1QS7A

The 1.8 angstrom structure of calmodulin rs20 peptide complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
145
structure length
145
Chain Sequence
LTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/peptide
molecule keywords CALMODULIN
publication title High Resolution Structure of a Calmodulin Rs20 Peptide Complex
rcsb
source organism Escherichia coli
total genus 57
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qs7A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qs7A02
4CFQA 2M7LA 1TNQA 3JVTC 2JT3A 1QX5B 2COLB 2OTGC 3BOWA 3KO0A 3SG4A 3CGAA 1K9UA 1Y0VH 1WLZA 1N2DA 1EG3A 2KFGA 4XYNA 2K8MB 4YGCB 2GGMA 2TN4A 3TS5B 2BECA 4YI9A 1DVIA 2V53A 3BUXB 3OX5A 1BMOA 1MXEA 3I5FB 2KGRA 1IH0A 2LV7A 3CR5X 4GGFC 4PE4A 3EK4A 4XJKB 1WDCC 5K89A 3EVRA 3NSLA 1SRAA 5D7FA 1NX1A 4E68A 3TUYC 3I5GC 5CSIA 3SG3A 1UHHA 3ZWHA 2BCBA 2M9GA 4I5LB 4IL1A 1ALVA 1LXFC 3O2PA 1DJXA 1SR6B 4PHKA 1MHOA 2ISDA 2FCDA 1YR5A 3OB1B 1N65A 2LP2A 1MWNA 1LINA 1L2OC 1S6JA 1DT7B 4OKHA 1DGVA 1JF0A 1DJHA 2JOJA 4DRWA 1A75B 1OMRA 2SASA 2ZRTA 1JUOA 2BKHB 2ZRSA 1KFXS 2HETA 4YGDB 1BR1B 3WXAA 1IJ6A 2LHIA 4PE7A 3PLFB 3EVUA 1B8CA 1PSBA 2DOQA 1HQVA 1IWQA 3PN7B 1UWOA 4L9MA 3O6BA 1PSRA 3PALA 2JQ6A 1AJ5A 1CLBA 2NLNA 3RLZA 4P5OE 4I5JA 4C0LA 2KI6D 4I5KA 1NX2A 3NSIA 3K21A 3WNXB 2JTZA 1YUTA 1ZACA 1QS7A 4ORAB 1KWOC 1NCYA 2ZN8A 4MRXA 3LK1A 2OPOA 4M2QA 1CLMA 1YX7A 1A4PA 1SL7A 4JPZB 3KF9A 5I2QA 2K2FA 4YBHB 2LM5A 2I7AA 4CLNA 1QTXA 3JVTB 4GGNA 3VRPA 5AEQA 1S5GY 2LVVA 5HKWA 2PRUA 1SK6D 1CTRA 1K93D 4GFTA 2K0JA 3FIAA 3TDIA 1F71A 2MA2A 1KK8C 2KAXA 2O5GA 4GBAA 3EK8A 2KYFA 1QV0A 4DCKA 2RGIA 5F6TA 1J7QA 1XFXO 1K9KA 4MVFA 1JF2A 1F4OA 1PK0D 2KQ6A 2M1KB 2Y4QA 5DKQA 2KGBC 1B47A 1MXLC 2Y1MA 1FI5A 2HF5A 1CFCA 4NQGA 4JWQA 5CSNA 4ORBB 1RECA 4PHMA 1IGVA 1AUIB 4ORCB 3CS1A 2ZKMX 1G8IA 5KTYA 1QJTA 5HKZA 4QJ3B 3I5GB 1IQ3A 1BLQA 4XJKA 1YRUB 2FJUB 3ZNIA 5IBWA 1VRKA 1JC2A 1SKTA 1ZUZA 1TCFA 2JWWA 4N1FA 4M2PA 1F8HA 1K8UA 2CCMA 2G9BA 3BUMB 1XFZO 1L2OB 2L51A 3KEVA 1DGUA 2FOTA 1SYMA 2JT0A 3O78A 1ZFSA 1BG1A 1OE9B 2M8UA 4BY4A 2L4IA 1WY9A 4CPVA 1E8AA 1PVAA 1A75A 2KI4B 1PULA 2LHLA 4UPGA 3D0YB 1GGZA 5I2OA 2L50A 2WORA 1DJWA 1R6PA 1WRLA 1C7WA 4PE0A 4AQIA 1KQMC 1QX7A 3NXAA 5J3XA 4C0JA 2KFFA 2H61A 4FTGA 3VRRA 1ALWA 4Q04A 2Y1NA 1RK9A 2WCFA 1KFUL 3CTNA 1J7RA 1B8LA 3IQOA 4ICBA 4YGAA 1F54A 1PVBA 1Q80A 1SPYA 1TIZA 5CSJA 1EXRA 1XYDA 2BCXA 3I5IC 1SL8A 2QPTA 4MSPA 3LCPC 4PDZA 3AKAA 1J1DA 1M39A 1B8RA 3F45A 1KWOB 1GJYA 2MJWB 3C1VA 2JNFA 4ZCUA 4N5XA 2PVBA 3GK2A 2LC5A 1QIVA 3JTDB 1NSHA 4FQOA 2AAOA 1RJVA 1K9PA 1IRJA 3ICBA 2KHNA 2EHBA 4CIDA 4GAOA 2GV5A 5AFPA 5B8IB 1QV1A 5FYXA 5HLVA 2WCBA 2BKIB 1MF8B 2NCPA 1Y1AA 3TDZA 1BF5A 1U5IB 4NDCA 4CFRA 3D10A 3H4SE 2LAPA 3FWBA 1EH2A 5KSZA 1DJZA 1DTLA 2IS9A 3SG5A 5I2LA 1EJ3A 2AMIA 2LP3A 3EK7A 3OB2B 4N1GA 1M46A 1QATA 5JJGA 1YRTB 1CDPA 1CFDA 1NCXA 2PALA 3I5HC 1JSAA 1S6IA 1XK4A 1ZMZA 1XO5A 2EC6B 2LLTA 1F4QA 4GGFA 3BUOB 4MLWA 2I94A 1LA0A 2JTTA 1GQMA 3BUNB 1HT9A 4PCWA 1NP8A 1NX0A 1PRWA 1CDLA 1UUSA 2BBMA 2KNEA 3KPXA 5CPVA 1JFJA 2F3YA 1CKKA 1RWYA 2MLFC 2OS8C 1OSAA 1M45A 2KBMA 1S36A 1SW8A 1OMVA 1K95A 1CDMA 2BL0B 2KAVA 4MEWA 4PALA 3TDUA 1K2HA 1UHJA 1AJ4A 3DVKA 1LKJA 2MBXA 1KQMB 2L0PA 2OTGB 3IQQA 4DIRA 3D0YA 2GGZA 1UHNA 1NIWA 1LVCD 2F8PA 3TS5C 4OR9B 1AHRA 1UURA 4PHNA 4D1EA 3SIAA 1XA5A 2Q91A 2LMVA 1V1FA 3OP0A 1NYAA 5DKNA 3DD4A 3I5FC 2JC2A 1B1GA 1IJ5A 2LMTA 4WQ3A 1TOPA 1YUSA 2MHHA 1OZSA 2M0RA 2LANA 1XFWO 1SY9A 2L4HA 4MRYA 1J7PA 1WDCB 2LUCA 2CT9A 2HPSA 3VRNA 3MSEB 2KSPA 3AAJA 4WQ2A 1R2UA 3TUYB 4MN0A 2KI6C 2I2RE 4HRGA 1BJFA 1NX3A 1ODBA 1TNWA 1SNLA 1K96A 1J55A 1CB1A 1A2XA 5PALA 1K94A 4ETOA 3EKHA 1GGWA 3FWCA 4A4CA 2NZ0A 2E6WA 2KQYA 1WRZA 4F0ZB 3PSRA 5TNCA 1LA3A 1U5IA 3M0WA 3CR4X 1QVIZ 1TTXA 3BYAA 5HKYA 2M29A 5KU1A 5AANA 3VRQA 1Y1XA 2ZNEA 1NUBA 3I5HB 4A4BA 3NSOA 3WHUB 2JU0A 1RTP1 1CLLA 1OOJA 1ZOTB 2MLEC 3SG7A 2ZN9A 1V1GA 3DVMA 3PN7C 2M1UA 1XFUO 1IG5A 1H4BA 2WOSA 1UP5A 2AUCA 2PSRA 4R1EA 3LL8B 3PM8A 1N0YA 3PATA 2LLUA 1DJIA 1WRKA 2LE9B 1SL9A 1UHIA 1M31A 2K7OA 1TNXA 4U8DA 4PE1A 3SJSA 1CFFA 2M49B 2K7DA 2NXQA 4NDDA 2Y5IA 2F33A 2LNKA 1W7JB 1XVJA 2F3ZA 3DVEA 4HSZA 4HREE 3A8RA 1OZOA 2NCOA 1KFUS 3SG6A 1D1OA 2HQWA 1KSOA 1WLMA 1SCMC 2JXLA 2I18A 2CXJA 1UHKA 2ZFDA 4MZJA 1W7IB 1QASA 4PHJA 5GQQC 4C0KA 2JT8A 3LLEA 1CMGA 2MAZA 2K2AA 1KK8B 3GK1A 4MZLA 3DVJA 3TZ1A 4AOMA 1B7TY 1S1EA 3DF0A 1MQ1A 2K7BA 3OX6A 2L2EA 3LK0A 1XK4C 1OQPA 1TNPA 1A03A 2KYCA 1B9AA 1BR4B 2F2PA 1CFPA 2M3WA 2F2OA 1JFKA 4ZCVA 1YVLA 1SBJA 1QLKA 2M7NA 1DF0B 2KDHA 4GPLB 3VGOA 3VROA 1CDNA 1KFXL 5AERA 2D8NA 1J7OA 1J1EA 2L98A 2R2IA 2A4JA 1YUUA 5I8NA 1S26D 1FW4A 5HLOA 1AK8A 1XFYO 1QIWA 1KK7Z 2WC8A 2KBIA 1AP4A 1EG4A 4M2OA 1IKUA 2CBLA 3CZTX 2SCPA 2BE6A 3CLNA 1NWDA 1QXPA 2PMYA 3BOWB 2KAYA 2JPTA 2KI4C 4MZKA 4DUQA 1SCVA 4YGEB 1S3PA 1Y6WA 2HQ8A 3HX4A 1QVIY 3EKJA 1MUXA 2PASA 4OVNF 1B7TZ 4HRHA 1L7ZA 4GUKA 4USLA 2EGDA 2G2BA 1CM1A 1DJGA 1PALA 2LMUA 1X02A 4YI8A 5ER4X 3DF0B 1B4CA 3I5IB 1YURA 3BUWB 5HYDA 2KFHA 5JOLA 1C07A 2M97A 4JQ0D 1F70A 1JWDA 3CR2A 1FBVA 1FPWA 3KHEA 2LCPA 1KCYA 2LLSA 2Q4UA 3SG2A 1QX2A 5ER5A 3HCMA 2LVKA 3JTDC 4DS7A 2WNDA 2QACA 2ZNDA 3OHMB 4OCIA 1K90D 1AVSA 2BCAA 1CMFA 4QJ4B 4NDBA 4P2YB 1YTZC 2P6BB 5DKRA 1FI6A 2LVJA 1H8BA 3A4UB 1YVHA 2FCEA 4TNCA 1DMOA 1BODA 1FF1A 2CNPA 1SCMB 3GOFA 2BBNA 1IQ5A 2E30A 2VRGA 3GK4X 1SR6C 3WHTB 1C7VA 3AKBA 3SIBA 4BY5A 1YX8A 1BT6A 1RFJA 2K61A 4I5NB 4YRUA 1CNPA 1JBAA 2CTNA 3AAKA 3QRXA 2LVIA 1BU3A 1DJYA 5BPJA 4AQJA 1TCOB 1A29A 1MR8A 1NPQA 1RROA 1SMGA 2B1UA 1KQVA 2O60A 1F55A 1CM4A 2K7CA 3NSKA 2WCEA 1S6CA 1NCZA 2H61C 2EC6C 5G08A 3BXKA 4OV2A 1KSMA 1TN4A 2BE4A 3FS7A 1DF0A 2JNXA 1G4YR 1BOCA 1TRFA 1OMDA 4YGBB 1EL4A 1Y1UA 3BQ3A 1QLSA 4MBEA 2KOTA 2JRFA 2JULA 2JXCA 3E3RA 2LUXA 3CWGA 3O4YA 2L5XB 2JZIA 1G33A 1S5GZ 2OS8B 4GNKB 4QJ5B 5AXIA 2BL0C 5CSFA 5D69A 3IF7A 3RM1A 1KK7Y 1XFVO 2MRDA 3PFVA 1M63B 4WRIA 3EVVA 2H2KA
