1JSAA

Myristoylated recoverin with two calciums bound, nmr, 24 structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
188
structure length
188
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanics of calcium-myristoyl switches.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium binding
molecule keywords RECOVERIN
total genus 28
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1997-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA01
5D69A 1RFJA 1F55A 1UHNA 5PALA 1SMGA 2MRDA 3DVJA 3EVUA 2WCEA 1FPWA 1B7TZ 4AQJA 1EG4A 3OX6A 1M45A 2NZ0A 1PVBA 5J3XA 1X02A 5HYDA 3BQ3A 1C7VA 4UPGA 4NDDA 3LK1A 2L0PA 3HCMA 1UWOA 4YBHB 1S5GY 2ZNEA 1W7IB 4NDBA 4OV2A 2KNEA 4MVFA 1TIZA 2QPTA 2LE9B 1JC2A 1SYMA 1UURA 5I8NA 5KSZA 3TUYB 4MN0A 3FIAA 3SG3A 2KI4B 1SCMB 1MUXA 3D0YA 2JOJA 4PE1A 3BOWA 1B8RA 1NX1A 2KI6D 3TS5C 3ZWHA 2LVJA 2PRUA 1Y0VH 2JZIA 1KFXL 1KFUL 1WDCC 2D8NA 5F6TA 3TDUA 3SG6A 1YVLA 1RWYA 3A8RA 1DMOA 3E3RA 1TN4A 1AJ5A 3DVMA 3SIAA 1G33A 1L2OC 1BODA 2BL0C 1F4OA 2EHBA 4PHKA 1OMRA 1SCVA 3EKHA 3PN7B 3KO0A 1DJYA 1U5IB 2JPTA 1TRFA 1QV0A 2LVIA 2EC6C 1FBVA 2VRGA 5HKZA 2R2IA 4R1EA 2L2EA 2BE6A 1BMOA 2M7LA 2KAXA 1JF0A 2LHLA 1G4YR 4L9MA 1YVHA 4NQGA 4C0KA 2KDHA 3NSIA 3CZTX 1Y6WA 1PVAA 1QASA 1CMGA 1M39A 2MBXA 2CT9A 3I5FB 1BJFA 2BCXA 3WHTB 4CPVA 4ETOA 3K21A 1KQMB 2JXLA 4HREE 2L4HA 4MZKA 1IG5A 1S26D 2LM5A 1SR6B 4DCKA 2Y1MA 1K94A 4TNCA 1MQ1A 4HRGA 2JXCA 4CIDA 4N5XA 2HETA 3EK7A 3NSLA 1LKJA 3BUWB 4GGFC 2IS9A 1QIVA 4FTGA 1OQPA 1CKKA 1K9KA 5AXIA 2H2KA 1WRKA 4PCWA 3TDZA 1L2OB 1XFXO 4YI8A 1OOJA 4WRIA 5HLOA 4YGCB 1DF0A 4GPLB 3I5IC 4QJ4B 3CGAA 2JT8A 1S6JA 1WLZA 4ORAB 5BPJA 1ZFSA 3EK4A 2ISDA 1D1OA 4ZCUA 4ORCB 1CM1A 3OX5A 1A75A 3VROA 2K2FA 1J7RA 3BYAA 3KF9A 1XK4C 5DKNA 2HF5A 4PDZA 1H4BA 1TTXA 2LVVA 2QACA 1NCXA 2ZRSA 1R6PA 5CSIA 3SIBA 3M0WA 4F0ZB 1KQMC 1S6IA 1LVCD 2KGBC 2LVKA 2I18A 1NYAA 1K8UA 3I5GC 1SR6C 2ZRTA 3SG5A 1TOPA 5I2OA 3NSOA 1Y1AA 3DD4A 1CLMA 2M9GA 4OVNF 3WHUB 1C7WA 2GGMA 1YRUB 3FS7A 3JTDC 1NPQA 4E68A 4OKHA 1KK7Z 1MR8A 1QLKA 3EVVA 1LINA 3OHMB 2BKIB 2M1KB 2M49B 3LLEA 1JFJA 1FF1A 1KSOA 4NDCA 3BUXB 1DJZA 2OTGC 2JTTA 1SNLA 2LLSA 1CM4A 1QJTA 1UUSA 1BLQA 3TZ1A 2BE4A 1MXEA 2OS8B 1JFKA 1KK7Y 2I7AA 5JOLA 1J7PA 2F33A 1SY9A 1Y1UA 3H4SE 2MLEC 4YGDB 2B1UA 4OR9B 1F8HA 2CXJA 1HQVA 4I5JA 4JWQA 5K89A 1RJVA 1U5IA 3DVKA 1SL9A 2HQ8A 3TDIA 1DF0B 2K0JA 2O5GA 3EKJA 3KEVA 3ICBA 1CDPA 1KK8B 1S3PA 1XYDA 1ZMZA 3PN7C 2WCBA 1NX0A 3C1VA 1EG3A 2K8MB 2EC6B 2AMIA 2K7CA 1RTP1 5KU1A 1DJWA 3SG2A 3O2PA 2KQYA 3SG7A 1QVIZ 2JULA 2P6BB 4A4CA 3D10A 4PE7A 1K9UA 1NX2A 4CFQA 2KI4C 3FWBA 1BT6A 1V1GA 2KOTA 3I5GB 4YGEB 1YUTA 2LNKA 4WQ3A 1JUOA 1QX5B 1SK6D 1WRLA 1WY9A 2JU0A 4BY5A 1K9PA 2GV5A 4XJKB 1IQ5A 2AAOA 3SG4A 1CFPA 1EL4A 1PSBA 4MRYA 4ORBB 1DJXA 4MZJA 1A03A 4C0LA 1CLLA 2V53A 2KYFA 1NX3A 1SL8A 5G08A 1K2HA 3CWGA 3CTNA 1A29A 2EGDA 1YUUA 1CDMA 2KAVA 1XFUO 3AKBA 2L5XB 3BXKA 1R2UA 1S36A 3O78A 4P5OE 1OE9B 1ZOTB 2JQ6A 2LV7A 1SW8A 1OMDA 1Y1XA 3DF0B 2KFGA 5D7FA 4BY4A 3LCPC 3DF0A 5GQQC 3VRQA 2HQWA 1ZACA 1IRJA 4GUKA 2RGIA 5AERA 2FCDA 3O6BA 5IBWA 1CFFA 1CLBA 1IGVA 2BECA 3JVTC 2COLB 3GK2A 2PALA 1ODBA 3EK8A 2LP3A 5DKRA 1SBJA 2BBMA 1B4CA 1FW4A 4GGFA 2L98A 3OB2B 1EH2A 1KWOC 4M2OA 1OZOA 1XFVO 3D0YB 1B8LA 4YI9A 1NIWA 3AAJA 1CB1A 2M7NA 3OB1B 1CTRA 1M63B 2KFFA 1RECA 1AP4A 2E30A 1WLMA 4N1FA 3A4UB 1B47A 5JJGA 5AEQA 2Y4QA 2K61A 5CPVA 2Q91A 1JSAA 5HLVA 1YX7A 2PMYA 2WOSA 2O60A 2Q4UA 2LHIA 4A4BA 1RROA 3VRRA 1WDCB 3VRPA 1TNWA 1DJGA 4P2YB 5HKWA 1DGUA 1PULA 1XVJA 2BL0B 3PM8A 3PSRA 2MHHA 1CDLA 1NWDA 3CS1A 1B8CA 2H61A 2CCMA 2L4IA 1UHIA 3MSEB 4MZLA 4IL1A 4M2PA 2F8PA 2LMVA 2G2BA 3KPXA 2ZKMX 1BOCA 3I5HC 1LA3A 1K96A 4OCIA 1NCZA 3VRNA 2JNXA 1EJ3A 2MJWB 2PASA 1LXFC 1ALVA 5CSFA 1IH0A 1IJ5A 2WC8A 1S6CA 3O4YA 2M1UA 5DKQA 2NLNA 1B7TY 1N0YA 2AUCA 1GQMA 1JWDA 1DGVA 1DJIA 1KWOB 3CR5X 3KHEA 1YTZC 2K7BA 2SASA 3IF7A 1E8AA 2ZFDA 1TNXA 1NUBA 4PE4A 1FI5A 4MLWA 2SCPA 2ZN9A 2ZN8A 2JT0A 1W7JB 1K93D 3IQQA 4I5LB 1M31A 1UHKA 1N2DA 2OTGB 4Q04A 1J55A 2K2AA 2WNDA 1QV1A 1UHHA 5AANA 4XJKA 1H8BA 1MHOA 1UP5A 4GAOA 2OPOA 4ICBA 1MWNA 1J7OA 5AFPA 1DT7B 2LUXA 3NSKA 4JPZB 1ALWA 4PHNA 1XA5A 1MF8B 1SCMC 4QJ5B 2Y5IA 1XK4A 5ER4X 1OSAA 3VGOA 1BU3A 2BCAA 4HRHA 4I5KA 2LLUA 2NXQA 1ZUZA 2KFHA 3I5IB 1AHRA 2BBNA 2PVBA 1BR1B 1TCFA 3CR2A 2KGRA 1KCYA 1IJ6A 1HT9A 2FCEA 2KBIA 3DVEA 1DJHA 3WNXB 1S5GZ 3BUOB 1SKTA 4N1GA 2PSRA 2FOTA 3BUMB 2LMTA 1A4PA 5ER5A 4DIRA 1AUIB 2F2OA 4JQ0D 4GGNA 2I2RE 2LLTA 1QLSA 4AQIA 1YR5A 2F2PA 4YGAA 1Q80A 4FQOA 5FYXA 1GJYA 2KSPA 2LAPA 1KQVA 1WRZA 1OZSA 1QS7A 3BOWB 3IQOA 1KFUS 4MSPA 4C0JA 1AVSA 1SPYA 1AJ4A 2F3YA 2NCPA 2CNPA 1GGWA 2KI6C 1QVIY 4U8DA 1JF2A 1MXLC 1NSHA 1XFYO 1YUSA 1BR4B 1BG1A 2KQ6A 2K7OA 4DS7A 3EVRA 3FWCA 4MRXA 5I2QA 2A4JA 2WCFA 1SL7A 1K95A 5KTYA 1CFDA 3WXAA 1XFZO 4GNKB 2L51A 1F70A 1QATA 5HKYA 2M29A 4D1EA 1JBAA 2M8UA 1UHJA 3RLZA 3CR4X 2JRFA 4XYNA 1J7QA 2LCPA 1L7ZA 1B9AA 2L50A 2OS8C 2M3WA 4PHMA 1SRAA 2MA2A 1QTXA 2GGZA 2DOQA 3NXAA 1A75B 3PLFB 1IKUA 1YURA 3JVTB 2KHNA 1TNPA 3GK4X 4CFRA 3ZNIA 4GFTA 5CSJA 3QRXA 1LA0A 4DRWA 5I2LA 1QXPA 1PK0D 1IWQA 1V1FA 2H61C 3I5FC 2ZNDA 4MBEA 1PRWA 1KK8C 4USLA 3OP0A 5TNCA 3CLNA 2FJUB 3GK1A 3RM1A 1J1EA 2CBLA 2JTZA 2I94A 4ZCVA 3I5HB 1PALA 4PE0A 3SJSA 1KSMA 2E6WA 2LMUA 2LUCA 1VRKA 1C07A 2LP2A 1CFCA 1S1EA 1QX7A 2CTNA 1CMFA 3AAKA 1KFXS 4PHJA 1AK8A 2JWWA 1A2XA 2Y1NA 2LANA 4DUQA 1K90D 1GGZA 2HPSA 2M97A 3HX4A 1BF5A 1XFWO 3PATA 1J1DA 1B1GA 3F45A 3TUYC 1XO5A 2WORA 1IQ3A 3PFVA 4CLNA 4HSZA 4WQ2A 1NCYA 4I5NB 1QIWA 4PALA 1NP8A 1OMVA 2G9BA 4GBAA 4AOMA 3TS5B 5B8IB 1TCOB 1YX8A 2BKHB 3GOFA 2JC2A 4QJ3B 2KYCA 1PSRA 1TNQA 2M0RA 1M46A 1QX2A 2MLFC 2K7DA 3AKAA 4YGBB 1F71A 3JTDB 2F3ZA 2JNFA 2LC5A 1N65A 1CDNA 3LK0A 2KBMA 3BUNB 4M2QA 2KAYA 2TN4A 1CNPA 1DTLA 4MEWA 1F4QA 1YRTB 2BCBA 1F54A 2MAZA 1EXRA 1RK9A 2NCOA 5CSNA 4YRUA 3PALA 1FI6A 2JT3A 3LL8B 1G8IA 1DVIA
