1OZSA

C-domain of human cardiac troponin c in complex with the inhibitory region of human cardiac troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ozsA00
1K9KA 1WDCC 1J7QA 1YR5A 2L5XB 1KFUS 2G9BA 2WCEA 1IWQA 2WC8A 1M63B 1XFXO 2ZKMX 4CLNA 3CLNA 1DJWA 1PRWA 2AMIA 1OZSA 2KFGA 3PALA 4JPZB 4ZCUA 1K95A 4YGEB 4NQGA 4ETOA 5DKRA 1KFUL 1QIVA 2P6BB 3CR5X 3DVJA 4PHNA 1CKKA 4HRHA 1DVIA 1L2OB 1VRKA 2K2AA 1B8RA 1YUSA 3FS7A 1V1GA 1XVJA 5AERA 1DJHA 1YX8A 1SCMB 2MHHA 1M39A 1MQ1A 3VGOA 1DF0A 1TCOB 2BKHB 3EVRA 3JVTC 1JWDA 1MXEA 4QJ4B 4M2PA 1OOJA 2EHBA 2M0RA 1TIZA 3DF0B 2LVJA 1SNLA 2AUCA 1CDNA 1QLKA 2JT8A 3GK4X 2Q4UA 3EK8A 1MF8B 3IQOA 1J7PA 1Y1UA 3EK4A 1DMOA 1LVCD 1IGVA 2M29A 1PULA 3VRQA 2JNXA 2EC6C 2D8NA 3ICBA 2JWWA 2MJWB 2NZ0A 2LV7A 5AXIA 1K8UA 2AAOA 3SG5A 1KQVA 3EKHA 4CIDA 1BT6A 1NIWA 2KI4B 1TOPA 2JRFA 2M8UA 1UHKA 3AAKA 3CGAA 5AFPA 1R6PA 2MLEC 1IQ5A 1RFJA 1XK4A 2KQ6A 3KEVA 3OB1B 2OPOA 2GV5A 3OX6A 3DVEA 3I5HB 3AAJA 1K96A 2E6WA 2F3ZA 3HCMA 2MBXA 1JFJA 2EGDA 1K94A 1F4QA 2Y1NA 1QX5B 1JFKA 3LK1A 1B47A 2H61C 2M3WA 1LKJA 3I5GC 1IKUA 1N65A 4HREE 3D0YB 3D0YA 1NPQA 5CSIA 1S6IA 3O78A 2K7BA 2LMUA 1QX2A 1QS7A 1OSAA 3AKBA 1ODBA 2JNFA 3VRRA 1EL4A 4GFTA 4MEWA 4GGFA 1PSBA 1NSHA 1TNPA 5HKZA 5KSZA 4N1FA 3IF7A 1UHHA 2NLNA 1F4OA 2ZRTA 4FQOA 2BL0C 4E68A 2BBMA 1EG4A 3DD4A 4OR9B 3TUYC 2ZRSA 3OB2B 1M45A 3PFVA 3LCPC 4ORBB 4WQ2A 2WNDA 3OHMB 5DKQA 1L7ZA 3BYAA 1F70A 1B9AA 3SJSA 3OP0A 1S5GZ 1KWOB 3EK7A 1CM4A 4I5NB 1G33A 2FOTA 1C7VA 1ZUZA 3CS1A 2JXCA 2HPSA 2LAPA 1DTLA 2OTGC 2QACA 1S26D 2LLTA 4JWQA 1UHJA 1K9UA 3BUMB 4ORCB 1DJZA 1WRKA 1CTRA 1SR6B 3TZ1A 4WQ3A 2CXJA 3PN7C 1YVHA 2COLB 2O5GA 3PLFB 3TS5C 1ZFSA 1SK6D 2L51A 2CTNA 2LP3A 1QLSA 4Q04A 4C0LA 1LA3A 4YBHB 2NXQA 1C07A 4PE7A 1NYAA 2JXLA 5ER5A 4L9MA 1HT9A 1ZACA 1OMRA 5I2LA 3I5FC 1TTXA 1J7RA 4NDDA 3RLZA 4GGNA 2K7OA 4GBAA 5KTYA 2R2IA 1R2UA 4GPLB 2M9GA 2WCBA 5K89A 2M7NA 4OKHA 2JOJA 3AKAA 2OS8B 1TNWA 1JC2A 2M49B 1LXFC 4N1GA 3F45A 3D10A 2BBNA 1CLLA 4DUQA 4D1EA 2MLFC 1J7OA 4MRYA 1J55A 2ISDA 1DGVA 4JQ0D 2HETA 2ZN8A 2M1UA 3MSEB 1MHOA 1CMGA 1AJ4A 1WDCB 3FWCA 2TN4A 5JOLA 2KBIA 1C7WA 1IRJA 1UUSA 4PHMA 1S6JA 3O2PA 4YGCB 5FYXA 3DF0A 1OMVA 2KHNA 4MBEA 5I2QA 4PCWA 2HQ8A 2B1UA 5D7FA 3FIAA 1QV1A 2KYCA 1BODA 1PSRA 1TN4A 2LM5A 2FCEA 1YTZC 1KQMC 3GK2A 1Y1XA 1UHNA 1MR8A 2JZIA 2ZFDA 1CDMA 3BUOB 2KFHA 4ICBA 1SW8A 2WCFA 1A4PA 1W7IB 1K90D 1XFYO 3CR2A 1UWOA 1YRUB 1FPWA 1B7TY 2KI6C 5HLOA 3LLEA 1NUBA 4P2YB 5CSJA 1A2XA 4DIRA 1B7TZ 2LMTA 3NXAA 3BUXB 4ZCVA 5ER4X 1XFVO 2K61A 4MVFA 2L4HA 1XK4C 3VRNA 3JVTB 2HQWA 2JQ6A 2L50A 1J1EA 3CWGA 1M46A 4YRUA 1RROA 4MZLA 2M7LA 3SG7A 1PVBA 3A4UB 2Y5IA 3VROA 2QPTA 1FW4A 2LHLA 2LUXA 3EVUA 3GK1A 1CNPA 1WRZA 2EC6B 4MSPA 2M1KB 5HLVA 3ZWHA 4DRWA 1JSAA 1ZMZA 1FBVA 3M0WA 3RM1A 1ALVA 1IH0A 4A4CA 3I5IC 4XJKB 1SMGA 4XJKA 1RK9A 1BR4B 3BXKA 4PALA 1W7JB 4GGFC 3EKJA 2BKIB 1IJ5A 2PVBA 1JBAA 2NCPA 2LUCA 4M2QA 2CT9A 2JU0A 3HX4A 4GUKA 4CFQA 1WLZA 1GGWA 4F0ZB 2ZNEA 2ZNDA 1WY9A 2MA2A 2KI6D 3BQ3A 5CSNA 3WXAA 5KU1A 2JT0A 1UURA 3NSOA 5GQQC 4YI8A 4AQJA 2K0JA 2H61A 5HKWA 3NSIA 1Y1AA 1WRLA 2Q91A 4C0KA 1BOCA 2KSPA 1KK8C 2FCDA 5AANA 1CMFA 1BU3A 1B1GA 3CTNA 1XFZO 2BE4A 2PMYA 5HYDA 1AK8A 1QVIY 2LLSA 1BR1B 5J3XA 1BG1A 1X02A 1E8AA 1S1EA 4QJ3B 4GAOA 5F6TA 1N2DA 2F2PA 1NCYA 4QJ5B 4DCKA 2L2EA 2BL0B 1LINA 1A29A 2VRGA 1CFDA 1LA0A 2WORA 4PHJA 3PM8A 3TUYB 2BE6A 1GJYA 2DOQA 1CFPA 4HSZA 2JPTA 1Q80A 1GQMA 1OE9B 2L0PA 1S36A 1F8HA 1AUIB 1F55A 1YX7A 4WRIA 1CFCA 1SL8A 2BCAA 1NX2A 3JTDB 3WHTB 1KFXS 1TCFA 2F2OA 3WHUB 1U5IB 1SY9A 2KAYA 1U5IA 2SASA 4U8DA 3BOWB 1FI5A 3BOWA 1KFXL 2MAZA 3PN7B 5G08A 2G2BA 1NCXA 3TDIA 3CR4X 2M97A 1B8CA 3SIBA 1N0YA 1L2OC 2KBMA 1QX7A 1TNXA 2PALA 2LE9B 4OVNF 1PALA 3DVMA 2CBLA 3O4YA 1A75B 1SCMC 1A75A 1QATA 3CZTX 2BECA 2LHIA 2NCOA 4NDCA 1CM1A 1B4CA 1OMDA 4USLA 4AQIA 1F54A 1GGZA 1YUUA 1HQVA 1V1FA 4N5XA 4PHKA 5AEQA 1BF5A 1XA5A 1CDPA 2JULA 2ZN9A 3LK0A 1QIWA 1RWYA 4PE1A 4YI9A 2L4IA 1H8BA 3I5FB 2I7AA 2A4JA 3VRPA 2KNEA 1QV0A 2LNKA 4OCIA 2LLUA 1SKTA 4MZJA 1S6CA 5CSFA 1XFUO 4I5KA 3DVKA 3SG2A 5B8IB 2RGIA 1NCZA 1KSMA 2JTTA 1FI6A 1DJYA 4GNKB 4M2OA 3NSLA 3TDUA 4PDZA 1SL7A 2F33A 1AJ5A 1DF0B 4P5OE 3TDZA 1G4YR 2KI4C 4MN0A 1ZOTB 1YRTB 1OZOA 1IG5A 2KYFA 1KSOA 1CLMA 1PK0D 2PASA 2I2RE 3FWBA 1YUTA 3I5HC 1YURA 1EH2A 2I18A 1NX0A 2CCMA 2K2FA 3BUNB 3GOFA 3NSKA 2H2KA 2JC2A 3O6BA 1KQMB 1JF2A 2SCPA 1F71A 1CFFA 5CPVA 4YGAA 2LMVA 5PALA 2JT3A 2KOTA 2O60A 1D1OA 2BCBA 1NX3A 1RECA 4MRXA 5D69A 5HKYA 5DKNA 3SG3A 1M31A 1IJ6A 4BY4A 5IBWA 1MWNA 4NDBA 1H4BA 2BCXA 2KDHA 1K93D 1DGUA 1NWDA 1OQPA 1SYMA 2WOSA 4R1EA 4C0JA 2K7CA 4IL1A 1XYDA 2K8MB 2Y1MA 2LVVA 2Y4QA 1RJVA 3H4SE 4CFRA 2KAVA 5I8NA 1NP8A 5BPJA 1QASA 1AP4A 3SG6A 1G8IA 2FJUB 3PATA 3A8RA 1SPYA 5TNCA 2V53A 2KQYA 1K9PA 2PRUA 4BY5A 3I5GB 4I5JA 1NX1A 1QTXA 1J1DA 2F3YA 1KWOC 3KHEA 3I5IB 3LL8B 1FF1A 3EVVA 4YGBB 1CDLA 1MUXA 1SBJA 3IQQA 4FTGA 1IQ3A 1EG3A 2MRDA 1JUOA 2KAXA 1YVLA 1UP5A 3KO0A 4ORAB 1RTP1 1A03A 2LC5A 1UHIA 1QVIZ 1ALWA 1SR6C 1SRAA 1BLQA 3C1VA 1XO5A 1BMOA 1EXRA 1WLMA 4DS7A 2HF5A 2JTZA 3WNXB 1JF0A 2PSRA 3E3RA 1Y6WA 4YGDB 4UPGA 1AVSA 1XFWO 1TRFA 1S5GY 1DJXA 4AOMA 1SCVA 2LCPA 1K2HA 3KF9A 2LVKA 4MZKA 2KGBC 2IS9A 1KK8B 1EJ3A 2K7DA 3JTDC 1DT7B 1DJGA 1TNQA 2E30A 3KPXA 4TNCA 1KCYA 4A4BA 3SIAA 2LANA 2I94A 2LP2A 1BJFA 2OTGB 3K21A 4MLWA 1Y0VH 2KGRA 4CPVA 5I2OA 1QJTA 2KFFA 1S3PA 1DJIA 1CB1A 1QXPA 2L98A 2OS8C 3PSRA 4PE0A 4XYNA 4OV2A 3TS5B 2CNPA 4PE4A 1PVAA 1CLBA 5JJGA 2LVIA 2GGZA 3BUWB 1B8LA 3ZNIA 3QRXA 3SG4A 2GGMA 1KK7Y 3OX5A 1KK7Z 1MXLC 2F8PA 4I5LB 1AHRA 1SL9A 4HRGA