chains in the Genus database with same CATH superfamily
4CFQA 2M7LA 1TNQA 3JVTC 2JT3A 1QX5B 2COLB 2OTGC 3BOWA 3KO0A 3SG4A 1TUZA 3CGAA 1K9UA 1Y0VH 1WLZA 5EL2A 1N2DA 1EG3A 2KFGA 3CABA 2K8MB 4XYNA 4YGCB 2GGMA 2TN4A 3TS5B 2BECA 3VB1A 4YI9A 1DVIA 2V53A 3BUXB 3DXLA 3OX5A 1BMOA 1MXEA 3I5FB 2KGRA 1IH0A 2LV7A 3CR5X 4GGFC 4PE4A 3EK4A 4XJKB 1WDCC 5K89A 3EVRA 3NSLA 1SRAA 5D7FA 1NX1A 4E68A 3TUYC 3I5GC 5CSIA 3SG3A 1UHHA 3ZWHA 2BCBA 2M9GA 4I5LB 4IL1A 2QEBA 1ALVA 1LXFC 3O2PA 1DJXA 1SR6B 4PHKA 1MHOA 2ISDA 3DY9A 2FCDA 1YR5A 3OB1B 1N65A 2LP2A 1MWNA 1LINA 1QWVA 1L2OC 1S6JA 1DT7B 4OKHA 1DGVA 2P70A 1JF0A 1DJHA 2JOJA 4DRWA 1A75B 1OMRA 3DZTA 2SASA 2ZRTA 1C3YA 1JUOA 2BKHB 2ZRSA 1KFXS 3O4XA 2HETA 4YGDB 1BR1B 1C3ZA 3WXAA 1IJ6A 2LHIA 2QDIA 4PE7A 3PLFB 3EVUA 1B8CA 1PSBA 2KLEA 2DOQA 1HQVA 1IWQA 3PN7B 1UWOA 4L9MA 3O6BA 1PSRA 3PALA 2JQ6A 1AJ5A 1CLBA 2NLNA 3RLZA 4P5OE 4I5JA 4C0LA 2KI6D 4I5KA 1NX2A 3NSIA 3CDNA 2WCMA 3K21A 3WNXB 2JTZA 1YUTA 1ZACA 1QS7A 1Z4HA 1ORGA 4ORAB 1KWOC 1NCYA 2ZN8A 4MRXA 3LK1A 5HL1A 2OPOA 4M2QA 1CLMA 1YX7A 1A4PA 1SL7A 4JPZB 3KF9A 3B6XA 2K2FA 4YBHB 5I2QA 2LM5A 2I7AA 4CLNA 1QTXA 3JVTB 4GGNA 3VRPA 5AEQA 1S5GY 2LVVA 5HKWA 2PRUA 2BAPA 3IVTA 3QMEA 1SK6D 1CTRA 1K93D 4GFTA 2K0JA 3FIAA 3TDIA 1F71A 2MA2A 3NHTA 1KK8C 2KAXA 2O5GA 4GBAA 3EK8A 2KYFA 1QV0A 4DCKA 2RGIA 5F6TA 1J7QA 1XFXO 1K9KA 4MVFA 1JF2A 1F4OA 1PK0D 2KQ6A 2M1KB 2Y4QA 5DKQA 2KGBC 1B47A 1MXLC 1OOGA 2Y1MA 1FI5A 2HF5A 1CFCA 4NQGA 1OOHA 4JWQA 5CSNA 4ORBB 1RECA 4PHMA 3N7HA 1IGVA 3S0GA 1AUIB 4ORCB 3CS1A 2QEVA 1G8IA 2ZKMX 5KTYA 1QJTA 5HKZA 3L47A 4QJ3B 3I5GB 1IQ3A 1BLQA 4XJKA 1YRUB 2FJUB 3ZNIA 5IBWA 1VRKA 1JC2A 1SKTA 1ZUZA 1TCFA 2JWWA 4N1FA 3BFHA 4M2PA 2PQLA 1F8HA 1K8UA 2CCMA 2G9BA 3BUMB 1XFZO 1L2OB 2L51A 3KEVA 1DGUA 2FOTA 1SYMA 2JT0A 3O78A 3R1OA 1ZFSA 1BG1A 1OE9B 2M8UA 4BY4A 1SSEB 2L4IA 1WY9A 4CPVA 2P71A 1E8AA 1PVAA 1A75A 2KI4B 1PULA 2LHLA 4UPGA 3D0YB 1GGZA 5I2OA 2L50A 2FJYA 1DJWA 1R6PA 1WRLA 1C7WA 2WORA 4PE0A 4AQIA 1KQMC 1QX7A 3NXAA 5J3XA 4C0JA 2KFFA 5D3OA 2H61A 4FTGA 3NHIA 3VRRA 1ALWA 4Q04A 2Y1NA 1RK9A 2WCFA 1KFUL 3CTNA 1J7RA 1B8LA 3IQOA 4ICBA 4YGAA 1F54A 1PVBA 1Q80A 1SPYA 1TIZA 5CSJA 1EXRA 1XYDA 2BCXA 3I5IC 1SL8A 2QPTA 4KYNA 3LCPC 4MSPA 3D75A 4PDZA 3AKAA 1J1DA 1M39A 1B8RA 2WC6A 1KWOB 3CZ1A 3F45A 1GJYA 2MJWB 3C1VA 2JNFA 4ZCUA 3NGVA 4N5XA 2PVBA 3GK2A 1LS8A 2LC5A 3S0EA 1QIVA 3CYZA 3JTDB 1NSHA 4FQOA 2AAOA 1RJVA 1TUJA 1K9PA 1IRJA 2WCLA 3ICBA 2KHNA 2EHBA 3BFBA 4CIDA 4GAOA 2GV5A 5AFPA 5B8IB 1QV1A 5FYXA 5HLVA 2WCBA 2BKIB 1MF8B 2NCPA 1Y1AA 3TDZA 1BF5A 1U5IB 4NDCA 4CFRA 3D10A 3OGNA 3CZ2A 3H4SE 2LAPA 3FWBA 3Q8IA 1EH2A 5KSZA 1DJZA 1DTLA 2IS9A 3SG5A 5I2LA 1EJ3A 2AMIA 2LP3A 3EK7A 3OB2B 4N1GA 1M46A 1QATA 5JJGA 1YRTB 1CDPA 1CFDA 1NCXA 2PALA 3I5HC 1JSAA 1S6IA 2WCHA 1XFRA 1IIOA 1XK4A 1ZMZA 3K1EA 1XO5A 2EC6B 2LLTA 3PJIA 1F4QA 4GGFA 3BUOB 4MLWA 1T14A 2I94A 1LA0A 2JTTA 5DICA 1GQMA 3BUNB 1HT9A 3L4AA 2H8VA 4PCWA 2PYQA 1NP8A 1NX0A 1PRWA 1CDLA 5I94A 1UUSA 2BBMA 2KNEA 3KPXA 5CPVA 1JFJA 2F3YA 1CKKA 1RWYA 2MLFC 2OS8C 1OSAA 1M45A 2KBMA 1S36A 1SW8A 1OMVA 1K95A 1CDMA 2BL0B 2KAVA 4MEWA 4PALA 3TDUA 1K2HA 1UHJA 1AJ4A 3DVKA 1LKJA 2MBXA 1KQMB 2L0PA 2OTGB 3IQQA 1DQEA 4DIRA 3D0YA 2GGZA 1UHNA 1NIWA 2KLDA 3R1VA 1LVCD 4F7FA 2F8PA 3TS5C 2WCKA 4OR9B 1AHRA 1UURA 3B88A 3D73A 4PHNA 4D1EA 3SIAA 1XA5A 2Q91A 2LMVA 1V1FA 3OP0A 1NYAA 5DKNA 3DD4A 3I5FC 2JC2A 1B1GA 1IJ5A 1OOIX 2LMTA 4WQ3A 1TOPA 1YUSA 2MHHA 3L4LA 1OZSA 2M0RA 2LANA 1XFWO 2WC5A 1SY9A 2L4HA 4MRYA 1J7PA 1WDCB 2LUCA 2CT9A 2HPSA 3VRNA 3MSEB 2KSPA 3AAJA 4WQ2A 1R2UA 2GTEA 3TUYB 4MN0A 2KI6C 2I2RE 4HRGA 1BJFA 1NX3A 1ODBA 1TNWA 1SNLA 1K96A 1J55A 3PM2A 1A2XA 4INWA 1CB1A 5PALA 1K94A 1DELA 4ETOA 3EKHA 1GGWA 3FWCA 4A4CA 2NZ0A 2E6WA 2KQYA 1WRZA 4F0ZB 3PSRA 5TNCA 1LA3A 1U5IA 3M0WA 3CR4X 1QVIZ 4JD9A 1TTXA 3BYAA 5HKYA 2BNXA 2M29A 5KU1A 5AANA 3VRQA 1Y1XA 3B7AA 2ZNEA 1NUBA 3I5HB 4A4BA 3NSOA 3WHUB 2JU0A 1RTP1 1CLLA 1OOJA 1ZOTB 2MLEC 3SG7A 2ZN9A 1V1GA 3DVMA 3PN7C 2M1UA 1XFUO 1IG5A 1H4BA 2WOSA 3D74A 1UP5A 2AUCA 2ERBA 2KPHA 2PSRA 4R1EA 3LL8B 3PM8A 1N0YA 3SS3A 3PATA 2LLUA 3BFAA 1DJIA 1WRKA 4FQTA 2LE9B 1SL9A 1UHIA 1M31A 2K7OA 1TNXA 4U8DA 2YGUA 4PE1A 3SJSA 1P28A 3OBVA 2M49B 1CFFA 2K7DA 2NXQA 4NDDA 2Y5IA 2F33A 2LNKA 1W7JB 1XVJA 2F3ZA 3DVEA 4HSZA 4HREE 3A8RA 1OZOA 2NCOA 1KFUS 2WCJA 3SG6A 3D77A 1D1OA 3UNWA 2HQWA 3B86A 1KSOA 1WLMA 3V2LA 1SCMC 2JXLA 2I18A 2CXJA 1UHKA 2ZFDA 3BJHA 4MZJA 1W7IB 2JPOA 1QASA 4PHJA 5GQQC 4C0KA 3RZSA 2JT8A 3LLEA 1CMGA 2MAZA 2K2AA 1KK8B 3S0BA 3GK1A 4MZLA 3DVJA 3TZ1A 4AOMA 1B7TY 1S1EA 3DF0A 1MQ1A 2K7BA 3OX6A 2L2EA 3LK0A 1XK4C 1TNPA 1OQPA 1A03A 2KYCA 1B9AA 1BR4B 2F2PA 1CFPA 2M3WA 2F2OA 1JFKA 4ZCVA 1YVLA 1SBJA 1QLKA 2M7NA 1DF0B 2KDHA 4GPLB 1TWOA 3VGOA 1GM0A 1OW4A 3VROA 1KFXL 1CDNA 5AERA 2D8NA 1J7OA 1J1EA 2L98A 2R2IA 2A4JA 1YUUA 5I8NA 2QEHA 1S26D 1FW4A 5HLOA 1AK8A 1XFYO 1QIWA 3FE9A 1DC1A 1KK7Z 2WC8A 2QEOA 2KBIA 1AP4A 1EG4A 4M2OA 1IKUA 2CBLA 3CZTX 