chains in the Genus database with same CATH superfamily
5D69A 1RFJA 1F55A 1UHNA 5PALA 1SMGA 2MRDA 3DVJA 3EVUA 2WCEA 1FPWA 1B7TZ 5I94A 4AQJA 1EG4A 3OX6A 1M45A 2NZ0A 1PVBA 5J3XA 1X02A 5HYDA 3BQ3A 1C7VA 4UPGA 4NDDA 3LK1A 2L0PA 2KLEA 2QDIA 3HCMA 1UWOA 4YBHB 1S5GY 2ZNEA 1W7IB 4NDBA 4OV2A 3S0DA 2KNEA 3D78A 4MVFA 1DEKA 1TIZA 2QPTA 2LE9B 1JC2A 1SYMA 1UURA 5I8NA 5KSZA 3TUYB 2PQLA 4MN0A 1DELA 3FIAA 2KI4B 1SCMB 3SG3A 1MUXA 3K1EA 3D0YA 2JOJA 4PE1A 3BOWA 1B8RA 1NX1A 2KI6D 3TS5C 3B7AA 3ZWHA 2LVJA 2PRUA 4F7FA 1Y0VH 2JZIA 1KFXL 1KFUL 1WDCC 2D8NA 5F6TA 3TDUA 2WCJA 3SG6A 1YVLA 1RWYA 3A8RA 1DMOA 3E3RA 1TN4A 1AJ5A 3DVMA 3SIAA 1G33A 1L2OC 1BODA 2BL0C 1F4OA 2EHBA 4PHKA 1OMRA 1SCVA 3EKHA 3PN7B 3DYEA 5D3OA 3KO0A 1DJYA 1U5IB 2JPTA 1TRFA 1QV0A 2LVIA 2EC6C 3S0EA 1FBVA 2VRGA 5HKZA 2R2IA 4R1EA 2L2EA 2BE6A 1BMOA 2WC5A 3FE8A 2M7LA 2KAXA 4JKTA 1JF0A 2LHLA 2YGUA 1G4YR 4L9MA 1YVHA 4NQGA 3CZ2A 3FE6A 2FJYA 4C0KA 2KDHA 3NSIA 3CZTX 1Y6WA 1PVAA 1QASA 1CMGA 1M39A 2MBXA 2CT9A 3I5FB 1BJFA 2BCXA 2K60A 3WHTB 4CPVA 4ETOA 3K21A 1KQMB 2JXLA 3BFAA 4HREE 2L4HA 1DC1A 4MZKA 2PYQA 3CABA 1IG5A 1S26D 2LM5A 1SR6B 4DCKA 2Y1MA 1K94A 4TNCA 2L5YA 1MQ1A 4HRGA 2JXCA 4OZDA 4CIDA 3SS5A 4N5XA 3R1OA 3NHIA 2HETA 3EK7A 3NSLA 1LKJA 3BUWB 4GGFC 2IS9A 1QIVA 4FTGA 4JD9A 1OQPA 1CKKA 1K9KA 5AXIA 1DQEA 2H2KA 1WRKA 4PCWA 3TDZA 1L2OB 1XFXO 4YI8A 1OOJA 4WRIA 4INWA 3R1VA 5HLOA 4YGCB 1DF0A 4GPLB 3I5IC 4QJ4B 3CGAA 1GM0A 2JT8A 1S6JA 1WLZA 4ORAB 5BPJA 1ZFSA 2WCKA 3VB1A 3EK4A 2ISDA 1D1OA 4ZCUA 4ORCB 1CM1A 3BJHA 3OX5A 1A75A 2P71A 3VROA 1CFFA 2K2FA 1J7RA 3BYAA 3KF9A 1XK4C 5DKNA 2HF5A 4PDZA 1H4BA 1TTXA 1Z4HA 1T14A 2LVVA 1C3ZA 2QACA 1NCXA 2ZRSA 1R6PA 5CSIA 3SIBA 3M0WA 4F0ZB 1KQMC 1S6IA 3NHTA 1LVCD 2KGBC 2LVKA 2I18A 1NYAA 1K8UA 3I5GC 1SR6C 2ZRTA 3SG5A 1TOPA 5I2OA 3NSOA 1Y1AA 3DD4A 3OGNA 1CLMA 2M9GA 4OVNF 3EG5B 3WHUB 1C7WA 2GGMA 1YRUB 3FS7A 3JTDC 1NPQA 4E68A 4OKHA 1OOIX 1KK7Z 1MR8A 1QLKA 3EVVA 1XFRA 1LINA 3OHMB 2BKIB 2M1KB 2M49B 3LLEA 1JFJA 1FF1A 1KSOA 4NDCA 5HL1A 3BUXB 1DJZA 2OTGC 2JTTA 1SNLA 2LLSA 1CM4A 1QJTA 1UUSA 1BLQA 2H8VA 3TZ1A 2BE4A 1MXEA 2OS8B 1JFKA 1KK7Y 2I7AA 5JOLA 1J7PA 2F33A 1SY9A 1Y1UA 3H4SE 2MLEC 1TUZA 2B1UA 4OR9B 4YGDB 1F8HA 2CXJA 1HQVA 4I5JA 4JWQA 5K89A 1RJVA 1U5IA 3DVKA 1SL9A 2HQ8A 3TDIA 1DF0B 2K0JA 2O5GA 3D75A 3EKJA 3ICBA 3KEVA 1CDPA 1KK8B 1S3PA 5DICA 1XYDA 1ZMZA 3FE9A 3PN7C 2WCBA 1NX0A 3C1VA 1EG3A 2K8MB 2EC6B 3R1PA 2AMIA 2K7CA 3DY9A 1RTP1 5KU1A 2BNXA 1DJWA 3SG2A 3O2PA 2KQYA 3SG7A 1QVIZ 2JULA 2P6BB 4A4CA 3D10A 4PE7A 1K9UA 1NX2A 4CFQA 2KI4C 3D76A 3N7HA 3FWBA 2WC6A 1BT6A 1V1GA 2KOTA 3I5GB 4YGEB 1YUTA 2WCHA 2LNKA 4WQ3A 1JUOA 1QX5B 1SK6D 1WRLA 1WY9A 3DXLA 2JU0A 4BY5A 1K9PA 2GV5A 4XJKB 1IQ5A 2AAOA 3SG4A 1CFPA 1EL4A 1PSBA 4MRYA 4ORBB 1DJXA 4MZJA 1A03A 4C0LA 1CLLA 2V53A 2KYFA 1NX3A 1SL8A 5G08A 1K2HA 3CWGA 3CTNA 1A29A 2EGDA 3CDNA 1YUUA 1CDMA 2KAVA 3BFHA 1XFUO 3L47A 3AKBA 2L5XB 3BXKA 1R2UA 1S36A 3O78A 4P5OE 1OE9B 1ZOTB 2JQ6A 2LV7A 3OBVA 1SW8A 1OMDA 1Y1XA 3DF0B 2KFGA 5D7FA 4BY4A 3CZ1A 4KYNA 3LCPC 3DF0A 5FI2A 1LS8A 5GQQC 3VRQA 1IRJA 1ZACA 2HQWA 4GUKA 2RGIA 3UNWA 2FCDA 3O6BA 5AERA 5IBWA 1CLBA 1IGVA 2BECA 3L4AA 3JVTC 2COLB 3GK2A 2PALA 1ODBA 3EK8A 2LP3A 5DKRA 1SBJA 2BBMA 3S0AA 1B4CA 1FW4A 4GGFA 2L98A 3OB2B 1EH2A 1KWOC 4M2OA 1OZOA 1XFVO 3D0YB 2WCLA 1B8LA 4YI9A 1C3YA 1NIWA 3AAJA 1CB1A 2M7NA 3OB1B 1CTRA 1M63B 2KFFA 1RECA 1AP4A 2E30A 1WLMA 4N1FA 3A4UB 1B47A 5JJGA 5AEQA 3D74A 3B6XA 2Y4QA 2K61A 5CPVA 2Q91A 3SS4A 5HLVA 1JSAA 3SS3A 1YX7A 4IJ7A 1IIOA 2PMYA 2WOSA 2O60A 2Q4UA 4PT1A 2LHIA 4A4BA 1RROA 3VRRA 1WDCB 3VRPA 1TNWA 1DJGA 5EL2A 4P2YB 2BAPA 5HKWA 1DGUA 1OW4A 1PULA 1XVJA 2BL0B 3PM8A 3PSRA 2L2CA 2MHHA 1CDLA 1NWDA 3CS1A 1B8CA 2H61A 2CCMA 2L4IA 1UHIA 3MSEB 4MZLA 4IL1A 4M2PA 2F8PA 2LMVA 2G2BA 3KPXA 2ZKMX 3S0FA 3I5HC 1BOCA 1LA3A 1K96A 4OCIA 1NCZA 3VRNA 2JNXA 1EJ3A 2MJWB 2PASA 1LXFC 1ALVA 3UO9A 5CSFA 3RZSA 1IH0A 1IJ5A 2WC8A 1S6CA 3O4YA 2M1UA 3BFBA 1W9ZA 2KPHA 5DKQA 2NLNA 1B7TY 1N0YA 2AUCA 2WCMA 5FI7A 1GQMA 3CZ0A 1JWDA 1DGVA 1DJIA 1KWOB 3CR5X 3KHEA 4FQTA 1YTZC 2K7BA 2SASA 3IF7A 1E8AA 2ZFDA 1TNXA 1NUBA 3L4LA 4PE4A 1FI5A 3CYZA 4MLWA 2KLDA 2SCPA 2ZN9A 2ZN8A 2JT0A 1W7JB 1K93D 3B86A 3IQQA 4I5LB 1M31A 1UHKA 1N2DA 2OTGB 3NGVA 4Q04A 3S0BA 1J55A 2K2AA 2WNDA 1QV1A 1UHHA 5AANA 4XJKA 1H8BA 1MHOA 1UP5A 4GAOA 2OPOA 4ICBA 1MWNA 1J7OA 5AFPA 1DT7B 2LUXA 3NSKA 4JPZB 1ALWA 4INXA 4PHNA 1XA5A 1MF8B 1SCMC 4QJ5B 2Y5IA 1XK4A 2JPOA 5ER4X 1OSAA 3VGOA 1BU3A 2BCAA 4HRHA 3S0GA 4I5KA 2LLUA 2NXQA 1ZUZA 2KFHA 3I5IB 1AHRA 2BBNA 1TUJA 2PVBA 3IVTA 1BR1B 1TCFA 3CR2A 2KGRA 1KCYA 1IJ6A 1HT9A 2P70A 2FCEA 1ORGA 2KBIA 3DVEA 2QEOA 1DJHA 3WNXB 1S5GZ 3BUOB 1SKTA 4N1GA 2PSRA 1P28A 1OOFA 2FOTA 3BUMB 2GTEA 2LMTA 1A4PA 5ER5A 3B87A 4DIRA 1AUIB 2F2OA 4JQ0D 4GGNA 2I2RE 2QEVA 2LLTA 1QLSA 4AQIA 1YR5A 2F2PA 4YGAA 1Q80A 4FQOA 5FYXA 1GJYA 2KSPA 2LAPA 1KQVA 1WRZA 3B88A 3QMEA 1OZSA 1QS7A 3BOWB 3IQOA 1KFUS 4MSPA 4C0JA 1AVSA 1SPYA 1AJ4A 2F3YA 2NCPA 2CNPA 2ERBA 1GGWA 2KI6C 