B A;  3SS3 A;  2FJY A;  3FE8 A;  5HKZ A;  1JFJ A;  2KFH A;  5KTY A;  4HRH A;  3IVT A;  1AVS A;  1V1F A;  1B8L A;  2FCE A;  4GGF C;  1REC A;  3RLZ A;  3WNX B;  1C07 A;  4MZJ A;  5KSZ A;  1H4B A;  2GV5 A;  1RJV A;  2LLS A;  1K9U A;  2F2O A;  4F7F A;  1B47 A;  1RFJ A;  2JU0 A;  3OB1 B;  1NIW A;  1G4Y R;  4PE4 A;  1TOP A;  1YRT B;  3HX4 A;  1DF0 B;  2LVI A;  3S0G A;  2LMU A;  4Q04 A;  1EG4 A;  1QV0 A;  2NCP A;  3A4U B;  1KFU S;  3PM8 A;  4ORB B;  4CPV A;  2L98 A;  4JWQ A;  2KPH A;  1DJH A;  2LNK A;  2WCL A;  4N5X A;  3WHT B;  2WCK A;  1QV1 A;  4CFQ A;  1QAS A;  3EK7 A;  3R1V A;  3DF0 B;  1DEK A;  1S36 A;  3SIB A;  5GQQ C;  1NP8 A;  1CKK A;  1UHK A;  3TS5 C;  3FWC A;  3SG7 A;  3O6B A;  1M39 A;  1IWQ A;  1ALW A;  2CXJ A;  2LAN A;  3PN7 B;  2P70 A;  2BNX A;  3I5I B;  4IJ7 A;  1SYM A;  1S26 D;  1A4P A;  3LL8 B;  1HQV A;  1JC2 A;  1XFV O;  3OBV A;  3VRP A;  3VRQ A;  3IQO A;  4MBE A;  2L5Y A;  1XFW O;  4PE0 A;  4ZCV A;  2LCP A;  3EG5 B;  4GGF A;  3SS4 A;  4D1E A;  1BG1 A;  1VRK A;  1L2O B;  2JT3 A;  5HLV A;  1CDP A;  1TRF A;  4PHK A;  5G08 A;  4INW A;  4DIR A;  1U5I B;  1JF0 A;  1MXL C;  1KFX L;  2QEH A;  1N2D A;  3S0E A;  1CFF A;  5I2L A;  1D1O A;  2ZND A;  4AQJ A;  3CYZ A;  1XK4 C;  1KK8 C;  3V2L A;  5FI2 A;  2HPS A;  2KLE A;  4PE7 A;  2LP2 A;  1M45 A;  2JNF A;  4BY5 A;  4ICB A;  3NGV A;  2JXL A;  2F2P A;  5AEQ A;  2KFF A;  2Y1N A;  5BPJ A;  1MWN A;  2BKI B;  2JTT A;  2PAS A;  1F70 A;  1R2U A;  5HKY A;  2QEV A;  1IJ6 A;  1NCY A;  3NSK A;  1CFC A;  3EK8 A;  2LHL A;  3WHU B;  4U8D A;  2HQ8 A;  1BLQ A;  5HL1 A;  3BJH A;  1F4Q A;  4PHM A;  2YGU A;  1YUR A;  1DGV A;  2L2C A;  2A4J A;  1UUS A;  2KI4 B;  2BAP A;  2HQW A;  2LC5 A;  1BF5 A;  1IQ3 A;  1DJW A;  4QJ5 B;  2MBX A;  2L4I A;  2I94 A;  1CDN A;  3FE9 A;  3SG2 A;  1B1G A;  1KK7 Y;  2Y5I A;  2KAY A;  3SG5 A;  4MVF A;  2O5G A;  1YUU A;  3EVR A;  5PAL A;  1B9A A;  2JT8 A;  4PT1 A;  1TNX A;  2HF5 A;  1F54 A;  1J7R A;  2PAL A;  1DGU A;  1OOG A;  1WLZ A;  1UHN A;  2PSR A;  