1OZSA

C-domain of human cardiac troponin c in complex with the inhibitory region of human cardiac troponin i
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ozsA00
2LV7A 2LVVA 2A4JA 3IF7A 2AUCA 2K61A 2BECA 2JC2A 1OMRA 1SR6B 2KI6D 3C1VA 2WCFA 1B8LA 5IBWA 1AP4A 1S6CA 1QXPA 1KQMB 1SR6C 1F70A 1EXRA 2EC6C 3E3RA 1S5GY 1MR8A 2JWWA 3BQ3A 1NYAA 2R2IA 1S3PA 1J7OA 3LLEA 1FW4A 2JT8A 5CPVA 3TZ1A 3KEVA 4DS7A 2KI6C 2WCBA 2K7OA 3OB2B 4USLA 1NIWA 2Y1MA 1A75A 2KAVA 1GQMA 3I5IB 4FQOA 1L2OB 2MRDA 1YX7A 1UHJA 1DF0B 2WNDA 3EK7A 1IJ6A 1SL7A 4M2PA 3BUXB 3O2PA 4MRXA 2ISDA 4AQIA 4GGNA 3NSKA 1CNPA 1IJ5A 2K7DA 2NXQA 1CDNA 3EVVA 4GFTA 2HF5A 2KFHA 1N0YA 2M8UA 1K93D 4FTGA 4PCWA 4N1GA 3SIBA 1F4OA 3BUWB 1B8CA 1L7ZA 5PALA 4Q04A 2JOJA 1UHNA 2L5XB 4L9MA 1FI6A 5K89A 3PFVA 2Q4UA 5I2LA 3HX4A 2LM5A 1QVIZ 1B8RA 3O6BA 2M0RA 5HLOA 1XFWO 3K21A 4CPVA 3AAJA 3KF9A 2BKHB 3PN7B 5AFPA 1K9KA 2F2PA 2QPTA 4PDZA 4CFRA 3AAKA 2Y4QA 3PSRA 1L2OC 2I7AA 4M2OA 1CKKA 3CZTX 5G08A 3I5FB 1CFFA 1LA0A 1K95A 1C7WA 1YVHA 1XFUO 3TUYB 3WHUB 1TNXA 1B1GA 1K8UA 1A2XA 1TNPA 2E6WA 1IG5A 2JRFA 3CWGA 2D8NA 1ALWA 1KQVA 4C0LA 2JPTA 1IH0A 1FBVA 1LINA 2BBMA 1AJ5A 2LNKA 2M1KB 2OTGB 1ZMZA 1S1EA 1K90D 2LP2A 2Y5IA 1OMVA 2GV5A 1NX0A 2HETA 2F33A 5DKNA 4CFQA 2JTTA 1WDCB 1SL8A 1WRKA 1AVSA 5TNCA 1NUBA 1RWYA 4YGBB 4CIDA 1DJZA 3NSIA 4WQ2A 2TN4A 1SK6D 2KYCA 1SY9A 1UP5A 1WDCC 1QIVA 3FWCA 2KQ6A 1JWDA 2B1UA 2CTNA 2KFFA 4PALA 1NX3A 5J3XA 2NCOA 1A75B 5I8NA 2FJUB 1IKUA 4GGFC 1DMOA 1BR1B 2ZKMX 1PVBA 1TNQA 1DF0A 2CBLA 4WRIA 1K96A 1UUSA 1QJTA 2NCPA 1F4QA 1MXLC 1TCFA 1GJYA 2KI4C 1DT7B 1Y1UA 2JXCA 2LMUA 2KHNA 2M3WA 3CS1A 4N5XA 2MA2A 2G9BA 5CSIA 1DGVA 1Y0VH 5DKQA 2VRGA 2AAOA 1DVIA 4ORBB 1SNLA 4YGEB 1RROA 1PALA 1SKTA 1XK4A 2OS8C 2KBIA 4PE0A 5JJGA 1G33A 1PRWA 2KBMA 1M46A 1S6JA 1KK8C 4DCKA 2FOTA 2MLFC 1B7TY 3EK4A 2NZ0A 3RM1A 4PHKA 1QLKA 1KK8B 2M7LA 1KFUL 2MAZA 2AMIA 3O4YA 1SPYA 2LHIA 3VRQA 3TDIA 2Y1NA 2I94A 2LLTA 2JQ6A 1RTP1 4NDBA 1DJWA 3SG2A 1XYDA 2LUCA 3WHTB 3WXAA 3LK0A 2WCEA 3JTDC 2HPSA 2LCPA 1SCMC 4ZCVA 2Q91A 3D0YA 5CSNA 3ZNIA 3GK2A 4MBEA 1JUOA 2CNPA 3SG4A 3FS7A 3SG3A 1ODBA 1BODA 3PM8A 1NCYA 1LVCD 1M63B 1CFDA 1CFPA 2SASA 4I5LB 2V53A 1CMFA 3ICBA 1HT9A 1CB1A 3QRXA 1B7TZ 1QX2A 1TCOB 3BOWA 1YRTB 4HREE 1EG4A 1OZOA 1CLMA 1D1OA 2KQYA 2KYFA 1R6PA 2I18A 5KU1A 1SL9A 1XVJA 2E30A 3DF0B 2LC5A 4YBHB 1DJHA 1KSOA 2KFGA 4GAOA 2K8MB 2K2AA 4D1EA 3TDZA 1YTZC 3IQQA 2BCXA 2P6BB 1JSAA 1UHHA 5CSFA 3DF0A 1LKJA 1J55A 1B4CA 1N65A 1NX1A 1QX7A 3I5GB 2FCEA 4NDDA 1KFXS 1H4BA 1CLLA 3BUOB 2CT9A 3HCMA 1RK9A 2F3YA 1YURA 2LLUA 1MUXA 1S36A 3DVJA 4MEWA 2KGBC 4E68A 1BOCA 3I5FC 1KCYA 2JNFA 3OB1B 4IL1A 1MWNA 3I5HB 2M9GA 3TUYC 2JXLA 1OQPA 1XFYO 2NLNA 4M2QA 1XO5A 1AUIB 3TS5B 1RECA 2PVBA 4YI8A 2M49B 4ZCUA 2KNEA 1BT6A 2LP3A 2RGIA 3VROA 1BR4B 1C7VA 1QV0A 5JOLA 2MJWB 2L0PA 1A29A 4GUKA 1SCVA 4GPLB 2LMTA 3CLNA 1BLQA 1OZSA 2KGRA 1IGVA 2FCDA 3I5GC 1UHIA 3CR5X 1K2HA 2JT0A 3LK1A 1YUUA 5D69A 2O5GA 1DTLA 3SJSA 4F0ZB 2SCPA 1J7PA 2JU0A 1K9PA 1OOJA 1ZUZA 3D0YB 4MVFA 4R1EA 3RLZA 3A4UB 1G4YR 1MHOA 1XFXO 4P2YB 3OHMB 4HRGA 1KSMA 1F54A 2L2EA 3GK4X 1WRLA 4DUQA 2MHHA 2M7NA 3EVRA 3O78A 1JF2A 3IQOA 1H8BA 3BUMB 4ICBA 1GGZA 2BE6A 3BOWB 2JULA 2F8PA 3JVTC 3KHEA 1MF8B 1GGWA 3OX6A 4MN0A 1QASA 1BF5A 3EKHA 1YR5A 2OS8B 4DIRA 2ZN9A 1OE9B 1DJGA 1QV1A 3FWBA 3BXKA 4PHNA 1QS7A 2LANA 1HQVA 1NWDA 1TOPA 2LAPA 4N1FA 4I5JA 1JFKA 1TTXA 3F45A 2LHLA 1X02A 4PE4A 4HRHA 4QJ5B 2LMVA 5B8IB 1N2DA 1SW8A 1QTXA 1SYMA 1A4PA 1AJ4A 2BL0C 2CXJA 2MLEC 4MZLA 5I2QA 2BE4A 2LVIA 3DD4A 3GK1A 3VGOA 4ETOA 1WY9A 1NCXA 1MXEA 1F8HA 4GNKB 1PVAA 1S6IA 2GGZA 2JT3A 3JTDB 1CMGA 1S26D 1JC2A 1KK7Z 2JZIA 5ER4X 4MLWA 1IWQA 4XJKA 1RJVA 1VRKA 5KTYA 4YGDB 1FF1A 4QJ4B 1SRAA 2HQWA 3CGAA 1QVIY 3EVUA 3OP0A 1R2UA 2L50A 4OR9B 5GQQC 2BKIB 2H61A 1PSBA 3DVKA 4I5NB 4OCIA 3I5IC 5D7FA 4YGAA 4DRWA 5BPJA 1OSAA 4YGCB 3MSEB 1BU3A 5FYXA 1F71A 2M97A 3NSOA 2K7CA 3ZWHA 1CDPA 1NCZA 1W7IB 2M1UA 2JNXA 2ZN8A 1EG3A 1YRUB 2H2KA 3EK8A 4WQ3A 1U5IA 1AHRA 2CCMA 2L4IA 4MSPA 1MQ1A 3H4SE 4OVNF 5AEQA 2JTZA 2LE9B 3SG5A 1YX8A 1E8AA 1BG1A 1AK8A 1EJ3A 4NQGA 3NSLA 4I5KA 2H61C 2ZNDA 4OV2A 2EHBA 2F2OA 3AKBA 4AOMA 4AQJA 1SCMB 3FIAA 1PK0D 2ZNEA 4PHJA 1WLZA 3TS5C 2I2RE 1BMOA 2K7BA 3GOFA 4PE7A 2IS9A 2M29A 1YVLA 1C07A 1ZOTB 2KAXA 1J7RA 1ALVA 4ORAB 3OX5A 2KOTA 1RFJA 1M45A 1W7JB 2WOSA 2WORA 4JQ0D 1XFVO 3PALA 2DOQA 3DVMA 1JBAA 2KSPA 4U8DA 1QIWA 1EL4A 2LVJA 4HSZA 2L4HA 1NP8A 1Q80A 2LVKA 4MRYA 5AXIA 4BY5A 1BJFA 2OTGC 1J7QA 1WRZA 1UHKA 1IQ3A 5CSJA 1J1DA 4UPGA 1S5GZ 3VRPA 4PHMA 5HYDA 1K9UA 3AKAA 3BYAA 1XA5A 2BBNA 3KO0A 1XFZO 1KWOC 1CFCA 4XJKB 1TN4A 4OKHA 3BUNB 1LA3A 1CM4A 1OMDA 1FPWA 1SMGA 2K2FA 1DJXA 5HKWA 1DGUA 1QATA 2BCAA 2HQ8A 2KAYA 1NX2A 2EGDA 1TNWA 3PN7C 1CM1A 1PULA 1TIZA 3DVEA 1XK4C 3I5HC 2MBXA 1ZFSA 2F3ZA 3CTNA 2PASA 4C0JA 1B47A 1IRJA 3CR4X 4P5OE 5I2OA 2KDHA 3JVTB 1YUTA 5F6TA 2K0JA 1G8IA 1V1FA 1QLSA 1IQ5A 4C0KA 2COLB 2O60A 1WLMA 1FI5A 1U5IB 2QACA 2ZRTA 1SBJA 2PALA 1B9AA 3SG6A 4A4CA 1PSRA 4NDCA 1EH2A 1YUSA 1NSHA 1M31A 1Y1XA 1TRFA 3LL8B 3PLFB 1KWOB 5HKYA 2ZFDA 2LUXA 1Y6WA 3D10A 1A03A 2WC8A 4YI9A 1JFJA 2PRUA 1CDLA 1UWOA 1Y1AA 2L51A 4JPZB 4MZJA 4GBAA 5ER5A 4GGFA 2BL0B 1JF0A 1J1EA 2LLSA 4YRUA 5AANA 3VRRA 1KQMC 1CTRA 3NXAA 4PE1A 1KK7Y 3CR2A 2G2BA 1CDMA 2PMYA 1DJIA 1QX5B 2EC6B 3M0WA 1KFUS 3PATA 1LXFC 2ZRSA 3SIAA 1NPQA 4MZKA 2BCBA 3A8RA 3EKJA 4BY4A 1CLBA 1KFXL 5AERA 2KI4B 1K94A 4XYNA 1V1GA 5DKRA 4JWQA 1DJYA 3SG7A 2OPOA 2PSRA 1UURA 3WNXB 3TDUA 4A4BA 4CLNA 2L98A 1F55A 3LCPC 4TNCA 5KSZA 4QJ3B 5HKZA 4ORCB 1M39A 3VRNA 2GGMA 3KPXA 5HLVA 1ZACA