3FE6A 2SCPA 2BE6A 3CLNA 3EG5B 1NWDA 1QXPA 2PMYA 3BOWB 2KAYA 3SS5A 2JPTA 2KI4C 4MZKA 4DUQA 1SCVA 4YGEB 1S3PA 4IJ7A 1Y6WA 2HQ8A 5FI2A 3HX4A 1OOFA 1QVIY 3EKJA 1MUXA 2PASA 3SS4A 4OVNF 3B87A 1B7TZ 4HRHA 1L7ZA 4GUKA 4USLA 2EGDA 2G2BA 1CM1A 1DJGA 1PALA 2LMUA 1X02A 4YI8A 5ER4X 3DF0B 1B4CA 3I5IB 1YURA 3BUWB 5HYDA 2KFHA 5FI6A 2L5YA 5JOLA 1C07A 2M97A 4JQ0D 1F70A 1Z2CB 1JWDA 3CR2A 1FBVA 1FPWA 3KHEA 2LCPA 3S0DA 2LLSA 2Q4UA 1KCYA 3SG2A 1QX2A 5ER5A 3HCMA 4OZDA 2LVKA 3JTDC 4DS7A 2WNDA 2QACA 2ZNDA 3OHMB 4OCIA 1K90D 1AVSA 2BCAA 1CMFA 4QJ4B 4NDBA 4JKTA 1YTZC 2P6BB 4P2YB 5DKRA 2LVJA 1FI6A 3D78A 1H8BA 3A4UB 1YVHA 2FCEA 3FE8A 4TNCA 1DMOA 1BODA 1FF1A 2CNPA 1SCMB 3GOFA 2BBNA 1IQ5A 2E30A 2VRGA 3GK4X 1SR6C 3WHTB 1C7VA 1DEKA 3AKBA 3SIBA 4BY5A 3S0AA 1YX8A 5FI7A 1BT6A 1RFJA 2K61A 4I5NB 3UO9A 4YRUA 1CNPA 1JBAA 2CTNA 3AAKA 3QRXA 2LVIA 1BU3A 1DJYA 5BPJA 4INXA 4AQJA 1TCOB 1A29A 1MR8A 1NPQA 3DYEA 1RROA 1SMGA 2B1UA 1KQVA 2O60A 1F55A 1CM4A 2K7CA 3NSKA 2WCEA 1S6CA 3R1PA 1NCZA 2H61C 4PT1A 2EC6C 5G08A 3BXKA 4OV2A 1KSMA 1TN4A 2BE4A 3FS7A 1DF0A 2JNXA 1W9ZA 3S0FA 1G4YR 1BOCA 3R72A 1TRFA 1OMDA 4YGBB 1EL4A 1Y1UA 3BQ3A 2L2CA 1QLSA 2K60A 4MBEA 2KOTA 2JRFA 2JULA 2JXCA 3E3RA 2LUXA 3CWGA 3O4YA 2L5XB 2JZIA 1G33A 1S5GZ 2OS8B 3D76A 4GNKB 4QJ5B 5AXIA 2BL0C 3CZ0A 5CSFA 5D69A 3IF7A 3RM1A 1KK7Y 1XFVO 2MRDA 3PFVA 1M63B 4WRIA 3EVVA 2H2KA
chains in the Genus database with same CATH topology
4CFQA 2M7LA 1TNQA 3JVTC 2JT3A 1QX5B 2COLB 2OTGC 3BOWA 3KO0A 3SG4A 3CGAA 1K9UA 1Y0VH 1WLZA 1N2DA 1EG3A 2KFGA 4XYNA 2K8MB 4YGCB 2GGMA 2TN4A 3TS5B 2BECA 4YI9A 1DVIA 2V53A 3BUXB 3OX5A 1BMOA 1MXEA 3I5FB 2KGRA 1IH0A 2LV7A 3CR5X 4GGFC 4PE4A 3EK4A 4XJKB 1WDCC 5K89A 3EVRA 3NSLA 1SRAA 5D7FA 1NX1A 4E68A 3TUYC 3I5GC 5CSIA 3SG3A 1UHHA 3ZWHA 2BCBA 2M9GA 4I5LB 4IL1A 1ALVA 1LXFC 3O2PA 1DJXA 1SR6B 4PHKA 1MHOA 2ISDA 2FCDA 1YR5A 3OB1B 1N65A 2LP2A 1MWNA 1LINA 1L2OC 1S6JA 1DT7B 4OKHA 1DGVA 1JF0A 1DJHA 2JOJA 4DRWA 1A75B 1OMRA 2SASA 2ZRTA 1JUOA 2BKHB 2ZRSA 1KFXS 2HETA 4YGDB 1BR1B 3WXAA 1IJ6A 2LHIA 4PE7A 3PLFB 3EVUA 1B8CA 1PSBA 2DOQA 1HQVA 1IWQA 3PN7B 1UWOA 4L9MA 3O6BA 1PSRA 3PALA 2JQ6A 1AJ5A 1CLBA 2NLNA 3RLZA 4P5OE 4I5JA 4C0LA 2KI6D 4I5KA 1NX2A 3NSIA 3K21A 3WNXB 2JTZA 1YUTA 1ZACA 1QS7A 4ORAB 1KWOC 1NCYA 2ZN8A 4MRXA 3LK1A 2OPOA 4M2QA 1CLMA 1YX7A 1A4PA 1SL7A 4JPZB 3KF9A 5I2QA 2K2FA 4YBHB 2LM5A 2I7AA 4CLNA 1QTXA 3JVTB 4GGNA 3VRPA 5AEQA 1S5GY 2LVVA 5HKWA 2PRUA 1SK6D 1CTRA 1K93D 4GFTA 2K0JA 3FIAA 3TDIA 1F71A 2MA2A 1KK8C 2KAXA 2O5GA 4GBAA 3EK8A 2KYFA 1QV0A 4DCKA 2RGIA 5F6TA 1J7QA 1XFXO 1K9KA 4MVFA 1JF2A 1F4OA 1PK0D 2KQ6A 2M1KB 2Y4QA 5DKQA 2KGBC 1B47A 1MXLC 2Y1MA 1FI5A 2HF5A 1CFCA 4NQGA 4JWQA 5CSNA 4ORBB 1RECA 4PHMA 1IGVA 1AUIB 4ORCB 3CS1A 2ZKMX 1G8IA 5KTYA 1QJTA 5HKZA 4QJ3B 3I5GB 1IQ3A 1BLQA 4XJKA 1YRUB 2FJUB 3ZNIA 5IBWA 1VRKA 1JC2A 1SKTA 1ZUZA 1TCFA 2JWWA 4N1FA 4M2PA 1F8HA 1K8UA 2CCMA 2G9BA 3BUMB 1XFZO 1L2OB 2L51A 3KEVA 1DGUA 2FOTA 1SYMA 2JT0A 3O78A 1ZFSA 1BG1A 1OE9B 2M8UA 4BY4A 2L4IA 1WY9A 4CPVA 1E8AA 1PVAA 1A75A 2KI4B 1PULA 2LHLA 4UPGA 3D0YB 1GGZA 5I2OA 2L50A 2WORA 1DJWA 1R6PA 1WRLA 1C7WA 4PE0A 4AQIA 1KQMC 1QX7A 3NXAA 5J3XA 4C0JA 2KFFA 2H61A 4FTGA 3VRRA 1ALWA 4Q04A 2Y1NA 1RK9A 2WCFA 1KFUL 3CTNA 1J7RA 1B8LA 3IQOA 4ICBA 4YGAA 1F54A 1PVBA 1Q80A 1SPYA 1TIZA 5CSJA 1EXRA 1XYDA 2BCXA 3I5IC 1SL8A 2QPTA 4MSPA 3LCPC 4PDZA 3AKAA 1J1DA 1M39A 1B8RA 3F45A 1KWOB 1GJYA 2MJWB 3C1VA 2JNFA 4ZCUA 4N5XA 2PVBA 3GK2A 2LC5A 1QIVA 3JTDB 1NSHA 4FQOA 2AAOA 1RJVA 1K9PA 1IRJA 3ICBA 2KHNA 2EHBA 4CIDA 4GAOA 2GV5A 5AFPA 5B8IB 1QV1A 5FYXA 5HLVA 2WCBA 2BKIB 1MF8B 2NCPA 1Y1AA 3TDZA 1BF5A 1U5IB 4NDCA 4CFRA 3D10A 3H4SE 2LAPA 3FWBA 1EH2A 5KSZA 1DJZA 1DTLA 2IS9A 3SG5A 5I2LA 1EJ3A 2AMIA 2LP3A 3EK7A 3OB2B 4N1GA 1M46A 1QATA 5JJGA 1YRTB 1CDPA 1CFDA 1NCXA 2PALA 3I5HC 1JSAA 1S6IA 1XK4A 1ZMZA 1XO5A 2EC6B 2LLTA 1F4QA 4GGFA 3BUOB 4MLWA 2I94A 1LA0A 2JTTA 1GQMA 3BUNB 1HT9A 4PCWA 1NP8A 1NX0A 1PRWA 1CDLA 1UUSA 2BBMA 2KNEA 3KPXA 5CPVA 1JFJA 2F3YA 1CKKA 1RWYA 2MLFC 2OS8C 1OSAA 1M45A 2KBMA 1S36A 1SW8A 1OMVA 1K95A 1CDMA 2BL0B 2KAVA 4MEWA 4PALA 3TDUA 1K2HA 1UHJA 1AJ4A 3DVKA 1LKJA 2MBXA 1KQMB 2L0PA 2OTGB 3IQQA 4DIRA 3D0YA 2GGZA 1UHNA 1NIWA 1LVCD 2F8PA 3TS5C 4OR9B 1AHRA 1UURA 4PHNA 4D1EA 3SIAA 1XA5A 2Q91A 2LMVA 1V1FA 3OP0A 1NYAA 5DKNA 3DD4A 3I5FC 2JC2A 1B1GA 1IJ5A 2LMTA 4WQ3A 1TOPA 1YUSA 2MHHA 1OZSA 2M0RA 2LANA 1XFWO 1SY9A 2L4HA 4MRYA 1J7PA 1WDCB 2LUCA 2CT9A 2HPSA 3VRNA 3MSEB 2KSPA 3AAJA 4WQ2A 1R2UA 3TUYB 4MN0A 2KI6C 2I2RE 4HRGA 1BJFA 1NX3A 1ODBA 1TNWA 1SNLA 1K96A 1J55A 1CB1A 1A2XA 5PALA 1K94A 4ETOA 3EKHA 1GGWA 3FWCA 4A4CA 2NZ0A 2E6WA 2KQYA 1WRZA 4F0ZB 3PSRA 5TNCA 1LA3A 1U5IA 3M0WA 3CR4X 1QVIZ 1TTXA 3BYAA 5HKYA 2M29A 5KU1A 5AANA 3VRQA 1Y1XA 2ZNEA 1NUBA 3I5HB 4A4BA 3NSOA 3WHUB 2JU0A 1RTP1 1CLLA 1OOJA 1ZOTB 2MLEC 3SG7A 2ZN9A 1V1GA 3DVMA 3PN7C 2M1UA 1XFUO 1IG5A 1H4BA 2WOSA 1UP5A 2AUCA 2PSRA 4R1EA 3LL8B 3PM8A 1N0YA 3PATA 2LLUA 1DJIA 1WRKA 2LE9B 1SL9A 1UHIA 1M31A 2K7OA 1TNXA 4U8DA 4PE1A 3SJSA 1CFFA 2M49B 2K7DA 2NXQA 4NDDA 2Y5IA 2F33A 2LNKA 1W7JB 1XVJA 2F3ZA 3DVEA 4HSZA 4HREE 3A8RA 1OZOA 2NCOA 1KFUS 3SG6A 1D1OA 2HQWA 1KSOA 1WLMA 1SCMC 2JXLA 2I18A 2CXJA 1UHKA 2ZFDA 4MZJA 1W7IB 1QASA 4PHJA 5GQQC 4C0KA 2JT8A 3LLEA 1CMGA 2MAZA 2K2AA 1KK8B 3GK1A 4MZLA 3DVJA 3TZ1A 4AOMA 1B7TY 1S1EA 3DF0A 1MQ1A 2K7BA 3OX6A 2L2EA 3LK0A 1XK4C 1OQPA 1TNPA 1A03A 2KYCA 1B9AA 1BR4B 2F2PA 1CFPA 2M3WA 2F2OA 1JFKA 4ZCVA 1YVLA 1SBJA 