1JSAA

Myristoylated recoverin with two calciums bound, nmr, 24 structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
188
structure length
188
Chain Sequence
b'GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOVERIN
publication title Molecular mechanics of calcium-myristoyl switches.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium binding
total genus 28
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1997-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA01
4A4BA 1J55A 1QATA 2KOTA 3D0YB 1SR6B 3TS5B 1QJTA 2JTZA 1NCZA 2I7AA 2BL0C 1NCXA 2AMIA 4P2YB 1MWNA 4CFQA 1SK6D 1F55A 1SW8A 5KTYA 2SCPA 1IJ5A 2F3YA 5TNCA 2CXJA 1S6CA 1CMFA 3FWCA 4MN0A 4OKHA 4OVNF 1UHHA 1RECA 1C7VA 3K21A 2M3WA 2PASA 2HF5A 2LNKA 2LLUA 2OPOA 1C07A 2BBNA 2ZN9A 2F2PA 1Y0VH 1IQ3A 2PRUA 1EH2A 1A75B 4PCWA 2GGMA 5AFPA 1BG1A 2B1UA 2K7OA 3KF9A 2JT8A 4DRWA 1FF1A 4MVFA 5PALA 1GQMA 3WXAA 2R2IA 1F70A 3SG7A 2MRDA 5I8NA 3EKHA 4OV2A 2JWWA 1NX3A 1KFXS 2L4HA 3D0YA 1M31A 2F8PA 1B8LA 1GGZA 3PFVA 2L50A 4YI8A 1V1FA 3WHTB 1QTXA 1S6JA 3M0WA 1XFWO 1HQVA 2G2BA 3LK0A 1K94A 3PM8A 1DJWA 2LC5A 3LK1A 5KSZA 4HRHA 3SG4A 2Y4QA 2ZNDA 3VROA 4GGNA 3AAKA 1AK8A 2ZN8A 3A4UB 3DVKA 5D69A 5GQQC 3JTDB 3OX5A 4C0LA 1ZACA 3I5GC 4YBHB 2PMYA 1QX7A 1A75A 2JPTA 2M7LA 1ZMZA 1VRKA 1YVLA 1YUSA 2K8MB 1XK4A 2FOTA 1Y1AA 1SY9A 1RFJA 3SG3A 1XFUO 3BUWB 3EVUA 2CBLA 1CLLA 1DJYA 1NSHA 1DMOA 2OS8C 2OTGB 3TUYC 1SKTA 1J1DA 1WRLA 4MRXA 2F2OA 2ISDA 4BY5A 1N65A 1ODBA 1PRWA 2TN4A 4ZCUA 4CFRA 1S26D 1S36A 2LMTA 1SBJA 2WC8A 3I5FB 2RGIA 2KYCA 3KPXA 1J7QA 5CSFA 3OHMB 5I2OA 3PN7B 1D1OA 3I5IC 1IJ6A 3CLNA 1DTLA 1KK8B 2NLNA 1YRTB 1PK0D 5K89A 1KWOC 2JC2A 2KGBC 2M29A 4DIRA 3WHUB 1XFYO 1UHNA 1EL4A 1TN4A 3OP0A 2Y5IA 2L5XB 1SYMA 2HQ8A 2HQWA 1DJGA 1QVIZ 4MBEA 1YRUB 1QVIY 3EVVA 1AJ5A 2Q4UA 2WNDA 1MXLC 1DJIA 1WRKA 1CFPA 2I94A 3E3RA 1A03A 3PSRA 1MHOA 3NXAA 4AQJA 3EK8A 3KEVA 2LHIA 1OMRA 2M1KB 3GK4X 2KI6D 4YRUA 4AQIA 3LL8B 1KQMC 1NUBA 5AXIA 2M9GA 1BT6A 1JSAA 1AHRA 2KHNA 1K96A 4NDBA 1MXEA 1N2DA 1WDCB 3C1VA 4GFTA 2LUCA 1YUUA 2MLFC 3I5HC 1SCMB 4OCIA 4NDDA 2LMVA 3OB2B 2LLSA 1DT7B 1H8BA 4YI9A 2KI4C 2K61A 3EK7A 3NSOA 2F3ZA 2EGDA 1PVAA 4HREE 1SCVA 3RLZA 1UUSA 4U8DA 2I18A 1CM1A 1IGVA 1OSAA 5JJGA 1NP8A 1YX7A 3CGAA 3SG6A 1JBAA 5ER4X 1YR5A 1BLQA 1TNQA 5DKRA 3KO0A 4MZKA 1QXPA 5CPVA 4DUQA 3PATA 1QASA 2LAPA 1S5GY 3VRPA 1SMGA 1QIWA 2LP3A 3O4YA 1L2OC 1DF0B 1SRAA 1M45A 2BECA 1PSRA 3VGOA 2LM5A 1LKJA 2KQ6A 2LLTA 3JVTC 1K2HA 1B8CA 1G8IA 2BCXA 2H61A 1OOJA 1K95A 2JOJA 1TIZA 2KQYA 1CB1A 4USLA 1F4QA 1AJ4A 1B1GA 4YGCB 1B7TY 4GGFC 1CDMA 1XFXO 2JXCA 4OR9B 4PE4A 1UHKA 1OZSA 4JWQA 1UHIA 1NWDA 1BR1B 2ZFDA 2K2FA 1JF2A 3BUNB 3F45A 2BL0B 1PULA 3HCMA 4PE7A 1XVJA 4XJKB 4PE0A 4ZCVA 1JC2A 1RWYA 2BCAA 4NDCA 4YGBB 3KHEA 1RJVA 2KAYA 3SG5A 2LUXA 2NCPA 1K93D 2LVIA 1S6IA 2LMUA 4FTGA 3MSEB 3NSLA 4MEWA 1K8UA 1NPQA 1JFJA 1A2XA 1DF0A 1NX0A 2HPSA 4PHMA 2K7DA 4E68A 4HSZA 5CSIA 2MHHA 1RTP1 1K9PA 2FJUB 2MAZA 2WOSA 1KFXL 2JT0A 3CWGA 4WQ3A 4ETOA 2QACA 2D8NA 2Y1MA 1UP5A 1BR4B 2JRFA 1DGVA 1KSOA 3EVRA 4GPLB 1CKKA 1JWDA 3BUMB 2E6WA 5CSNA 4WRIA 1ZUZA 4ICBA 1PALA 1F4OA 2V53A 1DVIA 3BYAA 3FS7A 4PALA 5AEQA 1TNPA 2EHBA 4TNCA 4MSPA 1IG5A 3SIAA 4NQGA 1XO5A 3BUXB 1IWQA 1PSBA 1B9AA 1CLMA 1TOPA 2P6BB 1OZOA 1SL9A 2JXLA 1IRJA 2KBMA 2G9BA 2EC6C 3DF0B 2M0RA 2M8UA 1U5IB 2I2RE 3I5GB 5KU1A 2LVKA 1R6PA 1YTZC 2PALA 4YGDB 1B4CA 2H2KA 3BOWB 1ZOTB 3BUOB 1QV1A 5HKZA 4QJ5B 1GGWA 3CZTX 5I2LA 2JNXA 1SR6C 2K7CA 2OS8B 2NXQA 3TS5C 4YGAA 2AUCA 3OB1B 3GK1A 4ORCB 3TUYB 4C0JA 4PHKA 3HX4A 4N5XA 2MJWB 2ZNEA 1JFKA 2M97A 4PDZA 4F0ZB 2M1UA 5FYXA 1LA3A 4QJ4B 2FCDA 2A4JA 3ZWHA 3VRNA 1CDPA 1CLBA 3VRRA 1XFZO 4CLNA 1QX2A 3AKBA 3I5IB 1FBVA 1MUXA 2LP2A 4L9MA 1K9UA 3EKJA 3PALA 1S3PA 1QS7A 3O78A 2BCBA 4DCKA 3DF0A 3LLEA 4MZJA 1KWOB 1U5IA 4MZLA 1XK4C 4PHJA 2VRGA 3AAJA 1CFFA 2NZ0A 2JU0A 2WCFA 1YVHA 3O6BA 1WY9A 3FIAA 1BODA 1DJZA 2L51A 3BOWA 1DJHA 2JTTA 2O60A 1NYAA 1ALWA 1HT9A 4N1FA 4XJKA 4HRGA 4I5NB 1OE9B 1F54A 4CIDA 4GBAA 1S5GZ 1KSMA 1NCYA 1TCFA 1TNXA 2BKIB 4M2OA 1LA0A 1CNPA 5HLOA 1F8HA 5I2QA 1N0YA 1UHJA 3EK4A 1WLZA 2CTNA 3BQ3A 3DVJA 2DOQA 2BE4A 2KI6C 3DVEA 4IL1A 5AANA 4CPVA 1KQMB 2HETA 4M2PA 3JTDC 1CMGA 3IF7A 2LHLA 5BPJA 5JOLA 1B7TZ 1BU3A 4PE1A 3OX6A 1M63B 2Q91A 1KFUS 2KNEA 3H4SE 3CR4X 3I5HB 3O2PA 1CFCA 1Y1XA 1CFDA 1IKUA 2ZKMX 1OQPA 3VRQA 2K2AA 2O5GA 3NSIA 4MRYA 2KI4B 5DKQA 4MLWA 2GGZA 2OTGC 1QIVA 1SL8A 1CDLA 1V1GA 1KQVA 1MF8B 2GV5A 2LE9B 5B8IB 3FWBA 1EG3A 3IQQA 1EXRA 1DGUA 3TZ1A 1J7OA 2L0PA 1NX1A 2K7BA 1FW4A 1A29A 1NX2A 3I5FC 3IQOA 1G4YR 2KBIA 4N1GA 1YUTA 4DS7A 1AUIB 5G08A 2JULA 5HLVA 4I5JA 3PN7C 1G33A 1JUOA 2KFFA 2KDHA 1KK8C 5J3XA 3TDIA 1KK7Z 2F33A 1L2OB 1AP4A 2LVVA 2M49B 1IH0A 4UPGA 1KFUL 3JVTB 1KK7Y 1W7JB 