chains in the Genus database with same CATH superfamily
1K9KA 1CNPA 1WDCC 1J7QA 1YR5A 2L5XB 1KFUS 2G9BA 2WCEA 1IWQA 2WC8A 1M63B 1XFXO 2ZKMX 4CLNA 3CLNA 1DJWA 1PRWA 2AMIA 1OZSA 2KFGA 3PALA 4JPZB 4ZCUA 1K95A 3OGNA 3CABA 4YGEB 4NQGA 3L4LA 4ETOA 2K60A 5DKRA 1KFUL 1QIVA 2P6BB 3CR5X 3DVJA 2YGUA 4PHNA 1CKKA 4HRHA 1DVIA 1L2OB 1VRKA 2K2AA 1B8RA 1YUSA 3FS7A 1V1GA 1XVJA 5AERA 1DJHA 1YX8A 1SCMB 2MHHA 1M39A 1MQ1A 3VGOA 4F7FA 1DF0A 1TCOB 2BKHB 3EVRA 3JVTC 1JWDA 1MXEA 4QJ4B 3FE8A 1OOJA 2EHBA 2M0RA 4M2PA 1TIZA 3DF0B 2LVJA 1SNLA 2AUCA 1CDNA 1QLKA 2JT8A 3BFBA 3GK4X 2Q4UA 3EK8A 1MF8B 3IQOA 1J7PA 1Y1UA 3EK4A 1DMOA 1LVCD 1IGVA 2M29A 1PULA 3S0BA 3VRQA 2JNXA 2EC6C 2D8NA 3DYEA 3ICBA 2JWWA 1C3YA 2MJWB 2NZ0A 1XFRA 5HL1A 2LV7A 5AXIA 1K8UA 2AAOA 3SG5A 1KQVA 3EKHA 3DY9A 4CIDA 1BT6A 3R72A 1NIWA 2KI4B 1TOPA 2JRFA 2M8UA 1UHKA 3S0GA 3AAKA 3CGAA 1C3ZA 5AFPA 1R6PA 2MLEC 1IQ5A 1RFJA 1XK4A 2KQ6A 3KEVA 3OB1B 3B87A 4PT1A 4INXA 2OPOA 2GV5A 3OX6A 3DVEA 3I5HB 4OZDA 3AAJA 1K96A 2E6WA 2F3ZA 3HCMA 5D3OA 2MBXA 1JFJA 2EGDA 1K94A 1F4QA 2Y1NA 1QX5B 1JFKA 2GTEA 3LK1A 1B47A 2H61C 2M3WA 1LKJA 3I5GC 1IKUA 1N65A 4HREE 3D0YB 3K1EA 3D0YA 1NPQA 5CSIA 1S6IA 3O78A 2K7BA 3NGVA 2LMUA 1QX2A 1QS7A 1OOHA 1OSAA 3D75A 3AKBA 1ODBA 2JNFA 3D74A 3VRRA 1EL4A 2WC5A 4GFTA 4MEWA 4GGFA 1PSBA 1NSHA 1TNPA 5HKZA 5KSZA 4N1FA 3IF7A 1UHHA 2NLNA 1F4OA 2ZRTA 4FQOA 2BL0C 4E68A 5I94A 2BBMA 1EG4A 1TUJA 3DD4A 4OR9B 3TUYC 2ZRSA 1LS8A 1M45A 3OB2B 3PFVA 3LCPC 4ORBB 4WQ2A 2WNDA 3OHMB 5DKQA 1L7ZA 1OOGA 3BYAA 1F70A 3R1VA 1B9AA 3SJSA 3OP0A 1S5GZ 1KWOB 3EK7A 1CM4A 4I5NB 2PYQA 1G33A 2FOTA 1C7VA 1ZUZA 3CS1A 2JXCA 2HPSA 2LAPA 1DTLA 3CZ1A 2OTGC 2QACA 1OOFA 1S26D 2LLTA 4JWQA 2KLEA 3R1OA 1UHJA 1K9UA 1P28A 3BUMB 4ORCB 1DJZA 1WRKA 1CTRA 1SR6B 3NHIA 3TZ1A 4WQ3A 2WCKA 2CXJA 3PN7C 5FI7A 1YVHA 2COLB 2O5GA 3PLFB 3TS5C 1ZFSA 1SK6D 2L51A 3S0AA 2CTNA 2LP3A 1QLSA 4Q04A 4C0LA 1LA3A 4YBHB 5EL2A 2NXQA 1C07A 4PE7A 1NYAA 2JXLA 5ER5A 4L9MA 2QDIA 3SS5A 1HT9A 2BAPA 1ZACA 1OMRA 5I2LA 3I5FC 1TTXA 1J7RA 4NDDA 3RLZA 4GGNA 2K7OA 4GBAA 5KTYA 2R2IA 1R2UA 4GPLB 2M9GA 2WCBA 3DZTA 3L4AA 5K89A 2M7NA 4OKHA 1QWVA 2JOJA 3AKAA 2OS8B 1TNWA 1JC2A 2M49B 1LXFC 4N1GA 3F45A 3D10A 2BBNA 1CLLA 4DUQA 4D1EA 2MLFC 1J7OA 4MRYA 1J55A 2ISDA 1DGVA 4JQ0D 2HETA 2ZN8A 2M1UA 3MSEB 1MHOA 1CMGA 1AJ4A 1WDCB 2QEHA 3FWCA 2TN4A 5JOLA 2KBIA 1C7WA 1IRJA 1UUSA 4PHMA 1S6JA 3O2PA 4YGCB 5FYXA 3DF0A 1OMVA 2FJYA 2KHNA 4MBEA 4PCWA 2HQ8A 2B1UA 5D7FA 3FIAA 1QV1A 2H8VA 2KYCA 1PSRA 1TN4A 2LM5A 2FCEA 1YTZC 1BODA 1KQMC 3GK2A 1Y1XA 1UHNA 1Z2CB 1MR8A 2JZIA 1CDMA 2ZFDA 2KFHA 3BUOB 3FE9A 3B7AA 4ICBA 1SW8A 2WCFA 1A4PA 1W7IB 1K90D 1XFYO 3CR2A 1UWOA 1YRUB 1FPWA 1B7TY 2KI6C 5HLOA 3LLEA 1NUBA 4P2YB 5CSJA 1A2XA 3L47A 4DIRA 1B7TZ 2WC6A 2LMTA 3NXAA 3BUXB 4ZCVA 5ER4X 1XFVO 2K61A 4MVFA 2L4HA 1XK4C 3VRNA 3JVTB 2HQWA 2JQ6A 2L50A 1J1EA 3CWGA 1M46A 3R1PA 5I2QA 3UO9A 3CYZA 4YRUA 1RROA 4MZLA 2M7LA 3D77A 3SG7A 1PVBA 3A4UB 2Y5IA 3VROA 2QPTA 1FW4A 2LHLA 2LUXA 3EVUA 3GK1A 3SS4A 1WRZA 2EC6B 4MSPA 2M1KB 5HLVA 3ZWHA 1OOIX 4DRWA 3S0EA 1ZMZA 1FBVA 1JSAA 3M0WA 3RM1A 1ALVA 1IH0A 4A4CA 3I5IC 4XJKB 1SMGA 4XJKA 1RK9A 1IIOA 1BR4B 3BXKA 3IVTA 4PALA 1W7JB 4GGFC 3EKJA 2BKIB 1IJ5A 2PVBA 1JBAA 2NCPA 2LUCA 4M2QA 2CT9A 2JU0A 2QEOA 3HX4A 4GUKA 1WLZA 4CFQA 4F0ZB 2ZNEA 2ZNDA 1GGWA 3D78A 1WY9A 2MA2A 2KI6D 3BQ3A 5CSNA 3O4XA 3WXAA 5KU1A 1DQEA 2JT0A 1UURA 3B88A 3RZSA 3B6XA 4JKTA 3BFHA 3NSOA 5GQQC 4YI8A 4AQJA 2K0JA 3S0FA 2H61A 4JD9A 5HKWA 3NSIA 3PJIA 1Y1AA 3S0DA 1WRLA 2Q91A 4C0KA 1BOCA 2KSPA 1Z4HA 1KK8C 2FCDA 5AANA 5FI6A 1DELA 1BU3A 1CMFA 1B1GA 3CTNA 1XFZO 2BE4A 2PMYA 5HYDA 1AK8A 1QVIY 2LLSA 1BR1B 5J3XA 1BG1A 1X02A 1E8AA 1S1EA 2WCJA 4QJ3B 4GAOA 5F6TA 1N2DA 2F2PA 1NCYA 4QJ5B 4DCKA 3PM2A 2L2EA 2BL0B 3Q8IA 1LINA 1A29A 1T14A 2VRGA 1CFDA 1LA0A 2WORA 4PHJA 3PM8A 3TUYB 2BE6A 1GJYA 2DOQA 1CFPA 4HSZA 2JPTA 1Q80A 1GQMA 1OE9B 2L0PA 3CDNA 1S36A 1F8HA 1AUIB 3D76A 1F55A 1F54A 1YX7A 3N7HA 4WRIA 1CFCA 1SL8A 2BCAA 1NX2A 1TUZA 3JTDB 3WHTB 1KFXS 1TCFA 2F2OA 2KPHA 3WHUB 1U5IB 1SY9A 2KAYA 1U5IA 2WCLA 2SASA 4U8DA 3BOWB 1FI5A 3BOWA 1ORGA 1KFXL 2MAZA 3PN7B 5G08A 2G2BA 1NCXA 3TDIA 3CR4X 2M97A 1B8CA 3SIBA 1N0YA 1L2OC 2KBMA 3OBVA 1QX7A 3V2LA 1TNXA 2PALA 2LE9B 4OVNF 1PALA 3DVMA 4FQTA 3SS3A 2CBLA 3O4YA 1A75B 1SCMC 1A75A 1QATA 3CZTX 2BECA 2LHIA 2NCOA 4NDCA 1CM1A 1B4CA 1OMDA 4USLA 4AQIA 3EG5B 1GGZA 1YUUA 1HQVA 1V1FA 4N5XA 4PHKA 5AEQA 1BF5A 5FI2A 1XA5A 1CDPA 2JULA 2ZN9A 3LK0A 1QIWA 1RWYA 4PE1A 2BNXA 2L4IA 4YI9A 1H8BA 3I5FB 2I7AA 2A4JA 3UNWA 3VRPA 2ERBA 2KNEA 1QV0A 2LNKA 4OCIA 1SSEB 2LLUA 1SKTA 4MZJA 1S6CA 1DC1A 5CSFA 1XFUO 3FE6A 4I5KA 3DVKA 4KYNA 3SG2A 5B8IB 2RGIA 4INWA 1NCZA 1KSMA 2JTTA 2WCMA 1FI6A 1DJYA 4GNKB 4M2OA 3NSLA 3TDUA 4PDZA 1SL7A 2F33A 1AJ5A 1DF0B 4P5OE 3TDZA 1G4YR 2KI4C 4MN0A 1ZOTB 1YRTB 1GM0A 1OZOA 1IG5A 2KYFA 3CZ0A 1KSOA 1CLMA 3D73A 5DICA 1PK0D 2PASA 2I2RE 3FWBA 1YUTA 3I5HC 1YURA 1EH2A 2I18A 1NX0A 2CCMA 2K2FA 3BUNB 3GOFA 3NSKA 3QMEA 2H2KA 2JC2A 2P70A 3O6BA 1KQMB 1JF2A 2SCPA 3VB1A 1F71A 1CFFA 2WCHA 5CPVA 4YGAA 2LMVA 5PALA 2JT3A 2KOTA 2O60A 1D1OA 2BCBA 1NX3A 1RECA 4MRXA 5D69A 5HKYA 5DKNA 3SG3A 1M31A 1IJ6A 4BY4A 5IBWA 1MWNA 4NDBA 1H4BA 2BCXA 2KDHA 1K93D 1DGUA 1NWDA 1OQPA 1SYMA 