1QLKA 2M7NA 1DF0B 2KDHA 4GPLB 3VGOA 3VROA 1CDNA 1KFXL 5AERA 2D8NA 1J7OA 1J1EA 2L98A 2R2IA 2A4JA 1YUUA 5I8NA 1S26D 1FW4A 5HLOA 1AK8A 1XFYO 1QIWA 1KK7Z 2WC8A 2KBIA 1AP4A 1EG4A 4M2OA 1IKUA 2CBLA 3CZTX 2SCPA 2BE6A 3CLNA 1NWDA 1QXPA 2PMYA 3BOWB 2KAYA 2JPTA 2KI4C 4MZKA 4DUQA 1SCVA 4YGEB 1S3PA 1Y6WA 2HQ8A 3HX4A 1QVIY 3EKJA 1MUXA 2PASA 4OVNF 1B7TZ 4HRHA 1L7ZA 4GUKA 4USLA 2EGDA 2G2BA 1CM1A 1DJGA 1PALA 2LMUA 1X02A 4YI8A 5ER4X 3DF0B 1B4CA 3I5IB 1YURA 3BUWB 5HYDA 2KFHA 5JOLA 1C07A 2M97A 4JQ0D 1F70A 1JWDA 3CR2A 1FBVA 1FPWA 3KHEA 2LCPA 1KCYA 2LLSA 2Q4UA 3SG2A 1QX2A 5ER5A 3HCMA 2LVKA 3JTDC 4DS7A 2WNDA 2QACA 2ZNDA 3OHMB 4OCIA 1K90D 1AVSA 2BCAA 1CMFA 4QJ4B 4NDBA 4P2YB 1YTZC 2P6BB 5DKRA 1FI6A 2LVJA 1H8BA 3A4UB 1YVHA 2FCEA 4TNCA 1DMOA 1BODA 1FF1A 2CNPA 1SCMB 3GOFA 2BBNA 1IQ5A 2E30A 2VRGA 3GK4X 1SR6C 3WHTB 1C7VA 3AKBA 3SIBA 4BY5A 1YX8A 1BT6A 1RFJA 2K61A 4I5NB 4YRUA 1CNPA 1JBAA 2CTNA 3AAKA 3QRXA 2LVIA 1BU3A 1DJYA 5BPJA 4AQJA 1TCOB 1A29A 1MR8A 1NPQA 1RROA 1SMGA 2B1UA 1KQVA 2O60A 1F55A 1CM4A 2K7CA 3NSKA 2WCEA 1S6CA 1NCZA 2H61C 2EC6C 5G08A 3BXKA 4OV2A 1KSMA 1TN4A 2BE4A 3FS7A 1DF0A 2JNXA 1G4YR 1BOCA 1TRFA 1OMDA 4YGBB 1EL4A 1Y1UA 3BQ3A 1QLSA 4MBEA 2KOTA 2JRFA 2JULA 2JXCA 3E3RA 2LUXA 3CWGA 3O4YA 2L5XB 2JZIA 1G33A 1S5GZ 2OS8B 4GNKB 4QJ5B 5AXIA 2BL0C 5CSFA 5D69A 3IF7A 3RM1A 1KK7Y 1XFVO 2MRDA 3PFVA 1M63B 4WRIA 3EVVA 2H2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFQ A;  2M7L A;  1TNQ A;  3JVT C;  2JT3 A;  1QX5 B;  2COL B;  2OTG C;  3BOW A;  3KO0 A;  3SG4 A;  3CGA A;  1K9U A;  1Y0V H;  1WLZ A;  1N2D A;  1EG3 A;  2KFG A;  4XYN A;  2K8M B;  4YGC B;  2GGM A;  2TN4 A;  3TS5 B;  2BEC A;  4YI9 A;  1DVI A;  2V53 A;  3BUX B;  3OX5 A;  1BMO A;  1MXE A;  3I5F B;  2KGR A;  1IH0 A;  2LV7 A;  3CR5 X;  4GGF C;  4PE4 A;  3EK4 A;  4XJK B;  1WDC C;  5K89 A;  3EVR A;  3NSL A;  1SRA A;  5D7F A;  1NX1 A;  4E68 A;  3TUY C;  3I5G C;  5CSI A;  3SG3 A;  1UHH A;  3ZWH A;  2BCB A;  2M9G A;  4I5L B;  4IL1 A;  1ALV A;  1LXF C;  3O2P A;  1DJX A;  1SR6 B;  4PHK A;  1MHO A;  2ISD A;  2FCD A;  1YR5 A;  3OB1 B;  1N65 A;  2LP2 A;  1MWN A;  1LIN A;  1L2O C;  1S6J A;  1DT7 B;  4OKH A;  1DGV A;  1JF0 A;  1DJH A;  2JOJ A;  4DRW A;  1A75 B;  1OMR A;  2SAS A;  2ZRT A;  1JUO A;  2BKH B;  2ZRS A;  1KFX S;  2HET A;  4YGD B;  1BR1 B;  3WXA A;  1IJ6 A;  2LHI A;  4PE7 A;  3PLF B;  3EVU A;  1B8C A;  1PSB A;  2DOQ A;  1HQV A;  1IWQ A;  3PN7 B;  1UWO A;  4L9M A;  3O6B A;  1PSR A;  3PAL A;  2JQ6 A;  1AJ5 A;  1CLB A;  2NLN A;  3RLZ A;  4P5O E;  4I5J A;  4C0L A;  2KI6 D;  4I5K A;  1NX2 A;  3NSI A;  3K21 A;  3WNX B;  2JTZ A;  1YUT A;  1ZAC A;  1QS7 A;  4ORA B;  1KWO C;  1NCY A;  2ZN8 A;  4MRX A;  3LK1 A;  2OPO A;  4M2Q A;  1CLM A;  1YX7 A;  1A4P A;  1SL7 A;  4JPZ B;  3KF9 A;  5I2Q A;  2K2F A;  4YBH B;  2LM5 A;  2I7A A;  4CLN A;  1QTX A;  3JVT B;  4GGN A;  3VRP A;  5AEQ A;  1S5G Y;  2LVV A;  5HKW A;  2PRU A;  1SK6 D;  1CTR A;  1K93 D;  4GFT A;  2K0J A;  3FIA A;  3TDI A;  1F71 A;  2MA2 A;  1KK8 C;  2KAX A;  2O5G A;  4GBA A;  3EK8 A;  2KYF A;  1QV0 A;  4DCK A;  2RGI A;  5F6T A;  1J7Q A;  1XFX O;  1K9K A;  4MVF A;  1JF2 A;  1F4O A;  1PK0 D;  2KQ6 A;  2M1K B;  2Y4Q A;  5DKQ A;  2KGB C;  1B47 A;  1MXL C;  2Y1M A;  1FI5 A;  2HF5 A;  1CFC A;  4NQG A;  4JWQ A;  5CSN A;  4ORB B;  1REC A;  4PHM A;  1IGV A;  1AUI B;  4ORC B;  3CS1 A;  2ZKM X;  1G8I A;  5KTY A;  1QJT A;  5HKZ A;  4QJ3 B;  3I5G B;  1IQ3 A;  1BLQ A;  4XJK A;  1YRU B;  2FJU B;  3ZNI A;  5IBW A;  1VRK A;  1JC2 A;  1SKT A;  1ZUZ A;  1TCF A;  2JWW A;  4N1F A;  4M2P A;  1F8H A;  1K8U A;  2CCM A;  2G9B A;  3BUM B;  1XFZ O;  1L2O B;  2L51 A;  3KEV A;  1DGU A;  2FOT A;  1SYM A;  2JT0 A;  3O78 A;  1ZFS A;  1BG1 A;  1OE9 B;  2M8U A;  4BY4 A;  2L4I A;  1WY9 A;  4CPV A;  1E8A A;  1PVA A;  1A75 A;  2KI4 B;  1PUL A;  2LHL A;  4UPG A;  3D0Y B;  1GGZ A;  5I2O A;  2L50 A;  2WOR A;  1DJW A;  1R6P A;  1WRL A;  1C7W A;  4PE0 A;  4AQI A;  1KQM C;  1QX7 A;  3NXA A;  5J3X A;  4C0J A;  2KFF A;  2H61 A;  4FTG A;  3VRR A;  1ALW A;  4Q04 A;  2Y1N A;  1RK9 A;  2WCF A;  1KFU L;  3CTN A;  1J7R A;  1B8L A;  3IQO A;  4ICB A;  4YGA A;  1F54 A;  1PVB A;  1Q80 A;  1SPY A;  1TIZ A;  5CSJ A;  1EXR A;  1XYD A;  2BCX A;  3I5I C;  1SL8 A;  2QPT A;  4MSP A;  3LCP C;  4PDZ A;  3AKA A;  1J1D A;  1M39 A;  1B8R A;  3F45 A;  1KWO B;  1GJY A;  2MJW B;  3C1V A;  2JNF A;  4ZCU A;  4N5X A;  2PVB A;  3GK2 A;  2LC5 A;  1QIV A;  3JTD B;  1NSH A;  4FQO A;  2AAO A;  1RJV A;  1K9P A;  1IRJ A;  3ICB A;  2KHN A;  2EHB A;  4CID A;  4GAO A;  2GV5 A;  5AFP A;  5B8I B;  1QV1 A;  5FYX A;  5HLV A;  2WCB A;  2BKI B;  1MF8 B;  2NCP A;  1Y1A A;  3TDZ A;  1BF5 A;  1U5I B;  4NDC A;  4CFR A;  3D10 A;  3H4S E;  2LAP A;  3FWB A;  1EH2 A;  5KSZ A;  1DJZ A;  1DTL A;  2IS9 A;  3SG5 A;  5I2L A;  1EJ3 A;  2AMI A;  2LP3 A;  3EK7 A;  3OB2 B;  4N1G A;  1M46 A;  1QAT A;  5JJG A;  1YRT B;  1CDP A;  1CFD A;  1NCX A;  2PAL A;  3I5H C;  1JSA A;  1S6I A;  1XK4 A;  1ZMZ A;  1XO5 A;  2EC6 B;  2LLT A;  1F4Q A;  4GGF A;  3BUO B;  4MLW A;  2I94 A;  1LA0 A;  2JTT A;  1GQM A;  3BUN B;  1HT9 A;  4PCW A;  1NP8 A;  1NX0 A;  1PRW A;  1CDL A;  1UUS A;  2BBM A;  2KNE A;  3KPX A;  5CPV A;  1JFJ A;  2F3Y A;  1CKK A;  1RWY A;  2MLF C;  2OS8 C;  1OSA A;  1M45 A;  2KBM A;  1S36 A;  1SW8 A;  1OMV A;  1K95 A;  1CDM A;  2BL0 B;  2KAV A;  4MEW A;  4PAL A;  3TDU A;  1K2H