1SPYA 1F71A 4GAOA 1RK9A 3DD4A 3WNXB 1FPWA 1M46A 2KFHA 1ZFSA 5DKNA 4M2QA 1LINA 1EG4A 1TNWA 4GUKA 1GJYA 2L4IA 1R2UA 1LVCD 4YGEB 2LANA 3DVMA 1WRZA 2QPTA 1J1EA 5HYDA 2JT3A 4Q04A 4ORBB 3SJSA 2L2EA 2MA2A 2ZRTA 1BMOA 4P5OE 4AOMA 2AAOA 1UURA 4C0KA 2LV7A 2CT9A 3CR5X 1OMDA 5IBWA 3PLFB 4GNKB 3GK2A 1KCYA 1OMVA 1CM4A 1CTRA 1UWOA 3NSKA 3RM1A 1Q80A 4ORAB 1AVSA 1JF0A 1BOCA 1J7RA 2NCOA 1E8AA 3BXKA 3D10A 1WDCC 5D7FA 2WCEA 2Y1NA 2H61C 1C7WA 1TCOB 1SCMC 2SASA 1BF5A 3TDUA 3SG2A 4QJ3B 3LCPC 1RROA 3ZNIA 2BKHB 4I5LB 5HKYA 1B8RA 2M7NA 2KFGA 4WQ2A 1L7ZA 2JQ6A 1W7IB 2MLEC 2COLB 4PHNA 3A8RA 4I5KA 1NIWA 1QX5B 2KGRA 1SNLA 1PVBA 2PVBA 4GGFA 1ALVA 1J7PA 1WLMA 1XYDA 2E30A 3GOFA 2CCMA 2BE6A 1LXFC 1QLKA 4A4CA 2MBXA 1TTXA 5CSJA 4XYNA 1EJ3A 4JPZB 1DJXA 1MQ1A 5HKWA 4D1EA 1BJFA 1K9KA 1A4PA 2KYFA 3SIBA 1YURA 1SL7A 4JQ0D 3AKAA 3ICBA 1FI5A 1S1EA 2PSRA 1YX8A 2CNPA 2K0JA 2KSPA 2LCPA 5F6TA 1Y1UA 2IS9A 2KAXA 1B47A 2WCBA 2ZRSA 3CS1A 5AERA 2EC6B 1X02A 1CDNA 1FI6A 3TDZA 2LVJA 1IQ5A 1M39A 2JNFA 1H4BA 1QLSA 2KAVA 3CTNA 1TRFA 3CR2A 2L98A 4FQOA 2BBMA 2FCEA 4BY4A 2WORA 1MR8A 1XFVO 3QRXA 5ER5A 1XA5A 1K90D 2JZIA 1Y6WA 1QV0A 4R1EA
chains in the Genus database with same CATH superfamily
3DY9A 4A4BA 1J55A 1QATA 2KOTA 3D0YB 4INXA 1SR6B 3TS5B 1QJTA 2JTZA 1NCZA 2I7AA 2BL0C 1NCXA 2AMIA 4P2YB 1MWNA 1SSEB 2WC5A 4CFQA 1SK6D 1F55A 1SW8A 3K1EA 5KTYA 2SCPA 1IJ5A 2F3YA 5TNCA 2CXJA 1S6CA 1CMFA 3FWCA 4MN0A 4OKHA 2GTEA 4OVNF 1UHHA 1RECA 1C7VA 3K21A 2M3WA 2PASA 2HF5A 2LNKA 2LLUA 2OPOA 1C07A 2BBNA 2ZN9A 2F2PA 1Y0VH 5D3OA 2PRUA 1IQ3A 1EH2A 1A75B 4PCWA 2GGMA 5AFPA 1BG1A 3D74A 3PJIA 4FQTA 2B1UA 2K7OA 3KF9A 2JT8A 4DRWA 3D73A 1FF1A 4MVFA 5PALA 1GQMA 4PT1A 2R2IA 2WCLA 3WXAA 3B7AA 1F70A 3SG7A 2MRDA 3NHIA 5I8NA 3EKHA 4OV2A 2JWWA 3RZSA 1NX3A 1KFXS 2L4HA 3D0YA 1M31A 2F8PA 1B8LA 1GGZA 3PFVA 2L50A 4YI8A 1V1FA 3WHTB 2WCKA 1QTXA 1S6JA 3M0WA 1XFWO 1HQVA 3B86A 2G2BA 3LK0A 1K94A 3PM8A 1DJWA 2LC5A 3LK1A 5KSZA 2QEOA 4HRHA 3SG4A 2Y4QA 2ZNDA 3VROA 4GGNA 3B88A 3AAKA 1AK8A 2ZN8A 3A4UB 3DVKA 5D69A 5GQQC 3JTDB 3OX5A 4C0LA 1ZACA 3I5GC 4YBHB 2PQLA 2PMYA 3QMEA 1QX7A 1A75A 2JPTA 2M7LA 1ZMZA 4OZDA 1VRKA 1YVLA 1YUSA 2K8MB 1XK4A 2FOTA 1Y1AA 1SY9A 1RFJA 3SG3A 1TUJA 1XFUO 3BUWB 3EVUA 2CBLA 1CLLA 3R1OA 1DJYA 1NSHA 1DMOA 2OS8C 2OTGB 3TUYC 1SKTA 1J1DA 1WRLA 4MRXA 2F2OA 2ISDA 4BY5A 1N65A 1ODBA 1PRWA 2TN4A 1W9ZA 4ZCUA 4CFRA 1S26D 1S36A 2LMTA 1SBJA 2WC8A 3I5FB 2RGIA 3UO9A 2KYCA 3KPXA 3O4XA 1J7QA 5CSFA 3OHMB 5I2OA 3PN7B 1D1OA 3I5IC 1IJ6A 3CLNA 1DTLA 1KK8B 2NLNA 1YRTB 3UNWA 1PK0D 5K89A 1KWOC 2JC2A 2KGBC 2M29A 4DIRA 3WHUB 1XFYO 1UHNA 3EG5B 3OBVA 1EL4A 1TN4A 3OP0A 2Y5IA 1IIOA 2L5XB 1SYMA 2HQ8A 2HQWA 1C3YA 1DJGA 1QVIZ 4MBEA 1YRUB 1QVIY 3EVVA 1AJ5A 2Q4UA 2WNDA 1MXLC 1DJIA 1WRKA 1CFPA 2I94A 3E3RA 1A03A 3PSRA 1MHOA 3NXAA 3CDNA 4AQJA 3EK8A 3KEVA 2LHIA 2ERBA 1OMRA 2M1KB 3GK4X 2KI6D 4YRUA 4AQIA 3LL8B 3SS4A 5FI6A 1KQMC 1NUBA 5AXIA 2M9GA 2WCJA 1BT6A 1JSAA 1AHRA 2WCMA 2KHNA 1K96A 3R1PA 4NDBA 1MXEA 1N2DA 1WDCB 3C1VA 4GFTA 2LUCA 1YUUA 2MLFC 3I5HC 1SCMB 2JPOA 4OCIA 4NDDA 2LMVA 3OB2B 2LLSA 1DT7B 3R1VA 1H8BA 4YI9A 2KI4C 2K61A 3EK7A 3NSOA 3BFBA 2F3ZA 2EGDA 1PVAA 4HREE 1SCVA 3RLZA 1UUSA 4U8DA 2I18A 1CM1A 1IGVA 1OSAA 3D76A 5JJGA 1NP8A 1YX7A 3CGAA 3SG6A 1JBAA 5ER4X 1YR5A 1BLQA 1TNQA 5DKRA 3KO0A 4MZKA 1QXPA 5CPVA 4DUQA 3PATA 1QASA 2LAPA 1S5GY 3S0BA 1SMGA 1QIWA 3VRPA 2LP3A 3O4YA 1L2OC 1DF0B 1SRAA 1M45A 3S0FA 2BECA 1PSRA 3VGOA 2LM5A 2QEBA 1LKJA 2KQ6A 2LLTA 3JVTC 1K2HA 1B8CA 1G8IA 2BCXA 2H61A 3S0AA 1OOJA 3FE9A 1K95A 2JOJA 1TIZA 2KQYA 1CB1A 4USLA 1F4QA 1AJ4A 1B1GA 4JD9A 4YGCB 1B7TY 4GGFC 1CDMA 1XFXO 1T14A 2JXCA 4OR9B 4PE4A 3DYEA 3BJHA 1UHKA 1OZSA 4JWQA 1UHIA 2PYQA 1NWDA 1BR1B 2ZFDA 2K2FA 1JF2A 3BUNB 3F45A 2BL0B 1PULA 3HCMA 4PE7A 1XVJA 4XJKB 3D75A 4PE0A 4ZCVA 1JC2A 1RWYA 2BCAA 4NDCA 4YGBB 3KHEA 1RJVA 2KAYA 3SG5A 2LUXA 2NCPA 1K93D 2LVIA 3BFAA 1S6IA 2LMUA 4FTGA 3MSEB 3NSLA 4MEWA 3SS5A 1K8UA 1NPQA 1JFJA 1A2XA 1DF0A 1NX0A 2P70A 2HPSA 4PHMA 2K7DA 4E68A 3CABA 4HSZA 5CSIA 2MHHA 1RTP1 3CZ1A 1K9PA 3FE6A 2FJUB 2MAZA 2WOSA 1KFXL 2JT0A 3CWGA 4WQ3A 4ETOA 2L5YA 2QACA 3OGNA 2D8NA 2Y1MA 3S0DA 1UP5A 1BR4B 2JRFA 1DGVA 1KSOA 3EVRA 4GPLB 1CKKA 1JWDA 2WC6A 3BUMB 3V2LA 2E6WA 1ORGA 5CSNA 4WRIA 1ZUZA 4ICBA 1PALA 1F4OA 2V53A 1DVIA 3BYAA 3FS7A 4PALA 5AEQA 1DC1A 1TNPA 2EHBA 4TNCA 4MSPA 1IG5A 3SIAA 4NQGA 1GM0A 1XO5A 3BUXB 1IWQA 1PSBA 4KYNA 1B9AA 1CLMA 1TOPA 2P6BB 1OZOA 1SL9A 2JXLA 1IRJA 2KBMA 2G9BA 2EC6C 3DF0B 2M0RA 2M8UA 1U5IB 2I2RE 3I5GB 3S0GA 5KU1A 2H8VA 2LVKA 1R6PA 1YTZC 2PALA 3L4LA 4YGDB 1B4CA 2H2KA 2YGUA 3BOWB 1ZOTB 3BUOB 1QV1A 5HKZA 4QJ5B 1GGWA 3CZTX 5EL2A 5I2LA 2JNXA 3FE8A 1SR6C 2K7CA 2OS8B 2NXQA 3TS5C 4YGAA 2AUCA 3OB1B 2KLEA 3GK1A 4ORCB 3TUYB 4C0JA 4PHKA 3HX4A 4F7FA 4N5XA 