2WOSA 4R1EA 4C0JA 2K7CA 4IL1A 1XYDA 2K8MB 2Y1MA 2LVVA 2Y4QA 1RJVA 3H4SE 4CFRA 2KAVA 2QEBA 5I8NA 1NP8A 5BPJA 1QASA 1DEKA 1AP4A 3SG6A 1G8IA 2FJUB 3PATA 3A8RA 1SPYA 5TNCA 2V53A 2L2CA 2KQYA 1K9PA 2L5YA 2KLDA 2PRUA 4BY5A 3I5GB 4I5JA 1NX1A 1QTXA 1J1DA 2F3YA 1KWOC 3KHEA 3I5IB 3LL8B 1FF1A 3EVVA 4YGBB 1TWOA 1CDLA 1MUXA 1SBJA 3IQQA 4FTGA 1IQ3A 1EG3A 2MRDA 1JUOA 2KAXA 1YVLA 1UP5A 3KO0A 4ORAB 1RTP1 1A03A 2LC5A 1UHIA 1QVIZ 3BJHA 1ALWA 1SR6C 1SRAA 1BLQA 3C1VA 1XO5A 4IJ7A 1BMOA 1EXRA 1WLMA 4DS7A 2HF5A 2JTZA 3WNXB 1JF0A 2QEVA 2PSRA 3DXLA 3E3RA 1Y6WA 4YGDB 4UPGA 1AVSA 1XFWO 1W9ZA 2P71A 1TRFA 1S5GY 1DJXA 4AOMA 1SCVA 2LCPA 1K2HA 3KF9A 2LVKA 4MZKA 2KGBC 2IS9A 2PQLA 1KK8B 1EJ3A 3B86A 2K7DA 3JTDC 1DT7B 1DJGA 1TNQA 2E30A 3KPXA 4TNCA 1KCYA 4A4BA 3SIAA 2LANA 2I94A 2LP2A 1BJFA 2JPOA 2OTGB 3K21A 1Y0VH 2KGRA 4MLWA 4CPVA 5I2OA 1QJTA 2KFFA 1S3PA 1DJIA 1CB1A 1QXPA 2L98A 2OS8C 3PSRA 4PE0A 3CZ2A 1OW4A 4XYNA 4OV2A 3TS5B 2CNPA 4PE4A 1PVAA 1CLBA 5JJGA 2LVIA 2GGZA 3BFAA 3BUWB 1B8LA 3NHTA 3QRXA 3ZNIA 3SG4A 2GGMA 1KK7Y 3OX5A 1KK7Z 1MXLC 2F8PA 4I5LB 1AHRA 1SL9A 4HRGA
chains in the Genus database with same CATH topology
1K9KA 1WDCC 1J7QA 1YR5A 2L5XB 1KFUS 2G9BA 2WCEA 1IWQA 2WC8A 1M63B 1XFXO 2ZKMX 4CLNA 3CLNA 1DJWA 1PRWA 2AMIA 1OZSA 2KFGA 3PALA 4JPZB 4ZCUA 1K95A 4YGEB 4NQGA 4ETOA 5DKRA 1KFUL 1QIVA 2P6BB 3CR5X 3DVJA 4PHNA 1CKKA 4HRHA 1DVIA 1L2OB 1VRKA 2K2AA 1B8RA 1YUSA 3FS7A 1V1GA 1XVJA 5AERA 1DJHA 1YX8A 1SCMB 2MHHA 1M39A 1MQ1A 3VGOA 1DF0A 1TCOB 2BKHB 3EVRA 3JVTC 1JWDA 1MXEA 4QJ4B 4M2PA 1OOJA 2EHBA 2M0RA 1TIZA 3DF0B 2LVJA 1SNLA 2AUCA 1CDNA 1QLKA 2JT8A 3GK4X 2Q4UA 3EK8A 1MF8B 3IQOA 1J7PA 1Y1UA 3EK4A 1DMOA 1LVCD 1IGVA 2M29A 1PULA 3VRQA 2JNXA 2EC6C 2D8NA 3ICBA 2JWWA 2MJWB 2NZ0A 2LV7A 5AXIA 1K8UA 2AAOA 3SG5A 1KQVA 3EKHA 4CIDA 1BT6A 1NIWA 2KI4B 1TOPA 2JRFA 2M8UA 1UHKA 3AAKA 3CGAA 5AFPA 1R6PA 2MLEC 1IQ5A 1RFJA 1XK4A 2KQ6A 3KEVA 3OB1B 2OPOA 2GV5A 3OX6A 3DVEA 3I5HB 3AAJA 1K96A 2E6WA 2F3ZA 3HCMA 2MBXA 1JFJA 2EGDA 1K94A 1F4QA 2Y1NA 1QX5B 1JFKA 3LK1A 1B47A 2H61C 2M3WA 1LKJA 3I5GC 1IKUA 1N65A 4HREE 3D0YB 3D0YA 1NPQA 5CSIA 1S6IA 3O78A 2K7BA 2LMUA 1QX2A 1QS7A 1OSAA 3AKBA 1ODBA 2JNFA 3VRRA 1EL4A 4GFTA 4MEWA 4GGFA 1PSBA 1NSHA 1TNPA 5HKZA 5KSZA 4N1FA 3IF7A 1UHHA 2NLNA 1F4OA 2ZRTA 4FQOA 2BL0C 4E68A 2BBMA 1EG4A 3DD4A 4OR9B 3TUYC 2ZRSA 3OB2B 1M45A 3PFVA 3LCPC 4ORBB 4WQ2A 2WNDA 3OHMB 5DKQA 1L7ZA 3BYAA 1F70A 1B9AA 3SJSA 3OP0A 1S5GZ 1KWOB 3EK7A 1CM4A 4I5NB 1G33A 2FOTA 1C7VA 1ZUZA 3CS1A 2JXCA 2HPSA 2LAPA 1DTLA 2OTGC 2QACA 1S26D 2LLTA 4JWQA 1UHJA 1K9UA 3BUMB 4ORCB 1DJZA 1WRKA 1CTRA 1SR6B 3TZ1A 4WQ3A 2CXJA 3PN7C 1YVHA 2COLB 2O5GA 3PLFB 3TS5C 1ZFSA 1SK6D 2L51A 2CTNA 2LP3A 1QLSA 4Q04A 4C0LA 1LA3A 4YBHB 2NXQA 1C07A 4PE7A 1NYAA 2JXLA 5ER5A 4L9MA 1HT9A 1ZACA 1OMRA 5I2LA 3I5FC 1TTXA 1J7RA 4NDDA 3RLZA 4GGNA 2K7OA 4GBAA 5KTYA 2R2IA 1R2UA 4GPLB 2M9GA 2WCBA 5K89A 2M7NA 4OKHA 2JOJA 3AKAA 2OS8B 1TNWA 1JC2A 2M49B 1LXFC 4N1GA 3F45A 3D10A 2BBNA 1CLLA 4DUQA 4D1EA 2MLFC 1J7OA 4MRYA 1J55A 2ISDA 1DGVA 4JQ0D 2HETA 2ZN8A 2M1UA 3MSEB 1MHOA 1CMGA 1AJ4A 1WDCB 3FWCA 2TN4A 5JOLA 2KBIA 1C7WA 1IRJA 1UUSA 4PHMA 1S6JA 3O2PA 4YGCB 5FYXA 3DF0A 1OMVA 2KHNA 4MBEA 5I2QA 4PCWA 2HQ8A 2B1UA 5D7FA 3FIAA 1QV1A 2KYCA 1BODA 1PSRA 1TN4A 2LM5A 2FCEA 1YTZC 1KQMC 3GK2A 1Y1XA 1UHNA 1MR8A 2JZIA 2ZFDA 1CDMA 3BUOB 2KFHA 4ICBA 1SW8A 2WCFA 1A4PA 1W7IB 1K90D 1XFYO 3CR2A 1UWOA 1YRUB 1FPWA 1B7TY 2KI6C 5HLOA 3LLEA 1NUBA 4P2YB 5CSJA 1A2XA 4DIRA 1B7TZ 2LMTA 3NXAA 3BUXB 4ZCVA 5ER4X 1XFVO 2K61A 4MVFA 2L4HA 1XK4C 3VRNA 3JVTB 2HQWA 2JQ6A 2L50A 1J1EA 3CWGA 1M46A 4YRUA 1RROA 4MZLA 2M7LA 3SG7A 1PVBA 3A4UB 2Y5IA 3VROA 2QPTA 1FW4A 2LHLA 2LUXA 3EVUA 3GK1A 1CNPA 1WRZA 2EC6B 4MSPA 2M1KB 5HLVA 3ZWHA 4DRWA 1JSAA 1ZMZA 1FBVA 3M0WA 3RM1A 1ALVA 1IH0A 4A4CA 3I5IC 4XJKB 1SMGA 4XJKA 1RK9A 1BR4B 3BXKA 4PALA 1W7JB 4GGFC 3EKJA 2BKIB 1IJ5A 2PVBA 1JBAA 2NCPA 2LUCA 4M2QA 2CT9A 2JU0A 3HX4A 4GUKA 4CFQA 1WLZA 1GGWA 4F0ZB 2ZNEA 2ZNDA 1WY9A 2MA2A 2KI6D 3BQ3A 5CSNA 3WXAA 5KU1A 2JT0A 1UURA 3NSOA 5GQQC 4YI8A 4AQJA 2K0JA 2H61A 5HKWA 3NSIA 1Y1AA 1WRLA 2Q91A 4C0KA 1BOCA 2KSPA 1KK8C 2FCDA 5AANA 1CMFA 1BU3A 1B1GA 3CTNA 1XFZO 2BE4A 2PMYA 5HYDA 1AK8A 1QVIY 2LLSA 1BR1B 5J3XA 1BG1A 1X02A 1E8AA 1S1EA 4QJ3B 4GAOA 5F6TA 1N2DA 2F2PA 1NCYA 4QJ5B 4DCKA 2L2EA 2BL0B 1LINA 1A29A 2VRGA 1CFDA 1LA0A 2WORA 4PHJA 3PM8A 3TUYB 2BE6A 1GJYA 2DOQA 1CFPA 4HSZA 2JPTA 1Q80A 1GQMA 1OE9B 2L0PA 1S36A 1F8HA 1AUIB 1F55A 1YX7A 4WRIA 1CFCA 1SL8A 2BCAA 1NX2A 3JTDB 3WHTB 1KFXS 1TCFA 2F2OA 3WHUB 1U5IB 1SY9A 2KAYA 1U5IA 2SASA 4U8DA 3BOWB 1FI5A 3BOWA 1KFXL 2MAZA 3PN7B 5G08A 2G2BA 1NCXA 3TDIA 3CR4X 2M97A 1B8CA 3SIBA 1N0YA 1L2OC 2KBMA 1QX7A 1TNXA 2PALA 2LE9B 4OVNF 1PALA 3DVMA 2CBLA 3O4YA 1A75B 1SCMC 1A75A 1QATA 3CZTX 2BECA 2LHIA 2NCOA 4NDCA 1CM1A 1B4CA 1OMDA 4USLA 4AQIA 1F54A 1GGZA 1YUUA 1HQVA 1V1FA 4N5XA 4PHKA 5AEQA 1BF5A 1XA5A 1CDPA 2JULA 2ZN9A 3LK0A 1QIWA 1RWYA 4PE1A 4YI9A 2L4IA 1H8BA 3I5FB 2I7AA 2A4JA 3VRPA 2KNEA 1QV0A 2LNKA 4OCIA 2LLUA 1SKTA 4MZJA 1S6CA 5CSFA 1XFUO 4I5KA 3DVKA 3SG2A 5B8IB 2RGIA 1NCZA 1KSMA 2JTTA 1FI6A 1DJYA 4GNKB 4M2OA 3NSLA 3TDUA 4PDZA 1SL7A 2F33A 1AJ5A 1DF0B 4P5OE 3TDZA 1G4YR 2KI4C 4MN0A 1ZOTB 1YRTB 1OZOA 1IG5A 2KYFA 1KSOA 1CLMA 1PK0D 2PASA 2I2RE 3FWBA 1YUTA 3I5HC 1YURA 1EH2A 2I18A 1NX0A 2CCMA 2K2FA 3BUNB 3GOFA 3NSKA 2H2KA 2JC2A 3O6BA 1KQMB 1JF2A 2SCPA 1F71A 1CFFA 5CPVA 4YGAA 