chains in the Genus database with same CATH superfamily
2LV7A 2LVVA 2A4JA 3IF7A 2AUCA 2K61A 2BECA 2JC2A 1OMRA 1SR6B 2KI6D 3C1VA 2WCFA 1B8LA 5IBWA 1AP4A 1S6CA 3R1PA 3L4LA 1QXPA 1KQMB 1SR6C 4PT1A 1F70A 1EXRA 2EC6C 3E3RA 1S5GY 2JPOA 1MR8A 2JWWA 3BQ3A 1DEKA 1NYAA 3FE8A 2R2IA 1S3PA 4OZDA 1J7OA 3LLEA 1FW4A 2JT8A 5CPVA 3TZ1A 3KEVA 4DS7A 2KI6C 2WCBA 2K7OA 3OB2B 4USLA 1NIWA 2Y1MA 1A75A 2KAVA 1GQMA 3I5IB 4FQOA 1L2OB 2MRDA 1YX7A 1UHJA 1DF0B 2WNDA 3EK7A 1IJ6A 3NHTA 1SL7A 4M2PA 3BUXB 3O2PA 4MRXA 1OOGA 2ISDA 4AQIA 4GGNA 3NSKA 1CNPA 1IJ5A 2K7DA 2NXQA 1CDNA 3EVVA 4GFTA 2HF5A 2KFHA 1N0YA 2M8UA 1K93D 4FTGA 4PCWA 4N1GA 3SIBA 1F4OA 3BUWB 1B8CA 1L7ZA 3L4AA 5PALA 4Q04A 2JOJA 1UHNA 2L5XB 2FJYA 4L9MA 1FI6A 5K89A 3PFVA 2Q4UA 5I2LA 3HX4A 2LM5A 1QVIZ 1B8RA 3O6BA 2M0RA 5HLOA 1XFWO 3K21A 4CPVA 3AAJA 3KF9A 2BKHB 3PN7B 5AFPA 1K9KA 2F2PA 2QPTA 4PDZA 4CFRA 3AAKA 3R1VA 2Y4QA 3PSRA 1L2OC 2I7AA 4M2OA 1CKKA 3CZTX 5G08A 3I5FB 1CFFA 1LA0A 1K95A 1C7WA 1YVHA 3DXLA 1XFUO 3TUYB 3WHUB 1TNXA 1B1GA 1K8UA 1A2XA 1TNPA 2E6WA 1IG5A 2JRFA 3O4XA 1GM0A 5HL1A 3CWGA 2D8NA 1ALWA 2YGUA 3B87A 1KQVA 4C0LA 2JPTA 3SS4A 1IH0A 2QEBA 1FBVA 1LINA 2BBMA 1AJ5A 2LNKA 2M1KB 2OTGB 4F7FA 1ZMZA 1S1EA 1K90D 2LP2A 2Y5IA 1OMVA 2GV5A 1NX0A 2HETA 2F33A 5DKNA 3B88A 4CFQA 3NGVA 2JTTA 1WDCB 1SL8A 1WRKA 1AVSA 5TNCA 1NUBA 1RWYA 4YGBB 4CIDA 1DJZA 3NSIA 4WQ2A 3OGNA 2TN4A 1SK6D 2KYCA 1SY9A 1UP5A 1WDCC 1QIVA 3FWCA 2KQ6A 1JWDA 2B1UA 2CTNA 2KFFA 4PALA 1NX3A 5J3XA 2NCOA 1A75B 5I8NA 2FJUB 1IKUA 4GGFC 1DMOA 1BR1B 2ZKMX 1PVBA 1TNQA 3S0GA 1DF0A 2CBLA 4WRIA 1K96A 1UUSA 1QJTA 2NCPA 1F4QA 1MXLC 1TCFA 3UO9A 1GJYA 2KI4C 1DT7B 1Y1UA 2JXCA 2LMUA 2KHNA 2M3WA 3CS1A 4N5XA 2WCKA 2MA2A 2G9BA 5CSIA 3S0AA 1DGVA 1Y0VH 5DKQA 2VRGA 2AAOA 1DVIA 4ORBB 1SNLA 4YGEB 1RROA 1PALA 1SKTA 3B86A 1XK4A 2OS8C 2KBIA 4PE0A 5JJGA 1G33A 3VB1A 1PRWA 2KBMA 5I94A 1M46A 1S6JA 1KK8C 4DCKA 2FOTA 2MLFC 2QDIA 1B7TY 3EK4A 2NZ0A 3RM1A 4PHKA 1QLKA 1KK8B 2M7LA 1KFUL 5DICA 2MAZA 2AMIA 3O4YA 1SPYA 3QMEA 2LHIA 3VRQA 3TDIA 2Y1NA 1C3YA 2I94A 2LLTA 2JQ6A 1RTP1 4NDBA 1DJWA 2KLDA 3SG2A 1XYDA 2LUCA 3WHTB 3WXAA 3LK0A 2WCEA 3JTDC 2HPSA 2LCPA 1SCMC 4ZCVA 2Q91A 3D0YA 5CSNA 3ZNIA 3IVTA 3GK2A 4MBEA 1JUOA 2CNPA 3N7HA 3FS7A 3SG4A 3BFBA 3SG3A 1ODBA 2KLEA 1BODA 3PM8A 2PQLA 1NCYA 1LVCD 1M63B 1CFDA 1CFPA 2SASA 4I5LB 2V53A 1CMFA 3ICBA 1HT9A 1CB1A 3QRXA 1B7TZ 1ORGA 3K1EA 1QX2A 1TCOB 3BOWA 1YRTB 4HREE 5D3OA 1EG4A 1OZOA 1CLMA 1D1OA 2KQYA 2KYFA 1R6PA 3D73A 2I18A 1T14A 5KU1A 1SL9A 1XVJA 2E30A 3DF0B 2LC5A 4YBHB 1DJHA 1KSOA 2KFGA 4GAOA 2K8MB 2K2AA 4D1EA 1Z2CB 3TDZA 1YTZC 3IQQA 2BCXA 2P6BB 1JSAA 1UHHA 5CSFA 3DF0A 1LKJA 1J55A 1B4CA 3D74A 3NHIA 1N65A 1NX1A 1QX7A 3CZ0A 3I5GB 2FCEA 4NDDA 1KFXS 1H4BA 1CLLA 3BUOB 2CT9A 2H8VA 1RK9A 2F3YA 2L2CA 3HCMA 1YURA 2LLUA 1MUXA 1S36A 3DVJA 5FI2A 4MEWA 2KGBC 4E68A 1BOCA 3I5FC 1KCYA 2JNFA 3OB1B 4IL1A 1DQEA 1MWNA 3I5HB 2M9GA 3TUYC 2JXLA 1OQPA 1XFYO 2NLNA 4M2QA 1XO5A 1AUIB 3TS5B 1RECA 2PVBA 2KPHA 4YI8A 2M49B 3CZ1A 4ZCUA 2KNEA 1BT6A 2LP3A 2RGIA 1DC1A 3Q8IA 2QEVA 3VROA 1BR4B 1C7VA 1QV0A 3R72A 3EG5B 5JOLA 2MJWB 2L0PA 1A29A 4GUKA 1SCVA 1C3ZA 4GPLB 2LMTA 3CLNA 1BLQA 2GTEA 1OZSA 2KGRA 1IGVA 2FCDA 3I5GC 1UHIA 5FI7A 3CR5X 1K2HA 1FPWA 2JT0A 3LK1A 3V2LA 1YUUA 5D69A 2O5GA 1DTLA 3SJSA 4F0ZB 2SCPA 1J7PA 1W9ZA 2JU0A 1K9PA 1OOJA 1ZUZA 3D0YB 4MVFA 4R1EA 3RLZA 3A4UB 1G4YR 1MHOA 1XFXO 4P2YB 3OHMB 4HRGA 1KSMA 1F54A 2L2EA 3CDNA 3GK4X 3SS3A 1WRLA 4DUQA 2MHHA 2M7NA 3EVRA 3O78A 1JF2A 3IQOA 1H8BA 3BUMB 4ICBA 1GGZA 2BE6A 3BOWB 2JULA 2F8PA 4INWA 3JVTC 3KHEA 3D77A 1MF8B 1GGWA 3DY9A 3CABA 3OX6A 4MN0A 1QASA 1BF5A 3EKHA 1YR5A 2OS8B 4DIRA 1TWOA 2ZN9A 1OE9B 2WCLA 1DJGA 1QV1A 2K60A 3FWBA 1P28A 2P70A 3BXKA 4PHNA 4FQTA 1QS7A 2LANA 1HQVA 3D75A 3CYZA 1NWDA 3SS5A 2BNXA 1TOPA 2LAPA 1OW4A 4I5JA 1JFKA 4N1FA 1TTXA 3F45A 2LHLA 3R1OA 1X02A 4PE4A 4HRHA 4QJ5B 3S0BA 2LMVA 1IIOA 5B8IB 1N2DA 1SW8A 1QTXA 1SYMA 1A4PA 1AJ4A 2BAPA 2BL0C 2CXJA 2MLEC 3BFHA 3CZ2A 2BE4A 2LVIA 3DD4A 4MZLA 3FE9A 3GK1A 3VGOA 4ETOA 1WY9A 1NCXA 1MXEA 5I2QA 1F8HA 4GNKB 2QEOA 1PVAA 3B6XA 1S6IA 2GGZA 2JT3A 3JTDB 1CMGA 1S26D 1JC2A 1KK7Z 2JZIA 5ER4X 4MLWA 1IWQA 1TUJA 4XJKA 1RJVA 1VRKA 5KTYA 4YGDB 1FF1A 4QJ4B 1SRAA 2HQWA 3CGAA 1QVIY 3EVUA 3OP0A 1R2UA 2L50A 4OR9B 5GQQC 2BKIB 2H61A 1PSBA 3DVKA 4I5NB 4OCIA 3I5IC 5D7FA 4YGAA 4DRWA 5BPJA 1OSAA 4YGCB 3MSEB 1BU3A 5FYXA 1F71A 2M97A 3NSOA 2K7CA 3ZWHA 1CDPA 1NCZA 1W7IB 2M1UA 2JNXA 2PYQA 2ZN8A 1EG3A 1YRUB 2H2KA 3EK8A 4WQ3A 1U5IA 1AHRA 2CCMA 2L4IA 4MSPA 1MQ1A 3H4SE 4OVNF 5AEQA 2JTZA 2LE9B 3SG5A 1YX8A 1E8AA 1BG1A 1AK8A 1EJ3A 1OOFA 4NQGA 3NSLA 4I5KA 2H61C 2WCHA 2ZNDA 4OV2A 2EHBA 2F2OA 3AKBA 4AOMA 4AQJA 1SCMB 3FIAA 1PK0D 2ZNEA 4PHJA 1WLZA 3PJIA 3TS5C 2I2RE 1BMOA 2K7BA 3GOFA 4PE7A 2IS9A 1LS8A 2M29A 1YVLA 1C07A 1ZOTB 2KAXA 1J7RA 2WC5A 1ALVA 4ORAB 3OX5A 2KOTA 1RFJA 3DYEA 1M45A 1W7JB 2WOSA 2WORA 4JQ0D 1XFVO 3PALA 2DOQA 3DVMA 1JBAA 2KSPA 2L5YA 4U8DA 1QIWA 1EL4A 2LVJA 4HSZA 2L4HA 1NP8A 1Q80A 2LVKA 4MRYA 5AXIA 4BY5A 1BJFA 2OTGC 1J7QA 1WRZA 1UHKA 1IQ3A 5CSJA 1J1DA 4UPGA 1S5GZ 1Z4HA 3FE6A 3VRPA 4PHMA 3PM2A 1XFRA 1K9UA 2QEHA 3AKAA 5HYDA 3BYAA 1XA5A 2BBNA 3KO0A 3DZTA 1XFZO 1SSEB 1KWOC 1TUZA 1CFCA 4XJKB 1TN4A 4OKHA 3BUNB 1LA3A 