2MJWB 2ZNEA 1JFKA 2M97A 4PDZA 4F0ZB 2M1UA 5FYXA 1LA3A 4QJ4B 3D77A 2FCDA 2QEHA 2A4JA 4INWA 3ZWHA 3VRNA 1CDPA 1CLBA 3VRRA 1XFZO 4CLNA 1QX2A 3AKBA 3I5IB 1FBVA 1MUXA 2LP2A 4L9MA 1LS8A 1K9UA 3EKJA 3PALA 2P71A 1S3PA 1QS7A 3O78A 2BCBA 4DCKA 3DF0A 3LLEA 4MZJA 1KWOB 1U5IA 4MZLA 1XK4C 4PHJA 2VRGA 3AAJA 1CFFA 2NZ0A 2JU0A 1P28A 2WCFA 1YVHA 3O6BA 1WY9A 3FIAA 1BODA 1DJZA 2L51A 3BOWA 1DJHA 1QWVA 2JTTA 1OOFA 2O60A 1NYAA 1ALWA 3R72A 1HT9A 4N1FA 4XJKA 4HRGA 4I5NB 1OE9B 5I94A 1F54A 4CIDA 4GBAA 1S5GZ 1KSMA 1NCYA 1TCFA 1TNXA 2BKIB 4IJ7A 1LA0A 1DQEA 4M2OA 5HLOA 1CNPA 1F8HA 5I2QA 1N0YA 1UHJA 3EK4A 1WLZA 2CTNA 3BQ3A 3DVJA 2DOQA 2BE4A 2KI6C 2K60A 3DVEA 4IL1A 5AANA 4CPVA 1KQMB 2HETA 2QEVA 4M2PA 3JTDC 1CMGA 3IF7A 2LHLA 5BPJA 5JOLA 3Q8IA 1B7TZ 1BU3A 4PE1A 3OX6A 1M63B 2Q91A 1KFUS 2QDIA 2KNEA 3H4SE 3CR4X 3I5HB 3O2PA 1CFCA 3NGVA 1Y1XA 1CFDA 3DXLA 1IKUA 2ZKMX 1OQPA 3VRQA 2K2AA 4JKTA 1OOGA 2O5GA 3NSIA 4MRYA 2KI4B 5DKQA 4MLWA 2GGZA 2OTGC 1QIVA 1SL8A 1CDLA 1V1GA 1KQVA 1MF8B 2GV5A 2LE9B 1DELA 5B8IB 3FWBA 3B87A 1EG3A 3IQQA 1EXRA 1DGUA 3TZ1A 1J7OA 2L0PA 3CZ0A 3CZ2A 1NX1A 2K7BA 1FW4A 1A29A 1NX2A 3I5FC 3IQOA 1G4YR 2KBIA 1OOHA 1YUTA 4N1GA 4DS7A 1AUIB 1C3ZA 5G08A 2JULA 5HLVA 4I5JA 3PN7C 1G33A 1JUOA 2KFFA 2KDHA 5DICA 1KK8C 1TWOA 5J3XA 3TDIA 1KK7Z 2F33A 1L2OB 3PM2A 3L4AA 1AP4A 2LVVA 2M49B 1IH0A 4UPGA 1KFUL 3JVTB 1KK7Y 1W7JB 1SPYA 1F71A 4GAOA 1RK9A 3DD4A 3WNXB 1FPWA 1M46A 2KFHA 1ZFSA 5DKNA 4M2QA 1LINA 1EG4A 1TNWA 4GUKA 1TUZA 5HL1A 1Z4HA 1GJYA 3L47A 2L4IA 1R2UA 1LVCD 4YGEB 3VB1A 1XFRA 2LANA 3DVMA 1WRZA 2QPTA 1J1EA 5HYDA 2JT3A 2KLDA 4Q04A 4ORBB 3SJSA 2L2EA 2MA2A 2ZRTA 1BMOA 2KPHA 3BFHA 4P5OE 4AOMA 2AAOA 1UURA 4C0KA 2LV7A 2CT9A 3B6XA 3CR5X 1OMDA 1OOIX 1OW4A 3PLFB 5IBWA 4GNKB 3GK2A 1KCYA 1OMVA 1CM4A 1CTRA 1UWOA 3NSKA 5FI2A 3RM1A 1Q80A 4ORAB 1AVSA 1JF0A 1BOCA 1J7RA 2NCOA 1E8AA 3BXKA 3D10A 1WDCC 3N7HA 2WCEA 5D7FA 2Y1NA 2H61C 1C7WA 1TCOB 1SCMC 2SASA 1BF5A 3IVTA 3TDUA 3SG2A 4QJ3B 3LCPC 1RROA 3ZNIA 2BKHB 4I5LB 5HKYA 1B8RA 2M7NA 2KFGA 4WQ2A 1L7ZA 3SS3A 2JQ6A 1Z2CB 1W7IB 2WCHA 2MLEC 2COLB 4PHNA 3A8RA 4I5KA 1NIWA 1QX5B 2KGRA 1SNLA 1PVBA 2PVBA 4GGFA 1ALVA 1J7PA 1WLMA 1XYDA 2E30A 3GOFA 2CCMA 2BE6A 1LXFC 1QLKA 2L2CA 4A4CA 3S0EA 2MBXA 1TTXA 5CSJA 3CYZA 4XYNA 1EJ3A 4JPZB 1DJXA 1MQ1A 5HKWA 4D1EA 1BJFA 1K9KA 1A4PA 2KYFA 2BNXA 1YURA 3NHTA 5FI7A 1SL7A 3SIBA 4JQ0D 3AKAA 3ICBA 1FI5A 1S1EA 2PSRA 1YX8A 3D78A 2CNPA 2K0JA 2KSPA 2LCPA 5F6TA 1Y1UA 2IS9A 2KAXA 1B47A 2WCBA 2ZRSA 3CS1A 5AERA 3DZTA 2EC6B 1X02A 1CDNA 1FI6A 3TDZA 2LVJA 1IQ5A 1M39A 2JNFA 1H4BA 2BAPA 1QLSA 2KAVA 3CTNA 1TRFA 1DEKA 2L98A 3CR2A 4FQOA 2BBMA 2FCEA 2FJYA 4BY4A 2WORA 1MR8A 1XFVO 3QRXA 5ER5A 1XA5A 1K90D 2JZIA 1Y6WA 1QV0A 4R1EA
chains in the Genus database with same CATH topology
4A4BA 1J55A 1QATA 2KOTA 3D0YB 1SR6B 3TS5B 1QJTA 2JTZA 1NCZA 2I7AA 2BL0C 1NCXA 2AMIA 4P2YB 1MWNA 4CFQA 1SK6D 1F55A 1SW8A 5KTYA 2SCPA 1IJ5A 2F3YA 5TNCA 2CXJA 1S6CA 1CMFA 3FWCA 4MN0A 4OKHA 4OVNF 1UHHA 1RECA 1C7VA 3K21A 2M3WA 2PASA 2HF5A 2LNKA 2LLUA 2OPOA 1C07A 2BBNA 2ZN9A 2F2PA 1Y0VH 1IQ3A 2PRUA 1EH2A 1A75B 4PCWA 2GGMA 5AFPA 1BG1A 2B1UA 2K7OA 3KF9A 2JT8A 4DRWA 1FF1A 4MVFA 5PALA 1GQMA 3WXAA 2R2IA 1F70A 3SG7A 2MRDA 5I8NA 3EKHA 4OV2A 2JWWA 1NX3A 1KFXS 2L4HA 3D0YA 1M31A 2F8PA 1B8LA 1GGZA 3PFVA 2L50A 4YI8A 1V1FA 3WHTB 1QTXA 1S6JA 3M0WA 1XFWO 1HQVA 2G2BA 3LK0A 1K94A 3PM8A 1DJWA 2LC5A 3LK1A 5KSZA 4HRHA 3SG4A 2Y4QA 2ZNDA 3VROA 4GGNA 3AAKA 1AK8A 2ZN8A 3A4UB 3DVKA 5D69A 5GQQC 3JTDB 3OX5A 4C0LA 1ZACA 3I5GC 4YBHB 2PMYA 1QX7A 1A75A 2JPTA 2M7LA 1ZMZA 1VRKA 1YVLA 1YUSA 2K8MB 1XK4A 2FOTA 1Y1AA 1SY9A 1RFJA 3SG3A 1XFUO 3BUWB 3EVUA 2CBLA 1CLLA 1DJYA 1NSHA 1DMOA 2OS8C 2OTGB 3TUYC 1SKTA 1J1DA 1WRLA 4MRXA 2F2OA 2ISDA 4BY5A 1N65A 1ODBA 1PRWA 2TN4A 4ZCUA 4CFRA 1S26D 1S36A 2LMTA 1SBJA 2WC8A 3I5FB 2RGIA 2KYCA 3KPXA 1J7QA 5CSFA 3OHMB 5I2OA 3PN7B 1D1OA 3I5IC 1IJ6A 3CLNA 1DTLA 1KK8B 2NLNA 1YRTB 1PK0D 5K89A 1KWOC 2JC2A 2KGBC 2M29A 4DIRA 3WHUB 1XFYO 1UHNA 1EL4A 1TN4A 3OP0A 2Y5IA 2L5XB 1SYMA 2HQ8A 2HQWA 1DJGA 1QVIZ 4MBEA 1YRUB 1QVIY 3EVVA 1AJ5A 2Q4UA 2WNDA 1MXLC 1DJIA 1WRKA 1CFPA 2I94A 3E3RA 1A03A 3PSRA 1MHOA 3NXAA 4AQJA 3EK8A 3KEVA 2LHIA 1OMRA 2M1KB 3GK4X 2KI6D 4YRUA 4AQIA 3LL8B 1KQMC 1NUBA 5AXIA 2M9GA 1BT6A 1JSAA 1AHRA 2KHNA 1K96A 4NDBA 1MXEA 1N2DA 1WDCB 3C1VA 4GFTA 2LUCA 1YUUA 2MLFC 3I5HC 1SCMB 4OCIA 4NDDA 2LMVA 3OB2B 2LLSA 1DT7B 1H8BA 4YI9A 2KI4C 2K61A 3EK7A 3NSOA 2F3ZA 2EGDA 1PVAA 4HREE 1SCVA 3RLZA 1UUSA 4U8DA 2I18A 1CM1A 1IGVA 1OSAA 5JJGA 1NP8A 1YX7A 3CGAA 3SG6A 1JBAA 5ER4X 1YR5A 1BLQA 1TNQA 5DKRA 3KO0A 4MZKA 1QXPA 5CPVA 4DUQA 3PATA 1QASA 2LAPA 1S5GY 3VRPA 1SMGA 1QIWA 2LP3A 3O4YA 1L2OC 1DF0B 1SRAA 1M45A 2BECA 1PSRA 3VGOA 2LM5A 1LKJA 2KQ6A 2LLTA 3JVTC 1K2HA 1B8CA 1G8IA 