A;  1UHJ A;  1AJ4 A;  3DVK A;  1LKJ A;  2MBX A;  1KQM B;  2L0P A;  2OTG B;  3IQQ A;  4DIR A;  3D0Y A;  2GGZ A;  1UHN A;  1NIW A;  1LVC D;  2F8P A;  3TS5 C;  4OR9 B;  1AHR A;  1UUR A;  4PHN A;  4D1E A;  3SIA A;  1XA5 A;  2Q91 A;  2LMV A;  1V1F A;  3OP0 A;  1NYA A;  5DKN A;  3DD4 A;  3I5F C;  2JC2 A;  1B1G A;  1IJ5 A;  2LMT A;  4WQ3 A;  1TOP A;  1YUS A;  2MHH A;  1OZS A;  2M0R A;  2LAN A;  1XFW O;  1SY9 A;  2L4H A;  4MRY A;  1J7P A;  1WDC B;  2LUC A;  2CT9 A;  2HPS A;  3VRN A;  3MSE B;  2KSP A;  3AAJ A;  4WQ2 A;  1R2U A;  3TUY B;  4MN0 A;  2KI6 C;  2I2R E;  4HRG A;  1BJF A;  1NX3 A;  1ODB A;  1TNW A;  1SNL A;  1K96 A;  1J55 A;  1CB1 A;  1A2X A;  5PAL A;  1K94 A;  4ETO A;  3EKH A;  1GGW A;  3FWC A;  4A4C A;  2NZ0 A;  2E6W A;  2KQY A;  1WRZ A;  4F0Z B;  3PSR A;  5TNC A;  1LA3 A;  1U5I A;  3M0W A;  3CR4 X;  1QVI Z;  1TTX A;  3BYA A;  5HKY A;  2M29 A;  5KU1 A;  5AAN A;  3VRQ A;  1Y1X A;  2ZNE A;  1NUB A;  3I5H B;  4A4B A;  3NSO A;  3WHU B;  2JU0 A;  1RTP 1;  1CLL A;  1OOJ A;  1ZOT B;  2MLE C;  3SG7 A;  2ZN9 A;  1V1G A;  3DVM A;  3PN7 C;  2M1U A;  1XFU O;  1IG5 A;  1H4B A;  2WOS A;  1UP5 A;  2AUC A;  2PSR A;  4R1E A;  3LL8 B;  3PM8 A;  1N0Y A;  3PAT A;  2LLU A;  1DJI A;  1WRK A;  2LE9 B;  1SL9 A;  1UHI A;  1M31 A;  2K7O A;  1TNX A;  4U8D A;  4PE1 A;  3SJS A;  1CFF A;  2M49 B;  2K7D A;  2NXQ A;  4NDD A;  2Y5I A;  2F33 A;  2LNK A;  1W7J B;  1XVJ A;  2F3Z A;  3DVE A;  4HSZ A;  4HRE E;  3A8R A;  1OZO A;  2NCO A;  1KFU S;  3SG6 A;  1D1O A;  2HQW A;  1KSO A;  1WLM A;  1SCM C;  2JXL A;  2I18 A;  2CXJ A;  1UHK A;  2ZFD A;  4MZJ A;  1W7I B;  1QAS A;  4PHJ A;  5GQQ C;  4C0K A;  2JT8 A;  3LLE A;  1CMG A;  2MAZ A;  2K2A A;  1KK8 B;  3GK1 A;  4MZL A;  3DVJ A;  3TZ1 A;  4AOM A;  1B7T Y;  1S1E A;  3DF0 A;  1MQ1 A;  2K7B A;  3OX6 A;  2L2E A;  3LK0 A;  1XK4 C;  1OQP A;  1TNP A;  1A03 A;  2KYC A;  1B9A A;  1BR4 B;  2F2P A;  1CFP A;  2M3W A;  2F2O A;  1JFK A;  4ZCV A;  1YVL A;  1SBJ A;  1QLK A;  2M7N A;  1DF0 B;  2KDH A;  4GPL B;  3VGO A;  3VRO A;  1CDN A;  1KFX L;  5AER A;  2D8N A;  1J7O A;  1J1E A;  2L98 A;  2R2I A;  2A4J A;  1YUU A;  5I8N A;  1S26 D;  1FW4 A;  5HLO A;  1AK8 A;  1XFY O;  1QIW A;  1KK7 Z;  2WC8 A;  2KBI A;  1AP4 A;  1EG4 A;  4M2O A;  1IKU A;  2CBL A;  3CZT X;  2SCP A;  2BE6 A;  3CLN A;  1NWD A;  1QXP A;  2PMY A;  3BOW B;  2KAY A;  2JPT A;  2KI4 C;  4MZK A;  4DUQ A;  1SCV A;  4YGE B;  1S3P A;  1Y6W A;  2HQ8 A;  3HX4 A;  1QVI Y;  3EKJ A;  1MUX A;  2PAS A;  4OVN F;  1B7T Z;  4HRH A;  1L7Z A;  4GUK A;  4USL A;  2EGD A;  2G2B A;  1CM1 A;  1DJG A;  1PAL A;  2LMU A;  1X02 A;  4YI8 A;  5ER4 X;  3DF0 B;  1B4C A;  3I5I B;  1YUR A;  3BUW B;  5HYD A;  2KFH A;  5JOL A;  1C07 A;  2M97 A;  4JQ0 D;  1F70 A;  1JWD A;  3CR2 A;  1FBV A;  1FPW A;  3KHE A;  2LCP A;  1KCY A;  2LLS A;  2Q4U A;  3SG2 A;  1QX2 A;  5ER5 A;  3HCM A;  2LVK A;  3JTD C;  4DS7 A;  2WND A;  2QAC A;  2ZND A;  3OHM B;  4OCI A;  1K90 D;  1AVS A;  2BCA A;  1CMF A;  4QJ4 B;  4NDB A;  4P2Y B;  1YTZ C;  2P6B B;  5DKR A;  1FI6 A;  2LVJ A;  1H8B A;  3A4U B;  1YVH A;  2FCE A;  4TNC A;  1DMO A;  1BOD A;  1FF1 A;  2CNP A;  1SCM B;  3GOF A;  2BBN A;  1IQ5 A;  2E30 A;  2VRG A;  3GK4 X;  1SR6 C;  3WHT B;  1C7V A;  3AKB A;  3SIB A;  4BY5 A;  1YX8 A;  1BT6 A;  1RFJ A;  2K61 A;  4I5N B;  4YRU A;  1CNP A;  1JBA A;  2CTN A;  3AAK A;  3QRX A;  2LVI A;  1BU3 A;  1DJY A;  5BPJ A;  4AQJ A;  1TCO B;  1A29 A;  1MR8 A;  1NPQ A;  1RRO A;  1SMG A;  2B1U A;  1KQV A;  2O60 A;  1F55 A;  1CM4 A;  2K7C A;  3NSK A;  2WCE A;  1S6C A;  1NCZ A;  2H61 C;  2EC6 C;  5G08 A;  3BXK A;  4OV2 A;  1KSM A;  1TN4 A;  2BE4 A;  3FS7 A;  1DF0 A;  2JNX A;  1G4Y R;  1BOC A;  1TRF A;  1OMD A;  4YGB B;  1EL4 A;  1Y1U A;  3BQ3 A;  1QLS A;  4MBE A;  2KOT A;  2JRF A;  2JUL A;  2JXC A;  3E3R A;  2LUX A;  3CWG A;  3O4Y A;  2L5X B;  2JZI A;  1G33 A;  1S5G Z;  2OS8 B;  4GNK B;  4QJ5 B;  5AXI A;  2BL0 C;  5CSF A;  5D69 A;  3IF7 A;  3RM1 A;  1KK7 Y;  1XFV O;  2MRD A;  3PFV A;  1M63 B;  4WRI A;  3EVV A;  2H2K A; 
#chains in the Genus database with same CATH topology
 4CFQ A;  2M7L A;  1TNQ A;  3JVT C;  2JT3 A;  1QX5 B;  2COL B;  2OTG C;  3BOW A;  3KO0 A;  3SG4 A;  1TUZ A;  3CGA A;  1K9U A;  1Y0V H;  1WLZ A;  5EL2 A;  1N2D A;  1EG3 A;  2KFG A;  3CAB A;  2K8M B;  4XYN A;  4YGC B;  2GGM A;  2TN4 A;  3TS5 B;  2BEC A;  3VB1 A;  4YI9 A;  1DVI A;  2V53 A;  3BUX B;  3DXL A;  3OX5 A;  1BMO A;  1MXE A;  3I5F B;  2KGR A;  1IH0 A;  2LV7 A;  3CR5 X;  4GGF C;  4PE4 A;  3EK4 A;  4XJK B;  1WDC C;  5K89 A;  3EVR A;  3NSL A;  1SRA A;  5D7F A;  1NX1 A;  4E68 A;  3TUY C;  3I5G C;  5CSI A;  3SG3 A;  1UHH A;  3ZWH A;  2BCB A;  2M9G A;  4I5L B;  4IL1 A;  2QEB A;  1ALV A;  1LXF C;  3O2P A;  1DJX A;  1SR6 B;  4PHK A;  1MHO A;  2ISD A;  3DY9 A;  2FCD A;  1YR5 A;  3OB1 B;  1N65 A;  2LP2 A;  1MWN A;  1LIN A;  1QWV A;  1L2O C;  1S6J A;  1DT7 B;  4OKH A;  1DGV A;  2P70 A;  1JF0 A;  1DJH A;  2JOJ A;  4DRW A;  1A75 B;  1OMR A;  3DZT A;  2SAS A;  2ZRT A;  1C3Y A;  1JUO A;  2BKH B;  2ZRS A;  1KFX S;  3O4X A;  2HET A;  4YGD B;  1BR1 B;  1C3Z A;  3WXA A;  1IJ6 A;  2LHI A;  2QDI A;  4PE7 A;  3PLF B;  3EVU A;  1B8C A;  1PSB A;  2KLE A;  2DOQ A;  1HQV A;  1IWQ A;  3PN7 B;  1UWO A;  4L9M A;  3O6B A;  1PSR A;  3PAL A;  2JQ6 A;  1AJ5 A;  1CLB A;  2NLN A;  3RLZ A;  4P5O E;  4I5J A;  4C0L A;  2KI6 D;  