3LK1 A;  5AFP A;  1EG3 A;  3I5H C;  4I5N B;  2CNP A;  3S0B A;  2FOT A;  2VRG A;  1ZFS A;  1F55 A;  1RRO A;  1WLM A;  2WCH A;  1B4C A;  1IIO A;  1A29 A;  1XFR A;  3CZ2 A;  4A4C A;  1CFP A;  1K94 A;  1NPQ A;  1IKU A;  3E3R A;  4JD9 A;  4GPL B;  3DD4 A;  4M2P A;  2NLN A;  4ORA B;  1M46 A;  1OMR A;  2KAX A;  5IBW A;  2WOR A;  2I7A A;  5I2O A;  1NYA A;  3B6X A;  4NDD A;  3MSE B;  3SIA A;  1JBA A;  2K2F A;  1TNQ A;  1GGW A;  3PLF B;  1TCF A;  1QS7 A;  2Y1M A;  1CMG A;  1Z2C B;  3AKB A;  3OP0 A;  2JOJ A;  1AP4 A;  1S5G Y;  1ZMZ A;  1T14 A;  4IL1 A;  5ER4 X;  4F0Z B;  4L9M A;  1EJ3 A;  2LVV A;  2K61 A;  4NDC A;  3ZWH A;  2K0J A;  1TNW A;  2KOT A;  1KFX S;  1NUB A;  1NX3 A;  1J7O A;  3TS5 B;  3D75 A;  2LAP A;  3B87 A;  2BL0 C;  1QAT A;  2LM5 A;  4JPZ B;  4MRY A;  1OE9 B;  2KQY A;  3PJI A;  4GGN A;  3D78 A;  2BBN A;  4YI8 A;  3JVT C;  2WCM A;  2M97 A;  1PVB A;  1CFD A;  2NXQ A;  2FCD A;  1TCO B;  3CZ1 A;  2BKH B;  4E68 A;  3VRR A;  1TN4 A;  4OVN F;  1K9P A;  2MLE C;  3CS1 A;  1JF2 A;  1B8R A;  2BE4 A;  2LP3 A;  2SAS A;  3FIA A;  4C0K A;  1IGV A;  1JSA A;  1QX7 A;  1XFZ O;  2K2A A;  2JC2 A;  1AUI B;  1LA0 A;  3R72 A;  1YUT A;  4MSP A;  2KI6 D;  4P5O E;  3RM1 A;  3SG6 A;  1KK8 B;  1XFY O;  1DJZ A;  1KQM B;  1LA3 A;  2BBM A;  2LMT A;  4YGA A;  1Y0V H;  1CDL A;  2F33 A;  2KI6 C;  1BOD A;  3NHI A;  2KYC A;  3BUM B;  1CLL A;  2LVJ A;  1MXE A;  3AKA A;  2ERB A;  1DMO A;  1QVI Z;  1CB1 A;  2NZ0 A;  1TTX A;  1JFK A;  1GM0 A;  4ETO A;  2MLF C;  2I2R E;  5J3X A;  2BEC A;  1QVI Y;  3EKJ A;  3KF9 A;  5D69 A;  2M0R A;  1A03 A;  1N0Y A;  4OZD A;  1PAL A;  4ORC B;  5B8I B;  2D8N A;  4QJ3 B;  4YGE B;  4OR9 B;  4OCI A;  2Q91 A;  2KGR A;  1S6C A;  3CWG A;  1K9K A;  2KGB C;  1G8I A;  2PRU A;  1M31 A;  2E30 A;  1H8B A;  4C0L A;  2P71 A;  3I5H B;  1KQM C;  3B86 A;  5FI6 A;  1NCZ A;  1OZS A;  5I94 A;  1FI6 A;  2JPO A;  2L50 A;  1IJ5 A;  4PAL A;  2WCB A;  1PRW A;  1SY9 A;  1WRZ A;  2Y4Q A;  3FS7 A;  4BY4 A;  5I2Q A;  2FJU B;  1AK8 A;  3EK4 