2BCXA 2H61A 1OOJA 1K95A 2JOJA 1TIZA 2KQYA 1CB1A 4USLA 1F4QA 1AJ4A 1B1GA 4YGCB 1B7TY 4GGFC 1CDMA 1XFXO 2JXCA 4OR9B 4PE4A 1UHKA 1OZSA 4JWQA 1UHIA 1NWDA 1BR1B 2ZFDA 2K2FA 1JF2A 3BUNB 3F45A 2BL0B 1PULA 3HCMA 4PE7A 1XVJA 4XJKB 4PE0A 4ZCVA 1JC2A 1RWYA 2BCAA 4NDCA 4YGBB 3KHEA 1RJVA 2KAYA 3SG5A 2LUXA 2NCPA 1K93D 2LVIA 1S6IA 2LMUA 4FTGA 3MSEB 3NSLA 4MEWA 1K8UA 1NPQA 1JFJA 1A2XA 1DF0A 1NX0A 2HPSA 4PHMA 2K7DA 4E68A 4HSZA 5CSIA 2MHHA 1RTP1 1K9PA 2FJUB 2MAZA 2WOSA 1KFXL 2JT0A 3CWGA 4WQ3A 4ETOA 2QACA 2D8NA 2Y1MA 1UP5A 1BR4B 2JRFA 1DGVA 1KSOA 3EVRA 4GPLB 1CKKA 1JWDA 3BUMB 2E6WA 5CSNA 4WRIA 1ZUZA 4ICBA 1PALA 1F4OA 2V53A 1DVIA 3BYAA 3FS7A 4PALA 5AEQA 1TNPA 2EHBA 4TNCA 4MSPA 1IG5A 3SIAA 4NQGA 1XO5A 3BUXB 1IWQA 1PSBA 1B9AA 1CLMA 1TOPA 2P6BB 1OZOA 1SL9A 2JXLA 1IRJA 2KBMA 2G9BA 2EC6C 3DF0B 2M0RA 2M8UA 1U5IB 2I2RE 3I5GB 5KU1A 2LVKA 1R6PA 1YTZC 2PALA 4YGDB 1B4CA 2H2KA 3BOWB 1ZOTB 3BUOB 1QV1A 5HKZA 4QJ5B 1GGWA 3CZTX 5I2LA 2JNXA 1SR6C 2K7CA 2OS8B 2NXQA 3TS5C 4YGAA 2AUCA 3OB1B 3GK1A 4ORCB 3TUYB 4C0JA 4PHKA 3HX4A 4N5XA 2MJWB 2ZNEA 1JFKA 2M97A 4PDZA 4F0ZB 2M1UA 5FYXA 1LA3A 4QJ4B 2FCDA 2A4JA 3ZWHA 3VRNA 1CDPA 1CLBA 3VRRA 1XFZO 4CLNA 1QX2A 3AKBA 3I5IB 1FBVA 1MUXA 2LP2A 4L9MA 1K9UA 3EKJA 3PALA 1S3PA 1QS7A 3O78A 2BCBA 4DCKA 3DF0A 3LLEA 4MZJA 1KWOB 1U5IA 4MZLA 1XK4C 4PHJA 2VRGA 3AAJA 1CFFA 2NZ0A 2JU0A 2WCFA 1YVHA 3O6BA 1WY9A 3FIAA 1BODA 1DJZA 2L51A 3BOWA 1DJHA 2JTTA 2O60A 1NYAA 1ALWA 1HT9A 4N1FA 4XJKA 4HRGA 4I5NB 1OE9B 1F54A 4CIDA 4GBAA 1S5GZ 1KSMA 1NCYA 1TCFA 1TNXA 2BKIB 4M2OA 1LA0A 1CNPA 5HLOA 1F8HA 5I2QA 1N0YA 1UHJA 3EK4A 1WLZA 2CTNA 3BQ3A 3DVJA 2DOQA 2BE4A 2KI6C 3DVEA 4IL1A 5AANA 4CPVA 1KQMB 2HETA 4M2PA 3JTDC 1CMGA 3IF7A 2LHLA 5BPJA 5JOLA 1B7TZ 1BU3A 4PE1A 3OX6A 1M63B 2Q91A 1KFUS 2KNEA 3H4SE 3CR4X 3I5HB 3O2PA 1CFCA 1Y1XA 1CFDA 1IKUA 2ZKMX 1OQPA 3VRQA 2K2AA 2O5GA 3NSIA 4MRYA 2KI4B 5DKQA 4MLWA 2GGZA 2OTGC 1QIVA 1SL8A 1CDLA 1V1GA 1KQVA 1MF8B 2GV5A 2LE9B 5B8IB 3FWBA 1EG3A 3IQQA 1EXRA 1DGUA 3TZ1A 1J7OA 2L0PA 1NX1A 2K7BA 1FW4A 1A29A 1NX2A 3I5FC 3IQOA 1G4YR 2KBIA 4N1GA 1YUTA 4DS7A 1AUIB 5G08A 2JULA 5HLVA 4I5JA 3PN7C 1G33A 1JUOA 2KFFA 2KDHA 1KK8C 5J3XA 3TDIA 1KK7Z 2F33A 1L2OB 1AP4A 2LVVA 2M49B 1IH0A 4UPGA 1KFUL 3JVTB 1KK7Y 1W7JB 1SPYA 1F71A 4GAOA 1RK9A 3DD4A 3WNXB 1FPWA 1M46A 2KFHA 1ZFSA 5DKNA 4M2QA 1LINA 1EG4A 1TNWA 4GUKA 1GJYA 2L4IA 1R2UA 1LVCD 4YGEB 2LANA 3DVMA 1WRZA 2QPTA 1J1EA 5HYDA 2JT3A 4Q04A 4ORBB 3SJSA 2L2EA 2MA2A 2ZRTA 1BMOA 4P5OE 4AOMA 2AAOA 1UURA 4C0KA 2LV7A 2CT9A 3CR5X 1OMDA 5IBWA 3PLFB 4GNKB 3GK2A 1KCYA 1OMVA 1CM4A 1CTRA 1UWOA 3NSKA 3RM1A 1Q80A 4ORAB 1AVSA 1JF0A 1BOCA 1J7RA 2NCOA 1E8AA 3BXKA 3D10A 1WDCC 5D7FA 2WCEA 2Y1NA 2H61C 1C7WA 1TCOB 1SCMC 2SASA 1BF5A 3TDUA 3SG2A 4QJ3B 3LCPC 1RROA 3ZNIA 2BKHB 4I5LB 5HKYA 1B8RA 2M7NA 2KFGA 4WQ2A 1L7ZA 2JQ6A 1W7IB 2MLEC 2COLB 4PHNA 3A8RA 4I5KA 1NIWA 1QX5B 2KGRA 1SNLA 1PVBA 2PVBA 4GGFA 1ALVA 1J7PA 1WLMA 1XYDA 2E30A 3GOFA 2CCMA 2BE6A 1LXFC 1QLKA 4A4CA 2MBXA 1TTXA 5CSJA 4XYNA 1EJ3A 4JPZB 1DJXA 1MQ1A 5HKWA 4D1EA 1BJFA 1K9KA 1A4PA 2KYFA 3SIBA 1YURA 1SL7A 4JQ0D 3AKAA 3ICBA 1FI5A 1S1EA 2PSRA 1YX8A 2CNPA 2K0JA 2KSPA 2LCPA 5F6TA 1Y1UA 2IS9A 2KAXA 1B47A 2WCBA 2ZRSA 3CS1A 5AERA 2EC6B 1X02A 1CDNA 1FI6A 3TDZA 2LVJA 1IQ5A 1M39A 2JNFA 1H4BA 1QLSA 2KAVA 3CTNA 1TRFA 3CR2A 2L98A 4FQOA 2BBMA 2FCEA 4BY4A 2WORA 1MR8A 1XFVO 3QRXA 5ER5A 1XA5A 1K90D 2JZIA 1Y6WA 1QV0A 4R1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  1J55 A;  1QAT A;  2KOT A;  3D0Y B;  1SR6 B;  3TS5 B;  1QJT A;  2JTZ A;  1NCZ A;  2I7A A;  2BL0 C;  1NCX A;  2AMI A;  4P2Y B;  1MWN A;  4CFQ A;  1SK6 D;  1F55 A;  1SW8 A;  5KTY A;  2SCP A;  1IJ5 A;  2F3Y A;  5TNC A;  2CXJ A;  1S6C A;  1CMF A;  3FWC A;  4MN0 A;  4OKH A;  4OVN F;  1UHH A;  1REC A;  1C7V A;  3K21 A;  2M3W A;  2PAS A;  2HF5 A;  2LNK A;  2LLU A;  2OPO A;  1C07 A;  2BBN A;  2ZN9 A;  2F2P A;  1Y0V H;  1IQ3 A;  2PRU A;  1EH2 A;  1A75 B;  4PCW A;  2GGM A;  5AFP A;  1BG1 A;  2B1U A;  2K7O A;  3KF9 A;  2JT8 A;  4DRW A;  1FF1 A;  4MVF A;  5PAL A;  1GQM A;  3WXA A;  2R2I A;  1F70 A;  3SG7 A;  2MRD A;  5I8N A;  3EKH A;  4OV2 A;  2JWW A;  1NX3 A;  1KFX S;  2L4H A;  3D0Y A;  1M31 A;  2F8P A;  1B8L A;  1GGZ A;  3PFV A;  2L50 A;  4YI8 A;  1V1F A;  3WHT B;  1QTX A;  1S6J A;  3M0W A;  1XFW O;  1HQV A;  2G2B A;  3LK0 A;  1K94 A;  3PM8 A;  1DJW A;  2LC5 A;  3LK1 A;  5KSZ A;  4HRH A;  3SG4 A;  2Y4Q A;  2ZND A;  3VRO A;  4GGN A;  3AAK A;  1AK8 A;  2ZN8 A;  3A4U B;  3DVK A;  5D69 A;  5GQQ C;  3JTD B;  3OX5 A;  4C0L A;  1ZAC A;  3I5G C;  4YBH B;  2PMY A;  1QX7 A;  1A75 A;  2JPT A;  2M7L A;  1ZMZ A;  1VRK A;  1YVL A;  1YUS A;  2K8M B;  1XK4 A;  2FOT A;  1Y1A A;  1SY9 A;  1RFJ A;  3SG3 A;  1XFU O;  3BUW B;  3EVU