1CM4A 1OMDA 3S0FA 1SMGA 2K2FA 1DJXA 5HKWA 1DGUA 1QATA 2BCAA 2HQ8A 2KAYA 1NX2A 2EGDA 1TNWA 3PN7C 1CM1A 1PULA 1TIZA 3DVEA 1XK4C 2WC6A 3D76A 3I5HC 2MBXA 1ZFSA 2F3ZA 3CTNA 2PASA 4C0JA 1B47A 1IRJA 3CR4X 5EL2A 4P5OE 2ERBA 5I2OA 2KDHA 3B7AA 1YUTA 3JVTB 2K0JA 4JD9A 5F6TA 1G8IA 1V1FA 1QLSA 1IQ5A 3BJHA 4C0KA 2WCMA 2COLB 2O60A 1WLMA 4KYNA 3S0EA 1U5IB 2QACA 2ZRTA 1FI5A 1SBJA 3BFAA 2PALA 1B9AA 2P71A 3SG6A 4A4CA 1PSRA 4NDCA 1EH2A 1YUSA 1NSHA 1M31A 1Y1XA 1TRFA 3LL8B 3PLFB 1DELA 3L47A 1KWOB 5HKYA 2ZFDA 2LUXA 1Y6WA 3D10A 1A03A 2WC8A 4YI9A 1JFJA 2PRUA 1CDLA 1UWOA 1Y1AA 2L51A 4JPZB 4MZJA 4GBAA 5ER5A 4GGFA 2BL0B 1JF0A 4INXA 1J1EA 2LLSA 1QWVA 3D78A 4YRUA 5AANA 3VRRA 1KQMC 1CTRA 3NXAA 4PE1A 3OBVA 1KK7Y 3CR2A 2G2BA 1CDMA 2PMYA 2EC6B 1DJIA 1QX5B 3M0WA 1KFUS 3PATA 1LXFC 2ZRSA 4IJ7A 5FI6A 3SIAA 1NPQA 4MZKA 2BCBA 3A8RA 3EKJA 4BY4A 3RZSA 1KFXL 1CLBA 3S0DA 5AERA 2KI4B 1K94A 2WCJA 4XYNA 1V1GA 5DKRA 4JWQA 1DJYA 3SG7A 2OPOA 2PSRA 1UURA 3WNXB 4JKTA 3TDUA 3UNWA 4A4BA 4CLNA 2L98A 1F55A 3LCPC 4TNCA 5KSZA 1OOHA 4QJ3B 5HKZA 4ORCB 1M39A 3VRNA 2GGMA 3KPXA 5HLVA 1ZACA 1OOIX
chains in the Genus database with same CATH topology
2LV7A 2LVVA 2A4JA 3IF7A 2AUCA 2K61A 2BECA 2JC2A 1OMRA 1SR6B 2KI6D 3C1VA 2WCFA 1B8LA 5IBWA 1AP4A 1S6CA 1QXPA 1KQMB 1SR6C 1F70A 1EXRA 2EC6C 3E3RA 1S5GY 1MR8A 2JWWA 3BQ3A 1NYAA 2R2IA 1S3PA 1J7OA 3LLEA 1FW4A 2JT8A 5CPVA 3TZ1A 3KEVA 4DS7A 2KI6C 2WCBA 2K7OA 3OB2B 4USLA 1NIWA 2Y1MA 1A75A 2KAVA 1GQMA 3I5IB 4FQOA 1L2OB 2MRDA 1YX7A 1UHJA 1DF0B 2WNDA 3EK7A 1IJ6A 1SL7A 4M2PA 3BUXB 3O2PA 4MRXA 2ISDA 4AQIA 4GGNA 3NSKA 1CNPA 1IJ5A 2K7DA 2NXQA 1CDNA 3EVVA 4GFTA 2HF5A 2KFHA 1N0YA 2M8UA 1K93D 4FTGA 4PCWA 4N1GA 3SIBA 1F4OA 3BUWB 1B8CA 1L7ZA 5PALA 4Q04A 2JOJA 1UHNA 2L5XB 4L9MA 1FI6A 5K89A 3PFVA 2Q4UA 5I2LA 3HX4A 2LM5A 1QVIZ 1B8RA 3O6BA 2M0RA 5HLOA 1XFWO 3K21A 4CPVA 3AAJA 3KF9A 2BKHB 3PN7B 5AFPA 1K9KA 2F2PA 2QPTA 4PDZA 4CFRA 3AAKA 2Y4QA 3PSRA 1L2OC 2I7AA 4M2OA 1CKKA 3CZTX 5G08A 3I5FB 1CFFA 1LA0A 1K95A 1C7WA 1YVHA 1XFUO 3TUYB 3WHUB 1TNXA 1B1GA 1K8UA 1A2XA 1TNPA 2E6WA 1IG5A 2JRFA 3CWGA 2D8NA 1ALWA 1KQVA 4C0LA 2JPTA 1IH0A 1FBVA 1LINA 2BBMA 1AJ5A 2LNKA 2M1KB 2OTGB 1ZMZA 1S1EA 1K90D 2LP2A 2Y5IA 1OMVA 2GV5A 1NX0A 2HETA 2F33A 5DKNA 4CFQA 2JTTA 1WDCB 1SL8A 1WRKA 1AVSA 5TNCA 1NUBA 1RWYA 4YGBB 4CIDA 1DJZA 3NSIA 4WQ2A 2TN4A 1SK6D 2KYCA 1SY9A 1UP5A 1WDCC 1QIVA 3FWCA 2KQ6A 1JWDA 2B1UA 2CTNA 2KFFA 4PALA 1NX3A 5J3XA 2NCOA 1A75B 5I8NA 2FJUB 1IKUA 4GGFC 1DMOA 1BR1B 2ZKMX 1PVBA 1TNQA 1DF0A 2CBLA 4WRIA 1K96A 1UUSA 1QJTA 2NCPA 1F4QA 1MXLC 1TCFA 1GJYA 2KI4C 1DT7B 1Y1UA 2JXCA 2LMUA 2KHNA 2M3WA 3CS1A 4N5XA 2MA2A 2G9BA 5CSIA 1DGVA 1Y0VH 5DKQA 2VRGA 2AAOA 1DVIA 4ORBB 1SNLA 4YGEB 1RROA 1PALA 1SKTA 1XK4A 2OS8C 2KBIA 4PE0A 5JJGA 1G33A 1PRWA 2KBMA 1M46A 1S6JA 1KK8C 4DCKA 2FOTA 2MLFC 1B7TY 3EK4A 2NZ0A 3RM1A 4PHKA 1QLKA 1KK8B 2M7LA 1KFUL 2MAZA 2AMIA 3O4YA 1SPYA 2LHIA 3VRQA 3TDIA 2Y1NA 2I94A 2LLTA 2JQ6A 1RTP1 4NDBA 1DJWA 3SG2A 1XYDA 2LUCA 3WHTB 3WXAA 3LK0A 2WCEA 3JTDC 2HPSA 2LCPA 1SCMC 4ZCVA 2Q91A 3D0YA 5CSNA 3ZNIA 3GK2A 4MBEA 1JUOA 2CNPA 3SG4A 3FS7A 3SG3A 1ODBA 1BODA 3PM8A 1NCYA 1LVCD 1M63B 1CFDA 1CFPA 2SASA 4I5LB 2V53A 1CMFA 3ICBA 1HT9A 1CB1A 3QRXA 1B7TZ 1QX2A 1TCOB 3BOWA 1YRTB 4HREE 1EG4A 1OZOA 1CLMA 1D1OA 2KQYA 2KYFA 1R6PA 2I18A 5KU1A 1SL9A 1XVJA 2E30A 3DF0B 2LC5A 4YBHB 1DJHA 1KSOA 2KFGA 4GAOA 2K8MB 2K2AA 4D1EA 3TDZA 1YTZC 3IQQA 2BCXA 2P6BB 1JSAA 1UHHA 5CSFA 3DF0A 1LKJA 1J55A 1B4CA 1N65A 1NX1A 1QX7A 3I5GB 2FCEA 4NDDA 1KFXS 1H4BA 1CLLA 3BUOB 2CT9A 3HCMA 1RK9A 2F3YA 1YURA 2LLUA 1MUXA 1S36A 3DVJA 4MEWA 2KGBC 4E68A 1BOCA 3I5FC 1KCYA 2JNFA 3OB1B 4IL1A 1MWNA 3I5HB 2M9GA 3TUYC 2JXLA 1OQPA 1XFYO 2NLNA 4M2QA 1XO5A 1AUIB 3TS5B 1RECA 2PVBA 4YI8A 2M49B 4ZCUA 2KNEA 1BT6A 2LP3A 2RGIA 3VROA 1BR4B 1C7VA 1QV0A 5JOLA 2MJWB 2L0PA 1A29A 4GUKA 1SCVA 4GPLB 2LMTA 3CLNA 1BLQA 1OZSA 2KGRA 1IGVA 2FCDA 3I5GC 1UHIA 3CR5X 1K2HA 2JT0A 3LK1A 1YUUA 5D69A 2O5GA 1DTLA 3SJSA 4F0ZB 2SCPA 1J7PA 2JU0A 1K9PA 1OOJA 1ZUZA 3D0YB 4MVFA 4R1EA 3RLZA 3A4UB 1G4YR 1MHOA 1XFXO 4P2YB 3OHMB 4HRGA 1KSMA 1F54A 2L2EA 3GK4X 1WRLA 4DUQA 2MHHA 2M7NA 3EVRA 3O78A 1JF2A 3IQOA 1H8BA 3BUMB 4ICBA 1GGZA 2BE6A 3BOWB 2JULA 2F8PA 3JVTC 3KHEA 1MF8B 1GGWA 3OX6A 4MN0A 1QASA 1BF5A 3EKHA 1YR5A 2OS8B 4DIRA 2ZN9A 1OE9B 1DJGA 1QV1A 3FWBA 3BXKA 4PHNA 1QS7A 2LANA 1HQVA 1NWDA 1TOPA 2LAPA 4N1FA 4I5JA 1JFKA 1TTXA 3F45A 2LHLA 1X02A 4PE4A 4HRHA 4QJ5B 2LMVA 5B8IB 1N2DA 1SW8A 1QTXA 1SYMA 1A4PA 1AJ4A 2BL0C 2CXJA 2MLEC 4MZLA 5I2QA 2BE4A 2LVIA 3DD4A 3GK1A 3VGOA 4ETOA 1WY9A 1NCXA 1MXEA 1F8HA 4GNKB 1PVAA 1S6IA 2GGZA 2JT3A 3JTDB 1CMGA 1S26D 1JC2A 1KK7Z 2JZIA 5ER4X 4MLWA 1IWQA 4XJKA 1RJVA 1VRKA 5KTYA 4YGDB 1FF1A 4QJ4B 1SRAA 2HQWA 3CGAA 1QVIY 3EVUA 3OP0A 1R2UA 2L50A 4OR9B 5GQQC 2BKIB 2H61A 1PSBA 3DVKA 4I5NB 4OCIA 3I5IC 5D7FA 4YGAA 4DRWA 5BPJA 1OSAA 4YGCB 3MSEB 1BU3A 5FYXA 1F71A 2M97A 3NSOA 2K7CA 3ZWHA 1CDPA 1NCZA 1W7IB 2M1UA 2JNXA 2ZN8A 1EG3A 1YRUB 2H2KA 3EK8A 4WQ3A 1U5IA 1AHRA 2CCMA 2L4IA 4MSPA 1MQ1A 3H4SE 4OVNF 5AEQA 2JTZA 2LE9B 3SG5A 1YX8A 1E8AA 1BG1A 1AK8A 1EJ3A 4NQGA 3NSLA 4I5KA 2H61C 2ZNDA 4OV2A 2EHBA 2F2OA 3AKBA 4AOMA 4AQJA 1SCMB 3FIAA 1PK0D 2ZNEA 4PHJA 1WLZA 3TS5C 2I2RE 1BMOA 2K7BA 3GOFA 4PE7A 2IS9A 2M29A 1YVLA 1C07A 1ZOTB 2KAXA 1J7RA 1ALVA 4ORAB 3OX5A 2KOTA 1RFJA 1M45A 1W7JB 2WOSA 2WORA 4JQ0D 1XFVO 3PALA 2DOQA 3DVMA 1JBAA 2KSPA 4U8DA 1QIWA 1EL4A 