1QVIY 4U8DA 1JF2A 1MXLC 1NSHA 1XFYO 1YUSA 1BR4B 1BG1A 2KQ6A 2K7OA 4DS7A 3EVRA 3FWCA 4MRXA 5I2QA 2A4JA 2WCFA 1SL7A 1K95A 5KTYA 1CFDA 3WXAA 1XFZO 4GNKB 2L51A 1F70A 1QATA 5HKYA 2M29A 4D1EA 1JBAA 2M8UA 1UHJA 3RLZA 3CR4X 2JRFA 3R72A 4XYNA 1J7QA 2LCPA 1L7ZA 1B9AA 2L50A 2OS8C 2M3WA 4PHMA 1QWVA 1SRAA 2MA2A 1QTXA 2GGZA 2DOQA 3NXAA 1A75B 3PLFB 1IKUA 1YURA 3JVTB 2KHNA 3PM2A 1TNPA 3GK4X 4CFRA 3ZNIA 4GFTA 5CSJA 3QRXA 1LA0A 4DRWA 5I2LA 1QXPA 5FI6A 1PK0D 3Q8IA 1IWQA 1V1FA 2H61C 3I5FC 2ZNDA 4MBEA 1PRWA 1KK8C 4USLA 2QEHA 3OP0A 5TNCA 3CLNA 2FJUB 3GK1A 3RM1A 1J1EA 2CBLA 2JTZA 2I94A 4ZCVA 3I5HB 1PALA 4PE0A 3SJSA 1KSMA 2E6WA 2LMUA 2LUCA 1VRKA 1C07A 2LP2A 1CFCA 1S1EA 1QX7A 2CTNA 1CMFA 3AAKA 1KFXS 4PHJA 1AK8A 2JWWA 1A2XA 2Y1NA 2LANA 4DUQA 1K90D 1GGZA 2HPSA 2M97A 3HX4A 3PJIA 1BF5A 1XFWO 3PATA 3V2LA 1J1DA 1B1GA 3F45A 3TUYC 1XO5A 2WORA 1IQ3A 3PFVA 3D77A 3O4XA 4CLNA 4HSZA 1TWOA 1SSEB 1Z2CB 1NCYA 4I5NB 1QIWA 4PALA 4WQ2A 1NP8A 1OMVA 2G9BA 4GBAA 4AOMA 3TS5B 5B8IB 1TCOB 1YX8A 2BKHB 3GOFA 2JC2A 4QJ3B 2KYCA 1PSRA 2QEBA 1TNQA 2M0RA 1M46A 1QX2A 2MLFC 2K7DA 3AKAA 4YGBB 1F71A 3JTDB 2F3ZA 2JNFA 2LC5A 1N65A 1CDNA 3LK0A 2KBMA 3BUNB 3DZTA 4M2QA 2KAYA 2TN4A 1CNPA 1DTLA 4MEWA 1OOGA 1F4QA 1YRTB 2BCBA 1F54A 1OOHA 2MAZA 1EXRA 1RK9A 2NCOA 5CSNA 4YRUA 3PALA 3D73A 2JT3A 1FI6A 3LL8B 1G8IA 1DVIA
chains in the Genus database with same CATH topology
5D69A 1RFJA 1F55A 1UHNA 5PALA 1SMGA 2MRDA 3DVJA 3EVUA 2WCEA 1FPWA 1B7TZ 4AQJA 1EG4A 3OX6A 1M45A 2NZ0A 1PVBA 5J3XA 1X02A 5HYDA 3BQ3A 1C7VA 4UPGA 4NDDA 3LK1A 2L0PA 3HCMA 1UWOA 4YBHB 1S5GY 2ZNEA 1W7IB 4NDBA 4OV2A 2KNEA 4MVFA 1TIZA 2QPTA 2LE9B 1JC2A 1SYMA 1UURA 5I8NA 5KSZA 3TUYB 4MN0A 3FIAA 3SG3A 2KI4B 1SCMB 1MUXA 3D0YA 2JOJA 4PE1A 3BOWA 1B8RA 1NX1A 2KI6D 3TS5C 3ZWHA 2LVJA 2PRUA 1Y0VH 2JZIA 1KFXL 1KFUL 1WDCC 2D8NA 5F6TA 3TDUA 3SG6A 1YVLA 1RWYA 3A8RA 1DMOA 3E3RA 1TN4A 1AJ5A 3DVMA 3SIAA 1G33A 1L2OC 1BODA 2BL0C 1F4OA 2EHBA 4PHKA 1OMRA 1SCVA 3EKHA 3PN7B 3KO0A 1DJYA 1U5IB 2JPTA 1TRFA 1QV0A 2LVIA 2EC6C 1FBVA 2VRGA 5HKZA 2R2IA 4R1EA 2L2EA 2BE6A 1BMOA 2M7LA 2KAXA 1JF0A 2LHLA 1G4YR 4L9MA 1YVHA 4NQGA 4C0KA 2KDHA 3NSIA 3CZTX 1Y6WA 1PVAA 1QASA 1CMGA 1M39A 2MBXA 2CT9A 3I5FB 1BJFA 2BCXA 3WHTB 4CPVA 4ETOA 3K21A 1KQMB 2JXLA 4HREE 2L4HA 4MZKA 1IG5A 1S26D 2LM5A 1SR6B 4DCKA 2Y1MA 1K94A 4TNCA 1MQ1A 4HRGA 2JXCA 4CIDA 4N5XA 2HETA 3EK7A 3NSLA 1LKJA 3BUWB 4GGFC 2IS9A 1QIVA 4FTGA 1OQPA 1CKKA 1K9KA 5AXIA 2H2KA 1WRKA 4PCWA 3TDZA 1L2OB 1XFXO 4YI8A 1OOJA 4WRIA 5HLOA 4YGCB 1DF0A 4GPLB 3I5IC 4QJ4B 3CGAA 2JT8A 1S6JA 1WLZA 4ORAB 5BPJA 1ZFSA 3EK4A 2ISDA 1D1OA 4ZCUA 4ORCB 1CM1A 3OX5A 1A75A 3VROA 2K2FA 1J7RA 3BYAA 3KF9A 1XK4C 5DKNA 2HF5A 4PDZA 1H4BA 1TTXA 2LVVA 2QACA 1NCXA 2ZRSA 1R6PA 5CSIA 3SIBA 3M0WA 4F0ZB 1KQMC 1S6IA 1LVCD 2KGBC 2LVKA 2I18A 1NYAA 1K8UA 3I5GC 1SR6C 2ZRTA 3SG5A 1TOPA 5I2OA 3NSOA 1Y1AA 3DD4A 1CLMA 2M9GA 4OVNF 3WHUB 1C7WA 2GGMA 1YRUB 3FS7A 3JTDC 1NPQA 4E68A 4OKHA 1KK7Z 1MR8A 1QLKA 3EVVA 1LINA 3OHMB 2BKIB 2M1KB 2M49B 3LLEA 1JFJA 1FF1A 1KSOA 4NDCA 3BUXB 1DJZA 2OTGC 2JTTA 1SNLA 2LLSA 1CM4A 1QJTA 1UUSA 1BLQA 3TZ1A 2BE4A 1MXEA 2OS8B 1JFKA 1KK7Y 2I7AA 5JOLA 1J7PA 2F33A 1SY9A 1Y1UA 3H4SE 2MLEC 4YGDB 2B1UA 4OR9B 1F8HA 2CXJA 1HQVA 4I5JA 4JWQA 5K89A 1RJVA 1U5IA 3DVKA 1SL9A 2HQ8A 3TDIA 1DF0B 2K0JA 2O5GA 3EKJA 3KEVA 3ICBA 1CDPA 1KK8B 1S3PA 1XYDA 1ZMZA 3PN7C 2WCBA 1NX0A 3C1VA 1EG3A 2K8MB 2EC6B 2AMIA 2K7CA 1RTP1 5KU1A 1DJWA 3SG2A 3O2PA 2KQYA 3SG7A 1QVIZ 2JULA 2P6BB 4A4CA 3D10A 4PE7A 1K9UA 1NX2A 4CFQA 2KI4C 3FWBA 1BT6A 1V1GA 2KOTA 3I5GB 4YGEB 1YUTA 2LNKA 4WQ3A 1JUOA 1QX5B 1SK6D 1WRLA 1WY9A 2JU0A 4BY5A 1K9PA 2GV5A 4XJKB 1IQ5A 2AAOA 3SG4A 1CFPA 1EL4A 1PSBA 4MRYA 4ORBB 1DJXA 4MZJA 1A03A 4C0LA 1CLLA 2V53A 2KYFA 1NX3A 1SL8A 5G08A 1K2HA 3CWGA 3CTNA 1A29A 2EGDA 1YUUA 1CDMA 2KAVA 1XFUO 3AKBA 2L5XB 3BXKA 1R2UA 1S36A 3O78A 4P5OE 1OE9B 1ZOTB 2JQ6A 2LV7A 1SW8A 1OMDA 1Y1XA 3DF0B 2KFGA 5D7FA 4BY4A 3LCPC 3DF0A 5GQQC 3VRQA 2HQWA 1ZACA 1IRJA 4GUKA 2RGIA 5AERA 2FCDA 3O6BA 5IBWA 1CFFA 1CLBA 1IGVA 2BECA 3JVTC 2COLB 3GK2A 2PALA 1ODBA 3EK8A 2LP3A 5DKRA 1SBJA 2BBMA 1B4CA 1FW4A 4GGFA 2L98A 3OB2B 1EH2A 1KWOC 4M2OA 1OZOA 1XFVO 3D0YB 1B8LA 4YI9A 1NIWA 3AAJA 1CB1A 2M7NA 3OB1B 1CTRA 1M63B 2KFFA 1RECA 1AP4A 2E30A 1WLMA 4N1FA 3A4UB 1B47A 5JJGA 5AEQA 2Y4QA 2K61A 5CPVA 2Q91A 1JSAA 5HLVA 1YX7A 2PMYA 2WOSA 2O60A 2Q4UA 2LHIA 4A4BA 1RROA 3VRRA 1WDCB 3VRPA 1TNWA 1DJGA 4P2YB 5HKWA 1DGUA 1PULA 1XVJA 2BL0B 3PM8A 3PSRA 2MHHA 1CDLA 1NWDA 3CS1A 1B8CA 2H61A 2CCMA 2L4IA 1UHIA 3MSEB 4MZLA 4IL1A 4M2PA 2F8PA 2LMVA 2G2BA 3KPXA 2ZKMX 1BOCA 3I5HC 1LA3A 1K96A 4OCIA 1NCZA 3VRNA 2JNXA 1EJ3A 2MJWB 2PASA 1LXFC 1ALVA 5CSFA 1IH0A 1IJ5A 2WC8A 1S6CA 3O4YA 2M1UA 5DKQA 2NLNA 1B7TY 1N0YA 2AUCA 1GQMA 1JWDA 1DGVA 1DJIA 1KWOB 3CR5X 3KHEA 1YTZC 2K7BA 2SASA 3IF7A 1E8AA 2ZFDA 1TNXA 1NUBA 4PE4A 1FI5A 4MLWA 2SCPA 2ZN9A 2ZN8A 2JT0A 1W7JB 1K93D 3IQQA 4I5LB 1M31A 1UHKA 1N2DA 2OTGB 4Q04A 1J55A 2K2AA 2WNDA 1QV1A 1UHHA 5AANA 4XJKA 1H8BA 1MHOA 1UP5A 4GAOA 2OPOA 4ICBA 1MWNA 1J7OA 5AFPA 1DT7B 2LUXA 3NSKA 4JPZB 1ALWA 4PHNA 1XA5A 1MF8B 1SCMC 4QJ5B 2Y5IA 1XK4A 5ER4X 1OSAA 3VGOA 1BU3A 2BCAA 4HRHA 4I5KA 2LLUA 2NXQA 1ZUZA 2KFHA 3I5IB 1AHRA 2BBNA 2PVBA 1BR1B 1TCFA 3CR2A 2KGRA 1KCYA 1IJ6A 1HT9A 2FCEA 2KBIA 3DVEA 1DJHA 3WNXB 1S5GZ 3BUOB 1SKTA 4N1GA 2PSRA 2FOTA 3BUMB 2LMTA 1A4PA 5ER5A 4DIRA 1AUIB 2F2OA 4JQ0D 4GGNA 2I2RE 2LLTA 1QLSA 4AQIA 1YR5A 2F2PA 4YGAA 1Q80A 4FQOA 