2LMVA 5PALA 2JT3A 2KOTA 2O60A 1D1OA 2BCBA 1NX3A 1RECA 4MRXA 5D69A 5HKYA 5DKNA 3SG3A 1M31A 1IJ6A 4BY4A 5IBWA 1MWNA 4NDBA 1H4BA 2BCXA 2KDHA 1K93D 1DGUA 1NWDA 1OQPA 1SYMA 2WOSA 4R1EA 4C0JA 2K7CA 4IL1A 1XYDA 2K8MB 2Y1MA 2LVVA 2Y4QA 1RJVA 3H4SE 4CFRA 2KAVA 5I8NA 1NP8A 5BPJA 1QASA 1AP4A 3SG6A 1G8IA 2FJUB 3PATA 3A8RA 1SPYA 5TNCA 2V53A 2KQYA 1K9PA 2PRUA 4BY5A 3I5GB 4I5JA 1NX1A 1QTXA 1J1DA 2F3YA 1KWOC 3KHEA 3I5IB 3LL8B 1FF1A 3EVVA 4YGBB 1CDLA 1MUXA 1SBJA 3IQQA 4FTGA 1IQ3A 1EG3A 2MRDA 1JUOA 2KAXA 1YVLA 1UP5A 3KO0A 4ORAB 1RTP1 1A03A 2LC5A 1UHIA 1QVIZ 1ALWA 1SR6C 1SRAA 1BLQA 3C1VA 1XO5A 1BMOA 1EXRA 1WLMA 4DS7A 2HF5A 2JTZA 3WNXB 1JF0A 2PSRA 3E3RA 1Y6WA 4YGDB 4UPGA 1AVSA 1XFWO 1TRFA 1S5GY 1DJXA 4AOMA 1SCVA 2LCPA 1K2HA 3KF9A 2LVKA 4MZKA 2KGBC 2IS9A 1KK8B 1EJ3A 2K7DA 3JTDC 1DT7B 1DJGA 1TNQA 2E30A 3KPXA 4TNCA 1KCYA 4A4BA 3SIAA 2LANA 2I94A 2LP2A 1BJFA 2OTGB 3K21A 4MLWA 1Y0VH 2KGRA 4CPVA 5I2OA 1QJTA 2KFFA 1S3PA 1DJIA 1CB1A 1QXPA 2L98A 2OS8C 3PSRA 4PE0A 4XYNA 4OV2A 3TS5B 2CNPA 4PE4A 1PVAA 1CLBA 5JJGA 2LVIA 2GGZA 3BUWB 1B8LA 3ZNIA 3QRXA 3SG4A 2GGMA 1KK7Y 3OX5A 1KK7Z 1MXLC 2F8PA 4I5LB 1AHRA 1SL9A 4HRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9K A;  1WDC C;  1J7Q A;  1YR5 A;  2L5X B;  1KFU S;  2G9B A;  2WCE A;  1IWQ A;  2WC8 A;  1M63 B;  1XFX O;  2ZKM X;  4CLN A;  3CLN A;  1DJW A;  1PRW A;  2AMI A;  1OZS A;  2KFG A;  3PAL A;  4JPZ B;  4ZCU A;  1K95 A;  4YGE B;  4NQG A;  4ETO A;  5DKR A;  1KFU L;  1QIV A;  2P6B B;  3CR5 X;  3DVJ A;  4PHN A;  1CKK A;  4HRH A;  1DVI A;  1L2O B;  1VRK A;  2K2A A;  1B8R A;  1YUS A;  3FS7 A;  1V1G A;  1XVJ A;  5AER A;  1DJH A;  1YX8 A;  1SCM B;  2MHH A;  1M39 A;  1MQ1 A;  3VGO A;  1DF0 A;  1TCO B;  2BKH B;  3EVR A;  3JVT C;  1JWD A;  1MXE A;  4QJ4 B;  4M2P A;  1OOJ A;  2EHB A;  2M0R A;  1TIZ A;  3DF0 B;  2LVJ A;  1SNL A;  2AUC A;  1CDN A;  1QLK A;  2JT8 A;  3GK4 X;  2Q4U A;  3EK8 A;  1MF8 B;  3IQO A;  1J7P A;  1Y1U A;  3EK4 A;  1DMO A;  1LVC D;  1IGV A;  2M29 A;  1PUL A;  3VRQ A;  2JNX A;  2EC6 C;  2D8N A;  3ICB A;  2JWW A;  2MJW B;  2NZ0 A;  2LV7 A;  5AXI A;  1K8U A;  2AAO A;  3SG5 A;  1KQV A;  3EKH A;  4CID A;  1BT6 A;  1NIW A;  2KI4 B;  1TOP A;  2JRF A;  2M8U A;  1UHK A;  3AAK A;  3CGA A;  5AFP A;  1R6P A;  2MLE C;  1IQ5 A;  1RFJ A;  1XK4 A;  2KQ6 A;  3KEV A;  3OB1 B;  2OPO A;  2GV5 A;  3OX6 A;  3DVE A;  3I5H B;  3AAJ A;  1K96 A;  2E6W A;  2F3Z A;  3HCM A;  2MBX A;  1JFJ A;  2EGD A;  1K94 A;  1F4Q A;  2Y1N A;  1QX5 B;  1JFK A;  3LK1 A;  1B47 A;  2H61 C;  2M3W A;  1LKJ A;  3I5G C;  1IKU A;  1N65 A;  4HRE E;  3D0Y B;  3D0Y A;  1NPQ A;  5CSI A;  1S6I A;  3O78 A;  2K7B A;  2LMU A;  1QX2 A;  1QS7 A;  1OSA A;  3AKB A;  1ODB A;  2JNF A;  3VRR A;  1EL4 A;  4GFT A;  4MEW A;  4GGF A;  1PSB A;  1NSH A;  1TNP A;  5HKZ A;  5KSZ A;  4N1F A;  3IF7 A;  1UHH A;  2NLN A;  1F4O A;  2ZRT A;  4FQO A;  2BL0 C;  4E68 A;  2BBM A;  1EG4 A;  3DD4 A;  4OR9 B;  3TUY C;  2ZRS A;  3OB2 B;  1M45 A;  3PFV A;  3LCP C;  4ORB B;  4WQ2 A;  2WND A;  3OHM B;  5DKQ A;  1L7Z A;  3BYA A;  1F70 A;  1B9A A;  3SJS A;  3OP0 A;  1S5G Z;  1KWO B;  3EK7 A;  1CM4 A;  4I5N B;  1G33 A;  2FOT A;  1C7V A;  1ZUZ A;  3CS1 A;  2JXC A;  2HPS A;  2LAP A;  1DTL A;  2OTG C;  2QAC A;  1S26 D;  2LLT A;  4JWQ A;  1UHJ A;  1K9U A;  3BUM B;  4ORC B;  1DJZ A;  1WRK A;  1CTR A;  1SR6 B;  3TZ1 A;  4WQ3 A;  2CXJ A;  3PN7 C;  1YVH A;  2COL B;  2O5G A;  3PLF B;  3TS5 C;  1ZFS A;  1SK6 D;  2L51 A;  2CTN A;  2LP3 A;  1QLS A;  4Q04 A;  4C0L A;  1LA3 A;  4YBH B;  2NXQ A;  1C07 A;  4PE7 A;  1NYA A;  2JXL A;  5ER5 A;  4L9M A;  1HT9 A;  1ZAC A;  1OMR A;  5I2L A;  3I5F C;  1TTX A;  1J7R A;  4NDD A;  3RLZ A;  4GGN A;  2K7O A;  4GBA A;  5KTY A;  2R2I A;  1R2U A;  4GPL B;  2M9G A;  2WCB A;  5K89 A;  2M7N A;  4OKH A;  2JOJ A;  3AKA A;  2OS8 B;  1TNW A;  1JC2 A;  2M49 B;  1LXF C;  4N1G A;  3F45 A;  3D10 A;  2BBN A;  1CLL A;  4DUQ A;  4D1E A;  2MLF C;  1J7O A;  4MRY A;  1J55 A;  2ISD A;  1DGV A;  4JQ0 D;  2HET A;  2ZN8 A;  2M1U A;  3MSE B;  1MHO A;  1CMG A;  1AJ4 A;  1WDC B;  3FWC A;  2TN4 A;  5JOL A;  2KBI A;  1C7W A;  1IRJ A;  1UUS A;  4PHM A;  1S6J A;  3O2P A;  4YGC B;  5FYX A;  3DF0 A;  1OMV A;  2KHN A;  4MBE A;  5I2Q A;  4PCW A;  2HQ8 A;  2B1U A;  5D7F A;  3FIA A;  1QV1 A;  2KYC A;  1BOD A;  1PSR A;  1TN4 A;  2LM5 A;  2FCE A;  1YTZ C;  1KQM C;  3GK2 A;  1Y1X A;  1UHN A;  1MR8 A;  2JZI A;  2ZFD A;  1CDM A;  3BUO B;  2KFH A;  4ICB A;  1SW8 A;  2WCF A;  1A4P A;  1W7I B;  1K90 D;  1XFY O;  3CR2 A;  1UWO A;  1YRU B;  1FPW A;  1B7T Y;  2KI6 C;  5HLO A;  3LLE A;  1NUB A;  4P2Y B;  5CSJ A;  1A2X A;  4DIR A;  1B7T Z;  2LMT A;  3NXA A;  3BUX B;  4ZCV A;  5ER4 X;  1XFV O;  2K61 A;  4MVF A;  2L4H A;  1XK4 C;  3VRN A;  3JVT B;  2HQW A;  2JQ6 A;  2L50 A;  1J1E A;  3CWG A;  1M46 A;  4YRU A;  1RRO A;  4MZL A;  2M7L A;  3SG7 A;  1PVB A;  3A4U B;  2Y5I A;  3VRO A;  2QPT A;  1FW4 A;  2LHL A;  2LUX A;  3EVU A;  3GK1 A;  1CNP A;  1WRZ A;  2EC6 B;  4MSP A;  2M1K B;  5HLV A;  3ZWH A;  4DRW A;  1JSA A;  1ZMZ A;  1FBV A;  3M0W A;  3RM1 A;  1ALV A;  1IH0 A;  4A4C A;  3I5I C;  4XJK B;  1SMG A;  4XJK A;  1RK9 A;  1BR4 B;  3BXK A;  4PAL A;  1W7J B;  4GGF C;  3EKJ A;  2BKI B;  1IJ5 A;  2PVB A;  1JBA A;  2NCP A;  2LUC A;  4M2Q A;  2CT9 A;  2JU0 A;  3HX4 A;  4GUK A;  4CFQ A;  1WLZ A;  1GGW