4I5K A;  1NX2 A;  3NSI A;  3CDN A;  2WCM A;  3K21 A;  3WNX B;  2JTZ A;  1YUT A;  1ZAC A;  1QS7 A;  1Z4H A;  1ORG A;  4ORA B;  1KWO C;  1NCY A;  2ZN8 A;  4MRX A;  3LK1 A;  5HL1 A;  2OPO A;  4M2Q A;  1CLM A;  1YX7 A;  1A4P A;  1SL7 A;  4JPZ B;  3KF9 A;  3B6X A;  2K2F A;  4YBH B;  5I2Q A;  2LM5 A;  2I7A A;  4CLN A;  1QTX A;  3JVT B;  4GGN A;  3VRP A;  5AEQ A;  1S5G Y;  2LVV A;  5HKW A;  2PRU A;  2BAP A;  3IVT A;  3QME A;  1SK6 D;  1CTR A;  1K93 D;  4GFT A;  2K0J A;  3FIA A;  3TDI A;  1F71 A;  2MA2 A;  3NHT A;  1KK8 C;  2KAX A;  2O5G A;  4GBA A;  3EK8 A;  2KYF A;  1QV0 A;  4DCK A;  2RGI A;  5F6T A;  1J7Q A;  1XFX O;  1K9K A;  4MVF A;  1JF2 A;  1F4O A;  1PK0 D;  2KQ6 A;  2M1K B;  2Y4Q A;  5DKQ A;  2KGB C;  1B47 A;  1MXL C;  1OOG A;  2Y1M A;  1FI5 A;  2HF5 A;  1CFC A;  4NQG A;  1OOH A;  4JWQ A;  5CSN A;  4ORB B;  1REC A;  4PHM A;  3N7H A;  1IGV A;  3S0G A;  1AUI B;  4ORC B;  3CS1 A;  2QEV A;  1G8I A;  2ZKM X;  5KTY A;  1QJT A;  5HKZ A;  3L47 A;  4QJ3 B;  3I5G B;  1IQ3 A;  1BLQ A;  4XJK A;  1YRU B;  2FJU B;  3ZNI A;  5IBW A;  1VRK A;  1JC2 A;  1SKT A;  1ZUZ A;  1TCF A;  2JWW A;  4N1F A;  3BFH A;  4M2P A;  2PQL A;  1F8H A;  1K8U A;  2CCM A;  2G9B A;  3BUM B;  1XFZ O;  1L2O B;  2L51 A;  3KEV A;  1DGU A;  2FOT A;  1SYM A;  2JT0 A;  3O78 A;  3R1O A;  1ZFS A;  1BG1 A;  1OE9 B;  2M8U A;  4BY4 A;  1SSE B;  2L4I A;  1WY9 A;  4CPV A;  2P71 A;  1E8A A;  1PVA A;  1A75 A;  2KI4 B;  1PUL A;  2LHL A;  4UPG A;  3D0Y B;  1GGZ A;  5I2O A;  2L50 A;  2FJY A;  1DJW A;  1R6P A;  1WRL A;  1C7W A;  2WOR A;  4PE0 A;  4AQI A;  1KQM C;  1QX7 A;  3NXA A;  5J3X A;  4C0J A;  2KFF A;  5D3O A;  2H61 A;  4FTG A;  3NHI A;  3VRR A;  1ALW A;  4Q04 A;  2Y1N A;  1RK9 A;  2WCF A;  1KFU L;  3CTN A;  1J7R A;  1B8L A;  3IQO A;  4ICB A;  4YGA A;  1F54 A;  1PVB A;  1Q80 A;  1SPY A;  1TIZ A;  5CSJ A;  1EXR A;  1XYD A;  2BCX A;  3I5I C;  1SL8 A;  2QPT A;  4KYN A;  3LCP C;  4MSP A;  3D75 A;  4PDZ A;  3AKA A;  1J1D A;  1M39 A;  1B8R A;  2WC6 A;  1KWO B;  3CZ1 A;  3F45 A;  1GJY A;  2MJW B;  3C1V A;  2JNF A;  4ZCU A;  3NGV A;  4N5X A;  2PVB A;  3GK2 A;  1LS8 A;  2LC5 A;  3S0E A;  1QIV A;  3CYZ A;  3JTD B;  1NSH A;  4FQO A;  2AAO A;  1RJV A;  1TUJ A;  1K9P A;  1IRJ A;  2WCL A;  3ICB A;  2KHN A;  2EHB A;  3BFB A;  4CID A;  4GAO A;  2GV5 A;  5AFP A;  5B8I B;  1QV1 A;  5FYX A;  5HLV A;  2WCB A;  2BKI B;  1MF8 B;  2NCP A;  1Y1A A;  3TDZ A;  1BF5 A;  1U5I B;  4NDC A;  4CFR A;  3D10 A;  3OGN A;  3CZ2 A;  3H4S E;  2LAP A;  3FWB A;  3Q8I A;  1EH2 A;  5KSZ A;  1DJZ A;  1DTL A;  2IS9 A;  3SG5 A;  5I2L A;  1EJ3 A;  2AMI A;  2LP3 A;  3EK7 A;  3OB2 B;  4N1G A;  1M46 A;  1QAT A;  5JJG A;  1YRT B;  1CDP A;  1CFD A;  1NCX A;  2PAL A;  3I5H C;  1JSA A;  1S6I A;  2WCH A;  1XFR A;  1IIO A;  1XK4 A;  1ZMZ A;  3K1E A;  1XO5 A;  2EC6 B;  2LLT A;  3PJI A;  1F4Q A;  4GGF A;  3BUO B;  4MLW A;  1T14 A;  2I94 A;  1LA0 A;  2JTT A;  5DIC A;  1GQM A;  3BUN B;  1HT9 A;  3L4A A;  2H8V A;  4PCW A;  2PYQ A;  1NP8 A;  1NX0 A;  1PRW A;  1CDL A;  5I94 A;  1UUS A;  2BBM A;  2KNE A;  3KPX A;  5CPV A;  1JFJ A;  2F3Y A;  1CKK A;  1RWY A;  2MLF C;  2OS8 C;  1OSA A;  1M45 A;  2KBM A;  1S36 A;  1SW8 A;  1OMV A;  1K95 A;  1CDM A;  2BL0 B;  2KAV A;  4MEW A;  4PAL A;  3TDU A;  1K2H A;  1UHJ A;  1AJ4 A;  3DVK A;  1LKJ A;  2MBX A;  1KQM B;  2L0P A;  2OTG B;  3IQQ A;  1DQE A;  4DIR A;  3D0Y A;  2GGZ A;  1UHN A;  1NIW A;  2KLD A;  3R1V A;  1LVC D;  4F7F A;  2F8P A;  3TS5 C;  2WCK A;  4OR9 B;  1AHR A;  1UUR A;  3B88 A;  3D73 A;  4PHN A;  4D1E A;  3SIA A;  1XA5 A;  2Q91 A;  2LMV A;  1V1F A;  3OP0 A;  1NYA A;  5DKN A;  3DD4 A;  3I5F C;  2JC2 A;  1B1G A;  1IJ5 A;  1OOI X;  2LMT A;  4WQ3 A;  1TOP A;  1YUS A;  2MHH A;  3L4L A;  1OZS A;  2M0R A;  2LAN A;  1XFW O;  2WC5 A;  1SY9 A;  2L4H A;  4MRY A;  1J7P A;  1WDC B;  2LUC A;  2CT9 A;  2HPS A;  3VRN A;  3MSE B;  2KSP A;  3AAJ A;  4WQ2 A;  1R2U A;  2GTE A;  3TUY B;  4MN0 A;  2KI6 C;  2I2R E;  4HRG A;  1BJF A;  1NX3 A;  1ODB A;  1TNW A;  1SNL A;  1K96 A;  1J55 A;  3PM2 A;  1A2X A;  4INW A;  1CB1 A;  5PAL A;  1K94 A;  1DEL A;  4ETO A;  3EKH A;  1GGW A;  3FWC A;  4A4C A;  2NZ0 A;  2E6W A;  2KQY A;  1WRZ A;  4F0Z B;  3PSR A;  5TNC A;  1LA3 A;  1U5I A;  3M0W A;  3CR4 X;  1QVI Z;  4JD9 A;  1TTX A;  3BYA A;  5HKY A;  2BNX A;  2M29 A;  5KU1 A;  5AAN A;  3VRQ A;  1Y1X A;  3B7A A;  2ZNE A;  1NUB A;  3I5H B;  4A4B A;  3NSO A;  3WHU B;  2JU0 A;  1RTP 1;  1CLL A;  1OOJ A;  1ZOT B;  2MLE C;  3SG7 A;  2ZN9 A;  1V1G A;  3DVM A;  3PN7 C;  2M1U A;  1XFU O;  1IG5 A;  1H4B A;  2WOS A;  3D74 A;  1UP5 A;  2AUC A;  2ERB A;  2KPH A;  2PSR A;  4R1E A;  3LL8 B;  3PM8 A;  1N0Y A;  3SS3 A;  3PAT A;  2LLU A;  3BFA A;  1DJI A;  1WRK A;  4FQT A;  2LE9 B;  1SL9 A;  1UHI A;  1M31 A;  2K7O A;  1TNX A;  4U8D A;  2YGU A;  4PE1 A;  3SJS A;  1P28 A;  3OBV A;  2M49 B;  1CFF A;  2K7D A;  2NXQ A;  4NDD A;  2Y5I A;  2F33 A;  2LNK A;  1W7J B;  1XVJ A;  2F3Z A;  3DVE A;  4HSZ A;  4HRE E;  3A8R A;  1OZO A;  2NCO A;  1KFU S;  2WCJ A;  3SG6 A;  3D77 A;  1D1O A;  3UNW A;  2HQW A;  3B86 A;  1KSO A;  1WLM A;  3V2L A;  1SCM C;  2JXL A;  2I18 A;  2CXJ A;  1UHK A;  2ZFD A;  3BJH A;  4MZJ A;  1W7I B;  2JPO A;  1QAS A;  4PHJ A;  5GQQ C;  4C0K A;  3RZS A;  2JT8 A;  3LLE A;  1CMG A;  2MAZ A;  2K2A A;  1KK8 B;  3S0B A;  3GK1 A;  4MZL A;  3DVJ A;  3TZ1 A;  4AOM