5FYXA 1GJYA 2KSPA 2LAPA 1KQVA 1WRZA 1OZSA 1QS7A 3BOWB 3IQOA 1KFUS 4MSPA 4C0JA 1AVSA 1SPYA 1AJ4A 2F3YA 2NCPA 2CNPA 1GGWA 2KI6C 1QVIY 4U8DA 1JF2A 1MXLC 1NSHA 1XFYO 1YUSA 1BR4B 1BG1A 2KQ6A 2K7OA 4DS7A 3EVRA 3FWCA 4MRXA 5I2QA 2A4JA 2WCFA 1SL7A 1K95A 5KTYA 1CFDA 3WXAA 1XFZO 4GNKB 2L51A 1F70A 1QATA 5HKYA 2M29A 4D1EA 1JBAA 2M8UA 1UHJA 3RLZA 3CR4X 2JRFA 4XYNA 1J7QA 2LCPA 1L7ZA 1B9AA 2L50A 2OS8C 2M3WA 4PHMA 1SRAA 2MA2A 1QTXA 2GGZA 2DOQA 3NXAA 1A75B 3PLFB 1IKUA 1YURA 3JVTB 2KHNA 1TNPA 3GK4X 4CFRA 3ZNIA 4GFTA 5CSJA 3QRXA 1LA0A 4DRWA 5I2LA 1QXPA 1PK0D 1IWQA 1V1FA 2H61C 3I5FC 2ZNDA 4MBEA 1PRWA 1KK8C 4USLA 3OP0A 5TNCA 3CLNA 2FJUB 3GK1A 3RM1A 1J1EA 2CBLA 2JTZA 2I94A 4ZCVA 3I5HB 1PALA 4PE0A 3SJSA 1KSMA 2E6WA 2LMUA 2LUCA 1VRKA 1C07A 2LP2A 1CFCA 1S1EA 1QX7A 2CTNA 1CMFA 3AAKA 1KFXS 4PHJA 1AK8A 2JWWA 1A2XA 2Y1NA 2LANA 4DUQA 1K90D 1GGZA 2HPSA 2M97A 3HX4A 1BF5A 1XFWO 3PATA 1J1DA 1B1GA 3F45A 3TUYC 1XO5A 2WORA 1IQ3A 3PFVA 4CLNA 4HSZA 4WQ2A 1NCYA 4I5NB 1QIWA 4PALA 1NP8A 1OMVA 2G9BA 4GBAA 4AOMA 3TS5B 5B8IB 1TCOB 1YX8A 2BKHB 3GOFA 2JC2A 4QJ3B 2KYCA 1PSRA 1TNQA 2M0RA 1M46A 1QX2A 2MLFC 2K7DA 3AKAA 4YGBB 1F71A 3JTDB 2F3ZA 2JNFA 2LC5A 1N65A 1CDNA 3LK0A 2KBMA 3BUNB 4M2QA 2KAYA 2TN4A 1CNPA 1DTLA 4MEWA 1F4QA 1YRTB 2BCBA 1F54A 2MAZA 1EXRA 1RK9A 2NCOA 5CSNA 4YRUA 3PALA 1FI6A 2JT3A 3LL8B 1G8IA 1DVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D69 A;  1RFJ A;  1F55 A;  1UHN A;  5PAL A;  1SMG A;  2MRD A;  3DVJ A;  3EVU A;  2WCE A;  1FPW A;  1B7T Z;  4AQJ A;  1EG4 A;  3OX6 A;  1M45 A;  2NZ0 A;  1PVB A;  5J3X A;  1X02 A;  5HYD A;  3BQ3 A;  1C7V A;  4UPG A;  4NDD A;  3LK1 A;  2L0P A;  3HCM A;  1UWO A;  4YBH B;  1S5G Y;  2ZNE A;  1W7I B;  4NDB A;  4OV2 A;  2KNE A;  4MVF A;  1TIZ A;  2QPT A;  2LE9 B;  1JC2 A;  1SYM A;  1UUR A;  5I8N A;  5KSZ A;  3TUY B;  4MN0 A;  3FIA A;  3SG3 A;  2KI4 B;  1SCM B;  1MUX A;  3D0Y A;  2JOJ A;  4PE1 A;  3BOW A;  1B8R A;  1NX1 A;  2KI6 D;  3TS5 C;  3ZWH A;  2LVJ A;  2PRU A;  1Y0V H;  2JZI A;  1KFX L;  1KFU L;  1WDC C;  2D8N A;  5F6T A;  3TDU A;  3SG6 A;  1YVL A;  1RWY A;  3A8R A;  1DMO A;  3E3R A;  1TN4 A;  1AJ5 A;  3DVM A;  3SIA A;  1G33 A;  1L2O C;  1BOD A;  2BL0 C;  1F4O A;  2EHB A;  4PHK A;  1OMR A;  1SCV A;  3EKH A;  3PN7 B;  3KO0 A;  1DJY A;  1U5I B;  2JPT A;  1TRF A;  1QV0 A;  2LVI A;  2EC6 C;  1FBV A;  2VRG A;  5HKZ A;  2R2I A;  4R1E A;  2L2E A;  2BE6 A;  1BMO A;  2M7L A;  2KAX A;  1JF0 A;  2LHL A;  1G4Y R;  4L9M A;  1YVH A;  4NQG A;  4C0K A;  2KDH A;  3NSI A;  3CZT X;  1Y6W A;  1PVA A;  1QAS A;  1CMG A;  1M39 A;  2MBX A;  2CT9 A;  3I5F B;  1BJF A;  2BCX A;  3WHT B;  4CPV A;  4ETO A;  3K21 A;  1KQM B;  2JXL A;  4HRE E;  2L4H A;  4MZK A;  1IG5 A;  1S26 D;  2LM5 A;  1SR6 B;  4DCK A;  2Y1M A;  1K94 A;  4TNC A;  1MQ1 A;  4HRG A;  2JXC A;  4CID A;  4N5X A;  2HET A;  3EK7 A;  3NSL A;  1LKJ A;  3BUW B;  4GGF C;  2IS9 A;  1QIV A;  4FTG A;  1OQP A;  1CKK A;  1K9K A;  5AXI A;  2H2K A;  1WRK A;  4PCW A;  3TDZ A;  1L2O B;  1XFX O;  4YI8 A;  1OOJ A;  4WRI A;  5HLO A;  4YGC B;  1DF0 A;  4GPL B;  3I5I C;  4QJ4 B;  3CGA A;  2JT8 A;  1S6J A;  1WLZ A;  4ORA B;  5BPJ A;  1ZFS A;  3EK4 A;  2ISD A;  1D1O A;  4ZCU A;  4ORC B;  1CM1 A;  3OX5 A;  1A75 A;  3VRO A;  2K2F A;  1J7R A;  3BYA A;  3KF9 A;  1XK4 C;  5DKN A;  2HF5 A;  4PDZ A;  1H4B A;  1TTX A;  2LVV A;  2QAC A;  1NCX A;  2ZRS A;  1R6P A;  5CSI A;  3SIB A;  3M0W A;  4F0Z B;  1KQM C;  1S6I A;  1LVC D;  2KGB C;  2LVK A;  2I18 A;  1NYA A;  1K8U A;  3I5G C;  1SR6 C;  2ZRT A;  3SG5 A;  1TOP A;  5I2O A;  3NSO A;  1Y1A A;  3DD4 A;  1CLM A;  2M9G A;  4OVN F;  3WHU B;  1C7W A;  2GGM A;  1YRU B;  3FS7 A;  3JTD C;  1NPQ A;  4E68 A;  4OKH A;  1KK7 Z;  1MR8 A;  1QLK A;  3EVV A;  1LIN A;  3OHM B;  2BKI B;  2M1K B;  2M49 B;  3LLE A;  1JFJ A;  1FF1 A;  1KSO A;  4NDC A;  3BUX B;  1DJZ A;  2OTG C;  2JTT A;  1SNL A;  2LLS A;  1CM4 A;  1QJT A;  1UUS A;  1BLQ A;  3TZ1 A;  2BE4 A;  1MXE A;  2OS8 B;  1JFK A;  1KK7 Y;  2I7A A;  5JOL A;  1J7P A;  2F33 A;  1SY9 A;  1Y1U A;  3H4S E;  2MLE C;  4YGD B;  2B1U A;  4OR9 B;  1F8H A;  2CXJ A;  1HQV A;  4I5J A;  4JWQ A;  5K89 A;  1RJV A;  1U5I A;  3DVK A;  1SL9 A;  2HQ8 A;  3TDI A;  1DF0 B;  2K0J A;  2O5G A;  3EKJ A;  3KEV A;  3ICB A;  1CDP A;  1KK8 B;  1S3P A;  1XYD A;  1ZMZ A;  3PN7 C;  2WCB A;  1NX0 A;  3C1V A;  1EG3 A;  2K8M B;  2EC6 B;  2AMI A;  2K7C A;  1RTP 1;  5KU1 A;  1DJW A;  3SG2 A;  3O2P A;  2KQY A;  3SG7 A;  1QVI Z;  2JUL A;  2P6B B;  4A4C A;  3D10 A;  4PE7 A;  1K9U A;  1NX2 A;  4CFQ A;  2KI4 C;  3FWB A;  1BT6 A;  1V1G A;  2KOT A;  3I5G B;  4YGE B;  1YUT A;  2LNK A;  4WQ3 A;  1JUO A;  1QX5 B;  1SK6 D;  1WRL A;  1WY9 A;  2JU0 A;  4BY5 A;  1K9P A;  2GV5 A;  4XJK B;  1IQ5 A;  2AAO A;  3SG4 A;  1CFP A;  1EL4 A;  1PSB A;  4MRY A;  4ORB B;  1DJX A;  4MZJ A;  1A03 A;  4C0L A;  1CLL A;  2V53 A;  2KYF A;  1NX3 A;  1SL8 A;  5G08 A;  1K2H A;  3CWG A;  3CTN A;  1A29 A;  2EGD A;  1YUU A;  1CDM A;  2KAV A;  1XFU O;  3AKB A;  2L5X B;  3BXK A;  1R2U A;  1S36 A;  3O78 A;  4P5O E;  1OE9 B;  1ZOT B;  2JQ6 A;  2LV7 A;  1SW8 A;  1OMD A;  1Y1X A;  3DF0 B;  2KFG A;  5D7F A;  4BY4 A;  3LCP C;  3DF0 A;  5GQQ C;  3VRQ A;  2HQW A;  1ZAC A;  1IRJ A;  4GUK A;  2RGI A;  5AER A;  2FCD A;  3O6B A;  5IBW A;  1CFF A;  1CLB A;  1IGV A;  2BEC A;  3JVT C;  2COL B;  3GK2 A;  2PAL A;  1ODB A;  3EK8 A;  2LP3 A;  