2LVJA 4HSZA 2L4HA 1NP8A 1Q80A 2LVKA 4MRYA 5AXIA 4BY5A 1BJFA 2OTGC 1J7QA 1WRZA 1UHKA 1IQ3A 5CSJA 1J1DA 4UPGA 1S5GZ 3VRPA 4PHMA 5HYDA 1K9UA 3AKAA 3BYAA 1XA5A 2BBNA 3KO0A 1XFZO 1KWOC 1CFCA 4XJKB 1TN4A 4OKHA 3BUNB 1LA3A 1CM4A 1OMDA 1FPWA 1SMGA 2K2FA 1DJXA 5HKWA 1DGUA 1QATA 2BCAA 2HQ8A 2KAYA 1NX2A 2EGDA 1TNWA 3PN7C 1CM1A 1PULA 1TIZA 3DVEA 1XK4C 3I5HC 2MBXA 1ZFSA 2F3ZA 3CTNA 2PASA 4C0JA 1B47A 1IRJA 3CR4X 4P5OE 5I2OA 2KDHA 3JVTB 1YUTA 5F6TA 2K0JA 1G8IA 1V1FA 1QLSA 1IQ5A 4C0KA 2COLB 2O60A 1WLMA 1FI5A 1U5IB 2QACA 2ZRTA 1SBJA 2PALA 1B9AA 3SG6A 4A4CA 1PSRA 4NDCA 1EH2A 1YUSA 1NSHA 1M31A 1Y1XA 1TRFA 3LL8B 3PLFB 1KWOB 5HKYA 2ZFDA 2LUXA 1Y6WA 3D10A 1A03A 2WC8A 4YI9A 1JFJA 2PRUA 1CDLA 1UWOA 1Y1AA 2L51A 4JPZB 4MZJA 4GBAA 5ER5A 4GGFA 2BL0B 1JF0A 1J1EA 2LLSA 4YRUA 5AANA 3VRRA 1KQMC 1CTRA 3NXAA 4PE1A 1KK7Y 3CR2A 2G2BA 1CDMA 2PMYA 1DJIA 1QX5B 2EC6B 3M0WA 1KFUS 3PATA 1LXFC 2ZRSA 3SIAA 1NPQA 4MZKA 2BCBA 3A8RA 3EKJA 4BY4A 1CLBA 1KFXL 5AERA 2KI4B 1K94A 4XYNA 1V1GA 5DKRA 4JWQA 1DJYA 3SG7A 2OPOA 2PSRA 1UURA 3WNXB 3TDUA 4A4BA 4CLNA 2L98A 1F55A 3LCPC 4TNCA 5KSZA 4QJ3B 5HKZA 4ORCB 1M39A 3VRNA 2GGMA 3KPXA 5HLVA 1ZACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV7 A;  2LVV A;  2A4J A;  3IF7 A;  2AUC A;  2K61 A;  2BEC A;  2JC2 A;  1OMR A;  1SR6 B;  2KI6 D;  3C1V A;  2WCF A;  1B8L A;  5IBW A;  1AP4 A;  1S6C A;  1QXP A;  1KQM B;  1SR6 C;  1F70 A;  1EXR A;  2EC6 C;  3E3R A;  1S5G Y;  1MR8 A;  2JWW A;  3BQ3 A;  1NYA A;  2R2I A;  1S3P A;  1J7O A;  3LLE A;  1FW4 A;  2JT8 A;  5CPV A;  3TZ1 A;  3KEV A;  4DS7 A;  2KI6 C;  2WCB A;  2K7O A;  3OB2 B;  4USL A;  1NIW A;  2Y1M A;  1A75 A;  2KAV A;  1GQM A;  3I5I B;  4FQO A;  1L2O B;  2MRD A;  1YX7 A;  1UHJ A;  1DF0 B;  2WND A;  3EK7 A;  1IJ6 A;  1SL7 A;  4M2P A;  3BUX B;  3O2P A;  4MRX A;  2ISD A;  4AQI A;  4GGN A;  3NSK A;  1CNP A;  1IJ5 A;  2K7D A;  2NXQ A;  1CDN A;  3EVV A;  4GFT A;  2HF5 A;  2KFH A;  1N0Y A;  2M8U A;  1K93 D;  4FTG A;  4PCW A;  4N1G A;  3SIB A;  1F4O A;  3BUW B;  1B8C A;  1L7Z A;  5PAL A;  4Q04 A;  2JOJ A;  1UHN A;  2L5X B;  4L9M A;  1FI6 A;  5K89 A;  3PFV A;  2Q4U A;  5I2L A;  3HX4 A;  2LM5 A;  1QVI Z;  1B8R A;  3O6B A;  2M0R A;  5HLO A;  1XFW O;  3K21 A;  4CPV A;  3AAJ A;  3KF9 A;  2BKH B;  3PN7 B;  5AFP A;  1K9K A;  2F2P A;  2QPT A;  4PDZ A;  4CFR A;  3AAK A;  2Y4Q A;  3PSR A;  1L2O C;  2I7A A;  4M2O A;  1CKK A;  3CZT X;  5G08 A;  3I5F B;  1CFF A;  1LA0 A;  1K95 A;  1C7W A;  1YVH A;  1XFU O;  3TUY B;  3WHU B;  1TNX A;  1B1G A;  1K8U A;  1A2X A;  1TNP A;  2E6W A;  1IG5 A;  2JRF A;  3CWG A;  2D8N A;  1ALW A;  1KQV A;  4C0L A;  2JPT A;  1IH0 A;  1FBV A;  1LIN A;  2BBM A;  1AJ5 A;  2LNK A;  2M1K B;  2OTG B;  1ZMZ A;  1S1E A;  1K90 D;  2LP2 A;  2Y5I A;  1OMV A;  2GV5 A;  1NX0 A;  2HET A;  2F33 A;  5DKN A;  4CFQ A;  2JTT A;  1WDC B;  1SL8 A;  1WRK A;  1AVS A;  5TNC A;  1NUB A;  1RWY A;  4YGB B;  4CID A;  1DJZ A;  3NSI A;  4WQ2 A;  2TN4 A;  1SK6 D;  2KYC A;  1SY9 A;  1UP5 A;  1WDC C;  1QIV A;  3FWC A;  2KQ6 A;  1JWD A;  2B1U A;  2CTN A;  2KFF A;  4PAL A;  1NX3 A;  5J3X A;  2NCO A;  1A75 B;  5I8N A;  2FJU B;  1IKU A;  4GGF C;  1DMO A;  1BR1 B;  2ZKM X;  1PVB A;  1TNQ A;  1DF0 A;  2CBL A;  4WRI A;  1K96 A;  1UUS A;  1QJT A;  2NCP A;  1F4Q A;  1MXL C;  1TCF A;  1GJY A;  2KI4 C;  1DT7 B;  1Y1U A;  2JXC A;  2LMU A;  2KHN A;  2M3W A;  3CS1 A;  4N5X A;  2MA2 A;  2G9B A;  5CSI A;  1DGV A;  1Y0V H;  5DKQ A;  2VRG A;  2AAO A;  1DVI A;  4ORB B;  1SNL A;  4YGE B;  1RRO A;  1PAL A;  1SKT A;  1XK4 A;  2OS8 C;  2KBI A;  4PE0 A;  5JJG A;  1G33 A;  1PRW A;  2KBM A;  1M46 A;  1S6J A;  1KK8 C;  4DCK A;  2FOT A;  2MLF C;  1B7T Y;  3EK4 A;  2NZ0 A;  3RM1 A;  4PHK A;  1QLK A;  1KK8 B;  2M7L A;  1KFU L;  2MAZ A;  2AMI A;  3O4Y A;  1SPY A;  2LHI A;  3VRQ A;  3TDI A;  2Y1N A;  2I94 A;  2LLT A;  2JQ6 A;  1RTP 1;  4NDB A;  1DJW A;  3SG2 A;  1XYD A;  2LUC A;  3WHT B;  3WXA A;  3LK0 A;  2WCE A;  3JTD C;  2HPS A;  2LCP A;  1SCM C;  4ZCV A;  2Q91 A;  3D0Y A;  5CSN A;  3ZNI A;  3GK2 A;  4MBE A;  1JUO A;  2CNP A;  3SG4 A;  3FS7 A;  3SG3 A;  1ODB A;  1BOD A;  3PM8 A;  1NCY A;  1LVC D;  1M63 B;  1CFD A;  1CFP A;  2SAS A;  4I5L B;  2V53 A;  1CMF A;  3ICB A;  1HT9 A;  1CB1 A;  3QRX A;  1B7T Z;  1QX2 A;  1TCO B;  3BOW A;  1YRT B;  4HRE E;  1EG4 A;  1OZO A;  1CLM A;  1D1O A;  2KQY A;  2KYF A;  1R6P A;  2I18 A;  5KU1 A;  1SL9 A;  1XVJ A;  2E30 A;  3DF0 B;  2LC5 A;  4YBH B;  1DJH A;  1KSO A;  2KFG A;  4GAO A;  2K8M B;  2K2A A;  4D1E A;  3TDZ A;  1YTZ C;  3IQQ A;  2BCX A;  2P6B B;  1JSA A;  1UHH A;  5CSF A;  3DF0 A;  1LKJ A;  1J55 A;  1B4C A;  1N65 A;  1NX1 A;  1QX7 A;  3I5G B;  2FCE A;  4NDD A;  1KFX S;  1H4B A;  1CLL A;  3BUO B;  2CT9 A;  3HCM A;  1RK9 A;  2F3Y A;  1YUR A;  2LLU A;  1MUX A;  1S36 A;  3DVJ A;  4MEW A;  2KGB C;  4E68 A;  1BOC A;  3I5F C;  1KCY A;  2JNF A;  3OB1 B;  4IL1 A;  1MWN A;  3I5H B;  2M9G A;  3TUY C;  2JXL A;  1OQP A;  1XFY O;  2NLN A;  4M2Q A;  1XO5 A;  1AUI B;  3TS5 B;  1REC A;  2PVB A;  4YI8 A;  2M49 B;  4ZCU A;  2KNE A;  1BT6 A;  2LP3 A;  2RGI A;  3VRO A;  1BR4 B;  1C7V A;  1QV0 A;  5JOL A;  2MJW B;  2L0P A;  1A29 A;  4GUK A;  1SCV A;  4GPL B;  2LMT A;  3CLN A;  1BLQ A;  1OZS A;  2KGR A;  1IGV A;  2FCD A;  3I5G C;  1UHI A;  3CR5 X;  1K2H A;  2JT0 A;  3LK1 A;  1YUU A;  5D69 A;  2O5G A;  