A;  4F0Z B;  2ZNE A;  2ZND A;  1WY9 A;  2MA2 A;  2KI6 D;  3BQ3 A;  5CSN A;  3WXA A;  5KU1 A;  2JT0 A;  1UUR A;  3NSO A;  5GQQ C;  4YI8 A;  4AQJ A;  2K0J A;  2H61 A;  5HKW A;  3NSI A;  1Y1A A;  1WRL A;  2Q91 A;  4C0K A;  1BOC A;  2KSP A;  1KK8 C;  2FCD A;  5AAN A;  1CMF A;  1BU3 A;  1B1G A;  3CTN A;  1XFZ O;  2BE4 A;  2PMY A;  5HYD A;  1AK8 A;  1QVI Y;  2LLS A;  1BR1 B;  5J3X A;  1BG1 A;  1X02 A;  1E8A A;  1S1E A;  4QJ3 B;  4GAO A;  5F6T A;  1N2D A;  2F2P A;  1NCY A;  4QJ5 B;  4DCK A;  2L2E A;  2BL0 B;  1LIN A;  1A29 A;  2VRG A;  1CFD A;  1LA0 A;  2WOR A;  4PHJ A;  3PM8 A;  3TUY B;  2BE6 A;  1GJY A;  2DOQ A;  1CFP A;  4HSZ A;  2JPT A;  1Q80 A;  1GQM A;  1OE9 B;  2L0P A;  1S36 A;  1F8H A;  1AUI B;  1F55 A;  1YX7 A;  4WRI A;  1CFC A;  1SL8 A;  2BCA A;  1NX2 A;  3JTD B;  3WHT B;  1KFX S;  1TCF A;  2F2O A;  3WHU B;  1U5I B;  1SY9 A;  2KAY A;  1U5I A;  2SAS A;  4U8D A;  3BOW B;  1FI5 A;  3BOW A;  1KFX L;  2MAZ A;  3PN7 B;  5G08 A;  2G2B A;  1NCX A;  3TDI A;  3CR4 X;  2M97 A;  1B8C A;  3SIB A;  1N0Y A;  1L2O C;  2KBM A;  1QX7 A;  1TNX A;  2PAL A;  2LE9 B;  4OVN F;  1PAL A;  3DVM A;  2CBL A;  3O4Y A;  1A75 B;  1SCM C;  1A75 A;  1QAT A;  3CZT X;  2BEC A;  2LHI A;  2NCO A;  4NDC A;  1CM1 A;  1B4C A;  1OMD A;  4USL A;  4AQI A;  1F54 A;  1GGZ A;  1YUU A;  1HQV A;  1V1F A;  4N5X A;  4PHK A;  5AEQ A;  1BF5 A;  1XA5 A;  1CDP A;  2JUL A;  2ZN9 A;  3LK0 A;  1QIW A;  1RWY A;  4PE1 A;  4YI9 A;  2L4I A;  1H8B A;  3I5F B;  2I7A A;  2A4J A;  3VRP A;  2KNE A;  1QV0 A;  2LNK A;  4OCI A;  2LLU A;  1SKT A;  4MZJ A;  1S6C A;  5CSF A;  1XFU O;  4I5K A;  3DVK A;  3SG2 A;  5B8I B;  2RGI A;  1NCZ A;  1KSM A;  2JTT A;  1FI6 A;  1DJY A;  4GNK B;  4M2O A;  3NSL A;  3TDU A;  4PDZ A;  1SL7 A;  2F33 A;  1AJ5 A;  1DF0 B;  4P5O E;  3TDZ A;  1G4Y R;  2KI4 C;  4MN0 A;  1ZOT B;  1YRT B;  1OZO A;  1IG5 A;  2KYF A;  1KSO A;  1CLM A;  1PK0 D;  2PAS A;  2I2R E;  3FWB A;  1YUT A;  3I5H C;  1YUR A;  1EH2 A;  2I18 A;  1NX0 A;  2CCM A;  2K2F A;  3BUN B;  3GOF A;  3NSK A;  2H2K A;  2JC2 A;  3O6B A;  1KQM B;  1JF2 A;  2SCP A;  1F71 A;  1CFF A;  5CPV A;  4YGA A;  2LMV A;  5PAL A;  2JT3 A;  2KOT A;  2O60 A;  1D1O A;  2BCB A;  1NX3 A;  1REC A;  4MRX A;  5D69 A;  5HKY A;  5DKN A;  3SG3 A;  1M31 A;  1IJ6 A;  4BY4 A;  5IBW A;  1MWN A;  4NDB A;  1H4B A;  2BCX A;  2KDH A;  1K93 D;  1DGU A;  1NWD A;  1OQP A;  1SYM A;  2WOS A;  4R1E A;  4C0J A;  2K7C A;  4IL1 A;  1XYD A;  2K8M B;  2Y1M A;  2LVV A;  2Y4Q A;  1RJV A;  3H4S E;  4CFR A;  2KAV A;  5I8N A;  1NP8 A;  5BPJ A;  1QAS A;  1AP4 A;  3SG6 A;  1G8I A;  2FJU B;  3PAT A;  3A8R A;  1SPY A;  5TNC A;  2V53 A;  2KQY A;  1K9P A;  2PRU A;  4BY5 A;  3I5G B;  4I5J A;  1NX1 A;  1QTX A;  1J1D A;  2F3Y A;  1KWO C;  3KHE A;  3I5I B;  3LL8 B;  1FF1 A;  3EVV A;  4YGB B;  1CDL A;  1MUX A;  1SBJ A;  3IQQ A;  4FTG A;  1IQ3 A;  1EG3 A;  2MRD A;  1JUO A;  2KAX A;  1YVL A;  1UP5 A;  3KO0 A;  4ORA B;  1RTP 1;  1A03 A;  2LC5 A;  1UHI A;  1QVI Z;  1ALW A;  1SR6 C;  1SRA A;  1BLQ A;  3C1V A;  1XO5 A;  1BMO A;  1EXR A;  1WLM A;  4DS7 A;  2HF5 A;  2JTZ A;  3WNX B;  1JF0 A;  2PSR A;  3E3R A;  1Y6W A;  4YGD B;  4UPG A;  1AVS A;  1XFW O;  1TRF A;  1S5G Y;  1DJX A;  4AOM A;  1SCV A;  2LCP A;  1K2H A;  3KF9 A;  2LVK A;  4MZK A;  2KGB C;  2IS9 A;  1KK8 B;  1EJ3 A;  2K7D A;  3JTD C;  1DT7 B;  1DJG A;  1TNQ A;  2E30 A;  3KPX A;  4TNC A;  1KCY A;  4A4B A;  3SIA A;  2LAN A;  2I94 A;  2LP2 A;  1BJF A;  2OTG B;  3K21 A;  4MLW A;  1Y0V H;  2KGR A;  4CPV A;  5I2O A;  1QJT A;  2KFF A;  1S3P A;  1DJI A;  1CB1 A;  1QXP A;  2L98 A;  2OS8 C;  3PSR A;  4PE0 A;  4XYN A;  4OV2 A;  3TS5 B;  2CNP A;  4PE4 A;  1PVA A;  1CLB A;  5JJG A;  2LVI A;  2GGZ A;  3BUW B;  1B8L A;  3ZNI A;  3QRX A;  3SG4 A;  2GGM A;  1KK7 Y;  3OX5 A;  1KK7 Z;  1MXL C;  2F8P A;  4I5L B;  1AHR A;  1SL9 A;  4HRG A; 
#chains in the Genus database with same CATH topology
 1K9K A;  1CNP A;  1WDC C;  1J7Q A;  1YR5 A;  2L5X B;  1KFU S;  2G9B A;  2WCE A;  1IWQ A;  2WC8 A;  1M63 B;  1XFX O;  2ZKM X;  4CLN A;  3CLN A;  1DJW A;  1PRW A;  2AMI A;  1OZS A;  2KFG A;  3PAL A;  4JPZ B;  4ZCU A;  1K95 A;  3OGN A;  3CAB A;  4YGE B;  4NQG A;  3L4L A;  4ETO A;  2K60 A;  5DKR A;  1KFU L;  1QIV A;  2P6B B;  3CR5 X;  3DVJ A;  2YGU A;  4PHN A;  1CKK A;  4HRH A;  1DVI A;  1L2O B;  1VRK A;  2K2A A;  1B8R A;  1YUS A;  3FS7 A;  1V1G A;  1XVJ A;  5AER A;  1DJH A;  1YX8 A;  1SCM B;  2MHH A;  1M39 A;  1MQ1 A;  3VGO A;  4F7F A;  1DF0 A;  1TCO B;  2BKH B;  3EVR A;  3JVT C;  1JWD A;  1MXE A;  4QJ4 B;  3FE8 A;  1OOJ A;  2EHB A;  2M0R A;  4M2P A;  1TIZ A;  3DF0 B;  2LVJ A;  1SNL A;  2AUC A;  1CDN A;  1QLK A;  2JT8 A;  3BFB A;  3GK4 X;  2Q4U A;  3EK8 A;  1MF8 B;  3IQO A;  1J7P A;  1Y1U A;  3EK4 A;  1DMO A;  1LVC D;  1IGV A;  2M29 A;  1PUL A;  3S0B A;  3VRQ A;  2JNX A;  2EC6 C;  2D8N A;  3DYE A;  3ICB A;  2JWW A;  1C3Y A;  2MJW B;  2NZ0 A;  1XFR A;  5HL1 A;  2LV7 A;  5AXI A;  1K8U A;  2AAO A;  3SG5 A;  1KQV A;  3EKH A;  3DY9 A;  4CID A;  1BT6 A;  3R72 A;  1NIW A;  2KI4 B;  1TOP A;  2JRF A;  2M8U A;  1UHK A;  3S0G A;  3AAK A;  3CGA A;  1C3Z A;  5AFP A;  1R6P A;  2MLE C;  1IQ5 A;  1RFJ A;  1XK4 A;  2KQ6 A;  3KEV A;  3OB1 B;  3B87 A;  4PT1 A;  4INX A;  2OPO A;  2GV5 A;  3OX6 A;  3DVE A;  3I5H B;  4OZD A;  3AAJ A;  1K96 A;  