5DKR A;  1SBJ A;  2BBM A;  1B4C A;  1FW4 A;  4GGF A;  2L98 A;  3OB2 B;  1EH2 A;  1KWO C;  4M2O A;  1OZO A;  1XFV O;  3D0Y B;  1B8L A;  4YI9 A;  1NIW A;  3AAJ A;  1CB1 A;  2M7N A;  3OB1 B;  1CTR A;  1M63 B;  2KFF A;  1REC A;  1AP4 A;  2E30 A;  1WLM A;  4N1F A;  3A4U B;  1B47 A;  5JJG A;  5AEQ A;  2Y4Q A;  2K61 A;  5CPV A;  2Q91 A;  1JSA A;  5HLV A;  1YX7 A;  2PMY A;  2WOS A;  2O60 A;  2Q4U A;  2LHI A;  4A4B A;  1RRO A;  3VRR A;  1WDC B;  3VRP A;  1TNW A;  1DJG A;  4P2Y B;  5HKW A;  1DGU A;  1PUL A;  1XVJ A;  2BL0 B;  3PM8 A;  3PSR A;  2MHH A;  1CDL A;  1NWD A;  3CS1 A;  1B8C A;  2H61 A;  2CCM A;  2L4I A;  1UHI A;  3MSE B;  4MZL A;  4IL1 A;  4M2P A;  2F8P A;  2LMV A;  2G2B A;  3KPX A;  2ZKM X;  1BOC A;  3I5H C;  1LA3 A;  1K96 A;  4OCI A;  1NCZ A;  3VRN A;  2JNX A;  1EJ3 A;  2MJW B;  2PAS A;  1LXF C;  1ALV A;  5CSF A;  1IH0 A;  1IJ5 A;  2WC8 A;  1S6C A;  3O4Y A;  2M1U A;  5DKQ A;  2NLN A;  1B7T Y;  1N0Y A;  2AUC A;  1GQM A;  1JWD A;  1DGV A;  1DJI A;  1KWO B;  3CR5 X;  3KHE A;  1YTZ C;  2K7B A;  2SAS A;  3IF7 A;  1E8A A;  2ZFD A;  1TNX A;  1NUB A;  4PE4 A;  1FI5 A;  4MLW A;  2SCP A;  2ZN9 A;  2ZN8 A;  2JT0 A;  1W7J B;  1K93 D;  3IQQ A;  4I5L B;  1M31 A;  1UHK A;  1N2D A;  2OTG B;  4Q04 A;  1J55 A;  2K2A A;  2WND A;  1QV1 A;  1UHH A;  5AAN A;  4XJK A;  1H8B A;  1MHO A;  1UP5 A;  4GAO A;  2OPO A;  4ICB A;  1MWN A;  1J7O A;  5AFP A;  1DT7 B;  2LUX A;  3NSK A;  4JPZ B;  1ALW A;  4PHN A;  1XA5 A;  1MF8 B;  1SCM C;  4QJ5 B;  2Y5I A;  1XK4 A;  5ER4 X;  1OSA A;  3VGO A;  1BU3 A;  2BCA A;  4HRH A;  4I5K A;  2LLU A;  2NXQ A;  1ZUZ A;  2KFH A;  3I5I B;  1AHR A;  2BBN A;  2PVB A;  1BR1 B;  1TCF A;  3CR2 A;  2KGR A;  1KCY A;  1IJ6 A;  1HT9 A;  2FCE A;  2KBI A;  3DVE A;  1DJH A;  3WNX B;  1S5G Z;  3BUO B;  1SKT A;  4N1G A;  2PSR A;  2FOT A;  3BUM B;  2LMT A;  1A4P A;  5ER5 A;  4DIR A;  1AUI B;  2F2O A;  4JQ0 D;  4GGN A;  2I2R E;  2LLT A;  1QLS A;  4AQI A;  1YR5 A;  2F2P A;  4YGA A;  1Q80 A;  4FQO A;  5FYX A;  1GJY A;  2KSP A;  2LAP A;  1KQV A;  1WRZ A;  1OZS A;  1QS7 A;  3BOW B;  3IQO A;  1KFU S;  4MSP A;  4C0J A;  1AVS A;  1SPY A;  1AJ4 A;  2F3Y A;  2NCP A;  2CNP A;  1GGW A;  2KI6 C;  1QVI Y;  4U8D A;  1JF2 A;  1MXL C;  1NSH A;  1XFY O;  1YUS A;  1BR4 B;  1BG1 A;  2KQ6 A;  2K7O A;  4DS7 A;  3EVR A;  3FWC A;  4MRX A;  5I2Q A;  2A4J A;  2WCF A;  1SL7 A;  1K95 A;  5KTY A;  1CFD A;  3WXA A;  1XFZ O;  4GNK B;  2L51 A;  1F70 A;  1QAT A;  5HKY A;  2M29 A;  4D1E A;  1JBA A;  2M8U A;  1UHJ A;  3RLZ A;  3CR4 X;  2JRF A;  4XYN A;  1J7Q A;  2LCP A;  1L7Z A;  1B9A A;  2L50 A;  2OS8 C;  2M3W A;  4PHM A;  1SRA A;  2MA2 A;  1QTX A;  2GGZ A;  2DOQ A;  3NXA A;  1A75 B;  3PLF B;  1IKU A;  1YUR A;  3JVT B;  2KHN A;  1TNP A;  3GK4 X;  4CFR A;  3ZNI A;  4GFT A;  5CSJ A;  3QRX A;  1LA0 A;  4DRW A;  5I2L A;  1QXP A;  1PK0 D;  1IWQ A;  1V1F A;  2H61 C;  3I5F C;  2ZND A;  4MBE A;  1PRW A;  1KK8 C;  4USL A;  3OP0 A;  5TNC A;  3CLN A;  2FJU B;  3GK1 A;  3RM1 A;  1J1E A;  2CBL A;  2JTZ A;  2I94 A;  4ZCV A;  3I5H B;  1PAL A;  4PE0 A;  3SJS A;  1KSM A;  2E6W A;  2LMU A;  2LUC A;  1VRK A;  1C07 A;  2LP2 A;  1CFC A;  1S1E A;  1QX7 A;  2CTN A;  1CMF A;  3AAK A;  1KFX S;  4PHJ A;  1AK8 A;  2JWW A;  1A2X A;  2Y1N A;  2LAN A;  4DUQ A;  1K90 D;  1GGZ A;  2HPS A;  2M97 A;  3HX4 A;  1BF5 A;  1XFW O;  3PAT A;  1J1D A;  1B1G A;  3F45 A;  3TUY C;  1XO5 A;  2WOR A;  1IQ3 A;  3PFV A;  4CLN A;  4HSZ A;  4WQ2 A;  1NCY A;  4I5N B;  1QIW A;  4PAL A;  1NP8 A;  1OMV A;  2G9B A;  4GBA A;  4AOM A;  3TS5 B;  5B8I B;  1TCO B;  1YX8 A;  2BKH B;  3GOF A;  2JC2 A;  4QJ3 B;  2KYC A;  1PSR A;  1TNQ A;  2M0R A;  1M46 A;  1QX2 A;  2MLF C;  2K7D A;  3AKA A;  4YGB B;  1F71 A;  3JTD B;  2F3Z A;  2JNF A;  2LC5 A;  1N65 A;  1CDN A;  3LK0 A;  2KBM A;  3BUN B;  4M2Q A;  2KAY A;  2TN4 A;  1CNP A;  1DTL A;  4MEW A;  1F4Q A;  1YRT B;  2BCB A;  1F54 A;  2MAZ A;  1EXR A;  1RK9 A;  2NCO A;  5CSN A;  4YRU A;  3PAL A;  1FI6 A;  2JT3 A;  3LL8 B;  1G8I A;  1DVI A; 
#chains in the Genus database with same CATH topology
 5D69 A;  1RFJ A;  1F55 A;  1UHN A;  5PAL A;  1SMG A;  2MRD A;  3DVJ A;  3EVU A;  2WCE A;  1FPW A;  1B7T Z;  5I94 A;  4AQJ A;  1EG4 A;  3OX6 A;  1M45 A;  2NZ0 A;  1PVB A;  5J3X A;  1X02 A;  5HYD A;  3BQ3 A;  1C7V A;  4UPG A;  4NDD A;  3LK1 A;  2L0P A;  2KLE A;  2QDI A;  3HCM A;  1UWO A;  4YBH B;  1S5G Y;  2ZNE A;  1W7I B;  4NDB A;  4OV2 A;  3S0D A;  2KNE A;  3D78 A;  4MVF A;  1DEK A;  1TIZ A;  2QPT A;  2LE9 B;  1JC2 A;  1SYM A;  1UUR A;  5I8N A;  5KSZ A;  3TUY B;  2PQL A;  4MN0 A;  1DEL A;  3FIA A;  2KI4 B;  1SCM B;  3SG3 A;  1MUX A;  3K1E A;  3D0Y A;  2JOJ A;  4PE1 A;  3BOW A;  1B8R A;  1NX1 A;  2KI6 D;  3TS5 C;  3B7A A;  3ZWH A;  2LVJ A;  2PRU A;  4F7F A;  1Y0V H;  2JZI A;  1KFX L;  1KFU L;  1WDC C;  2D8N A;  5F6T A;  3TDU A;  2WCJ A;  3SG6 A;  1YVL A;  1RWY A;  3A8R A;  1DMO A;  3E3R A;  1TN4 A;  1AJ5 A;  3DVM A;  3SIA A;  1G33 A;  1L2O C;  1BOD A;  2BL0 C;  1F4O A;  2EHB A;  4PHK A;  1OMR A;  1SCV A;  3EKH A;  3PN7 B;  3DYE A;  5D3O A;  3KO0 A;  1DJY A;  1U5I B;  2JPT A;  1TRF A;  1QV0 A;  2LVI A;  2EC6 C;  3S0E A;  1FBV A;  2VRG A;  5HKZ A;  2R2I A;  4R1E A;  2L2E A;  2BE6 A;  1BMO A;  2WC5 A;  3FE8 A;  2M7L A;  2KAX A;  4JKT A;  1JF0 A;  2LHL A;  2YGU A;  1G4Y R;  4L9M A;  1YVH A;  4NQG A;  3CZ2 A;  3FE6 