1DTL A;  3SJS A;  4F0Z B;  2SCP A;  1J7P A;  2JU0 A;  1K9P A;  1OOJ A;  1ZUZ A;  3D0Y B;  4MVF A;  4R1E A;  3RLZ A;  3A4U B;  1G4Y R;  1MHO A;  1XFX O;  4P2Y B;  3OHM B;  4HRG A;  1KSM A;  1F54 A;  2L2E A;  3GK4 X;  1WRL A;  4DUQ A;  2MHH A;  2M7N A;  3EVR A;  3O78 A;  1JF2 A;  3IQO A;  1H8B A;  3BUM B;  4ICB A;  1GGZ A;  2BE6 A;  3BOW B;  2JUL A;  2F8P A;  3JVT C;  3KHE A;  1MF8 B;  1GGW A;  3OX6 A;  4MN0 A;  1QAS A;  1BF5 A;  3EKH A;  1YR5 A;  2OS8 B;  4DIR A;  2ZN9 A;  1OE9 B;  1DJG A;  1QV1 A;  3FWB A;  3BXK A;  4PHN A;  1QS7 A;  2LAN A;  1HQV A;  1NWD A;  1TOP A;  2LAP A;  4N1F A;  4I5J A;  1JFK A;  1TTX A;  3F45 A;  2LHL A;  1X02 A;  4PE4 A;  4HRH A;  4QJ5 B;  2LMV A;  5B8I B;  1N2D A;  1SW8 A;  1QTX A;  1SYM A;  1A4P A;  1AJ4 A;  2BL0 C;  2CXJ A;  2MLE C;  4MZL A;  5I2Q A;  2BE4 A;  2LVI A;  3DD4 A;  3GK1 A;  3VGO A;  4ETO A;  1WY9 A;  1NCX A;  1MXE A;  1F8H A;  4GNK B;  1PVA A;  1S6I A;  2GGZ A;  2JT3 A;  3JTD B;  1CMG A;  1S26 D;  1JC2 A;  1KK7 Z;  2JZI A;  5ER4 X;  4MLW A;  1IWQ A;  4XJK A;  1RJV A;  1VRK A;  5KTY A;  4YGD B;  1FF1 A;  4QJ4 B;  1SRA A;  2HQW A;  3CGA A;  1QVI Y;  3EVU A;  3OP0 A;  1R2U A;  2L50 A;  4OR9 B;  5GQQ C;  2BKI B;  2H61 A;  1PSB A;  3DVK A;  4I5N B;  4OCI A;  3I5I C;  5D7F A;  4YGA A;  4DRW A;  5BPJ A;  1OSA A;  4YGC B;  3MSE B;  1BU3 A;  5FYX A;  1F71 A;  2M97 A;  3NSO A;  2K7C A;  3ZWH A;  1CDP A;  1NCZ A;  1W7I B;  2M1U A;  2JNX A;  2ZN8 A;  1EG3 A;  1YRU B;  2H2K A;  3EK8 A;  4WQ3 A;  1U5I A;  1AHR A;  2CCM A;  2L4I A;  4MSP A;  1MQ1 A;  3H4S E;  4OVN F;  5AEQ A;  2JTZ A;  2LE9 B;  3SG5 A;  1YX8 A;  1E8A A;  1BG1 A;  1AK8 A;  1EJ3 A;  4NQG A;  3NSL A;  4I5K A;  2H61 C;  2ZND A;  4OV2 A;  2EHB A;  2F2O A;  3AKB A;  4AOM A;  4AQJ A;  1SCM B;  3FIA A;  1PK0 D;  2ZNE A;  4PHJ A;  1WLZ A;  3TS5 C;  2I2R E;  1BMO A;  2K7B A;  3GOF A;  4PE7 A;  2IS9 A;  2M29 A;  1YVL A;  1C07 A;  1ZOT B;  2KAX A;  1J7R A;  1ALV A;  4ORA B;  3OX5 A;  2KOT A;  1RFJ A;  1M45 A;  1W7J B;  2WOS A;  2WOR A;  4JQ0 D;  1XFV O;  3PAL A;  2DOQ A;  3DVM A;  1JBA A;  2KSP A;  4U8D A;  1QIW A;  1EL4 A;  2LVJ A;  4HSZ A;  2L4H A;  1NP8 A;  1Q80 A;  2LVK A;  4MRY A;  5AXI A;  4BY5 A;  1BJF A;  2OTG C;  1J7Q A;  1WRZ A;  1UHK A;  1IQ3 A;  5CSJ A;  1J1D A;  4UPG A;  1S5G Z;  3VRP A;  4PHM A;  5HYD A;  1K9U A;  3AKA A;  3BYA A;  1XA5 A;  2BBN A;  3KO0 A;  1XFZ O;  1KWO C;  1CFC A;  4XJK B;  1TN4 A;  4OKH A;  3BUN B;  1LA3 A;  1CM4 A;  1OMD A;  1FPW A;  1SMG A;  2K2F A;  1DJX A;  5HKW A;  1DGU A;  1QAT A;  2BCA A;  2HQ8 A;  2KAY A;  1NX2 A;  2EGD A;  1TNW A;  3PN7 C;  1CM1 A;  1PUL A;  1TIZ A;  3DVE A;  1XK4 C;  3I5H C;  2MBX A;  1ZFS A;  2F3Z A;  3CTN A;  2PAS A;  4C0J A;  1B47 A;  1IRJ A;  3CR4 X;  4P5O E;  5I2O A;  2KDH A;  3JVT B;  1YUT A;  5F6T A;  2K0J A;  1G8I A;  1V1F A;  1QLS A;  1IQ5 A;  4C0K A;  2COL B;  2O60 A;  1WLM A;  1FI5 A;  1U5I B;  2QAC A;  2ZRT A;  1SBJ A;  2PAL A;  1B9A A;  3SG6 A;  4A4C A;  1PSR A;  4NDC A;  1EH2 A;  1YUS A;  1NSH A;  1M31 A;  1Y1X A;  1TRF A;  3LL8 B;  3PLF B;  1KWO B;  5HKY A;  2ZFD A;  2LUX A;  1Y6W A;  3D10 A;  1A03 A;  2WC8 A;  4YI9 A;  1JFJ A;  2PRU A;  1CDL A;  1UWO A;  1Y1A A;  2L51 A;  4JPZ B;  4MZJ A;  4GBA A;  5ER5 A;  4GGF A;  2BL0 B;  1JF0 A;  1J1E A;  2LLS A;  4YRU A;  5AAN A;  3VRR A;  1KQM C;  1CTR A;  3NXA A;  4PE1 A;  1KK7 Y;  3CR2 A;  2G2B A;  1CDM A;  2PMY A;  1DJI A;  1QX5 B;  2EC6 B;  3M0W A;  1KFU S;  3PAT A;  1LXF C;  2ZRS A;  3SIA A;  1NPQ A;  4MZK A;  2BCB A;  3A8R A;  3EKJ A;  4BY4 A;  1CLB A;  1KFX L;  5AER A;  2KI4 B;  1K94 A;  4XYN A;  1V1G A;  5DKR A;  4JWQ A;  1DJY A;  3SG7 A;  2OPO A;  2PSR A;  1UUR A;  3WNX B;  3TDU A;  4A4B A;  4CLN A;  2L98 A;  1F55 A;  3LCP C;  4TNC A;  5KSZ A;  4QJ3 B;  5HKZ A;  4ORC B;  1M39 A;  3VRN A;  2GGM A;  3KPX A;  5HLV A;  1ZAC A; 
#chains in the Genus database with same CATH topology
 2LV7 A;  2LVV A;  2A4J A;  3IF7 A;  2AUC A;  2K61 A;  2BEC A;  2JC2 A;  1OMR A;  1SR6 B;  2KI6 D;  3C1V A;  2WCF A;  1B8L A;  5IBW A;  1AP4 A;  1S6C A;  3R1P A;  3L4L A;  1QXP A;  1KQM B;  1SR6 C;  4PT1 A;  1F70 A;  1EXR A;  2EC6 C;  3E3R A;  1S5G Y;  2JPO A;  1MR8 A;  2JWW A;  3BQ3 A;  1DEK A;  1NYA A;  3FE8 A;  2R2I A;  1S3P A;  4OZD A;  1J7O A;  3LLE A;  1FW4 A;  2JT8 A;  5CPV A;  3TZ1 A;  3KEV A;  4DS7 A;  2KI6 C;  2WCB A;  2K7O A;  3OB2 B;  4USL A;  1NIW A;  2Y1M A;  1A75 A;  2KAV A;  1GQM A;  3I5I B;  4FQO A;  1L2O B;  2MRD A;  1YX7 A;  1UHJ A;  1DF0 B;  2WND A;  3EK7 A;  1IJ6 A;  3NHT A;  1SL7 A;  4M2P A;  3BUX B;  3O2P A;  4MRX A;  1OOG A;  2ISD A;  4AQI A;  4GGN A;  3NSK A;  1CNP A;  1IJ5 A;  2K7D A;  2NXQ A;  1CDN A;  3EVV A;  4GFT A;  2HF5 A;  2KFH A;  1N0Y A;  2M8U A;  1K93 D;  4FTG A;  4PCW A;  4N1G A;  3SIB A;  1F4O A;  3BUW B;  1B8C A;  1L7Z A;  3L4A A;  5PAL A;  4Q04 A;  2JOJ A;  1UHN A;  2L5X B;  2FJY A;  4L9M A;  1FI6 A;  5K89 A;  3PFV A;  2Q4U A;  5I2L A;  3HX4 A;  2LM5 A;  1QVI Z;  1B8R A;  3O6B A;  2M0R A;  5HLO A;  1XFW O;  3K21 A;  4CPV A;  3AAJ A;  3KF9 A;  2BKH B;  3PN7 B;  5AFP A;  1K9K A;  2F2P A;  2QPT A;  4PDZ A;  4CFR A;  3AAK A;  3R1V A;  2Y4Q A;  3PSR A;  1L2O C;  2I7A A;  4M2O A;  1CKK A;  3CZT X;  5G08 A;  3I5F B;  1CFF A;  1LA0 A;  1K95 A;  1C7W A;  1YVH A;  3DXL A;  1XFU O;  3TUY B;  