2E6W A;  2F3Z A;  3HCM A;  5D3O A;  2MBX A;  1JFJ A;  2EGD A;  1K94 A;  1F4Q A;  2Y1N A;  1QX5 B;  1JFK A;  2GTE A;  3LK1 A;  1B47 A;  2H61 C;  2M3W A;  1LKJ A;  3I5G C;  1IKU A;  1N65 A;  4HRE E;  3D0Y B;  3K1E A;  3D0Y A;  1NPQ A;  5CSI A;  1S6I A;  3O78 A;  2K7B A;  3NGV A;  2LMU A;  1QX2 A;  1QS7 A;  1OOH A;  1OSA A;  3D75 A;  3AKB A;  1ODB A;  2JNF A;  3D74 A;  3VRR A;  1EL4 A;  2WC5 A;  4GFT A;  4MEW A;  4GGF A;  1PSB A;  1NSH A;  1TNP A;  5HKZ A;  5KSZ A;  4N1F A;  3IF7 A;  1UHH A;  2NLN A;  1F4O A;  2ZRT A;  4FQO A;  2BL0 C;  4E68 A;  5I94 A;  2BBM A;  1EG4 A;  1TUJ A;  3DD4 A;  4OR9 B;  3TUY C;  2ZRS A;  1LS8 A;  1M45 A;  3OB2 B;  3PFV A;  3LCP C;  4ORB B;  4WQ2 A;  2WND A;  3OHM B;  5DKQ A;  1L7Z A;  1OOG A;  3BYA A;  1F70 A;  3R1V A;  1B9A A;  3SJS A;  3OP0 A;  1S5G Z;  1KWO B;  3EK7 A;  1CM4 A;  4I5N B;  2PYQ A;  1G33 A;  2FOT A;  1C7V A;  1ZUZ A;  3CS1 A;  2JXC A;  2HPS A;  2LAP A;  1DTL A;  3CZ1 A;  2OTG C;  2QAC A;  1OOF A;  1S26 D;  2LLT A;  4JWQ A;  2KLE A;  3R1O A;  1UHJ A;  1K9U A;  1P28 A;  3BUM B;  4ORC B;  1DJZ A;  1WRK A;  1CTR A;  1SR6 B;  3NHI A;  3TZ1 A;  4WQ3 A;  2WCK A;  2CXJ A;  3PN7 C;  5FI7 A;  1YVH A;  2COL B;  2O5G A;  3PLF B;  3TS5 C;  1ZFS A;  1SK6 D;  2L51 A;  3S0A A;  2CTN A;  2LP3 A;  1QLS A;  4Q04 A;  4C0L A;  1LA3 A;  4YBH B;  5EL2 A;  2NXQ A;  1C07 A;  4PE7 A;  1NYA A;  2JXL A;  5ER5 A;  4L9M A;  2QDI A;  3SS5 A;  1HT9 A;  2BAP A;  1ZAC A;  1OMR A;  5I2L A;  3I5F C;  1TTX A;  1J7R A;  4NDD A;  3RLZ A;  4GGN A;  2K7O A;  4GBA A;  5KTY A;  2R2I A;  1R2U A;  4GPL B;  2M9G A;  2WCB A;  3DZT A;  3L4A A;  5K89 A;  2M7N A;  4OKH A;  1QWV A;  2JOJ A;  3AKA A;  2OS8 B;  1TNW A;  1JC2 A;  2M49 B;  1LXF C;  4N1G A;  3F45 A;  3D10 A;  2BBN A;  1CLL A;  4DUQ A;  4D1E A;  2MLF C;  1J7O A;  4MRY A;  1J55 A;  2ISD A;  1DGV A;  4JQ0 D;  2HET A;  2ZN8 A;  2M1U A;  3MSE B;  1MHO A;  1CMG A;  1AJ4 A;  1WDC B;  2QEH A;  3FWC A;  2TN4 A;  5JOL A;  2KBI A;  1C7W A;  1IRJ A;  1UUS A;  4PHM A;  1S6J A;  3O2P A;  4YGC B;  5FYX A;  3DF0 A;  1OMV A;  2FJY A;  2KHN A;  4MBE A;  4PCW A;  2HQ8 A;  2B1U A;  5D7F A;  3FIA A;  1QV1 A;  2H8V A;  2KYC A;  1PSR A;  1TN4 A;  2LM5 A;  2FCE A;  1YTZ C;  1BOD A;  1KQM C;  3GK2 A;  1Y1X A;  1UHN A;  1Z2C B;  1MR8 A;  2JZI A;  1CDM A;  2ZFD A;  2KFH A;  3BUO B;  3FE9 A;  3B7A A;  4ICB A;  1SW8 A;  2WCF A;  1A4P A;  1W7I B;  1K90 D;  1XFY O;  3CR2 A;  1UWO A;  1YRU B;  1FPW A;  1B7T Y;  2KI6 C;  5HLO A;  3LLE A;  1NUB A;  4P2Y B;  5CSJ A;  1A2X A;  3L47 A;  4DIR A;  1B7T Z;  2WC6 A;  2LMT A;  3NXA A;  3BUX B;  4ZCV A;  5ER4 X;  1XFV O;  2K61 A;  4MVF A;  2L4H A;  1XK4 C;  3VRN A;  3JVT B;  2HQW A;  2JQ6 A;  2L50 A;  1J1E A;  3CWG A;  1M46 A;  3R1P A;  5I2Q A;  3UO9 A;  3CYZ A;  4YRU A;  1RRO A;  4MZL A;  2M7L A;  3D77 A;  3SG7 A;  1PVB A;  3A4U B;  2Y5I A;  3VRO A;  2QPT A;  1FW4 A;  2LHL A;  2LUX A;  3EVU A;  3GK1 A;  3SS4 A;  1WRZ A;  2EC6 B;  4MSP A;  2M1K B;  5HLV A;  3ZWH A;  1OOI X;  4DRW A;  3S0E A;  1ZMZ A;  1FBV A;  1JSA A;  3M0W A;  3RM1 A;  1ALV A;  1IH0 A;  4A4C A;  3I5I C;  4XJK B;  1SMG A;  4XJK A;  1RK9 A;  1IIO A;  1BR4 B;  3BXK A;  3IVT A;  4PAL A;  1W7J B;  4GGF C;  3EKJ A;  2BKI B;  1IJ5 A;  2PVB A;  1JBA A;  2NCP A;  2LUC A;  4M2Q A;  2CT9 A;  2JU0 A;  2QEO A;  3HX4 A;  4GUK A;  1WLZ A;  4CFQ A;  4F0Z B;  2ZNE A;  2ZND A;  1GGW A;  3D78 A;  1WY9 A;  2MA2 A;  2KI6 D;  3BQ3 A;  5CSN A;  3O4X A;  3WXA A;  5KU1 A;  1DQE A;  2JT0 A;  1UUR A;  3B88 A;  3RZS A;  3B6X A;  4JKT A;  3BFH A;  3NSO A;  5GQQ C;  4YI8 A;  4AQJ A;  2K0J A;  3S0F A;  2H61 A;  4JD9 A;  5HKW A;  3NSI A;  3PJI A;  1Y1A A;  3S0D A;  1WRL A;  2Q91 A;  4C0K A;  1BOC A;  2KSP A;  1Z4H A;  1KK8 C;  2FCD A;  5AAN A;  5FI6 A;  1DEL A;  1BU3 A;  1CMF A;  1B1G A;  3CTN A;  1XFZ O;  2BE4 A;  2PMY A;  5HYD A;  1AK8 A;  1QVI Y;  2LLS A;  1BR1 B;  5J3X A;  1BG1 A;  1X02 A;  1E8A A;  1S1E A;  2WCJ A;  4QJ3 B;  4GAO A;  5F6T A;  1N2D A;  2F2P A;  1NCY A;  4QJ5 B;  4DCK A;  3PM2 A;  2L2E A;  2BL0 B;  3Q8I A;  1LIN A;  1A29 A;  1T14 A;  2VRG A;  1CFD A;  1LA0 A;  2WOR A;  4PHJ A;  3PM8 A;  3TUY B;  2BE6 A;  1GJY A;  2DOQ A;  1CFP A;  4HSZ A;  2JPT A;  1Q80 A;  1GQM A;  1OE9 B;  2L0P A;  3CDN A;  1S36 A;  1F8H A;  1AUI B;  3D76 A;  1F55 A;  1F54 A;  1YX7 A;  3N7H A;  4WRI A;  1CFC A;  1SL8 A;  2BCA A;  1NX2 A;  1TUZ A;  3JTD B;  3WHT B;  1KFX S;  1TCF A;  2F2O A;  2KPH A;  3WHU B;  1U5I B;  1SY9 A;  2KAY A;  1U5I A;  2WCL A;  2SAS A;  4U8D A;  3BOW B;  1FI5 A;  3BOW A;  1ORG A;  1KFX L;  2MAZ A;  3PN7 B;  5G08 A;  2G2B A;  1NCX A;  3TDI A;  3CR4 X;  2M97 A;  1B8C A;  3SIB A;  1N0Y A;  1L2O C;  2KBM A;  3OBV A;  1QX7 A;  3V2L A;  1TNX A;  2PAL A;  2LE9 B;  4OVN F;  1PAL A;  3DVM A;  4FQT A;  3SS3 A;  2CBL A;  3O4Y A;  1A75 B;  1SCM C;  1A75 A;  1QAT A;  3CZT X;  2BEC A;  2LHI A;  2NCO A;  4NDC A;  1CM1 A;  1B4C A;  1OMD A;  4USL A;  4AQI A;  3EG5 B;  1GGZ A;  1YUU A;  1HQV A;  1V1F A;  4N5X A;  4PHK A;  5AEQ A;  1BF5 A;  5FI2 A;  1XA5 A;  1CDP A;  2JUL A;  2ZN9 A;  3LK0 A;  1QIW A;  1RWY A;  4PE1 A;  2BNX A;  2L4I A;  4YI9 A;  1H8B A;  3I5F B;  2I7A A;  2A4J A;  3UNW A;  3VRP A;  2ERB A;  2KNE A;  1QV0 A;  2LNK A;  4OCI A;  1SSE B;  2LLU A;  1SKT A;  4MZJ A;  1S6C A;  1DC1 A;  5CSF A;  