A;  2FJY A;  4C0K A;  2KDH A;  3NSI A;  3CZT X;  1Y6W A;  1PVA A;  1QAS A;  1CMG A;  1M39 A;  2MBX A;  2CT9 A;  3I5F B;  1BJF A;  2BCX A;  2K60 A;  3WHT B;  4CPV A;  4ETO A;  3K21 A;  1KQM B;  2JXL A;  3BFA A;  4HRE E;  2L4H A;  1DC1 A;  4MZK A;  2PYQ A;  3CAB A;  1IG5 A;  1S26 D;  2LM5 A;  1SR6 B;  4DCK A;  2Y1M A;  1K94 A;  4TNC A;  2L5Y A;  1MQ1 A;  4HRG A;  2JXC A;  4OZD A;  4CID A;  3SS5 A;  4N5X A;  3R1O A;  3NHI A;  2HET A;  3EK7 A;  3NSL A;  1LKJ A;  3BUW B;  4GGF C;  2IS9 A;  1QIV A;  4FTG A;  4JD9 A;  1OQP A;  1CKK A;  1K9K A;  5AXI A;  1DQE A;  2H2K A;  1WRK A;  4PCW A;  3TDZ A;  1L2O B;  1XFX O;  4YI8 A;  1OOJ A;  4WRI A;  4INW A;  3R1V A;  5HLO A;  4YGC B;  1DF0 A;  4GPL B;  3I5I C;  4QJ4 B;  3CGA A;  1GM0 A;  2JT8 A;  1S6J A;  1WLZ A;  4ORA B;  5BPJ A;  1ZFS A;  2WCK A;  3VB1 A;  3EK4 A;  2ISD A;  1D1O A;  4ZCU A;  4ORC B;  1CM1 A;  3BJH A;  3OX5 A;  1A75 A;  2P71 A;  3VRO A;  1CFF A;  2K2F A;  1J7R A;  3BYA A;  3KF9 A;  1XK4 C;  5DKN A;  2HF5 A;  4PDZ A;  1H4B A;  1TTX A;  1Z4H A;  1T14 A;  2LVV A;  1C3Z A;  2QAC A;  1NCX A;  2ZRS A;  1R6P A;  5CSI A;  3SIB A;  3M0W A;  4F0Z B;  1KQM C;  1S6I A;  3NHT A;  1LVC D;  2KGB C;  2LVK A;  2I18 A;  1NYA A;  1K8U A;  3I5G C;  1SR6 C;  2ZRT A;  3SG5 A;  1TOP A;  5I2O A;  3NSO A;  1Y1A A;  3DD4 A;  3OGN A;  1CLM A;  2M9G A;  4OVN F;  3EG5 B;  3WHU B;  1C7W A;  2GGM A;  1YRU B;  3FS7 A;  3JTD C;  1NPQ A;  4E68 A;  4OKH A;  1OOI X;  1KK7 Z;  1MR8 A;  1QLK A;  3EVV A;  1XFR A;  1LIN A;  3OHM B;  2BKI B;  2M1K B;  2M49 B;  3LLE A;  1JFJ A;  1FF1 A;  1KSO A;  4NDC A;  5HL1 A;  3BUX B;  1DJZ A;  2OTG C;  2JTT A;  1SNL A;  2LLS A;  1CM4 A;  1QJT A;  1UUS A;  1BLQ A;  2H8V A;  3TZ1 A;  2BE4 A;  1MXE A;  2OS8 B;  1JFK A;  1KK7 Y;  2I7A A;  5JOL A;  1J7P A;  2F33 A;  1SY9 A;  1Y1U A;  3H4S E;  2MLE C;  1TUZ A;  2B1U A;  4OR9 B;  4YGD B;  1F8H A;  2CXJ A;  1HQV A;  4I5J A;  4JWQ A;  5K89 A;  1RJV A;  1U5I A;  3DVK A;  1SL9 A;  2HQ8 A;  3TDI A;  1DF0 B;  2K0J A;  2O5G A;  3D75 A;  3EKJ A;  3ICB A;  3KEV A;  1CDP A;  1KK8 B;  1S3P A;  5DIC A;  1XYD A;  1ZMZ A;  3FE9 A;  3PN7 C;  2WCB A;  1NX0 A;  3C1V A;  1EG3 A;  2K8M B;  2EC6 B;  3R1P A;  2AMI A;  2K7C A;  3DY9 A;  1RTP 1;  5KU1 A;  2BNX A;  1DJW A;  3SG2 A;  3O2P A;  2KQY A;  3SG7 A;  1QVI Z;  2JUL A;  2P6B B;  4A4C A;  3D10 A;  4PE7 A;  1K9U A;  1NX2 A;  4CFQ A;  2KI4 C;  3D76 A;  3N7H A;  3FWB A;  2WC6 A;  1BT6 A;  1V1G A;  2KOT A;  3I5G B;  4YGE B;  1YUT A;  2WCH A;  2LNK A;  4WQ3 A;  1JUO A;  1QX5 B;  1SK6 D;  1WRL A;  1WY9 A;  3DXL A;  2JU0 A;  4BY5 A;  1K9P A;  2GV5 A;  4XJK B;  1IQ5 A;  2AAO A;  3SG4 A;  1CFP A;  1EL4 A;  1PSB A;  4MRY A;  4ORB B;  1DJX A;  4MZJ A;  1A03 A;  4C0L A;  1CLL A;  2V53 A;  2KYF A;  1NX3 A;  1SL8 A;  5G08 A;  1K2H A;  3CWG A;  3CTN A;  1A29 A;  2EGD A;  3CDN A;  1YUU A;  1CDM A;  2KAV A;  3BFH A;  1XFU O;  3L47 A;  3AKB A;  2L5X B;  3BXK A;  1R2U A;  1S36 A;  3O78 A;  4P5O E;  1OE9 B;  1ZOT B;  2JQ6 A;  2LV7 A;  3OBV A;  1SW8 A;  1OMD A;  1Y1X A;  3DF0 B;  2KFG A;  5D7F A;  4BY4 A;  3CZ1 A;  4KYN A;  3LCP C;  3DF0 A;  5FI2 A;  1LS8 A;  5GQQ C;  3VRQ A;  1IRJ A;  1ZAC A;  2HQW A;  4GUK A;  2RGI A;  3UNW A;  2FCD A;  3O6B A;  5AER A;  5IBW A;  1CLB A;  1IGV A;  2BEC A;  3L4A A;  3JVT C;  2COL B;  3GK2 A;  2PAL A;  1ODB A;  3EK8 A;  2LP3 A;  5DKR A;  1SBJ A;  2BBM A;  3S0A A;  1B4C A;  1FW4 A;  4GGF A;  2L98 A;  3OB2 B;  1EH2 A;  1KWO C;  4M2O A;  1OZO A;  1XFV O;  3D0Y B;  2WCL A;  1B8L A;  4YI9 A;  1C3Y A;  1NIW A;  3AAJ A;  1CB1 A;  2M7N A;  3OB1 B;  1CTR A;  1M63 B;  2KFF A;  1REC A;  1AP4 A;  2E30 A;  1WLM A;  4N1F A;  3A4U B;  1B47 A;  5JJG A;  5AEQ A;  3D74 A;  3B6X A;  2Y4Q A;  2K61 A;  5CPV A;  2Q91 A;  3SS4 A;  5HLV A;  1JSA A;  3SS3 A;  1YX7 A;  4IJ7 A;  1IIO A;  2PMY A;  2WOS A;  2O60 A;  2Q4U A;  4PT1 A;  2LHI A;  4A4B A;  1RRO A;  3VRR A;  1WDC B;  3VRP A;  1TNW A;  1DJG A;  5EL2 A;  4P2Y B;  2BAP A;  5HKW A;  1DGU A;  1OW4 A;  1PUL A;  1XVJ A;  2BL0 B;  3PM8 A;  3PSR A;  2L2C A;  2MHH A;  1CDL A;  1NWD A;  3CS1 A;  1B8C A;  2H61 A;  2CCM A;  2L4I A;  1UHI A;  3MSE B;  4MZL A;  4IL1 A;  4M2P A;  2F8P A;  2LMV A;  2G2B A;  3KPX A;  2ZKM X;  3S0F A;  3I5H C;  1BOC A;  1LA3 A;  1K96 A;  4OCI A;  1NCZ A;  3VRN A;  2JNX A;  1EJ3 A;  2MJW B;  2PAS A;  1LXF C;  1ALV A;  3UO9 A;  5CSF A;  3RZS A;  1IH0 A;  1IJ5 A;  2WC8 A;  1S6C A;  3O4Y A;  2M1U A;  3BFB A;  1W9Z A;  2KPH A;  5DKQ A;  2NLN A;  1B7T Y;  1N0Y A;  2AUC A;  2WCM A;  5FI7 A;  1GQM A;  3CZ0 A;  1JWD A;  1DGV A;  1DJI A;  1KWO B;  3CR5 X;  3KHE A;  4FQT A;  1YTZ C;  2K7B A;  2SAS A;  3IF7 A;  1E8A A;  2ZFD A;  1TNX A;  1NUB A;  3L4L A;  4PE4 A;  1FI5 A;  3CYZ A;  4MLW A;  2KLD A;  2SCP A;  2ZN9 A;  2ZN8 A;  2JT0 A;  1W7J B;  1K93 D;  3B86 A;  3IQQ A;  4I5L B;  1M31 A;  1UHK A;  1N2D A;  2OTG B;  3NGV A;  4Q04 A;  3S0B A;  1J55 A;  2K2A A;  2WND A;  1QV1 A;  1UHH A;  5AAN A;  4XJK A;  1H8B A;  1MHO A;  1UP5 A;  4GAO A;  2OPO A;  4ICB A;  1MWN A;  1J7O A;  5AFP A;  1DT7 B;  2LUX A;  3NSK A;  4JPZ B;  1ALW A;  4INX A;  4PHN A;  1XA5 A;  1MF8 B;  1SCM C;  4QJ5 B;  2Y5I A;  1XK4 A;  2JPO A;  5ER4 X;  1OSA A;  3VGO A;  1BU3 A;  2BCA A;  4HRH A;  3S0G A;  4I5K A;  2LLU A;  2NXQ A;  1ZUZ A;  2KFH A;  3I5I B;  1AHR A;  2BBN A;  1TUJ A;  2PVB A;  3IVT