3WHU B;  1TNX A;  1B1G A;  1K8U A;  1A2X A;  1TNP A;  2E6W A;  1IG5 A;  2JRF A;  3O4X A;  1GM0 A;  5HL1 A;  3CWG A;  2D8N A;  1ALW A;  2YGU A;  3B87 A;  1KQV A;  4C0L A;  2JPT A;  3SS4 A;  1IH0 A;  2QEB A;  1FBV A;  1LIN A;  2BBM A;  1AJ5 A;  2LNK A;  2M1K B;  2OTG B;  4F7F A;  1ZMZ A;  1S1E A;  1K90 D;  2LP2 A;  2Y5I A;  1OMV A;  2GV5 A;  1NX0 A;  2HET A;  2F33 A;  5DKN A;  3B88 A;  4CFQ A;  3NGV A;  2JTT A;  1WDC B;  1SL8 A;  1WRK A;  1AVS A;  5TNC A;  1NUB A;  1RWY A;  4YGB B;  4CID A;  1DJZ A;  3NSI A;  4WQ2 A;  3OGN A;  2TN4 A;  1SK6 D;  2KYC A;  1SY9 A;  1UP5 A;  1WDC C;  1QIV A;  3FWC A;  2KQ6 A;  1JWD A;  2B1U A;  2CTN A;  2KFF A;  4PAL A;  1NX3 A;  5J3X A;  2NCO A;  1A75 B;  5I8N A;  2FJU B;  1IKU A;  4GGF C;  1DMO A;  1BR1 B;  2ZKM X;  1PVB A;  1TNQ A;  3S0G A;  1DF0 A;  2CBL A;  4WRI A;  1K96 A;  1UUS A;  1QJT A;  2NCP A;  1F4Q A;  1MXL C;  1TCF A;  3UO9 A;  1GJY A;  2KI4 C;  1DT7 B;  1Y1U A;  2JXC A;  2LMU A;  2KHN A;  2M3W A;  3CS1 A;  4N5X A;  2WCK A;  2MA2 A;  2G9B A;  5CSI A;  3S0A A;  1DGV A;  1Y0V H;  5DKQ A;  2VRG A;  2AAO A;  1DVI A;  4ORB B;  1SNL A;  4YGE B;  1RRO A;  1PAL A;  1SKT A;  3B86 A;  1XK4 A;  2OS8 C;  2KBI A;  4PE0 A;  5JJG A;  1G33 A;  3VB1 A;  1PRW A;  2KBM A;  5I94 A;  1M46 A;  1S6J A;  1KK8 C;  4DCK A;  2FOT A;  2MLF C;  2QDI A;  1B7T Y;  3EK4 A;  2NZ0 A;  3RM1 A;  4PHK A;  1QLK A;  1KK8 B;  2M7L A;  1KFU L;  5DIC A;  2MAZ A;  2AMI A;  3O4Y A;  1SPY A;  3QME A;  2LHI A;  3VRQ A;  3TDI A;  2Y1N A;  1C3Y A;  2I94 A;  2LLT A;  2JQ6 A;  1RTP 1;  4NDB A;  1DJW A;  2KLD A;  3SG2 A;  1XYD A;  2LUC A;  3WHT B;  3WXA A;  3LK0 A;  2WCE A;  3JTD C;  2HPS A;  2LCP A;  1SCM C;  4ZCV A;  2Q91 A;  3D0Y A;  5CSN A;  3ZNI A;  3IVT A;  3GK2 A;  4MBE A;  1JUO A;  2CNP A;  3N7H A;  3FS7 A;  3SG4 A;  3BFB A;  3SG3 A;  1ODB A;  2KLE A;  1BOD A;  3PM8 A;  2PQL A;  1NCY A;  1LVC D;  1M63 B;  1CFD A;  1CFP A;  2SAS A;  4I5L B;  2V53 A;  1CMF A;  3ICB A;  1HT9 A;  1CB1 A;  3QRX A;  1B7T Z;  1ORG A;  3K1E A;  1QX2 A;  1TCO B;  3BOW A;  1YRT B;  4HRE E;  5D3O A;  1EG4 A;  1OZO A;  1CLM A;  1D1O A;  2KQY A;  2KYF A;  1R6P A;  3D73 A;  2I18 A;  1T14 A;  5KU1 A;  1SL9 A;  1XVJ A;  2E30 A;  3DF0 B;  2LC5 A;  4YBH B;  1DJH A;  1KSO A;  2KFG A;  4GAO A;  2K8M B;  2K2A A;  4D1E A;  1Z2C B;  3TDZ A;  1YTZ C;  3IQQ A;  2BCX A;  2P6B B;  1JSA A;  1UHH A;  5CSF A;  3DF0 A;  1LKJ A;  1J55 A;  1B4C A;  3D74 A;  3NHI A;  1N65 A;  1NX1 A;  1QX7 A;  3CZ0 A;  3I5G B;  2FCE A;  4NDD A;  1KFX S;  1H4B A;  1CLL A;  3BUO B;  2CT9 A;  2H8V A;  1RK9 A;  2F3Y A;  2L2C A;  3HCM A;  1YUR A;  2LLU A;  1MUX A;  1S36 A;  3DVJ A;  5FI2 A;  4MEW A;  2KGB C;  4E68 A;  1BOC A;  3I5F C;  1KCY A;  2JNF A;  3OB1 B;  4IL1 A;  1DQE A;  1MWN A;  3I5H B;  2M9G A;  3TUY C;  2JXL A;  1OQP A;  1XFY O;  2NLN A;  4M2Q A;  1XO5 A;  1AUI B;  3TS5 B;  1REC A;  2PVB A;  2KPH A;  4YI8 A;  2M49 B;  3CZ1 A;  4ZCU A;  2KNE A;  1BT6 A;  2LP3 A;  2RGI A;  1DC1 A;  3Q8I A;  2QEV A;  3VRO A;  1BR4 B;  1C7V A;  1QV0 A;  3R72 A;  3EG5 B;  5JOL A;  2MJW B;  2L0P A;  1A29 A;  4GUK A;  1SCV A;  1C3Z A;  4GPL B;  2LMT A;  3CLN A;  1BLQ A;  2GTE A;  1OZS A;  2KGR A;  1IGV A;  2FCD A;  3I5G C;  1UHI A;  5FI7 A;  3CR5 X;  1K2H A;  1FPW A;  2JT0 A;  3LK1 A;  3V2L A;  1YUU A;  5D69 A;  2O5G A;  1DTL A;  3SJS A;  4F0Z B;  2SCP A;  1J7P A;  1W9Z A;  2JU0 A;  1K9P A;  1OOJ A;  1ZUZ A;  3D0Y B;  4MVF A;  4R1E A;  3RLZ A;  3A4U B;  1G4Y R;  1MHO A;  1XFX O;  4P2Y B;  3OHM B;  4HRG A;  1KSM A;  1F54 A;  2L2E A;  3CDN A;  3GK4 X;  3SS3 A;  1WRL A;  4DUQ A;  2MHH A;  2M7N A;  3EVR A;  3O78 A;  1JF2 A;  3IQO A;  1H8B A;  3BUM B;  4ICB A;  1GGZ A;  2BE6 A;  3BOW B;  2JUL A;  2F8P A;  4INW A;  3JVT C;  3KHE A;  3D77 A;  1MF8 B;  1GGW A;  3DY9 A;  3CAB A;  3OX6 A;  4MN0 A;  1QAS A;  1BF5 A;  3EKH A;  1YR5 A;  2OS8 B;  4DIR A;  1TWO A;  2ZN9 A;  1OE9 B;  2WCL A;  1DJG A;  1QV1 A;  2K60 A;  3FWB A;  1P28 A;  2P70 A;  3BXK A;  4PHN A;  4FQT A;  1QS7 A;  2LAN A;  1HQV A;  3D75 A;  3CYZ A;  1NWD A;  3SS5 A;  2BNX A;  1TOP A;  2LAP A;  1OW4 A;  4I5J A;  1JFK A;  4N1F A;  1TTX A;  3F45 A;  2LHL A;  3R1O A;  1X02 A;  4PE4 A;  4HRH A;  4QJ5 B;  3S0B A;  2LMV A;  1IIO A;  5B8I B;  1N2D A;  1SW8 A;  1QTX A;  1SYM A;  1A4P A;  1AJ4 A;  2BAP A;  2BL0 C;  2CXJ A;  2MLE C;  3BFH A;  3CZ2 A;  2BE4 A;  2LVI A;  3DD4 A;  4MZL A;  3FE9 A;  3GK1 A;  3VGO A;  4ETO A;  1WY9 A;  1NCX A;  1MXE A;  5I2Q A;  1F8H A;  4GNK B;  2QEO A;  1PVA A;  3B6X A;  1S6I A;  2GGZ A;  2JT3 A;  3JTD B;  1CMG A;  1S26 D;  1JC2 A;  1KK7 Z;  2JZI A;  5ER4 X;  4MLW A;  1IWQ A;  1TUJ A;  4XJK A;  1RJV A;  1VRK A;  5KTY A;  4YGD B;  1FF1 A;  4QJ4 B;  1SRA A;  2HQW A;  3CGA A;  1QVI Y;  3EVU A;  3OP0 A;  1R2U A;  2L50 A;  4OR9 B;  5GQQ C;  2BKI B;  2H61 A;  1PSB A;  3DVK A;  4I5N B;  4OCI A;  3I5I C;  5D7F A;  4YGA A;  4DRW A;  5BPJ A;  1OSA A;  4YGC B;  3MSE B;  1BU3 A;  5FYX A;  1F71 A;  2M97 A;  3NSO A;  2K7C A;  3ZWH A;  1CDP A;  1NCZ A;  1W7I B;  2M1U A;  2JNX A;  2PYQ A;  2ZN8 A;  1EG3 A;  1YRU B;  2H2K A;  3EK8 A;  4WQ3 A;  1U5I A;  1AHR A;  2CCM A;  2L4I A;  4MSP A;  1MQ1 A;  3H4S E;  4OVN F;  5AEQ A;  2JTZ A;  2LE9 B;  3SG5 A;  1YX8 A;  1E8A A;  1BG1 A;  1AK8 A;  1EJ3 A;  1OOF A;  4NQG A;  3NSL A;  4I5K