1XFU O;  3FE6 A;  4I5K A;  3DVK A;  4KYN A;  3SG2 A;  5B8I B;  2RGI A;  4INW A;  1NCZ A;  1KSM A;  2JTT A;  2WCM A;  1FI6 A;  1DJY A;  4GNK B;  4M2O A;  3NSL A;  3TDU A;  4PDZ A;  1SL7 A;  2F33 A;  1AJ5 A;  1DF0 B;  4P5O E;  3TDZ A;  1G4Y R;  2KI4 C;  4MN0 A;  1ZOT B;  1YRT B;  1GM0 A;  1OZO A;  1IG5 A;  2KYF A;  3CZ0 A;  1KSO A;  1CLM A;  3D73 A;  5DIC A;  1PK0 D;  2PAS A;  2I2R E;  3FWB A;  1YUT A;  3I5H C;  1YUR A;  1EH2 A;  2I18 A;  1NX0 A;  2CCM A;  2K2F A;  3BUN B;  3GOF A;  3NSK A;  3QME A;  2H2K A;  2JC2 A;  2P70 A;  3O6B A;  1KQM B;  1JF2 A;  2SCP A;  3VB1 A;  1F71 A;  1CFF A;  2WCH A;  5CPV A;  4YGA A;  2LMV A;  5PAL A;  2JT3 A;  2KOT A;  2O60 A;  1D1O A;  2BCB A;  1NX3 A;  1REC A;  4MRX A;  5D69 A;  5HKY A;  5DKN A;  3SG3 A;  1M31 A;  1IJ6 A;  4BY4 A;  5IBW A;  1MWN A;  4NDB A;  1H4B A;  2BCX A;  2KDH A;  1K93 D;  1DGU A;  1NWD A;  1OQP A;  1SYM A;  2WOS A;  4R1E A;  4C0J A;  2K7C A;  4IL1 A;  1XYD A;  2K8M B;  2Y1M A;  2LVV A;  2Y4Q A;  1RJV A;  3H4S E;  4CFR A;  2KAV A;  2QEB A;  5I8N A;  1NP8 A;  5BPJ A;  1QAS A;  1DEK A;  1AP4 A;  3SG6 A;  1G8I A;  2FJU B;  3PAT A;  3A8R A;  1SPY A;  5TNC A;  2V53 A;  2L2C A;  2KQY A;  1K9P A;  2L5Y A;  2KLD A;  2PRU A;  4BY5 A;  3I5G B;  4I5J A;  1NX1 A;  1QTX A;  1J1D A;  2F3Y A;  1KWO C;  3KHE A;  3I5I B;  3LL8 B;  1FF1 A;  3EVV A;  4YGB B;  1TWO A;  1CDL A;  1MUX A;  1SBJ A;  3IQQ A;  4FTG A;  1IQ3 A;  1EG3 A;  2MRD A;  1JUO A;  2KAX A;  1YVL A;  1UP5 A;  3KO0 A;  4ORA B;  1RTP 1;  1A03 A;  2LC5 A;  1UHI A;  1QVI Z;  3BJH A;  1ALW A;  1SR6 C;  1SRA A;  1BLQ A;  3C1V A;  1XO5 A;  4IJ7 A;  1BMO A;  1EXR A;  1WLM A;  4DS7 A;  2HF5 A;  2JTZ A;  3WNX B;  1JF0 A;  2QEV A;  2PSR A;  3DXL A;  3E3R A;  1Y6W A;  4YGD B;  4UPG A;  1AVS A;  1XFW O;  1W9Z A;  2P71 A;  1TRF A;  1S5G Y;  1DJX A;  4AOM A;  1SCV A;  2LCP A;  1K2H A;  3KF9 A;  2LVK A;  4MZK A;  2KGB C;  2IS9 A;  2PQL A;  1KK8 B;  1EJ3 A;  3B86 A;  2K7D A;  3JTD C;  1DT7 B;  1DJG A;  1TNQ A;  2E30 A;  3KPX A;  4TNC A;  1KCY A;  4A4B A;  3SIA A;  2LAN A;  2I94 A;  2LP2 A;  1BJF A;  2JPO A;  2OTG B;  3K21 A;  1Y0V H;  2KGR A;  4MLW A;  4CPV A;  5I2O A;  1QJT A;  2KFF A;  1S3P A;  1DJI A;  1CB1 A;  1QXP A;  2L98 A;  2OS8 C;  3PSR A;  4PE0 A;  3CZ2 A;  1OW4 A;  4XYN A;  4OV2 A;  3TS5 B;  2CNP A;  4PE4 A;  1PVA A;  1CLB A;  5JJG A;  2LVI A;  2GGZ A;  3BFA A;  3BUW B;  1B8L A;  3NHT A;  3QRX A;  3ZNI A;  3SG4 A;  2GGM A;  1KK7 Y;  3OX5 A;  1KK7 Z;  1MXL C;  2F8P A;  4I5L B;  1AHR A;  1SL9 A;  4HRG A; 
#chains in the Genus database with same CATH homology
 1K9K A;  1WDC C;  1J7Q A;  1YR5 A;  2L5X B;  1KFU S;  2G9B A;  2WCE A;  1IWQ A;  2WC8 A;  1M63 B;  1XFX O;  2ZKM X;  4CLN A;  3CLN A;  1DJW A;  1PRW A;  2AMI A;  1OZS A;  2KFG A;  3PAL A;  4JPZ B;  4ZCU A;  1K95 A;  4YGE B;  4NQG A;  4ETO A;  5DKR A;  1KFU L;  1QIV A;  2P6B B;  3CR5 X;  3DVJ A;  4PHN A;  1CKK A;  4HRH A;  1DVI A;  1L2O B;  1VRK A;  2K2A A;  1B8R A;  1YUS A;  3FS7 A;  1V1G A;  1XVJ A;  5AER A;  1DJH A;  1YX8 A;  1SCM B;  2MHH A;  1M39 A;  1MQ1 A;  3VGO A;  1DF0 A;  1TCO B;  2BKH B;  3EVR A;  3JVT C;  1JWD A;  1MXE A;  4QJ4 B;  4M2P A;  1OOJ A;  2EHB A;  2M0R A;  1TIZ A;  3DF0 B;  2LVJ A;  1SNL A;  2AUC A;  1CDN A;  1QLK A;  2JT8 A;  3GK4 X;  2Q4U A;  3EK8 A;  1MF8 B;  3IQO A;  1J7P A;  1Y1U A;  3EK4 A;  1DMO A;  1LVC D;  1IGV A;  2M29 A;  1PUL A;  3VRQ A;  2JNX A;  2EC6 C;  2D8N A;  3ICB A;  2JWW A;  2MJW B;  2NZ0 A;  2LV7 A;  5AXI A;  1K8U A;  2AAO A;  3SG5 A;  1KQV A;  3EKH A;  4CID A;  1BT6 A;  1NIW A;  2KI4 B;  1TOP A;  2JRF A;  2M8U A;  1UHK A;  3AAK A;  3CGA A;  5AFP A;  1R6P A;  2MLE C;  1IQ5 A;  1RFJ A;  1XK4 A;  2KQ6 A;  3KEV A;  3OB1 B;  2OPO A;  2GV5 A;  3OX6 A;  3DVE A;  3I5H B;  3AAJ A;  1K96 A;  2E6W A;  2F3Z A;  3HCM A;  2MBX A;  1JFJ A;  2EGD A;  1K94 A;  1F4Q A;  2Y1N A;  1QX5 B;  1JFK A;  3LK1 A;  1B47 A;  2H61 C;  2M3W A;  1LKJ A;  3I5G C;  1IKU A;  1N65 A;  4HRE E;  3D0Y B;  3D0Y A;  1NPQ A;  5CSI A;  1S6I A;  3O78 A;  2K7B A;  2LMU A;  1QX2 A;  1QS7 A;  1OSA A;  3AKB A;  1ODB A;  2JNF A;  3VRR A;  1EL4 A;  4GFT A;  4MEW A;  4GGF A;  1PSB A;  1NSH A;  1TNP A;  5HKZ A;  5KSZ A;  4N1F A;  3IF7 A;  1UHH A;  2NLN A;  1F4O A;  2ZRT A;  4FQO A;  2BL0 C;  4E68 A;  2BBM A;  1EG4 A;  3DD4 A;  4OR9 B;  3TUY C;  2ZRS A;  3OB2 B;  1M45 A;  3PFV A;  3LCP C;  4ORB B;  4WQ2 A;  2WND A;  3OHM B;  5DKQ A;  1L7Z A;  3BYA A;  1F70 A;  1B9A A;  3SJS A;  3OP0 A;  1S5G Z;  1KWO B;  3EK7 A;  1CM4 A;  4I5N B;  1G33 A;  2FOT A;  1C7V A;  1ZUZ A;  3CS1 A;  2JXC A;  2HPS A;  2LAP A;  1DTL A;  2OTG C;  2QAC A;  1S26 D;  2LLT A;  4JWQ A;  1UHJ A;  1K9U A;  3BUM B;  4ORC B;  1DJZ A;  1WRK A;  1CTR A;  1SR6 B;  3TZ1 A;  4WQ3 A;  2CXJ A;  3PN7 C;  1YVH A;  2COL B;  2O5G A;  3PLF B;  3TS5 C;  1ZFS A;  1SK6 D;  2L51 A;  2CTN A;  2LP3 A;  1QLS A;  4Q04 A;  4C0L A;  1LA3 A;  4YBH B;  2NXQ A;  1C07 A;  4PE7 A;  1NYA A;  2JXL A;  5ER5 A;  4L9M A;  1HT9 A;  1ZAC A;  1OMR A;  5I2L A;  3I5F C;  1TTX A;  1J7R A;  4NDD A;  3RLZ A;  4GGN A;  2K7O A;  4GBA A;  5KTY A;  2R2I A;  1R2U A;  4GPL B;  2M9G A;  2WCB A;  5K89 A;  2M7N A;  4OKH A;  2JOJ A;  3AKA A;  2OS8 B;  1TNW A;  1JC2 A;  2M49 B;  1LXF C;  4N1G A;  3F45 A;  3D10 A;  2BBN A;  1CLL A;  4DUQ A;  4D1E