A;  1BR1 B;  1TCF A;  3CR2 A;  2KGR A;  1KCY A;  1IJ6 A;  1HT9 A;  2P70 A;  2FCE A;  1ORG A;  2KBI A;  3DVE A;  2QEO A;  1DJH A;  3WNX B;  1S5G Z;  3BUO B;  1SKT A;  4N1G A;  2PSR A;  1P28 A;  1OOF A;  2FOT A;  3BUM B;  2GTE A;  2LMT A;  1A4P A;  5ER5 A;  3B87 A;  4DIR A;  1AUI B;  2F2O A;  4JQ0 D;  4GGN A;  2I2R E;  2QEV A;  2LLT A;  1QLS A;  4AQI A;  1YR5 A;  2F2P A;  4YGA A;  1Q80 A;  4FQO A;  5FYX A;  1GJY A;  2KSP A;  2LAP A;  1KQV A;  1WRZ A;  3B88 A;  3QME A;  1OZS A;  1QS7 A;  3BOW B;  3IQO A;  1KFU S;  4MSP A;  4C0J A;  1AVS A;  1SPY A;  1AJ4 A;  2F3Y A;  2NCP A;  2CNP A;  2ERB A;  1GGW A;  2KI6 C;  1QVI Y;  4U8D A;  1JF2 A;  1MXL C;  1NSH A;  1XFY O;  1YUS A;  1BR4 B;  1BG1 A;  2KQ6 A;  2K7O A;  4DS7 A;  3EVR A;  3FWC A;  4MRX A;  5I2Q A;  2A4J A;  2WCF A;  1SL7 A;  1K95 A;  5KTY A;  1CFD A;  3WXA A;  1XFZ O;  4GNK B;  2L51 A;  1F70 A;  1QAT A;  5HKY A;  2M29 A;  4D1E A;  1JBA A;  2M8U A;  1UHJ A;  3RLZ A;  3CR4 X;  2JRF A;  3R72 A;  4XYN A;  1J7Q A;  2LCP A;  1L7Z A;  1B9A A;  2L50 A;  2OS8 C;  2M3W A;  4PHM A;  1QWV A;  1SRA A;  2MA2 A;  1QTX A;  2GGZ A;  2DOQ A;  3NXA A;  1A75 B;  3PLF B;  1IKU A;  1YUR A;  3JVT B;  2KHN A;  3PM2 A;  1TNP A;  3GK4 X;  4CFR A;  3ZNI A;  4GFT A;  5CSJ A;  3QRX A;  1LA0 A;  4DRW A;  5I2L A;  1QXP A;  5FI6 A;  1PK0 D;  3Q8I A;  1IWQ A;  1V1F A;  2H61 C;  3I5F C;  2ZND A;  4MBE A;  1PRW A;  1KK8 C;  4USL A;  2QEH A;  3OP0 A;  5TNC A;  3CLN A;  2FJU B;  3GK1 A;  3RM1 A;  1J1E A;  2CBL A;  2JTZ A;  2I94 A;  4ZCV A;  3I5H B;  1PAL A;  4PE0 A;  3SJS A;  1KSM A;  2E6W A;  2LMU A;  2LUC A;  1VRK A;  1C07 A;  2LP2 A;  1CFC A;  1S1E A;  1QX7 A;  2CTN A;  1CMF A;  3AAK A;  1KFX S;  4PHJ A;  1AK8 A;  2JWW A;  1A2X A;  2Y1N A;  2LAN A;  4DUQ A;  1K90 D;  1GGZ A;  2HPS A;  2M97 A;  3HX4 A;  3PJI A;  1BF5 A;  1XFW O;  3PAT A;  3V2L A;  1J1D A;  1B1G A;  3F45 A;  3TUY C;  1XO5 A;  2WOR A;  1IQ3 A;  3PFV A;  3D77 A;  3O4X A;  4CLN A;  4HSZ A;  1TWO A;  1SSE B;  1Z2C B;  1NCY A;  4I5N B;  1QIW A;  4PAL A;  4WQ2 A;  1NP8 A;  1OMV A;  2G9B A;  4GBA A;  4AOM A;  3TS5 B;  5B8I B;  1TCO B;  1YX8 A;  2BKH B;  3GOF A;  2JC2 A;  4QJ3 B;  2KYC A;  1PSR A;  2QEB A;  1TNQ A;  2M0R A;  1M46 A;  1QX2 A;  2MLF C;  2K7D A;  3AKA A;  4YGB B;  1F71 A;  3JTD B;  2F3Z A;  2JNF A;  2LC5 A;  1N65 A;  1CDN A;  3LK0 A;  2KBM A;  3BUN B;  3DZT A;  4M2Q A;  2KAY A;  2TN4 A;  1CNP A;  1DTL A;  4MEW A;  1OOG A;  1F4Q A;  1YRT B;  2BCB A;  1F54 A;  1OOH A;  2MAZ A;  1EXR A;  1RK9 A;  2NCO A;  5CSN A;  4YRU A;  3PAL A;  3D73 A;  2JT3 A;  1FI6 A;  3LL8 B;  1G8I A;  1DVI A; 
#chains in the Genus database with same CATH homology
 5D69 A;  1RFJ A;  1F55 A;  1UHN A;  5PAL A;  1SMG A;  2MRD A;  3DVJ A;  3EVU A;  2WCE A;  1FPW A;  1B7T Z;  4AQJ A;  1EG4 A;  3OX6 A;  1M45 A;  2NZ0 A;  1PVB A;  5J3X A;  1X02 A;  5HYD A;  3BQ3 A;  1C7V A;  4UPG A;  4NDD A;  3LK1 A;  2L0P A;  3HCM A;  1UWO A;  4YBH B;  1S5G Y;  2ZNE A;  1W7I B;  4NDB A;  4OV2 A;  2KNE A;  4MVF A;  1TIZ A;  2QPT A;  2LE9 B;  1JC2 A;  1SYM A;  1UUR A;  5I8N A;  5KSZ A;  3TUY B;  4MN0 A;  3FIA A;  3SG3 A;  2KI4 B;  1SCM B;  1MUX A;  3D0Y A;  2JOJ A;  4PE1 A;  3BOW A;  1B8R A;  1NX1 A;  2KI6 D;  3TS5 C;  3ZWH A;  2LVJ A;  2PRU A;  1Y0V H;  2JZI A;  1KFX L;  1KFU L;  1WDC C;  2D8N A;  5F6T A;  3TDU A;  3SG6 A;  1YVL A;  1RWY A;  3A8R A;  1DMO A;  3E3R A;  1TN4 A;  1AJ5 A;  3DVM A;  3SIA A;  1G33 A;  1L2O C;  1BOD A;  2BL0 C;  1F4O A;  2EHB A;  4PHK A;  1OMR A;  1SCV A;  3EKH A;  3PN7 B;  3KO0 A;  1DJY A;  1U5I B;  2JPT A;  1TRF A;  1QV0 A;  2LVI A;  2EC6 C;  1FBV A;  2VRG A;  5HKZ A;  2R2I A;  4R1E A;  2L2E A;  2BE6 A;  1BMO A;  2M7L A;  2KAX A;  1JF0 A;  2LHL A;  1G4Y R;  4L9M A;  1YVH A;  4NQG A;  4C0K A;  2KDH A;  3NSI A;  3CZT X;  1Y6W A;  1PVA A;  1QAS A;  1CMG A;  1M39 A;  2MBX A;  2CT9 A;  3I5F B;  1BJF A;  2BCX A;  3WHT B;  4CPV A;  4ETO A;  3K21 A;  1KQM B;  2JXL A;  4HRE E;  2L4H A;  4MZK A;  1IG5 A;  1S26 D;  2LM5 A;  1SR6 B;  4DCK A;  2Y1M A;  1K94 A;  4TNC A;  1MQ1 A;  4HRG A;  2JXC A;  4CID A;  4N5X A;  2HET A;  3EK7 A;  3NSL A;  1LKJ A;  3BUW B;  4GGF C;  2IS9 A;  1QIV A;  4FTG A;  1OQP A;  1CKK A;  1K9K A;  5AXI A;  2H2K A;  1WRK A;  4PCW A;  3TDZ A;  1L2O B;  1XFX O;  4YI8 A;  1OOJ A;  4WRI A;  5HLO A;  4YGC B;  1DF0 A;  4GPL B;  3I5I C;  4QJ4 B;  3CGA A;  2JT8 A;  1S6J A;  1WLZ A;  4ORA B;  5BPJ A;  1ZFS A;  3EK4 A;  2ISD A;  1D1O A;  4ZCU A;  4ORC B;  1CM1 A;  3OX5 A;  1A75 A;  3VRO A;  2K2F A;  1J7R A;  3BYA A;  3KF9 A;  1XK4 C;  5DKN A;  2HF5 A;  4PDZ A;  1H4B A;  1TTX A;  2LVV A;  2QAC A;  1NCX A;  2ZRS A;  1R6P A;  5CSI A;  3SIB A;  3M0W A;  4F0Z B;  1KQM C;  1S6I A;  1LVC D;  2KGB C;  2LVK A;  2I18 A;  1NYA A;  1K8U A;  3I5G C;  1SR6 C;  2ZRT A;  3SG5 A;  1TOP A;  5I2O A;  3NSO A;  1Y1A A;  3DD4 A;  1CLM A;  2M9G A;  4OVN F;  3WHU B;  1C7W A;  2GGM A;  1YRU B;  3FS7 A;  3JTD C;  1NPQ A;  4E68 A;  4OKH A;  1KK7 Z;  1MR8 A;  1QLK A;  3EVV A;  1LIN A;  3OHM B;  2BKI B;  2M1K B;  2M49 B;  3LLE A;  1JFJ A;  1FF1 A;  1KSO A;  4NDC A;  3BUX B;  1DJZ A;  2OTG C;  2JTT A;  1SNL A;  2LLS A;  1CM4 A;  1QJT A;  1UUS A;  1BLQ A;  3TZ1 A;  2BE4 A;  1MXE A;  2OS8 B;  1JFK A;  1KK7 Y;  2I7A A;  5JOL A;  1J7P A;  2F33 A;  1SY9 A;  1Y1U A;  3H4S E;  2MLE C;  4YGD B;  2B1U A;  4OR9 