A;  2K60 A;  3D10 A;  5D3O A;  3WXA A;  1PSB A;  1ALV A;  2I18 A;  1QX5 B;  2K7O A;  5AER A;  5FYX A;  2KSP A;  3I5F B;  5HKW A;  4P2Y B;  2P6B B;  4GUK A;  1C7W A;  2L0P A;  1UP5 A;  2M9G A;  2O60 A;  5DIC A;  1SL7 A;  3VGO A;  4GNK B;  1ODB A;  2LUX A;  3BFB A;  1C3Y A;  3VB1 A;  1WRK A;  3BUW B;  1F4O A;  3HCM A;  1SCM C;  1SCV A;  2IS9 A;  5JJG A;  1EL4 A;  2PVB A;  2OPO A;  1J55 A;  4CFR A;  2LV7 A;  1RK9 A;  1SPY A;  2R2I A;  3BUN B;  1UWO A;  3LK0 A;  4USL A;  1AJ4 A;  3LLE A;  3QME A;  1FF1 A;  3JTD C;  3OB2 B;  1LS8 A;  3S0A A;  3IQQ A;  1YVL A;  2AUC A;  2WND A;  4FQT A;  1B7T Z;  1S6J A;  2M49 B;  1XVJ A;  2KFG A;  3BUX B;  4MZL A;  3BFH A;  3CR5 X;  1BT6 A;  2L51 A;  2M29 A;  4KYN A;  1SK6 D;  1Y1U A;  1V1G A;  4QJ4 B;  3RZS A;  2BL0 B;  2OS8 B;  3SJS A;  2LMV A;  2LUC A;  4M2O A;  3NXA A;  5K89 A;  4DS7 A;  2JQ6 A;  2TN4 A;  3D0Y A;  3VRN A;  1OMV A;  1DJI A;  1Y6W A;  3UO9 A;  5DKR A;  3ZNI A;  2WC6 A;  3I5F C;  3JVT B;  1DC1 A;  1W7J B;  3K1E A;  3TUY C;  4CID A;  4PHJ A;  1UHJ A;  1QLK A;  2G2B A;  3CGA A;  2LLU A;  2MRD A;  1S6I A;  1YTZ C;  2BCX A;  1FBV A;  3O78 A;  5HYD A;  5HLO A;  3UNW A;  4HRG A;  1FW4 A;  1NX2 A;  3A8R A;  3CTN A;  2JWW A;  1CNP A;  1J1E A;  5FI7 A;  2BCB A;  4INX A;  1CTR A;  3IF7 A;  1KSO A;  1AJ5 A;  4YGD B;  4HRE E;  3NSI A;  1WDC C;  2H8V A;  5CSI A;  5ER5 A;  1BMO A;  4C0J A;  1AHR A;  1OOF A;  1UHH A;  3BOW A;  2CTN A;  1YX8 A;  5D7F A;  1CM1 A;  4YBH B;  2M7L A;  1FI5 A;  1QX2 A;  1QWV A;  3OX6 A;  3GK2 A;  4N1G A;  2OS8 C;  1NX1 A;  2PMY A;  4MZK A;  1S3P A;  1BJF A;  2MJW B;  1TNP A;  3O4X A;  3SG3 A;  3AAK A;  2JXC A;  2KDH A;  3L4A A;  1NX0 A;  1LVC D;  2LVK A;  3NSO A;  1IH0 A;  3KO0 A;  2GGM A;  3TDU A;  3GOF A;  3N7H A;  2JPT A;  2JTZ A;  3D77 A;  1U5I A;  1A75 A;  2QEB A;  1MQ1 A;  1R6P A;  1KQV A;  5AAN A;  1DJG A;  1RTP 1;  1CM4 A;  3F45 A;  4I5J A;  1DVI A;  1SBJ A;  4CLN A;  1OOJ A;  1TIZ A;  1MUX A;  3DVE A;  1Y1X A;  5DKQ A;  2KYF A;  2AMI A;  1CDM