A;  2MLF C;  1J7O A;  4MRY A;  1J55 A;  2ISD A;  1DGV A;  4JQ0 D;  2HET A;  2ZN8 A;  2M1U A;  3MSE B;  1MHO A;  1CMG A;  1AJ4 A;  1WDC B;  3FWC A;  2TN4 A;  5JOL A;  2KBI A;  1C7W A;  1IRJ A;  1UUS A;  4PHM A;  1S6J A;  3O2P A;  4YGC B;  5FYX A;  3DF0 A;  1OMV A;  2KHN A;  4MBE A;  5I2Q A;  4PCW A;  2HQ8 A;  2B1U A;  5D7F A;  3FIA A;  1QV1 A;  2KYC A;  1BOD A;  1PSR A;  1TN4 A;  2LM5 A;  2FCE A;  1YTZ C;  1KQM C;  3GK2 A;  1Y1X A;  1UHN A;  1MR8 A;  2JZI A;  2ZFD A;  1CDM A;  3BUO B;  2KFH A;  4ICB A;  1SW8 A;  2WCF A;  1A4P A;  1W7I B;  1K90 D;  1XFY O;  3CR2 A;  1UWO A;  1YRU B;  1FPW A;  1B7T Y;  2KI6 C;  5HLO A;  3LLE A;  1NUB A;  4P2Y B;  5CSJ A;  1A2X A;  4DIR A;  1B7T Z;  2LMT A;  3NXA A;  3BUX B;  4ZCV A;  5ER4 X;  1XFV O;  2K61 A;  4MVF A;  2L4H A;  1XK4 C;  3VRN A;  3JVT B;  2HQW A;  2JQ6 A;  2L50 A;  1J1E A;  3CWG A;  1M46 A;  4YRU A;  1RRO A;  4MZL A;  2M7L A;  3SG7 A;  1PVB A;  3A4U B;  2Y5I A;  3VRO A;  2QPT A;  1FW4 A;  2LHL A;  2LUX A;  3EVU A;  3GK1 A;  1CNP A;  1WRZ A;  2EC6 B;  4MSP A;  2M1K B;  5HLV A;  3ZWH A;  4DRW A;  1JSA A;  1ZMZ A;  1FBV A;  3M0W A;  3RM1 A;  1ALV A;  1IH0 A;  4A4C A;  3I5I C;  4XJK B;  1SMG A;  4XJK A;  1RK9 A;  1BR4 B;  3BXK A;  4PAL A;  1W7J B;  4GGF C;  3EKJ A;  2BKI B;  1IJ5 A;  2PVB A;  1JBA A;  2NCP A;  2LUC A;  4M2Q A;  2CT9 A;  2JU0 A;  3HX4 A;  4GUK A;  4CFQ A;  1WLZ A;  1GGW A;  4F0Z B;  2ZNE A;  2ZND A;  1WY9 A;  2MA2 A;  2KI6 D;  3BQ3 A;  5CSN A;  3WXA A;  5KU1 A;  2JT0 A;  1UUR A;  3NSO A;  5GQQ C;  4YI8 A;  4AQJ A;  2K0J A;  2H61 A;  5HKW A;  3NSI A;  1Y1A A;  1WRL A;  2Q91 A;  4C0K A;  1BOC A;  2KSP A;  1KK8 C;  2FCD A;  5AAN A;  1CMF A;  1BU3 A;  1B1G A;  3CTN A;  1XFZ O;  2BE4 A;  2PMY A;  5HYD A;  1AK8 A;  1QVI Y;  2LLS A;  1BR1 B;  5J3X A;  1BG1 A;  1X02 A;  1E8A A;  1S1E A;  4QJ3 B;  4GAO A;  5F6T A;  1N2D A;  2F2P A;  1NCY A;  4QJ5 B;  4DCK A;  2L2E A;  2BL0 B;  1LIN A;  1A29 A;  2VRG A;  1CFD A;  1LA0 A;  2WOR A;  4PHJ A;  3PM8 A;  3TUY B;  2BE6 A;  1GJY A;  2DOQ A;  1CFP A;  4HSZ A;  2JPT A;  1Q80 A;  1GQM A;  1OE9 B;  2L0P A;  1S36 A;  1F8H A;  1AUI B;  1F55 A;  1YX7 A;  4WRI A;  1CFC A;  1SL8 A;  2BCA A;  1NX2 A;  3JTD B;  3WHT B;  1KFX S;  1TCF A;  2F2O A;  3WHU B;  1U5I B;  1SY9 A;  2KAY A;  1U5I A;  2SAS A;  4U8D A;  3BOW B;  1FI5 A;  3BOW A;  1KFX L;  2MAZ A;  3PN7 B;  5G08 A;  2G2B A;  1NCX A;  3TDI A;  3CR4 X;  2M97 A;  1B8C A;  3SIB A;  1N0Y A;  1L2O C;  2KBM A;  1QX7 A;  1TNX A;  2PAL A;  2LE9 B;  4OVN F;  1PAL A;  3DVM A;  2CBL A;  3O4Y A;  1A75 B;  1SCM C;  1A75 A;  1QAT A;  3CZT X;  2BEC A;  2LHI A;  2NCO A;  4NDC A;  1CM1 A;  1B4C A;  1OMD A;  4USL A;  4AQI A;  1F54 A;  1GGZ A;  1YUU A;  1HQV A;  1V1F A;  4N5X A;  4PHK A;  5AEQ A;  1BF5 A;  1XA5 A;  1CDP A;  2JUL A;  2ZN9 A;  3LK0 A;  1QIW A;  1RWY A;  4PE1 A;  4YI9 A;  2L4I A;  1H8B A;  3I5F B;  2I7A A;  2A4J A;  3VRP A;  2KNE A;  1QV0 A;  2LNK A;  4OCI A;  2LLU A;  1SKT A;  4MZJ A;  1S6C A;  5CSF A;  1XFU O;  4I5K A;  3DVK A;  3SG2 A;  5B8I B;  2RGI A;  1NCZ A;  1KSM A;  2JTT A;  1FI6 A;  1DJY A;  4GNK B;  4M2O A;  3NSL A;  3TDU A;  4PDZ A;  1SL7 A;  2F33 A;  1AJ5 A;  1DF0 B;  4P5O E;  3TDZ A;  1G4Y R;  2KI4 C;  4MN0 A;  1ZOT B;  1YRT B;  1OZO A;  1IG5 A;  2KYF A;  1KSO A;  1CLM A;  1PK0 D;  2PAS A;  2I2R E;  3FWB A;  1YUT A;  3I5H C;  1YUR A;  1EH2 A;  2I18 A;  1NX0 A;  2CCM A;  2K2F A;  3BUN B;  3GOF A;  3NSK A;  2H2K A;  2JC2 A;  3O6B A;  1KQM B;  1JF2 A;  2SCP A;  1F71 A;  1CFF A;  5CPV A;  4YGA A;  2LMV A;  5PAL A;  2JT3 A;  2KOT A;  2O60 A;  1D1O A;  2BCB A;  1NX3 A;  1REC A;  4MRX A;  5D69 A;  5HKY A;  5DKN A;  3SG3 A;  1M31 A;  1IJ6 A;  4BY4 A;  5IBW A;  1MWN A;  4NDB A;  1H4B A;  2BCX A;  2KDH A;  1K93 D;  1DGU A;  1NWD A;  1OQP A;  1SYM A;  2WOS A;  4R1E A;  4C0J A;  2K7C A;  4IL1 A;  1XYD A;  2K8M B;  2Y1M A;  2LVV A;  2Y4Q A;  1RJV A;  3H4S E;  4CFR A;  2KAV A;  5I8N A;  1NP8 A;  5BPJ A;  1QAS A;  1AP4 A;  3SG6 A;  1G8I A;  2FJU B;  3PAT A;  3A8R A;  1SPY A;  5TNC A;  2V53 A;  2KQY A;  1K9P A;  2PRU A;  4BY5 A;  3I5G B;  4I5J A;  1NX1 A;  1QTX A;  1J1D A;  2F3Y A;  1KWO C;  3KHE A;  3I5I B;  3LL8 B;  1FF1 A;  3EVV A;  4YGB B;  1CDL A;  1MUX A;  1SBJ A;  3IQQ A;  4FTG A;  1IQ3 A;  1EG3 A;  2MRD A;  1JUO A;  2KAX A;  1YVL A;  1UP5 A;  3KO0 A;  4ORA B;  1RTP 1;  1A03 A;  2LC5 A;  1UHI A;  1QVI Z;  1ALW A;  1SR6 C;  1SRA A;  1BLQ A;  3C1V A;  1XO5 A;  1BMO A;  1EXR A;  1WLM A;  4DS7 A;  2HF5 A;  2JTZ A;  3WNX B;  1JF0 A;  2PSR A;  3E3R A;  1Y6W A;  4YGD B;  4UPG A;  1AVS A;  1XFW O;  1TRF A;  1S5G Y;  1DJX A;  4AOM A;  1SCV A;  2LCP A;  1K2H A;  3KF9 A;  2LVK A;  4MZK A;  2KGB C;  2IS9 A;  1KK8 B;  1EJ3 A;  2K7D A;  3JTD C;  1DT7 B;  1DJG A;  1TNQ A;  2E30 A;  3KPX A;  4TNC A;  1KCY A;  4A4B A;  3SIA A;  2LAN A;  2I94 A;  2LP2 A;  1BJF A;  2OTG B;  3K21 A;  4MLW A;  1Y0V H;  2KGR A;  4CPV A;  5I2O A;  1QJT A;  2KFF A;  1S3P A;  1DJI A;  1CB1 A;  1QXP A;  2L98 A;  2OS8 C;  3PSR A;  4PE0 A;  4XYN A;  4OV2 A;  3TS5 B;  2CNP A;  4PE4 A;  1PVA A;  1CLB A;  5JJG A;  2LVI A;  2GGZ A;  3BUW B;  1B8L A;  3ZNI A;  3QRX A;  3SG4 A;  2GGM A;  1KK7 Y;  3OX5 A;  1KK7 Z;  1MXL C;  2F8P A;  4I5L B;  1AHR A;  1SL9 A;  4HRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...