A;  2CBL A;  1CLL A;  1DJY A;  1NSH A;  1DMO A;  2OS8 C;  2OTG B;  3TUY C;  1SKT A;  1J1D A;  1WRL A;  4MRX A;  2F2O A;  2ISD A;  4BY5 A;  1N65 A;  1ODB A;  1PRW A;  2TN4 A;  4ZCU A;  4CFR A;  1S26 D;  1S36 A;  2LMT A;  1SBJ A;  2WC8 A;  3I5F B;  2RGI A;  2KYC A;  3KPX A;  1J7Q A;  5CSF A;  3OHM B;  5I2O A;  3PN7 B;  1D1O A;  3I5I C;  1IJ6 A;  3CLN A;  1DTL A;  1KK8 B;  2NLN A;  1YRT B;  1PK0 D;  5K89 A;  1KWO C;  2JC2 A;  2KGB C;  2M29 A;  4DIR A;  3WHU B;  1XFY O;  1UHN A;  1EL4 A;  1TN4 A;  3OP0 A;  2Y5I A;  2L5X B;  1SYM A;  2HQ8 A;  2HQW A;  1DJG A;  1QVI Z;  4MBE A;  1YRU B;  1QVI Y;  3EVV A;  1AJ5 A;  2Q4U A;  2WND A;  1MXL C;  1DJI A;  1WRK A;  1CFP A;  2I94 A;  3E3R A;  1A03 A;  3PSR A;  1MHO A;  3NXA A;  4AQJ A;  3EK8 A;  3KEV A;  2LHI A;  1OMR A;  2M1K B;  3GK4 X;  2KI6 D;  4YRU A;  4AQI A;  3LL8 B;  1KQM C;  1NUB A;  5AXI A;  2M9G A;  1BT6 A;  1JSA A;  1AHR A;  2KHN A;  1K96 A;  4NDB A;  1MXE A;  1N2D A;  1WDC B;  3C1V A;  4GFT A;  2LUC A;  1YUU A;  2MLF C;  3I5H C;  1SCM B;  4OCI A;  4NDD A;  2LMV A;  3OB2 B;  2LLS A;  1DT7 B;  1H8B A;  4YI9 A;  2KI4 C;  2K61 A;  3EK7 A;  3NSO A;  2F3Z A;  2EGD A;  1PVA A;  4HRE E;  1SCV A;  3RLZ A;  1UUS A;  4U8D A;  2I18 A;  1CM1 A;  1IGV A;  1OSA A;  5JJG A;  1NP8 A;  1YX7 A;  3CGA A;  3SG6 A;  1JBA A;  5ER4 X;  1YR5 A;  1BLQ A;  1TNQ A;  5DKR A;  3KO0 A;  4MZK A;  1QXP A;  5CPV A;  4DUQ A;  3PAT A;  1QAS A;  2LAP A;  1S5G Y;  3VRP A;  1SMG A;  1QIW A;  2LP3 A;  3O4Y A;  1L2O C;  1DF0 B;  1SRA A;  1M45 A;  2BEC A;  1PSR A;  3VGO A;  2LM5 A;  1LKJ A;  2KQ6 A;  2LLT A;  3JVT C;  1K2H A;  1B8C A;  1G8I A;  2BCX A;  2H61 A;  1OOJ A;  1K95 A;  2JOJ A;  1TIZ A;  2KQY A;  1CB1 A;  4USL A;  1F4Q A;  1AJ4 A;  1B1G A;  4YGC B;  1B7T Y;  4GGF C;  1CDM A;  1XFX O;  2JXC A;  4OR9 B;  4PE4 A;  1UHK A;  1OZS A;  4JWQ A;  1UHI A;  1NWD A;  1BR1 B;  2ZFD A;  2K2F A;  1JF2 A;  3BUN B;  3F45 A;  2BL0 B;  1PUL A;  3HCM A;  4PE7 A;  1XVJ A;  4XJK B;  4PE0 A;  4ZCV A;  1JC2 A;  1RWY A;  2BCA A;  4NDC A;  4YGB B;  3KHE A;  1RJV A;  2KAY A;  3SG5 A;  2LUX A;  2NCP A;  1K93 D;  2LVI A;  1S6I A;  2LMU A;  4FTG A;  3MSE B;  3NSL A;  4MEW A;  1K8U A;  1NPQ A;  1JFJ A;  1A2X A;  1DF0 A;  1NX0 A;  2HPS A;  4PHM A;  2K7D A;  4E68 A;  4HSZ A;  5CSI A;  2MHH A;  1RTP 1;  1K9P A;  2FJU B;  2MAZ A;  2WOS A;  1KFX L;  2JT0 A;  3CWG A;  4WQ3 A;  4ETO A;  2QAC A;  2D8N A;  2Y1M A;  1UP5 A;  1BR4 B;  2JRF A;  1DGV A;  1KSO A;  3EVR A;  4GPL B;  1CKK A;  1JWD A;  3BUM B;  2E6W A;  5CSN A;  4WRI A;  1ZUZ A;  4ICB A;  1PAL A;  1F4O A;  2V53 A;  1DVI A;  3BYA A;  3FS7 A;  4PAL A;  5AEQ A;  1TNP A;  2EHB A;  4TNC A;  4MSP A;  1IG5 A;  3SIA A;  4NQG A;  1XO5 A;  3BUX B;  1IWQ A;  1PSB A;  1B9A A;  1CLM A;  1TOP A;  2P6B B;  1OZO A;  1SL9 A;  2JXL A;  1IRJ A;  2KBM A;  2G9B A;  2EC6 C;  3DF0 B;  2M0R A;  2M8U A;  1U5I B;  2I2R E;  3I5G B;  5KU1 A;  2LVK A;  1R6P A;  1YTZ C;  2PAL A;  4YGD B;  1B4C A;  2H2K A;  3BOW B;  1ZOT B;  3BUO B;  1QV1 A;  5HKZ A;  4QJ5 B;  1GGW A;  3CZT X;  5I2L A;  2JNX A;  1SR6 C;  2K7C A;  2OS8 B;  2NXQ A;  3TS5 C;  4YGA A;  2AUC A;  3OB1 B;  3GK1 A;  4ORC B;  3TUY B;  4C0J A;  4PHK A;  3HX4 A;  4N5X A;  2MJW B;  2ZNE A;  1JFK A;  2M97 A;  4PDZ A;  4F0Z B;  2M1U A;  5FYX A;  1LA3 A;  4QJ4 B;  2FCD A;  2A4J A;  3ZWH A;  3VRN A;  1CDP A;  1CLB A;  3VRR A;  1XFZ O;  4CLN A;  1QX2 A;  3AKB A;  3I5I B;  1FBV A;  1MUX A;  2LP2 A;  4L9M A;  1K9U A;  3EKJ A;  3PAL A;  1S3P A;  1QS7 A;  3O78 A;  2BCB A;  4DCK A;  3DF0 A;  3LLE A;  4MZJ A;  1KWO B;  1U5I A;  4MZL A;  1XK4 C;  4PHJ A;  2VRG A;  3AAJ A;  1CFF A;  2NZ0 A;  2JU0 A;  2WCF A;  1YVH A;  3O6B A;  1WY9 A;  3FIA A;  1BOD A;  1DJZ A;  2L51 A;  3BOW A;  1DJH A;  2JTT A;  2O60 A;  1NYA A;  1ALW A;  1HT9 A;  4N1F A;  4XJK A;  4HRG A;  4I5N B;  1OE9 B;  1F54 A;  4CID A;  4GBA A;  1S5G Z;  1KSM A;  1NCY A;  1TCF A;  1TNX A;  2BKI B;  4M2O A;  1LA0 A;  1CNP A;  5HLO A;  1F8H A;  5I2Q A;  1N0Y A;  1UHJ A;  3EK4 A;  1WLZ A;  2CTN A;  3BQ3 A;  3DVJ A;  2DOQ A;  2BE4 A;  2KI6 C;  3DVE A;  4IL1 A;  5AAN A;  4CPV A;  1KQM B;  2HET A;  4M2P A;  3JTD C;  1CMG A;  3IF7 A;  2LHL A;  5BPJ A;  5JOL A;  1B7T Z;  1BU3 A;  4PE1 A;  3OX6 A;  1M63 B;  2Q91 A;  1KFU S;  2KNE A;  3H4S E;  3CR4 X;  3I5H B;  3O2P A;  1CFC A;  1Y1X A;  1CFD A;  1IKU A;  2ZKM X;  1OQP A;  3VRQ A;  2K2A A;  2O5G A;  3NSI A;  4MRY A;  2KI4 B;  5DKQ A;  4MLW A;  2GGZ A;  2OTG C;  1QIV A;  1SL8 A;  1CDL A;  1V1G A;  1KQV A;  1MF8 B;  2GV5 A;  2LE9 B;  5B8I B;  3FWB A;  1EG3 A;  3IQQ A;  1EXR A;  1DGU A;  3TZ1 A;  1J7O A;  2L0P A;  1NX1 A;  2K7B A;  1FW4 A;  1A29 A;  1NX2 A;  3I5F C;  