A;  2JT0 A;  1UHI A;  1BU3 A;  1QIW A;  1M63 B;  2NCO A;  1K96 A;  3BYA A;  3I5G C;  3FE6 A;  4XYN A;  3R1O A;  1TUJ A;  1OW4 A;  1OZO A;  2M1K B;  3D0Y B;  2KBI A;  3L47 A;  1J7P A;  4A4B A;  2KBM A;  1QTX A;  2ZRS A;  1SNL A;  5I8N A;  1CLB A;  1N65 A;  3AAJ A;  1GJY A;  4TNC A;  3EVU A;  4DCK A;  2EC6 B;  1IG5 A;  1MR8 A;  3SS5 A;  3R1P A;  2JNX A;  4JQ0 D;  1SW8 A;  3D73 A;  3DYE A;  2M1U A;  2JZI A;  5CSF A;  2CCM A;  3DVJ A;  1TWO A;  1ZOT B;  3DZT A;  4GFT A;  2HET A;  1DT7 B;  1KSM A;  2F3Y A;  3PAL A;  4I5K A;  1J1D A;  1SCM B;  1K93 D;  1NSH A;  2PYQ A;  4N1F A;  1CLM A;  1LKJ A;  2KHN A;  2OTG C;  1F8H A;  1CMF A;  1B8C A;  2L4H A;  2QPT A;  3BOW B;  1ORG A;  5EL2 A;  2ISD A;  3JTD B;  5CPV A;  1RWY A;  1Z4H A;  2AAO A;  1XFU O;  4FTG A;  3LCP C;  1SL8 A;  2GTE A;  2LE9 B;  2V53 A;  3BQ3 A;  3CR4 X;  3NSL A;  1C7V A;  2WOS A;  3DXL A;  1YX7 A;  2WC8 A;  4M2Q A;  1KCY A;  2ZN9 A;  2QDI A;  3B88 A;  3CZ0 A;  3PAT A;  3M0W A;  3OX5 A;  4PDZ A;  1XYD A;  5CSN A;  1YRU B;  5JOL A;  3VRO A;  1WRL A;  2QEO A;  2MAZ A;  4YI9 A;  4YRU A;  1YVH A;  3TZ1 A;  2ZFD A;  1BR4 B;  1DQE A;  1QIV A;  1W9Z A;  5KU1 A;  3BFA A;  4WQ2 A;  2EGD A;  2EC6 C;  2ZN8 A;  1PUL A;  4NDB A;  1LXF C;  1A75 B;  3TUY B;  1K8U A;  2CBL A;  1Y1A A;  2LHI A;  3TDZ A;  3S0D A;  3CAB A;  2M8U A;  4UPG A;  1JUO A;  3KPX A;  1SMG A;  3ICB A;  4XJK A;  4MLW A;  2JUL A;  5F6T A;  1GGZ A;  3FWB A;  3BXK A;  1XA5 A;  2CT9 A;  2RGI A;  3PSR A;  3S0F A;  5TNC A;  2M7N A;  4GAO A;  4MRX A;  2KNE A;  3QRX A;  4GBA A;  4PHN A;  2B1U A;  3PN7 C;  1WDC B;  2K7D A;  3I5I C;  2QAC A;  2F3Z A;  3BUO B;  1C3Z A;  1JWD A;  3GK4 X;  4WQ3 A;  1QXP A;  4AOM A;  2KLD A;  2Q4U A;  1DEL A;  4PCW A;  1P28 A;  1K90 D;  1PVA A;  1SL9 A;  2K7C A;  2EHB A;  1KK7 Z;  2WC5 A;  1B7T Y;  1Q80 A;  1EXR A;  1KFU L;  2K8M B;  1E8A A;  2DOQ A;  1MF8 B;  2COL B;  2H61 C;  1IRJ A;  4I5L B;  4WRI A;  1L2O C;  1LIN A;  3CZT X;  3OHM B;  1F71 A;  4ZCU A;  1OMD A;  3CR2 A;  3DVK A;  1TUZ A; 