A;  1B7T Y;  1S1E A;  3DF0 A;  1MQ1 A;  2K7B A;  3OX6 A;  2L2E A;  3LK0 A;  1XK4 C;  1TNP A;  1OQP A;  1A03 A;  2KYC A;  1B9A A;  1BR4 B;  2F2P A;  1CFP A;  2M3W A;  2F2O A;  1JFK A;  4ZCV A;  1YVL A;  1SBJ A;  1QLK A;  2M7N A;  1DF0 B;  2KDH A;  4GPL B;  1TWO A;  3VGO A;  1GM0 A;  1OW4 A;  3VRO A;  1KFX L;  1CDN A;  5AER A;  2D8N A;  1J7O A;  1J1E A;  2L98 A;  2R2I A;  2A4J A;  1YUU A;  5I8N A;  2QEH A;  1S26 D;  1FW4 A;  5HLO A;  1AK8 A;  1XFY O;  1QIW A;  3FE9 A;  1DC1 A;  1KK7 Z;  2WC8 A;  2QEO A;  2KBI A;  1AP4 A;  1EG4 A;  4M2O A;  1IKU A;  2CBL A;  3CZT X;  3FE6 A;  2SCP A;  2BE6 A;  3CLN A;  3EG5 B;  1NWD A;  1QXP A;  2PMY A;  3BOW B;  2KAY A;  3SS5 A;  2JPT A;  2KI4 C;  4MZK A;  4DUQ A;  1SCV A;  4YGE B;  1S3P A;  4IJ7 A;  1Y6W A;  2HQ8 A;  5FI2 A;  3HX4 A;  1OOF A;  1QVI Y;  3EKJ A;  1MUX A;  2PAS A;  3SS4 A;  4OVN F;  3B87 A;  1B7T Z;  4HRH A;  1L7Z A;  4GUK A;  4USL A;  2EGD A;  2G2B A;  1CM1 A;  1DJG A;  1PAL A;  2LMU A;  1X02 A;  4YI8 A;  5ER4 X;  3DF0 B;  1B4C A;  3I5I B;  1YUR A;  3BUW B;  5HYD A;  2KFH A;  5FI6 A;  2L5Y A;  5JOL A;  1C07 A;  2M97 A;  4JQ0 D;  1F70 A;  1Z2C B;  1JWD A;  3CR2 A;  1FBV A;  1FPW A;  3KHE A;  2LCP A;  3S0D A;  2LLS A;  2Q4U A;  1KCY A;  3SG2 A;  1QX2 A;  5ER5 A;  3HCM A;  4OZD A;  2LVK A;  3JTD C;  4DS7 A;  2WND A;  2QAC A;  2ZND A;  3OHM B;  4OCI A;  1K90 D;  1AVS A;  2BCA A;  1CMF A;  4QJ4 B;  4NDB A;  4JKT A;  1YTZ C;  2P6B B;  4P2Y B;  5DKR A;  2LVJ A;  1FI6 A;  3D78 A;  1H8B A;  3A4U B;  1YVH A;  2FCE A;  3FE8 A;  4TNC A;  1DMO A;  1BOD A;  1FF1 A;  2CNP A;  1SCM B;  3GOF A;  2BBN A;  1IQ5 A;  2E30 A;  2VRG A;  3GK4 X;  1SR6 C;  3WHT B;  1C7V A;  1DEK A;  3AKB A;  3SIB A;  4BY5 A;  3S0A A;  1YX8 A;  5FI7 A;  1BT6 A;  1RFJ A;  2K61 A;  4I5N B;  3UO9 A;  4YRU A;  1CNP A;  1JBA A;  2CTN A;  3AAK A;  3QRX A;  2LVI A;  1BU3 A;  1DJY A;  5BPJ A;  4INX A;  4AQJ A;  1TCO B;  1A29 A;  1MR8 A;  1NPQ A;  3DYE A;  1RRO A;  1SMG A;  2B1U A;  1KQV A;  2O60 A;  1F55 A;  1CM4 A;  2K7C A;  3NSK A;  2WCE A;  1S6C A;  3R1P A;  1NCZ A;  2H61 C;  4PT1 A;  2EC6 C;  5G08 A;  3BXK A;  4OV2 A;  1KSM A;  1TN4 A;  2BE4 A;  3FS7 A;  1DF0 A;  2JNX A;  1W9Z A;  3S0F A;  1G4Y R;  1BOC A;  3R72 A;  1TRF A;  1OMD A;  4YGB B;  1EL4 A;  1Y1U A;  3BQ3 A;  2L2C A;  1QLS A;  2K60 A;  4MBE A;  2KOT A;  2JRF A;  2JUL A;  2JXC A;  3E3R A;  2LUX A;  3CWG A;  3O4Y A;  2L5X B;  2JZI A;  1G33 A;  1S5G Z;  2OS8 B;  3D76 A;  4GNK B;  4QJ5 B;  5AXI A;  2BL0 C;  3CZ0 A;  5CSF A;  5D69 A;  3IF7 A;  3RM1 A;  1KK7 Y;  1XFV O;  2MRD A;  3PFV A;  1M63 B;  4WRI A;  3EVV A;  2H2K A; 
#chains in the Genus database with same CATH homology
 4CFQ A;  2M7L A;  1TNQ A;  3JVT C;  2JT3 A;  1QX5 B;  2COL B;  2OTG C;  3BOW A;  3KO0 A;  3SG4 A;  3CGA A;  1K9U A;  1Y0V H;  1WLZ A;  1N2D A;  1EG3 A;  2KFG A;  4XYN A;  2K8M B;  4YGC B;  2GGM A;  2TN4 A;  3TS5 B;  2BEC A;  4YI9 A;  1DVI A;  2V53 A;  3BUX B;  3OX5 A;  1BMO A;  1MXE A;  3I5F B;  2KGR A;  1IH0 A;  2LV7 A;  3CR5 X;  4GGF C;  4PE4 A;  3EK4 A;  4XJK B;  1WDC C;  5K89 A;  3EVR A;  3NSL A;  1SRA A;  5D7F A;  1NX1 A;  4E68 A;  3TUY C;  3I5G C;  5CSI A;  3SG3 A;  1UHH A;  3ZWH A;  2BCB A;  2M9G A;  4I5L B;  4IL1 A;  1ALV A;  1LXF C;  3O2P A;  1DJX A;  1SR6 B;  4PHK A;  1MHO A;  2ISD A;  2FCD A;  1YR5 A;  3OB1 B;  1N65 A;  2LP2 A;  1MWN A;  1LIN A;  1L2O C;  1S6J A;  1DT7 B;  4OKH A;  1DGV A;  1JF0 A;  1DJH A;  2JOJ A;  4DRW A;  1A75 B;  1OMR A;  2SAS A;  2ZRT A;  1JUO A;  2BKH B;  2ZRS A;  1KFX S;  2HET A;  4YGD B;  1BR1 B;  3WXA A;  1IJ6 A;  2LHI A;  4PE7 A;  3PLF B;  3EVU A;  1B8C A;  1PSB A;  2DOQ A;  1HQV A;  1IWQ A;  3PN7 B;  1UWO A;  4L9M A;  3O6B A;  1PSR A;  3PAL A;  2JQ6 A;  1AJ5 A;  1CLB A;  2NLN A;  3RLZ A;  4P5O E;  4I5J A;  4C0L A;  2KI6 D;  4I5K A;  1NX2 A;  3NSI A;  3K21 A;  3WNX B;  2JTZ A;  1YUT A;  1ZAC A;  1QS7 A;  4ORA B;  1KWO C;  1NCY A;  2ZN8 A;  4MRX A;  3LK1 A;  2OPO A;  4M2Q A;  1CLM A;  1YX7 A;  1A4P A;  1SL7 A;  4JPZ B;  3KF9 A;  5I2Q A;  2K2F A;  4YBH B;  2LM5 A;  2I7A A;  4CLN A;  1QTX A;  3JVT B;  4GGN A;  3VRP A;  5AEQ A;  1S5G Y;  2LVV A;  5HKW A;  2PRU A;  1SK6 D;  1CTR A;  1K93 D;  4GFT A;  2K0J A;  3FIA A;  3TDI A;  1F71 A;  2MA2 A;  1KK8 C;  2KAX A;  2O5G A;  4GBA A;  3EK8 A;  2KYF A;  1QV0 A;  4DCK A;  2RGI A;  5F6T A;  1J7Q A;  1XFX O;  1K9K A;  4MVF A;  1JF2 A;  1F4O A;  1PK0 D;  2KQ6 A;  2M1K B;  2Y4Q A;  5DKQ A;  2KGB C;  1B47 A;  1MXL C;  2Y1M A;  1FI5 A;  2HF5 A;  1CFC A;  4NQG A;  4JWQ A;  5CSN A;  4ORB B;  1REC A;  4PHM A;  1IGV A;  1AUI B;  4ORC B;  3CS1 A;  2ZKM X;  1G8I A;  5KTY A;  1QJT A;  5HKZ A;  4QJ3 B;  3I5G B;  1IQ3 A;  1BLQ A;  4XJK A;  1YRU B;  2FJU B;  3ZNI A;  5IBW A;  1VRK A;  1JC2 A;  1SKT A;  1ZUZ A;  1TCF A;  2JWW A;  4N1F A;  4M2P A;  1F8H A;  1K8U A;  2CCM A;  2G9B A;  3BUM B;  1XFZ O;  1L2O B;  2L51 A;  3KEV A;  1DGU A;  2FOT A;  1SYM A;  2JT0 A;  3O78 A;  1ZFS A;  1BG1 A;  1OE9 B;  2M8U A;  4BY4 A;  2L4I A;  1WY9 A;  4CPV A;  1E8A A;  1PVA A;  1A75 A;  2KI4 B;  1PUL A;  2LHL A;  4UPG A;  3D0Y B;  1GGZ A;  5I2O A;  2L50 A;  2WOR A;  1DJW A;  1R6P A;  1WRL A;  1C7W A;  4PE0 A;  4AQI A;  1KQM C;  1QX7 A;  3NXA A;  5J3X A;  4C0J A;  2KFF A;  2H61 A;  4FTG A;  3VRR A;  1ALW A;  4Q04 A;  2Y1N A;  1RK9 A;  2WCF A;  1KFU L;  3CTN A;  1J7R A;  