3IQO A;  1G4Y R;  2KBI A;  4N1G A;  1YUT A;  4DS7 A;  1AUI B;  5G08 A;  2JUL A;  5HLV A;  4I5J A;  3PN7 C;  1G33 A;  1JUO A;  2KFF A;  2KDH A;  1KK8 C;  5J3X A;  3TDI A;  1KK7 Z;  2F33 A;  1L2O B;  1AP4 A;  2LVV A;  2M49 B;  1IH0 A;  4UPG A;  1KFU L;  3JVT B;  1KK7 Y;  1W7J B;  1SPY A;  1F71 A;  4GAO A;  1RK9 A;  3DD4 A;  3WNX B;  1FPW A;  1M46 A;  2KFH A;  1ZFS A;  5DKN A;  4M2Q A;  1LIN A;  1EG4 A;  1TNW A;  4GUK A;  1GJY A;  2L4I A;  1R2U A;  1LVC D;  4YGE B;  2LAN A;  3DVM A;  1WRZ A;  2QPT A;  1J1E A;  5HYD A;  2JT3 A;  4Q04 A;  4ORB B;  3SJS A;  2L2E A;  2MA2 A;  2ZRT A;  1BMO A;  4P5O E;  4AOM A;  2AAO A;  1UUR A;  4C0K A;  2LV7 A;  2CT9 A;  3CR5 X;  1OMD A;  5IBW A;  3PLF B;  4GNK B;  3GK2 A;  1KCY A;  1OMV A;  1CM4 A;  1CTR A;  1UWO A;  3NSK A;  3RM1 A;  1Q80 A;  4ORA B;  1AVS A;  1JF0 A;  1BOC A;  1J7R A;  2NCO A;  1E8A A;  3BXK A;  3D10 A;  1WDC C;  5D7F A;  2WCE A;  2Y1N A;  2H61 C;  1C7W A;  1TCO B;  1SCM C;  2SAS A;  1BF5 A;  3TDU A;  3SG2 A;  4QJ3 B;  3LCP C;  1RRO A;  3ZNI A;  2BKH B;  4I5L B;  5HKY A;  1B8R A;  2M7N A;  2KFG A;  4WQ2 A;  1L7Z A;  2JQ6 A;  1W7I B;  2MLE C;  2COL B;  4PHN A;  3A8R A;  4I5K A;  1NIW A;  1QX5 B;  2KGR A;  1SNL A;  1PVB A;  2PVB A;  4GGF A;  1ALV A;  1J7P A;  1WLM A;  1XYD A;  2E30 A;  3GOF A;  2CCM A;  2BE6 A;  1LXF C;  1QLK A;  4A4C A;  2MBX A;  1TTX A;  5CSJ A;  4XYN A;  1EJ3 A;  4JPZ B;  1DJX A;  1MQ1 A;  5HKW A;  4D1E A;  1BJF A;  1K9K A;  1A4P A;  2KYF A;  3SIB A;  1YUR A;  1SL7 A;  4JQ0 D;  3AKA A;  3ICB A;  1FI5 A;  1S1E A;  2PSR A;  1YX8 A;  2CNP A;  2K0J A;  2KSP A;  2LCP A;  5F6T A;  1Y1U A;  2IS9 A;  2KAX A;  1B47 A;  2WCB A;  2ZRS A;  3CS1 A;  5AER A;  2EC6 B;  1X02 A;  1CDN A;  1FI6 A;  3TDZ A;  2LVJ A;  1IQ5 A;  1M39 A;  2JNF A;  1H4B A;  1QLS A;  2KAV A;  3CTN A;  1TRF A;  3CR2 A;  2L98 A;  4FQO A;  2BBM A;  2FCE A;  4BY4 A;  2WOR A;  1MR8 A;  1XFV O;  3QRX A;  5ER5 A;  1XA5 A;  1K90 D;  2JZI A;  1Y6W A;  1QV0 A;  4R1E A; 
#chains in the Genus database with same CATH topology
 3DY9 A;  4A4B A;  1J55 A;  1QAT A;  2KOT A;  3D0Y B;  4INX A;  1SR6 B;  3TS5 B;  1QJT A;  2JTZ A;  1NCZ A;  2I7A A;  2BL0 C;  1NCX A;  2AMI A;  4P2Y B;  1MWN A;  1SSE B;  2WC5 A;  4CFQ A;  1SK6 D;  1F55 A;  1SW8 A;  3K1E A;  5KTY A;  2SCP A;  1IJ5 A;  2F3Y A;  5TNC A;  2CXJ A;  1S6C A;  1CMF A;  3FWC A;  4MN0 A;  4OKH A;  2GTE A;  4OVN F;  1UHH A;  1REC A;  1C7V A;  3K21 A;  2M3W A;  2PAS A;  2HF5 A;  2LNK A;  2LLU A;  2OPO A;  1C07 A;  2BBN A;  2ZN9 A;  2F2P A;  1Y0V H;  5D3O A;  2PRU A;  1IQ3 A;  1EH2 A;  1A75 B;  4PCW A;  2GGM A;  5AFP A;  1BG1 A;  3D74 A;  3PJI A;  4FQT A;  2B1U A;  2K7O A;  3KF9 A;  2JT8 A;  4DRW A;  3D73 A;  1FF1 A;  4MVF A;  5PAL A;  1GQM A;  4PT1 A;  2R2I A;  2WCL A;  3WXA A;  3B7A A;  1F70 A;  3SG7 A;  2MRD A;  3NHI A;  5I8N A;  3EKH A;  4OV2 A;  2JWW A;  3RZS A;  1NX3 A;  1KFX S;  2L4H A;  3D0Y A;  1M31 A;  2F8P A;  1B8L A;  1GGZ A;  3PFV A;  2L50 A;  4YI8 A;  1V1F A;  3WHT B;  2WCK A;  1QTX A;  1S6J A;  3M0W A;  1XFW O;  1HQV A;  3B86 A;  2G2B A;  3LK0 A;  1K94 A;  3PM8 A;  1DJW A;  2LC5 A;  3LK1 A;  5KSZ A;  2QEO A;  4HRH A;  3SG4 A;  2Y4Q A;  2ZND A;  3VRO A;  4GGN A;  3B88 A;  3AAK A;  1AK8 A;  2ZN8 A;  3A4U B;  3DVK A;  5D69 A;  5GQQ C;  3JTD B;  3OX5 A;  4C0L A;  1ZAC A;  3I5G C;  4YBH B;  2PQL A;  2PMY A;  3QME A;  1QX7 A;  1A75 A;  2JPT A;  2M7L A;  1ZMZ A;  4OZD A;  1VRK A;  1YVL A;  1YUS A;  2K8M B;  1XK4 A;  2FOT A;  1Y1A A;  1SY9 A;  1RFJ A;  3SG3 A;  1TUJ A;  1XFU O;  3BUW B;  3EVU A;  2CBL A;  1CLL A;  3R1O A;  1DJY A;  1NSH A;  1DMO A;  2OS8 C;  2OTG B;  3TUY C;  1SKT A;  1J1D A;  1WRL A;  4MRX A;  2F2O A;  2ISD A;  4BY5 A;  1N65 A;  1ODB A;  1PRW A;  2TN4 A;  1W9Z A;  4ZCU A;  4CFR A;  1S26 D;  1S36 A;  2LMT A;  1SBJ A;  2WC8 A;  3I5F B;  2RGI A;  3UO9 A;  2KYC A;  3KPX A;  3O4X A;  1J7Q A;  5CSF A;  3OHM B;  5I2O A;  3PN7 B;  1D1O A;  3I5I C;  1IJ6 A;  3CLN A;  1DTL A;  1KK8 B;  2NLN A;  1YRT B;  3UNW A;  1PK0 D;  5K89 A;  1KWO C;  2JC2 A;  2KGB C;  2M29 A;  4DIR A;  3WHU B;  1XFY O;  1UHN A;  3EG5 B;  3OBV A;  1EL4 A;  1TN4 A;  3OP0 A;  2Y5I A;  1IIO A;  2L5X B;  1SYM A;  2HQ8 A;  2HQW A;  1C3Y A;  1DJG A;  1QVI Z;  4MBE A;  1YRU B;  1QVI Y;  3EVV A;  1AJ5 A;  2Q4U A;  2WND A;  1MXL C;  1DJI A;  1WRK A;  1CFP A;  2I94 A;  3E3R A;  1A03 A;  3PSR A;  1MHO A;  3NXA A;  3CDN A;  4AQJ A;  3EK8 A;  3KEV A;  2LHI A;  2ERB A;  1OMR A;  2M1K B;  3GK4 X;  2KI6 D;  4YRU A;  4AQI A;  3LL8 B;  3SS4 A;  5FI6 A;  1KQM C;  1NUB A;  5AXI A;  2M9G A;  2WCJ A;  1BT6 A;  1JSA A;  1AHR A;  2WCM A;  2KHN A;  1K96 A;  3R1P A;  4NDB A;  1MXE A;  1N2D A;  