#chains in the Genus database with same CATH homology
 1BR1 B;  4HSZ A;  1FPW A;  2GGZ A;  2JRF A;  1OQP A;  1YUS A;  2KQ6 A;  2BCA A;  2SCP A;  3KEV A;  1BOC A;  4AQI A;  2ZRT A;  1DF0 A;  1GQM A;  1YR5 A;  2F8P A;  3DVM A;  3EVV A;  2ZNE A;  3O2P A;  1SKT A;  1XK4 A;  3KHE A;  3K21 A;  5CSJ A;  1XFX O;  4DRW A;  3H4S E;  1KWO B;  1DTL A;  1SR6 B;  2KAV A;  4MEW A;  4YGB B;  3DF0 A;  1SRA A;  1HT9 A;  4YGC B;  1S1E A;  1NCX A;  1DJY A;  1K95 A;  3I5G B;  3TDI A;  1QJT A;  1UUR A;  3C1V A;  3EKH A;  2WCE A;  4OV2 A;  5DKN A;  3SG4 A;  2KI4 C;  4FQO A;  2M3W A;  2MA2 A;  1IQ5 A;  2LLT A;  1ZUZ A;  4NQG A;  1NWD A;  4OKH A;  1S5G Z;  2E6W A;  4DUQ A;  2H2K A;  1W7I B;  2L2E A;  4XJK B;  1PK0 D;  1QLS A;  1EH2 A;  1ZAC A;  1MHO A;  2H61 A;  1WY9 A;  5AXI A;  3O4Y A;  2ZKM X;  2MHH A;  1OSA A;  3GK1 A;  3CLN A;  4PE1 A;  1X02 A;  1K2H A;  4MN0 A;  2L5X B;  2OTG B;  1A2X A;  2WCF A;  1G33 A;  1XO5 A;  1KWO C;  1SR6 C;  4R1E A;  2K7B A;  2BE6 A;  1L7Z A;  1PSR A;  1DJX A;  3PFV A;  1J7Q A;  2G9B A;  5HKZ A;  1JFJ A;  2KFH A;  5KTY A;  4HRH A;  4GGF C;  1AVS A;  1V1F A;  1B8L A;  2FCE A;  3WNX B;  1REC A;  3RLZ A;  1C07 A;  4MZJ A;  5KSZ A;  1H4B A;  2GV5 A;  1RJV A;  2LLS A;  1K9U A;  2F2O A;  1B47 A;  1RFJ A;  2JU0 A;  3OB1 B;  1NIW A;  1G4Y R;  4PE4 A;  1TOP A;  1YRT B;  3HX4 A;  1DF0 B;  2LVI A;  2LMU A;  4Q04 A;  1EG4 A;  1QV0 A;  2NCP A;  3A4U B;  1KFU S;  3PM8 A;  4ORB B;  4CPV A;  2L98 A;  4JWQ A;  4N5X A;  1DJH A;  2LNK A;  3WHT B;  1QV1 A;  4CFQ A;  1QAS A;  3EK7 A;  3DF0 B;  1S36 A;  3SIB A;  5GQQ C;  1NP8 A;  1CKK A;  1UHK A;  3TS5 C;  3FWC A;  3SG7 A;  3O6B A;  1M39 A;  1IWQ A;  1ALW A;  2CXJ A;  2LAN A;  3PN7 B;  3I5I B;  1SYM A;  1S26 D;  1A4P A;  3LL8 B;  1HQV A;  1JC2 A;  1XFV O;  3VRP A;  3VRQ A;  3IQO A;  4MBE A;  1XFW O;  4PE0 A;  4ZCV A;  2LCP A;  4GGF A;  4D1E A;  1BG1 A;  1VRK A;  1L2O B;  2JT3 A;  5HLV A;  1CDP A;  1TRF A;  4PHK A;  5G08 A;  4DIR A;  1U5I B;  1JF0 A;  1MXL