B;  1F8H A;  2CXJ A;  1HQV A;  4I5J A;  4JWQ A;  5K89 A;  1RJV A;  1U5I A;  3DVK A;  1SL9 A;  2HQ8 A;  3TDI A;  1DF0 B;  2K0J A;  2O5G A;  3EKJ A;  3KEV A;  3ICB A;  1CDP A;  1KK8 B;  1S3P A;  1XYD A;  1ZMZ A;  3PN7 C;  2WCB A;  1NX0 A;  3C1V A;  1EG3 A;  2K8M B;  2EC6 B;  2AMI A;  2K7C A;  1RTP 1;  5KU1 A;  1DJW A;  3SG2 A;  3O2P A;  2KQY A;  3SG7 A;  1QVI Z;  2JUL A;  2P6B B;  4A4C A;  3D10 A;  4PE7 A;  1K9U A;  1NX2 A;  4CFQ A;  2KI4 C;  3FWB A;  1BT6 A;  1V1G A;  2KOT A;  3I5G B;  4YGE B;  1YUT A;  2LNK A;  4WQ3 A;  1JUO A;  1QX5 B;  1SK6 D;  1WRL A;  1WY9 A;  2JU0 A;  4BY5 A;  1K9P A;  2GV5 A;  4XJK B;  1IQ5 A;  2AAO A;  3SG4 A;  1CFP A;  1EL4 A;  1PSB A;  4MRY A;  4ORB B;  1DJX A;  4MZJ A;  1A03 A;  4C0L A;  1CLL A;  2V53 A;  2KYF A;  1NX3 A;  1SL8 A;  5G08 A;  1K2H A;  3CWG A;  3CTN A;  1A29 A;  2EGD A;  1YUU A;  1CDM A;  2KAV A;  1XFU O;  3AKB A;  2L5X B;  3BXK A;  1R2U A;  1S36 A;  3O78 A;  4P5O E;  1OE9 B;  1ZOT B;  2JQ6 A;  2LV7 A;  1SW8 A;  1OMD A;  1Y1X A;  3DF0 B;  2KFG A;  5D7F A;  4BY4 A;  3LCP C;  3DF0 A;  5GQQ C;  3VRQ A;  2HQW A;  1ZAC A;  1IRJ A;  4GUK A;  2RGI A;  5AER A;  2FCD A;  3O6B A;  5IBW A;  1CFF A;  1CLB A;  1IGV A;  2BEC A;  3JVT C;  2COL B;  3GK2 A;  2PAL A;  1ODB A;  3EK8 A;  2LP3 A;  5DKR A;  1SBJ A;  2BBM A;  1B4C A;  1FW4 A;  4GGF A;  2L98 A;  3OB2 B;  1EH2 A;  1KWO C;  4M2O A;  1OZO A;  1XFV O;  3D0Y B;  1B8L A;  4YI9 A;  1NIW A;  3AAJ A;  1CB1 A;  2M7N A;  3OB1 B;  1CTR A;  1M63 B;  2KFF A;  1REC A;  1AP4 A;  2E30 A;  1WLM A;  4N1F A;  3A4U B;  1B47 A;  5JJG A;  5AEQ A;  2Y4Q A;  2K61 A;  5CPV A;  2Q91 A;  1JSA A;  5HLV A;  1YX7 A;  2PMY A;  2WOS A;  2O60 A;  2Q4U A;  2LHI A;  4A4B A;  1RRO A;  3VRR A;  1WDC B;  3VRP A;  1TNW A;  1DJG A;  4P2Y B;  5HKW A;  1DGU A;  1PUL A;  1XVJ A;  2BL0 B;  3PM8 A;  3PSR A;  2MHH A;  1CDL A;  1NWD A;  3CS1 A;  1B8C A;  2H61 A;  2CCM A;  2L4I A;  1UHI A;  3MSE B;  4MZL A;  4IL1 A;  4M2P A;  2F8P A;  2LMV A;  2G2B A;  3KPX A;  2ZKM X;  1BOC A;  3I5H C;  1LA3 A;  1K96 A;  4OCI A;  1NCZ A;  3VRN A;  2JNX A;  1EJ3 A;  2MJW B;  2PAS A;  1LXF C;  1ALV A;  5CSF A;  1IH0 A;  1IJ5 A;  2WC8 A;  1S6C A;  3O4Y A;  2M1U A;  5DKQ A;  2NLN A;  1B7T Y;  1N0Y A;  2AUC A;  1GQM A;  1JWD A;  1DGV A;  1DJI A;  1KWO B;  3CR5 X;  3KHE A;  1YTZ C;  2K7B A;  2SAS A;  3IF7 A;  1E8A A;  2ZFD A;  1TNX A;  1NUB A;  4PE4 A;  1FI5 A;  4MLW A;  2SCP A;  2ZN9 A;  2ZN8 A;  2JT0 A;  1W7J B;  1K93 D;  3IQQ A;  4I5L B;  1M31 A;  1UHK A;  1N2D A;  2OTG B;  4Q04 A;  1J55 A;  2K2A A;  2WND A;  1QV1 A;  1UHH A;  5AAN A;  4XJK A;  1H8B A;  1MHO A;  1UP5 A;  4GAO A;  2OPO A;  4ICB A;  1MWN A;  1J7O A;  5AFP A;  1DT7 B;  2LUX A;  3NSK A;  4JPZ B;  1ALW A;  4PHN A;  1XA5 A;  1MF8 B;  1SCM C;  4QJ5 B;  2Y5I A;  1XK4 A;  5ER4 X;  1OSA A;  3VGO A;  1BU3 A;  2BCA A;  4HRH A;  4I5K A;  2LLU A;  2NXQ A;  1ZUZ A;  2KFH A;  3I5I B;  1AHR A;  2BBN A;  2PVB A;  1BR1 B;  1TCF A;  3CR2 A;  2KGR A;  1KCY A;  1IJ6 A;  1HT9 A;  2FCE A;  2KBI A;  3DVE A;  1DJH A;  3WNX B;  1S5G Z;  3BUO B;  1SKT A;  4N1G A;  2PSR A;  2FOT A;  3BUM B;  2LMT A;  1A4P A;  5ER5 A;  4DIR A;  1AUI B;  2F2O A;  4JQ0 D;  4GGN A;  2I2R E;  2LLT A;  1QLS A;  4AQI A;  1YR5 A;  2F2P A;  4YGA A;  1Q80 A;  4FQO A;  5FYX A;  1GJY A;  2KSP A;  2LAP A;  1KQV A;  1WRZ A;  1OZS A;  1QS7 A;  3BOW B;  3IQO A;  1KFU S;  4MSP A;  4C0J A;  1AVS A;  1SPY A;  1AJ4 A;  2F3Y A;  2NCP A;  2CNP A;  1GGW A;  2KI6 C;  1QVI Y;  4U8D A;  1JF2 A;  1MXL C;  1NSH A;  1XFY O;  1YUS A;  1BR4 B;  1BG1 A;  2KQ6 A;  2K7O A;  4DS7 A;  3EVR A;  3FWC A;  4MRX A;  5I2Q A;  2A4J A;  2WCF A;  1SL7 A;  1K95 A;  5KTY A;  1CFD A;  3WXA A;  1XFZ O;  4GNK B;  2L51 A;  1F70 A;  1QAT A;  5HKY A;  2M29 A;  4D1E A;  1JBA A;  2M8U A;  1UHJ A;  3RLZ A;  3CR4 X;  2JRF A;  4XYN A;  1J7Q A;  2LCP A;  1L7Z A;  1B9A A;  2L50 A;  2OS8 C;  2M3W A;  4PHM A;  1SRA A;  2MA2 A;  1QTX A;  2GGZ A;  2DOQ A;  3NXA A;  1A75 B;  3PLF B;  1IKU A;  1YUR A;  3JVT B;  2KHN A;  1TNP A;  3GK4 X;  4CFR A;  3ZNI A;  4GFT A;  5CSJ A;  3QRX A;  1LA0 A;  4DRW A;  5I2L A;  1QXP A;  1PK0 D;  1IWQ A;  1V1F A;  2H61 C;  3I5F C;  2ZND A;  4MBE A;  1PRW A;  1KK8 C;  4USL A;  3OP0 A;  5TNC A;  3CLN A;  2FJU B;  3GK1 A;  3RM1 A;  1J1E A;  2CBL A;  2JTZ A;  2I94 A;  4ZCV A;  3I5H B;  1PAL A;  4PE0 A;  3SJS A;  1KSM A;  2E6W A;  2LMU A;  2LUC A;  1VRK A;  1C07 A;  2LP2 A;  1CFC A;  1S1E A;  1QX7 A;  2CTN A;  1CMF A;  3AAK A;  1KFX S;  4PHJ A;  1AK8 A;  2JWW A;  1A2X A;  2Y1N A;  2LAN A;  4DUQ A;  1K90 D;  1GGZ A;  2HPS A;  2M97 A;  3HX4 A;  1BF5 A;  1XFW O;  3PAT A;  1J1D A;  1B1G A;  3F45 A;  3TUY C;  1XO5 A;  2WOR A;  1IQ3 A;  3PFV A;  4CLN A;  4HSZ A;  4WQ2 A;  1NCY A;  4I5N B;  1QIW A;  4PAL A;  1NP8 A;  1OMV A;  2G9B A;  4GBA A;  4AOM A;  3TS5 B;  5B8I B;  1TCO B;  1YX8 A;  2BKH B;  3GOF A;  2JC2 A;  4QJ3 B;  2KYC A;  1PSR A;  1TNQ A;  2M0R A;  1M46 A;  1QX2 A;  2MLF C;  2K7D A;  3AKA A;  4YGB B;  1F71 A;  3JTD B;  2F3Z A;  2JNF A;  2LC5 A;  1N65 A;  1CDN A;  3LK0 A;  2KBM A;  3BUN B;  4M2Q A;  2KAY A;  2TN4 A;  1CNP A;  1DTL A;  4MEW A;  1F4Q A;  1YRT B;  2BCB A;  1F54 A;  2MAZ A;  1EXR A;  1RK9 A;  2NCO A;  5CSN A;  4YRU A;  3PAL A;  1FI6 A;  2JT3 A;  3LL8 B;  1G8I A;  1DVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...