1WDC B;  3C1V A;  4GFT A;  2LUC A;  1YUU A;  2MLF C;  3I5H C;  1SCM B;  2JPO A;  4OCI A;  4NDD A;  2LMV A;  3OB2 B;  2LLS A;  1DT7 B;  3R1V A;  1H8B A;  4YI9 A;  2KI4 C;  2K61 A;  3EK7 A;  3NSO A;  3BFB A;  2F3Z A;  2EGD A;  1PVA A;  4HRE E;  1SCV A;  3RLZ A;  1UUS A;  4U8D A;  2I18 A;  1CM1 A;  1IGV A;  1OSA A;  3D76 A;  5JJG A;  1NP8 A;  1YX7 A;  3CGA A;  3SG6 A;  1JBA A;  5ER4 X;  1YR5 A;  1BLQ A;  1TNQ A;  5DKR A;  3KO0 A;  4MZK A;  1QXP A;  5CPV A;  4DUQ A;  3PAT A;  1QAS A;  2LAP A;  1S5G Y;  3S0B A;  1SMG A;  1QIW A;  3VRP A;  2LP3 A;  3O4Y A;  1L2O C;  1DF0 B;  1SRA A;  1M45 A;  3S0F A;  2BEC A;  1PSR A;  3VGO A;  2LM5 A;  2QEB A;  1LKJ A;  2KQ6 A;  2LLT A;  3JVT C;  1K2H A;  1B8C A;  1G8I A;  2BCX A;  2H61 A;  3S0A A;  1OOJ A;  3FE9 A;  1K95 A;  2JOJ A;  1TIZ A;  2KQY A;  1CB1 A;  4USL A;  1F4Q A;  1AJ4 A;  1B1G A;  4JD9 A;  4YGC B;  1B7T Y;  4GGF C;  1CDM A;  1XFX O;  1T14 A;  2JXC A;  4OR9 B;  4PE4 A;  3DYE A;  3BJH A;  1UHK A;  1OZS A;  4JWQ A;  1UHI A;  2PYQ A;  1NWD A;  1BR1 B;  2ZFD A;  2K2F A;  1JF2 A;  3BUN B;  3F45 A;  2BL0 B;  1PUL A;  3HCM A;  4PE7 A;  1XVJ A;  4XJK B;  3D75 A;  4PE0 A;  4ZCV A;  1JC2 A;  1RWY A;  2BCA A;  4NDC A;  4YGB B;  3KHE A;  1RJV A;  2KAY A;  3SG5 A;  2LUX A;  2NCP A;  1K93 D;  2LVI A;  3BFA A;  1S6I A;  2LMU A;  4FTG A;  3MSE B;  3NSL A;  4MEW A;  3SS5 A;  1K8U A;  1NPQ A;  1JFJ A;  1A2X A;  1DF0 A;  1NX0 A;  2P70 A;  2HPS A;  4PHM A;  2K7D A;  4E68 A;  3CAB A;  4HSZ A;  5CSI A;  2MHH A;  1RTP 1;  3CZ1 A;  1K9P A;  3FE6 A;  2FJU B;  2MAZ A;  2WOS A;  1KFX L;  2JT0 A;  3CWG A;  4WQ3 A;  4ETO A;  2L5Y A;  2QAC A;  3OGN A;  2D8N A;  2Y1M A;  3S0D A;  1UP5 A;  1BR4 B;  2JRF A;  1DGV A;  1KSO A;  3EVR A;  4GPL B;  1CKK A;  1JWD A;  2WC6 A;  3BUM B;  3V2L A;  2E6W A;  1ORG A;  5CSN A;  4WRI A;  1ZUZ A;  4ICB A;  1PAL A;  1F4O A;  2V53 A;  1DVI A;  3BYA A;  3FS7 A;  4PAL A;  5AEQ A;  1DC1 A;  1TNP A;  2EHB A;  4TNC A;  4MSP A;  1IG5 A;  3SIA A;  4NQG A;  1GM0 A;  1XO5 A;  3BUX B;  1IWQ A;  1PSB A;  4KYN A;  1B9A A;  1CLM A;  1TOP A;  2P6B B;  1OZO A;  1SL9 A;  2JXL A;  1IRJ A;  2KBM A;  2G9B A;  2EC6 C;  3DF0 B;  2M0R A;  2M8U A;  1U5I B;  2I2R E;  3I5G B;  3S0G A;  5KU1 A;  2H8V A;  2LVK A;  1R6P A;  1YTZ C;  2PAL A;  3L4L A;  4YGD B;  1B4C A;  2H2K A;  2YGU A;  3BOW B;  1ZOT B;  3BUO B;  1QV1 A;  5HKZ A;  4QJ5 B;  1GGW A;  3CZT X;  5EL2 A;  5I2L A;  2JNX A;  3FE8 A;  1SR6 C;  2K7C A;  2OS8 B;  2NXQ A;  3TS5 C;  4YGA A;  2AUC A;  3OB1 B;  2KLE A;  3GK1 A;  4ORC B;  3TUY B;  4C0J A;  4PHK A;  3HX4 A;  4F7F A;  4N5X A;  2MJW B;  2ZNE A;  1JFK A;  2M97 A;  4PDZ A;  4F0Z B;  2M1U A;  5FYX A;  1LA3 A;  4QJ4 B;  3D77 A;  2FCD A;  2QEH A;  2A4J A;  4INW A;  3ZWH A;  3VRN A;  1CDP A;  1CLB A;  3VRR A;  1XFZ O;  4CLN A;  1QX2 A;  3AKB A;  3I5I B;  1FBV A;  1MUX A;  2LP2 A;  4L9M A;  1LS8 A;  1K9U A;  3EKJ A;  3PAL A;  2P71 A;  1S3P A;  1QS7 A;  3O78 A;  2BCB A;  4DCK A;  3DF0 A;  3LLE A;  4MZJ A;  1KWO B;  1U5I A;  4MZL A;  1XK4 C;  4PHJ A;  2VRG A;  3AAJ A;  1CFF A;  2NZ0 A;  2JU0 A;  1P28 A;  2WCF A;  1YVH A;  3O6B A;  1WY9 A;  3FIA A;  1BOD A;  1DJZ A;  2L51 A;  3BOW A;  1DJH A;  1QWV A;  2JTT A;  1OOF A;  2O60 A;  1NYA A;  1ALW A;  3R72 A;  1HT9 A;  4N1F A;  4XJK A;  4HRG A;  4I5N B;  1OE9 B;  5I94 A;  1F54 A;  4CID A;  4GBA A;  1S5G Z;  1KSM A;  1NCY A;  1TCF A;  1TNX A;  2BKI B;  4IJ7 A;  1LA0 A;  1DQE A;  4M2O A;  5HLO A;  1CNP A;  1F8H A;  5I2Q A;  1N0Y A;  1UHJ A;  3EK4 A;  1WLZ A;  2CTN A;  3BQ3 A;  3DVJ A;  2DOQ A;  2BE4 A;  2KI6 C;  2K60 A;  3DVE A;  4IL1 A;  5AAN A;  4CPV A;  1KQM B;  2HET A;  2QEV A;  4M2P A;  3JTD C;  1CMG A;  3IF7 A;  2LHL A;  5BPJ A;  5JOL A;  3Q8I A;  1B7T Z;  1BU3 A;  4PE1 A;  3OX6 A;  1M63 B;  2Q91 A;  1KFU S;  2QDI A;  2KNE A;  3H4S E;  3CR4 X;  3I5H B;  3O2P A;  1CFC A;  3NGV A;  1Y1X A;  1CFD A;  3DXL A;  1IKU A;  2ZKM X;  1OQP A;  3VRQ A;  2K2A A;  4JKT A;  1OOG A;  2O5G A;  3NSI A;  4MRY A;  2KI4 B;  5DKQ A;  4MLW A;  2GGZ A;  2OTG C;  1QIV A;  1SL8 A;  1CDL A;  1V1G A;  1KQV A;  1MF8 B;  2GV5 A;  2LE9 B;  1DEL A;  5B8I B;  3FWB A;  3B87 A;  1EG3 A;  3IQQ A;  1EXR A;  1DGU A;  3TZ1 A;  1J7O A;  2L0P A;  3CZ0 A;  3CZ2 A;  1NX1 A;  2K7B A;  1FW4 A;  1A29 A;  1NX2 A;  3I5F C;  3IQO A;  1G4Y R;  2KBI A;  1OOH A;  1YUT A;  4N1G A;  4DS7 A;  1AUI B;  1C3Z A;  5G08 A;  2JUL A;  5HLV A;  4I5J A;  3PN7 C;  1G33 A;  1JUO A;  2KFF A;  2KDH A;  5DIC A;  1KK8 C;  1TWO A;  5J3X A;  3TDI A;  1KK7 Z;  2F33 A;  1L2O B;  3PM2 A;  3L4A A;  1AP4 A;  2LVV A;  2M49 B;  1IH0 A;  4UPG A;  1KFU L;  3JVT B;  1KK7 Y;  1W7J B;  1SPY A;  1F71 A;  4GAO A;  1RK9 A;  