C;  1KFX L;  1N2D A;  1CFF A;  5I2L A;  1D1O A;  2ZND A;  4AQJ A;  1XK4 C;  1KK8 C;  2HPS A;  4PE7 A;  2LP2 A;  1M45 A;  2JNF A;  4BY5 A;  4ICB A;  2JXL A;  2F2P A;  5AEQ A;  2KFF A;  2Y1N A;  5BPJ A;  1MWN A;  2BKI B;  2JTT A;  2PAS A;  1F70 A;  1R2U A;  5HKY A;  1IJ6 A;  1NCY A;  3NSK A;  1CFC A;  3EK8 A;  2LHL A;  3WHU B;  4U8D A;  2HQ8 A;  1BLQ A;  1F4Q A;  4PHM A;  1YUR A;  1DGV A;  2A4J A;  1UUS A;  2KI4 B;  2HQW A;  2LC5 A;  1BF5 A;  1IQ3 A;  1DJW A;  4QJ5 B;  2MBX A;  2L4I A;  2I94 A;  1CDN A;  3SG2 A;  1B1G A;  1KK7 Y;  2Y5I A;  2KAY A;  3SG5 A;  4MVF A;  2O5G A;  1YUU A;  3EVR A;  5PAL A;  1B9A A;  2JT8 A;  1TNX A;  2HF5 A;  1F54 A;  1J7R A;  2PAL A;  1DGU A;  1WLZ A;  2PSR A;  1UHN A;  3LK1 A;  5AFP A;  1EG3 A;  3I5H C;  4I5N B;  2CNP A;  2FOT A;  2VRG A;  1ZFS A;  1F55 A;  1RRO A;  1WLM A;  1B4C A;  1A29 A;  4A4C A;  1CFP A;  1K94 A;  1NPQ A;  1IKU A;  3E3R A;  4GPL B;  3DD4 A;  4M2P A;  2NLN A;  4ORA B;  1M46 A;  1OMR A;  2KAX A;  5IBW A;  2WOR A;  2I7A A;  5I2O A;  1NYA A;  4NDD A;  3MSE B;  3SIA A;  1JBA A;  2K2F A;  1TNQ A;  1GGW A;  3PLF B;  1TCF A;  1QS7 A;  2Y1M A;  1CMG A;  3AKB A;  3OP0 A;  2JOJ A;  1AP4 A;  1S5G Y;  1ZMZ A;  4IL1 A;  5ER4 X;  4F0Z B;  4L9M A;  1EJ3 A;  2LVV A;  2K61 A;  4NDC A;  3ZWH A;  2K0J A;  1TNW A;  2KOT A;  1KFX S;  1NUB A;  1NX3 A;  1J7O A;  3TS5 B;  2LAP A;  2BL0 C;  1QAT A;  2LM5 A;  4JPZ B;  4MRY A;  1OE9 B;  2KQY A;  4GGN A;  2BBN A;  4YI8 A;  3JVT C;  2M97 A;  1PVB A;  1CFD A;  2NXQ A;  2FCD A;  1TCO B;  2BKH B;  4E68 A;  3VRR A;  1TN4 A;  4OVN F;  1K9P A;  2MLE C;  3CS1 A;  1JF2 A;  1B8R A;  2BE4 A;  2LP3 A;  2SAS A;  3FIA A;  4C0K A;  1IGV A;  1JSA A;  1QX7 A;  1XFZ O;  2K2A A;  2JC2 A;  1AUI B;  1LA0 A;  4MSP A;  1YUT A;  3RM1 A;  2KI6 D;  4P5O E;  3SG6 A;  1KK8 B;  1XFY O;  1DJZ A;  1KQM B;  1LA3 A;  2BBM A;  2LMT A;  4YGA A;  1Y0V H;  1CDL A;  2F33 A;  2KI6 C;  1BOD A;  2KYC A;  3BUM B;  1CLL A;  2LVJ A;  1MXE A;  3AKA A;  1DMO A;  1QVI Z;  1CB1 A;  