A;  2H61 C;  2WCH A;  2ZND A;  4OV2 A;  2EHB A;  2F2O A;  3AKB A;  4AOM A;  4AQJ A;  1SCM B;  3FIA A;  1PK0 D;  2ZNE A;  4PHJ A;  1WLZ A;  3PJI A;  3TS5 C;  2I2R E;  1BMO A;  2K7B A;  3GOF A;  4PE7 A;  2IS9 A;  1LS8 A;  2M29 A;  1YVL A;  1C07 A;  1ZOT B;  2KAX A;  1J7R A;  2WC5 A;  1ALV A;  4ORA B;  3OX5 A;  2KOT A;  1RFJ A;  3DYE A;  1M45 A;  1W7J B;  2WOS A;  2WOR A;  4JQ0 D;  1XFV O;  3PAL A;  2DOQ A;  3DVM A;  1JBA A;  2KSP A;  2L5Y A;  4U8D A;  1QIW A;  1EL4 A;  2LVJ A;  4HSZ A;  2L4H A;  1NP8 A;  1Q80 A;  2LVK A;  4MRY A;  5AXI A;  4BY5 A;  1BJF A;  2OTG C;  1J7Q A;  1WRZ A;  1UHK A;  1IQ3 A;  5CSJ A;  1J1D A;  4UPG A;  1S5G Z;  1Z4H A;  3FE6 A;  3VRP A;  4PHM A;  3PM2 A;  1XFR A;  1K9U A;  2QEH A;  3AKA A;  5HYD A;  3BYA A;  1XA5 A;  2BBN A;  3KO0 A;  3DZT A;  1XFZ O;  1SSE B;  1KWO C;  1TUZ A;  1CFC A;  4XJK B;  1TN4 A;  4OKH A;  3BUN B;  1LA3 A;  1CM4 A;  1OMD A;  3S0F A;  1SMG A;  2K2F A;  1DJX A;  5HKW A;  1DGU A;  1QAT A;  2BCA A;  2HQ8 A;  2KAY A;  1NX2 A;  2EGD A;  1TNW A;  3PN7 C;  1CM1 A;  1PUL A;  1TIZ A;  3DVE A;  1XK4 C;  2WC6 A;  3D76 A;  3I5H C;  2MBX A;  1ZFS A;  2F3Z A;  3CTN A;  2PAS A;  4C0J A;  1B47 A;  1IRJ A;  3CR4 X;  5EL2 A;  4P5O E;  2ERB A;  5I2O A;  2KDH A;  3B7A A;  1YUT A;  3JVT B;  2K0J A;  4JD9 A;  5F6T A;  1G8I A;  1V1F A;  1QLS A;  1IQ5 A;  3BJH A;  4C0K A;  2WCM A;  2COL B;  2O60 A;  1WLM A;  4KYN A;  3S0E A;  1U5I B;  2QAC A;  2ZRT A;  1FI5 A;  1SBJ A;  3BFA A;  2PAL A;  1B9A A;  2P71 A;  3SG6 A;  4A4C A;  1PSR A;  4NDC A;  1EH2 A;  1YUS A;  1NSH A;  1M31 A;  1Y1X A;  1TRF A;  3LL8 B;  3PLF B;  1DEL A;  3L47 A;  1KWO B;  5HKY A;  2ZFD A;  2LUX A;  1Y6W A;  3D10 A;  1A03 A;  2WC8 A;  4YI9 A;  1JFJ A;  2PRU A;  1CDL A;  1UWO A;  1Y1A A;  2L51 A;  4JPZ B;  4MZJ A;  4GBA A;  5ER5 A;  4GGF A;  2BL0 B;  1JF0 A;  4INX A;  1J1E A;  2LLS A;  1QWV A;  3D78 A;  4YRU A;  5AAN A;  3VRR A;  1KQM C;  1CTR A;  3NXA A;  4PE1 A;  3OBV A;  1KK7 Y;  3CR2 A;  2G2B A;  1CDM A;  2PMY A;  2EC6 B;  1DJI A;  1QX5 B;  3M0W A;  1KFU S;  3PAT A;  1LXF C;  2ZRS A;  4IJ7 A;  5FI6 A;  3SIA A;  1NPQ A;  4MZK A;  2BCB A;  3A8R A;  3EKJ A;  4BY4 A;  3RZS A;  1KFX L;  1CLB A;  3S0D A;  5AER A;  2KI4 B;  1K94 A;  2WCJ A;  4XYN A;  1V1G A;  5DKR A;  4JWQ A;  1DJY A;  3SG7 A;  2OPO A;  2PSR A;  1UUR A;  3WNX B;  4JKT A;  3TDU A;  3UNW A;  4A4B A;  4CLN A;  2L98 A;  1F55 A;  3LCP C;  4TNC A;  5KSZ A;  1OOH A;  4QJ3 B;  5HKZ A;  4ORC B;  1M39 A;  3VRN A;  2GGM A;  3KPX A;  5HLV A;  1ZAC A;  1OOI X; 
#chains in the Genus database with same CATH homology
 2LV7 A;  2LVV A;  2A4J A;  3IF7 A;  2AUC A;  2K61 A;  2BEC A;  2JC2 A;  1OMR A;  1SR6 B;  2KI6 D;  3C1V A;  2WCF A;  1B8L A;  5IBW A;  1AP4 A;  1S6C A;  1QXP A;  1KQM B;  1SR6 C;  1F70 A;  1EXR A;  2EC6 C;  3E3R A;  1S5G Y;  1MR8 A;  2JWW A;  3BQ3 A;  1NYA A;  2R2I A;  1S3P A;  1J7O A;  3LLE A;  1FW4 A;  2JT8 A;  5CPV A;  3TZ1 A;  3KEV A;  4DS7 A;  2KI6 C;  2WCB A;  2K7O A;  3OB2 B;  4USL A;  1NIW A;  2Y1M A;  1A75 A;  2KAV A;  1GQM A;  3I5I B;  4FQO A;  1L2O B;  2MRD A;  1YX7 A;  1UHJ A;  1DF0 B;  2WND A;  3EK7 A;  1IJ6 A;  1SL7 A;  4M2P A;  3BUX B;  3O2P A;  4MRX A;  2ISD A;  4AQI A;  4GGN A;  3NSK A;  1CNP A;  1IJ5 A;  2K7D A;  2NXQ A;  1CDN A;  3EVV A;  4GFT A;  2HF5 A;  2KFH A;  1N0Y A;  2M8U A;  1K93 D;  4FTG A;  4PCW A;  4N1G A;  3SIB A;  1F4O A;  3BUW B;  1B8C A;  1L7Z A;  5PAL A;  4Q04 A;  2JOJ A;  1UHN A;  2L5X B;  4L9M A;  1FI6 A;  5K89 A;  3PFV A;  2Q4U A;  5I2L A;  3HX4 A;  2LM5 A;  1QVI Z;  1B8R A;  3O6B A;  2M0R A;  5HLO A;  1XFW O;  3K21 A;  4CPV A;  3AAJ A;  3KF9 A;  2BKH B;  3PN7 B;  5AFP A;  1K9K A;  2F2P A;  2QPT A;  4PDZ A;  4CFR A;  3AAK A;  2Y4Q A;  3PSR A;  1L2O C;  2I7A A;  4M2O A;  1CKK A;  3CZT X;  5G08 A;  3I5F B;  1CFF A;  1LA0 A;  1K95 A;  1C7W A;  1YVH A;  1XFU O;  3TUY B;  3WHU B;  1TNX A;  1B1G A;  1K8U A;  1A2X A;  1TNP A;  2E6W A;  1IG5 A;  2JRF A;  3CWG A;  2D8N A;  1ALW A;  1KQV A;  4C0L A;  2JPT A;  1IH0 A;  1FBV A;  1LIN A;  2BBM A;  1AJ5 A;  2LNK A;  2M1K B;  2OTG B;  1ZMZ A;  1S1E A;  1K90 D;  2LP2 A;  2Y5I A;  1OMV A;  2GV5 A;  1NX0 A;  2HET A;  2F33 A;  5DKN A;  4CFQ A;  2JTT A;  1WDC B;  1SL8 A;  1WRK A;  1AVS A;  5TNC A;  1NUB A;  1RWY A;  4YGB B;  4CID A;  1DJZ A;  3NSI A;  4WQ2 A;  2TN4 A;  1SK6 D;  2KYC A;  1SY9 A;  1UP5 A;  1WDC C;  1QIV A;  3FWC A;  2KQ6 A;  1JWD A;  2B1U A;  2CTN A;  2KFF A;  4PAL A;  1NX3 A;  5J3X A;  2NCO A;  1A75 B;  5I8N A;  2FJU B;  1IKU A;  4GGF C;  1DMO A;  1BR1 B;  2ZKM X;  1PVB A;  1TNQ A;  1DF0 A;  2CBL A;  4WRI A;  1K96 A;  1UUS A;  1QJT A;  2NCP A;  1F4Q A;  1MXL C;  1TCF A;  1GJY A;  2KI4 C;  1DT7 B;  1Y1U A;  2JXC A;  2LMU A;  2KHN A;  2M3W A;  3CS1 A;  4N5X A;  2MA2 A;  2G9B A;  5CSI A;  1DGV A;  1Y0V H;  5DKQ A;  2VRG A;  2AAO A;  1DVI A;  4ORB B;  1SNL A;  4YGE B;  1RRO A;  1PAL A;  1SKT A;  1XK4 A;  2OS8 C;  2KBI A;  4PE0 A;  5JJG A;  1G33 A;  1PRW A;  2KBM A;  1M46 A;  1S6J A;  1KK8 C;  4DCK A;  2FOT A;  2MLF C;  1B7T Y;  3EK4 A;  2NZ0 A;  3RM1 A;  4PHK A;  1QLK A;  1KK8 B;  2M7L A;  1KFU L;  2MAZ A;  2AMI A;  3O4Y A;  1SPY A;  2LHI A;  3VRQ A;  3TDI A;  2Y1N A;  2I94 A;  2LLT A;  2JQ6 A;  1RTP 1;  4NDB A;  1DJW A;  3SG2 A;  1XYD A;  2LUC A;  3WHT B;  3WXA A;  3LK0 