1B8L A;  3IQO A;  4ICB A;  4YGA A;  1F54 A;  1PVB A;  1Q80 A;  1SPY A;  1TIZ A;  5CSJ A;  1EXR A;  1XYD A;  2BCX A;  3I5I C;  1SL8 A;  2QPT A;  4MSP A;  3LCP C;  4PDZ A;  3AKA A;  1J1D A;  1M39 A;  1B8R A;  3F45 A;  1KWO B;  1GJY A;  2MJW B;  3C1V A;  2JNF A;  4ZCU A;  4N5X A;  2PVB A;  3GK2 A;  2LC5 A;  1QIV A;  3JTD B;  1NSH A;  4FQO A;  2AAO A;  1RJV A;  1K9P A;  1IRJ A;  3ICB A;  2KHN A;  2EHB A;  4CID A;  4GAO A;  2GV5 A;  5AFP A;  5B8I B;  1QV1 A;  5FYX A;  5HLV A;  2WCB A;  2BKI B;  1MF8 B;  2NCP A;  1Y1A A;  3TDZ A;  1BF5 A;  1U5I B;  4NDC A;  4CFR A;  3D10 A;  3H4S E;  2LAP A;  3FWB A;  1EH2 A;  5KSZ A;  1DJZ A;  1DTL A;  2IS9 A;  3SG5 A;  5I2L A;  1EJ3 A;  2AMI A;  2LP3 A;  3EK7 A;  3OB2 B;  4N1G A;  1M46 A;  1QAT A;  5JJG A;  1YRT B;  1CDP A;  1CFD A;  1NCX A;  2PAL A;  3I5H C;  1JSA A;  1S6I A;  1XK4 A;  1ZMZ A;  1XO5 A;  2EC6 B;  2LLT A;  1F4Q A;  4GGF A;  3BUO B;  4MLW A;  2I94 A;  1LA0 A;  2JTT A;  1GQM A;  3BUN B;  1HT9 A;  4PCW A;  1NP8 A;  1NX0 A;  1PRW A;  1CDL A;  1UUS A;  2BBM A;  2KNE A;  3KPX A;  5CPV A;  1JFJ A;  2F3Y A;  1CKK A;  1RWY A;  2MLF C;  2OS8 C;  1OSA A;  1M45 A;  2KBM A;  1S36 A;  1SW8 A;  1OMV A;  1K95 A;  1CDM A;  2BL0 B;  2KAV A;  4MEW A;  4PAL A;  3TDU A;  1K2H A;  1UHJ A;  1AJ4 A;  3DVK A;  1LKJ A;  2MBX A;  1KQM B;  2L0P A;  2OTG B;  3IQQ A;  4DIR A;  3D0Y A;  2GGZ A;  1UHN A;  1NIW A;  1LVC D;  2F8P A;  3TS5 C;  4OR9 B;  1AHR A;  1UUR A;  4PHN A;  4D1E A;  3SIA A;  1XA5 A;  2Q91 A;  2LMV A;  1V1F A;  3OP0 A;  1NYA A;  5DKN A;  3DD4 A;  3I5F C;  2JC2 A;  1B1G A;  1IJ5 A;  2LMT A;  4WQ3 A;  1TOP A;  1YUS A;  2MHH A;  1OZS A;  2M0R A;  2LAN A;  1XFW O;  1SY9 A;  2L4H A;  4MRY A;  1J7P A;  1WDC B;  2LUC A;  2CT9 A;  2HPS A;  3VRN A;  3MSE B;  2KSP A;  3AAJ A;  4WQ2 A;  1R2U A;  3TUY B;  4MN0 A;  2KI6 C;  2I2R E;  4HRG A;  1BJF A;  1NX3 A;  1ODB A;  1TNW A;  1SNL A;  1K96 A;  1J55 A;  1CB1 A;  1A2X A;  5PAL A;  1K94 A;  4ETO A;  3EKH A;  1GGW A;  3FWC A;  4A4C A;  2NZ0 A;  2E6W A;  2KQY A;  1WRZ A;  4F0Z B;  3PSR A;  5TNC A;  1LA3 A;  1U5I A;  3M0W A;  3CR4 X;  1QVI Z;  1TTX A;  3BYA A;  5HKY A;  2M29 A;  5KU1 A;  5AAN A;  3VRQ A;  1Y1X A;  2ZNE A;  1NUB A;  3I5H B;  4A4B A;  3NSO A;  3WHU B;  2JU0 A;  1RTP 1;  1CLL A;  1OOJ A;  1ZOT B;  2MLE C;  3SG7 A;  2ZN9 A;  1V1G A;  3DVM A;  3PN7 C;  2M1U A;  1XFU O;  1IG5 A;  1H4B A;  2WOS A;  1UP5 A;  2AUC A;  2PSR A;  4R1E A;  3LL8 B;  3PM8 A;  1N0Y A;  3PAT A;  2LLU A;  1DJI A;  1WRK A;  2LE9 B;  1SL9 A;  1UHI A;  1M31 A;  2K7O A;  1TNX A;  4U8D A;  4PE1 A;  3SJS A;  1CFF A;  2M49 B;  2K7D A;  2NXQ A;  4NDD A;  2Y5I A;  2F33 A;  2LNK A;  1W7J B;  1XVJ A;  2F3Z A;  3DVE A;  4HSZ A;  4HRE E;  3A8R A;  1OZO A;  2NCO A;  1KFU S;  3SG6 A;  1D1O A;  2HQW A;  1KSO A;  1WLM A;  1SCM C;  2JXL A;  2I18 A;  2CXJ A;  1UHK A;  2ZFD A;  4MZJ A;  1W7I B;  1QAS A;  4PHJ A;  5GQQ C;  4C0K A;  2JT8 A;  3LLE A;  1CMG A;  2MAZ A;  2K2A A;  1KK8 B;  3GK1 A;  4MZL A;  3DVJ A;  3TZ1 A;  4AOM A;  1B7T Y;  1S1E A;  3DF0 A;  1MQ1 A;  2K7B A;  3OX6 A;  2L2E A;  3LK0 A;  1XK4 C;  1OQP A;  1TNP A;  1A03 A;  2KYC A;  1B9A A;  1BR4 B;  2F2P A;  1CFP A;  2M3W A;  2F2O A;  1JFK A;  4ZCV A;  1YVL A;  1SBJ A;  1QLK A;  2M7N A;  1DF0 B;  2KDH A;  4GPL B;  3VGO A;  3VRO A;  1CDN A;  1KFX L;  5AER A;  2D8N A;  1J7O A;  1J1E A;  2L98 A;  2R2I A;  2A4J A;  1YUU A;  5I8N A;  1S26 D;  1FW4 A;  5HLO A;  1AK8 A;  1XFY O;  1QIW A;  1KK7 Z;  2WC8 A;  2KBI A;  1AP4 A;  1EG4 A;  4M2O A;  1IKU A;  2CBL A;  3CZT X;  2SCP A;  2BE6 A;  3CLN A;  1NWD A;  1QXP A;  2PMY A;  3BOW B;  2KAY A;  2JPT A;  2KI4 C;  4MZK A;  4DUQ A;  1SCV A;  4YGE B;  1S3P A;  1Y6W A;  2HQ8 A;  3HX4 A;  1QVI Y;  3EKJ A;  1MUX A;  2PAS A;  4OVN F;  1B7T Z;  4HRH A;  1L7Z A;  4GUK A;  4USL A;  2EGD A;  2G2B A;  1CM1 A;  1DJG A;  1PAL A;  2LMU A;  1X02 A;  4YI8 A;  5ER4 X;  3DF0 B;  1B4C A;  3I5I B;  1YUR A;  3BUW B;  5HYD A;  2KFH A;  5JOL A;  1C07 A;  2M97 A;  4JQ0 D;  1F70 A;  1JWD A;  3CR2 A;  1FBV A;  1FPW A;  3KHE A;  2LCP A;  1KCY A;  2LLS A;  2Q4U A;  3SG2 A;  1QX2 A;  5ER5 A;  3HCM A;  2LVK A;  3JTD C;  4DS7 A;  2WND A;  2QAC A;  2ZND A;  3OHM B;  4OCI A;  1K90 D;  1AVS A;  2BCA A;  1CMF A;  4QJ4 B;  4NDB A;  4P2Y B;  1YTZ C;  2P6B B;  5DKR A;  1FI6 A;  2LVJ A;  1H8B A;  3A4U B;  1YVH A;  2FCE A;  4TNC A;  1DMO A;  1BOD A;  1FF1 A;  2CNP A;  1SCM B;  3GOF A;  2BBN A;  1IQ5 A;  2E30 A;  2VRG A;  3GK4 X;  1SR6 C;  3WHT B;  1C7V A;  3AKB A;  3SIB A;  4BY5 A;  1YX8 A;  1BT6 A;  1RFJ A;  2K61 A;  4I5N B;  4YRU A;  1CNP A;  1JBA A;  2CTN A;  3AAK A;  3QRX A;  2LVI A;  1BU3 A;  1DJY A;  5BPJ A;  4AQJ A;  1TCO B;  1A29 A;  1MR8 A;  1NPQ A;  1RRO A;  1SMG A;  2B1U A;  1KQV A;  2O60 A;  1F55 A;  1CM4 A;  2K7C A;  3NSK A;  2WCE A;  1S6C A;  1NCZ A;  2H61 C;  2EC6 C;  5G08 A;  3BXK A;  4OV2 A;  1KSM A;  1TN4 A;  2BE4 A;  3FS7 A;  1DF0 A;  2JNX A;  1G4Y R;  1BOC A;  1TRF A;  1OMD A;  4YGB B;  1EL4 A;  1Y1U A;  3BQ3 A;  1QLS A;  4MBE A;  2KOT A;  2JRF A;  2JUL A;  2JXC A;  3E3R A;  2LUX A;  3CWG A;  3O4Y A;  2L5X B;  2JZI A;  1G33 A;  1S5G Z;  2OS8 B;  4GNK B;  4QJ5 B;  5AXI A;  2BL0 C;  5CSF A;  5D69 A;  3IF7 A;  3RM1 A;  1KK7 Y;  1XFV O;  2MRD A;  3PFV A;  1M63 B;  4WRI A;  3EVV A;  2H2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...