2NZ0 A;  1TTX A;  1JFK A;  4ETO A;  2MLF C;  2I2R E;  5J3X A;  2BEC A;  1QVI Y;  3EKJ A;  3KF9 A;  5D69 A;  2M0R A;  1A03 A;  1N0Y A;  1PAL A;  4ORC B;  5B8I B;  2D8N A;  4QJ3 B;  4YGE B;  4OR9 B;  4OCI A;  2Q91 A;  2KGR A;  1S6C A;  3CWG A;  1K9K A;  2KGB C;  1G8I A;  2PRU A;  1M31 A;  2E30 A;  1H8B A;  4C0L A;  3I5H B;  1KQM C;  1NCZ A;  1OZS A;  1FI6 A;  4PAL A;  2L50 A;  1IJ5 A;  2WCB A;  1PRW A;  1SY9 A;  1WRZ A;  2Y4Q A;  3FS7 A;  4BY4 A;  5I2Q A;  2FJU B;  1AK8 A;  3EK4 A;  3D10 A;  3WXA A;  1PSB A;  1ALV A;  2I18 A;  1QX5 B;  2K7O A;  5AER A;  5FYX A;  2KSP A;  3I5F B;  5HKW A;  4P2Y B;  2P6B B;  4GUK A;  1C7W A;  2L0P A;  1UP5 A;  2M9G A;  2O60 A;  3VGO A;  1SL7 A;  4GNK B;  1ODB A;  2LUX A;  1WRK A;  3BUW B;  1F4O A;  3HCM A;  1SCM C;  1SCV A;  2IS9 A;  5JJG A;  1EL4 A;  2PVB A;  2OPO A;  1J55 A;  4CFR A;  2LV7 A;  1RK9 A;  1SPY A;  2R2I A;  3BUN B;  1UWO A;  3LK0 A;  4USL A;  1AJ4 A;  3LLE A;  1FF1 A;  3JTD C;  3OB2 B;  3IQQ A;  1YVL A;  2AUC A;  2WND A;  1B7T Z;  1S6J A;  2M49 B;  1XVJ A;  2KFG A;  3BUX B;  4MZL A;  3CR5 X;  1BT6 A;  2L51 A;  2M29 A;  1SK6 D;  1Y1U A;  1V1G A;  4QJ4 B;  2BL0 B;  2OS8 B;  3SJS A;  2LMV A;  2LUC A;  4M2O A;  3NXA A;  5K89 A;  4DS7 A;  2JQ6 A;  2TN4 A;  3D0Y A;  3VRN A;  1OMV A;  1DJI A;  1Y6W A;  5DKR A;  3ZNI A;  3I5F C;  3JVT B;  1W7J B;  3TUY C;  4CID A;  4PHJ A;  1UHJ A;  1QLK A;  2G2B A;  3CGA A;  2LLU A;  2MRD A;  1S6I A;  1YTZ C;  2BCX A;  1FBV A;  3O78 A;  5HYD A;  5HLO A;  4HRG A;  1FW4 A;  1NX2 A;  3A8R A;  3CTN A;  2JWW A;  1CNP A;  1J1E A;  2BCB A;  1CTR A;  3IF7 A;  1KSO A;  1AJ5 A;  4YGD B;  4HRE E;  3NSI A;  1WDC C;  5CSI A;  5ER5 A;  1BMO A;  4C0J A;  1AHR A;  1UHH A;  3BOW A;  2CTN A;  1YX8 A;  5D7F A;  1CM1 A;  4YBH B;  2M7L A;  1FI5 A;  1QX2 A;  3OX6 A;  4N1G A;  3GK2 A;  2OS8 C;  1NX1 A;  2PMY A;  4MZK A;  1S3P A;  1BJF A;  2MJW B;  1TNP A;  3SG3 A;  3AAK A;  2JXC A;  2KDH A;  1NX0 A;  1LVC D;  2LVK A;  3NSO A;  1IH0 A;  3KO0 A;  2GGM A;  3TDU A;  