A;  2WCE A;  3JTD C;  2HPS A;  2LCP A;  1SCM C;  4ZCV A;  2Q91 A;  3D0Y A;  5CSN A;  3ZNI A;  3GK2 A;  4MBE A;  1JUO A;  2CNP A;  3SG4 A;  3FS7 A;  3SG3 A;  1ODB A;  1BOD A;  3PM8 A;  1NCY A;  1LVC D;  1M63 B;  1CFD A;  1CFP A;  2SAS A;  4I5L B;  2V53 A;  1CMF A;  3ICB A;  1HT9 A;  1CB1 A;  3QRX A;  1B7T Z;  1QX2 A;  1TCO B;  3BOW A;  1YRT B;  4HRE E;  1EG4 A;  1OZO A;  1CLM A;  1D1O A;  2KQY A;  2KYF A;  1R6P A;  2I18 A;  5KU1 A;  1SL9 A;  1XVJ A;  2E30 A;  3DF0 B;  2LC5 A;  4YBH B;  1DJH A;  1KSO A;  2KFG A;  4GAO A;  2K8M B;  2K2A A;  4D1E A;  3TDZ A;  1YTZ C;  3IQQ A;  2BCX A;  2P6B B;  1JSA A;  1UHH A;  5CSF A;  3DF0 A;  1LKJ A;  1J55 A;  1B4C A;  1N65 A;  1NX1 A;  1QX7 A;  3I5G B;  2FCE A;  4NDD A;  1KFX S;  1H4B A;  1CLL A;  3BUO B;  2CT9 A;  3HCM A;  1RK9 A;  2F3Y A;  1YUR A;  2LLU A;  1MUX A;  1S36 A;  3DVJ A;  4MEW A;  2KGB C;  4E68 A;  1BOC A;  3I5F C;  1KCY A;  2JNF A;  3OB1 B;  4IL1 A;  1MWN A;  3I5H B;  2M9G A;  3TUY C;  2JXL A;  1OQP A;  1XFY O;  2NLN A;  4M2Q A;  1XO5 A;  1AUI B;  3TS5 B;  1REC A;  2PVB A;  4YI8 A;  2M49 B;  4ZCU A;  2KNE A;  1BT6 A;  2LP3 A;  2RGI A;  3VRO A;  1BR4 B;  1C7V A;  1QV0 A;  5JOL A;  2MJW B;  2L0P A;  1A29 A;  4GUK A;  1SCV A;  4GPL B;  2LMT A;  3CLN A;  1BLQ A;  1OZS A;  2KGR A;  1IGV A;  2FCD A;  3I5G C;  1UHI A;  3CR5 X;  1K2H A;  2JT0 A;  3LK1 A;  1YUU A;  5D69 A;  2O5G A;  1DTL A;  3SJS A;  4F0Z B;  2SCP A;  1J7P A;  2JU0 A;  1K9P A;  1OOJ A;  1ZUZ A;  3D0Y B;  4MVF A;  4R1E A;  3RLZ A;  3A4U B;  1G4Y R;  1MHO A;  1XFX O;  4P2Y B;  3OHM B;  4HRG A;  1KSM A;  1F54 A;  2L2E A;  3GK4 X;  1WRL A;  4DUQ A;  2MHH A;  2M7N A;  3EVR A;  3O78 A;  1JF2 A;  3IQO A;  1H8B A;  3BUM B;  4ICB A;  1GGZ A;  2BE6 A;  3BOW B;  2JUL A;  2F8P A;  3JVT C;  3KHE A;  1MF8 B;  1GGW A;  3OX6 A;  4MN0 A;  1QAS A;  1BF5 A;  3EKH A;  1YR5 A;  2OS8 B;  4DIR A;  2ZN9 A;  1OE9 B;  1DJG A;  1QV1 A;  3FWB A;  3BXK A;  4PHN A;  1QS7 A;  2LAN A;  1HQV A;  1NWD A;  1TOP A;  2LAP A;  4N1F A;  4I5J A;  1JFK A;  1TTX A;  3F45 A;  2LHL A;  1X02 A;  4PE4 A;  4HRH A;  4QJ5 B;  2LMV A;  5B8I B;  1N2D A;  1SW8 A;  1QTX A;  1SYM A;  1A4P A;  1AJ4 A;  2BL0 C;  2CXJ A;  2MLE C;  4MZL A;  5I2Q A;  2BE4 A;  2LVI A;  3DD4 A;  3GK1 A;  3VGO A;  4ETO A;  1WY9 A;  1NCX A;  1MXE A;  1F8H A;  4GNK B;  1PVA A;  1S6I A;  2GGZ A;  2JT3 A;  3JTD B;  1CMG A;  1S26 D;  1JC2 A;  1KK7 Z;  2JZI A;  5ER4 X;  4MLW A;  1IWQ A;  4XJK A;  1RJV A;  1VRK A;  5KTY A;  4YGD B;  1FF1 A;  4QJ4 B;  1SRA A;  2HQW A;  3CGA A;  1QVI Y;  3EVU A;  3OP0 A;  1R2U A;  2L50 A;  4OR9 B;  5GQQ C;  2BKI B;  2H61 A;  1PSB A;  3DVK A;  4I5N B;  4OCI A;  3I5I C;  5D7F A;  4YGA A;  4DRW A;  5BPJ A;  1OSA A;  4YGC B;  3MSE B;  1BU3 A;  5FYX A;  1F71 A;  2M97 A;  3NSO A;  2K7C A;  3ZWH A;  1CDP A;  1NCZ A;  1W7I B;  2M1U A;  2JNX A;  2ZN8 A;  1EG3 A;  1YRU B;  2H2K A;  3EK8 A;  4WQ3 A;  1U5I A;  1AHR A;  2CCM A;  2L4I A;  4MSP A;  1MQ1 A;  3H4S E;  4OVN F;  5AEQ A;  2JTZ A;  2LE9 B;  3SG5 A;  1YX8 A;  1E8A A;  1BG1 A;  1AK8 A;  1EJ3 A;  4NQG A;  3NSL A;  4I5K A;  2H61 C;  2ZND A;  4OV2 A;  2EHB A;  2F2O A;  3AKB A;  4AOM A;  4AQJ A;  1SCM B;  3FIA A;  1PK0 D;  2ZNE A;  4PHJ A;  1WLZ A;  3TS5 C;  2I2R E;  1BMO A;  2K7B A;  3GOF A;  4PE7 A;  2IS9 A;  2M29 A;  1YVL A;  1C07 A;  1ZOT B;  2KAX A;  1J7R A;  1ALV A;  4ORA B;  3OX5 A;  2KOT A;  1RFJ A;  1M45 A;  1W7J B;  2WOS A;  2WOR A;  4JQ0 D;  1XFV O;  3PAL A;  2DOQ A;  3DVM A;  1JBA A;  2KSP A;  4U8D A;  1QIW A;  1EL4 A;  2LVJ A;  4HSZ A;  2L4H A;  1NP8 A;  1Q80 A;  2LVK A;  4MRY A;  5AXI A;  4BY5 A;  1BJF A;  2OTG C;  1J7Q A;  1WRZ A;  1UHK A;  1IQ3 A;  5CSJ A;  1J1D A;  4UPG A;  1S5G Z;  3VRP A;  4PHM A;  5HYD A;  1K9U A;  3AKA A;  3BYA A;  1XA5 A;  2BBN A;  3KO0 A;  1XFZ O;  1KWO C;  1CFC A;  4XJK B;  1TN4 A;  4OKH A;  3BUN B;  1LA3 A;  1CM4 A;  1OMD A;  1FPW A;  1SMG A;  2K2F A;  1DJX A;  5HKW A;  1DGU A;  1QAT A;  2BCA A;  2HQ8 A;  2KAY A;  1NX2 A;  2EGD A;  1TNW A;  3PN7 C;  1CM1 A;  1PUL A;  1TIZ A;  3DVE A;  1XK4 C;  3I5H C;  2MBX A;  1ZFS A;  2F3Z A;  3CTN A;  2PAS A;  4C0J A;  1B47 A;  1IRJ A;  3CR4 X;  4P5O E;  5I2O A;  2KDH A;  3JVT B;  1YUT A;  5F6T A;  2K0J A;  1G8I A;  1V1F A;  1QLS A;  1IQ5 A;  4C0K A;  2COL B;  2O60 A;  1WLM A;  1FI5 A;  1U5I B;  2QAC A;  2ZRT A;  1SBJ A;  2PAL A;  1B9A A;  3SG6 A;  4A4C A;  1PSR A;  4NDC A;  1EH2 A;  1YUS A;  1NSH A;  1M31 A;  1Y1X A;  1TRF A;  3LL8 B;  3PLF B;  1KWO B;  5HKY A;  2ZFD A;  2LUX A;  1Y6W A;  3D10 A;  1A03 A;  2WC8 A;  4YI9 A;  1JFJ A;  2PRU A;  1CDL A;  1UWO A;  1Y1A A;  2L51 A;  4JPZ B;  4MZJ A;  4GBA A;  5ER5 A;  4GGF A;  2BL0 B;  1JF0 A;  1J1E A;  2LLS A;  4YRU A;  5AAN A;  3VRR A;  1KQM C;  1CTR A;  3NXA A;  4PE1 A;  1KK7 Y;  3CR2 A;  2G2B A;  1CDM A;  2PMY A;  1DJI A;  1QX5 B;  2EC6 B;  3M0W A;  1KFU S;  3PAT A;  1LXF C;  2ZRS A;  3SIA A;  1NPQ A;  4MZK A;  2BCB A;  3A8R A;  3EKJ A;  4BY4 A;  1CLB A;  1KFX L;  5AER A;  2KI4 B;  1K94 A;  4XYN A;  1V1G A;  5DKR A;  4JWQ A;  1DJY A;  3SG7 A;  2OPO A;  2PSR A;  1UUR A;  3WNX B;  3TDU A;  4A4B A;  4CLN A;  2L98 A;  1F55 A;  3LCP C;  4TNC A;  5KSZ A;  4QJ3 B;  5HKZ A;  4ORC B;  1M39 A;  3VRN A;  2GGM A;  3KPX A;  5HLV A;  1ZAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...