3GOF A;  2JPT A;  2JTZ A;  1U5I A;  1A75 A;  1MQ1 A;  1R6P A;  1KQV A;  5AAN A;  1DJG A;  1RTP 1;  1CM4 A;  3F45 A;  4I5J A;  1DVI A;  1SBJ A;  4CLN A;  1OOJ A;  1TIZ A;  1MUX A;  3DVE A;  1Y1X A;  5DKQ A;  2KYF A;  2AMI A;  1CDM A;  2JT0 A;  1UHI A;  1BU3 A;  1QIW A;  1M63 B;  2NCO A;  1K96 A;  3BYA A;  3I5G C;  4XYN A;  1OZO A;  2M1K B;  3D0Y B;  2KBI A;  1J7P A;  4A4B A;  2KBM A;  1QTX A;  2ZRS A;  1SNL A;  5I8N A;  1CLB A;  1N65 A;  3AAJ A;  1GJY A;  4TNC A;  3EVU A;  4DCK A;  2EC6 B;  1IG5 A;  1MR8 A;  2JNX A;  4JQ0 D;  1SW8 A;  2M1U A;  2JZI A;  5CSF A;  2CCM A;  3DVJ A;  1ZOT B;  4GFT A;  2HET A;  1DT7 B;  1KSM A;  2F3Y A;  3PAL A;  4I5K A;  1J1D A;  1SCM B;  1K93 D;  1NSH A;  4N1F A;  1CLM A;  1LKJ A;  2KHN A;  2OTG C;  1F8H A;  1CMF A;  1B8C A;  2L4H A;  2QPT A;  3BOW B;  2ISD A;  3JTD B;  5CPV A;  1RWY A;  2AAO A;  1XFU O;  4FTG A;  3LCP C;  1SL8 A;  2LE9 B;  2V53 A;  3BQ3 A;  3CR4 X;  3NSL A;  1C7V A;  2WOS A;  1YX7 A;  2WC8 A;  4M2Q A;  1KCY A;  2ZN9 A;  3PAT A;  3M0W A;  3OX5 A;  4PDZ A;  1XYD A;  5CSN A;  1YRU B;  5JOL A;  3VRO A;  1WRL A;  2MAZ A;  4YI9 A;  4YRU A;  1YVH A;  3TZ1 A;  2ZFD A;  1BR4 B;  1QIV A;  5KU1 A;  4WQ2 A;  2EGD A;  2EC6 C;  2ZN8 A;  1PUL A;  4NDB A;  1LXF C;  1A75 B;  3TUY B;  1K8U A;  2CBL A;  1Y1A A;  2LHI A;  3TDZ A;  4UPG A;  2M8U A;  1JUO A;  3KPX A;  1SMG A;  3ICB A;  4XJK A;  4MLW A;  2JUL A;  5F6T A;  1GGZ A;  3FWB A;  3BXK A;  1XA5 A;  2CT9 A;  2RGI A;  3PSR A;  5TNC A;  2M7N A;  4GAO A;  4MRX A;  2KNE A;  3QRX A;  4GBA A;  4PHN A;  2B1U A;  3PN7 C;  1WDC B;  2K7D A;  3I5I C;  2QAC A;  2F3Z A;  3BUO B;  1JWD A;  3GK4 X;  4WQ3 A;  1QXP A;  4AOM A;  2Q4U A;  4PCW A;  1K90 D;  1PVA A;  1SL9 A;  2K7C A;  2EHB A;  1KK7 Z;  1B7T Y;  1Q80 A;  1EXR A;  1KFU L;  2K8M B;  1E8A A;  2DOQ A;  1MF8 B;  2COL B;  2H61 C;  1IRJ A;  4I5L B;  4WRI A;  1L2O C;  1LIN A;  3CZT X;  3OHM B;  1F71 A;  4ZCU A;  1OMD A;  3CR2 A;  3DVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...