3DD4 A;  3WNX B;  1FPW A;  1M46 A;  2KFH A;  1ZFS A;  5DKN A;  4M2Q A;  1LIN A;  1EG4 A;  1TNW A;  4GUK A;  1TUZ A;  5HL1 A;  1Z4H A;  1GJY A;  3L47 A;  2L4I A;  1R2U A;  1LVC D;  4YGE B;  3VB1 A;  1XFR A;  2LAN A;  3DVM A;  1WRZ A;  2QPT A;  1J1E A;  5HYD A;  2JT3 A;  2KLD A;  4Q04 A;  4ORB B;  3SJS A;  2L2E A;  2MA2 A;  2ZRT A;  1BMO A;  2KPH A;  3BFH A;  4P5O E;  4AOM A;  2AAO A;  1UUR A;  4C0K A;  2LV7 A;  2CT9 A;  3B6X A;  3CR5 X;  1OMD A;  1OOI X;  1OW4 A;  3PLF B;  5IBW A;  4GNK B;  3GK2 A;  1KCY A;  1OMV A;  1CM4 A;  1CTR A;  1UWO A;  3NSK A;  5FI2 A;  3RM1 A;  1Q80 A;  4ORA B;  1AVS A;  1JF0 A;  1BOC A;  1J7R A;  2NCO A;  1E8A A;  3BXK A;  3D10 A;  1WDC C;  3N7H A;  2WCE A;  5D7F A;  2Y1N A;  2H61 C;  1C7W A;  1TCO B;  1SCM C;  2SAS A;  1BF5 A;  3IVT A;  3TDU A;  3SG2 A;  4QJ3 B;  3LCP C;  1RRO A;  3ZNI A;  2BKH B;  4I5L B;  5HKY A;  1B8R A;  2M7N A;  2KFG A;  4WQ2 A;  1L7Z A;  3SS3 A;  2JQ6 A;  1Z2C B;  1W7I B;  2WCH A;  2MLE C;  2COL B;  4PHN A;  3A8R A;  4I5K A;  1NIW A;  1QX5 B;  2KGR A;  1SNL A;  1PVB A;  2PVB A;  4GGF A;  1ALV A;  1J7P A;  1WLM A;  1XYD A;  2E30 A;  3GOF A;  2CCM A;  2BE6 A;  1LXF C;  1QLK A;  2L2C A;  4A4C A;  3S0E A;  2MBX A;  1TTX A;  5CSJ A;  3CYZ A;  4XYN A;  1EJ3 A;  4JPZ B;  1DJX A;  1MQ1 A;  5HKW A;  4D1E A;  1BJF A;  1K9K A;  1A4P A;  2KYF A;  2BNX A;  1YUR A;  3NHT A;  5FI7 A;  1SL7 A;  3SIB A;  4JQ0 D;  3AKA A;  3ICB A;  1FI5 A;  1S1E A;  2PSR A;  1YX8 A;  3D78 A;  2CNP A;  2K0J A;  2KSP A;  2LCP A;  5F6T A;  1Y1U A;  2IS9 A;  2KAX A;  1B47 A;  2WCB A;  2ZRS A;  3CS1 A;  5AER A;  3DZT A;  2EC6 B;  1X02 A;  1CDN A;  1FI6 A;  3TDZ A;  2LVJ A;  1IQ5 A;  1M39 A;  2JNF A;  1H4B A;  2BAP A;  1QLS A;  2KAV A;  3CTN A;  1TRF A;  1DEK A;  2L98 A;  3CR2 A;  4FQO A;  2BBM A;  2FCE A;  2FJY A;  4BY4 A;  2WOR A;  1MR8 A;  1XFV O;  3QRX A;  5ER5 A;  1XA5 A;  1K90 D;  2JZI A;  1Y6W A;  1QV0 A;  4R1E A; 
#chains in the Genus database with same CATH homology
 4A4B A;  1J55 A;  1QAT A;  2KOT A;  3D0Y B;  1SR6 B;  3TS5 B;  1QJT A;  2JTZ A;  1NCZ A;  2I7A A;  2BL0 C;  1NCX A;  2AMI A;  4P2Y B;  1MWN A;  4CFQ A;  1SK6 D;  1F55 A;  1SW8 A;  5KTY A;  2SCP A;  1IJ5 A;  2F3Y A;  5TNC A;  2CXJ A;  1S6C A;  1CMF A;  3FWC A;  4MN0 A;  4OKH A;  4OVN F;  1UHH A;  1REC A;  1C7V A;  3K21 A;  2M3W A;  2PAS A;  2HF5 A;  2LNK A;  2LLU A;  2OPO A;  1C07 A;  2BBN A;  2ZN9 A;  2F2P A;  1Y0V H;  1IQ3 A;  2PRU A;  1EH2 A;  1A75 B;  4PCW A;  2GGM A;  5AFP A;  1BG1 A;  2B1U A;  2K7O A;  3KF9 A;  2JT8 A;  4DRW A;  1FF1 A;  4MVF A;  5PAL A;  1GQM A;  3WXA A;  2R2I A;  1F70 A;  3SG7 A;  2MRD A;  5I8N A;  3EKH A;  4OV2 A;  2JWW A;  1NX3 A;  1KFX S;  2L4H A;  3D0Y A;  1M31 A;  2F8P A;  1B8L A;  1GGZ A;  3PFV A;  2L50 A;  4YI8 A;  1V1F A;  3WHT B;  1QTX A;  1S6J A;  3M0W A;  1XFW O;  1HQV A;  2G2B A;  3LK0 A;  1K94 A;  3PM8 A;  1DJW A;  2LC5 A;  3LK1 A;  5KSZ A;  4HRH A;  3SG4 A;  2Y4Q A;  2ZND A;  3VRO A;  4GGN A;  3AAK A;  1AK8 A;  2ZN8 A;  3A4U B;  3DVK A;  5D69 A;  5GQQ C;  3JTD B;  3OX5 A;  4C0L A;  1ZAC A;  3I5G C;  4YBH B;  2PMY A;  1QX7 A;  1A75 A;  2JPT A;  2M7L A;  1ZMZ A;  1VRK A;  1YVL A;  1YUS A;  2K8M B;  1XK4 A;  2FOT A;  1Y1A A;  1SY9 A;  1RFJ A;  3SG3 A;  1XFU O;  3BUW B;  3EVU A;  2CBL A;  1CLL A;  1DJY A;  1NSH A;  1DMO A;  2OS8 C;  2OTG B;  3TUY C;  1SKT A;  1J1D A;  1WRL A;  4MRX A;  2F2O A;  2ISD A;  4BY5 A;  1N65 A;  1ODB A;  1PRW A;  2TN4 A;  4ZCU A;  4CFR A;  1S26 D;  1S36 A;  2LMT A;  1SBJ A;  2WC8 A;  3I5F B;  2RGI A;  2KYC A;  3KPX A;  1J7Q A;  5CSF A;  3OHM B;  5I2O A;  3PN7 B;  1D1O A;  3I5I C;  1IJ6 A;  3CLN A;  1DTL A;  1KK8 B;  2NLN A;  1YRT B;  1PK0 D;  5K89 A;  1KWO C;  2JC2 A;  2KGB C;  2M29 A;  4DIR A;  3WHU B;  1XFY O;  1UHN A;  1EL4 A;  1TN4 A;  3OP0 A;  2Y5I A;  2L5X B;  1SYM A;  2HQ8 A;  2HQW A;  1DJG A;  1QVI Z;  4MBE A;  1YRU B;  1QVI Y;  3EVV A;  1AJ5 A;  2Q4U A;  2WND A;  1MXL C;  1DJI A;  1WRK A;  1CFP A;  2I94 A;  3E3R A;  1A03 A;  3PSR A;  1MHO A;  3NXA A;  4AQJ A;  3EK8 A;  3KEV A;  2LHI A;  1OMR A;  2M1K B;  3GK4 X;  2KI6 D;  4YRU A;  4AQI A;  3LL8 B;  1KQM C;  1NUB A;  5AXI A;  2M9G A;  1BT6 A;  1JSA A;  1AHR A;  2KHN A;  1K96 A;  4NDB A;  1MXE A;  1N2D A;  1WDC B;  3C1V A;  4GFT A;  2LUC A;  1YUU A;  2MLF C;  3I5H C;  1SCM B;  4OCI A;  4NDD A;  2LMV A;  3OB2 B;  2LLS A;  1DT7 B;  1H8B A;  4YI9 A;  2KI4 C;  2K61 A;  3EK7 A;  3NSO A;  2F3Z A;  2EGD A;  1PVA A;  4HRE E;  1SCV A;  3RLZ A;  1UUS A;  4U8D A;  2I18 A;  1CM1 A;  1IGV A;  1OSA A;  5JJG A;  1NP8 A;  1YX7 A;  3CGA A;  3SG6 A;  1JBA A;  5ER4 X;  1YR5 A;  1BLQ A;  1TNQ A;  5DKR A;  3KO0 A;  4MZK A;  1QXP A;  5CPV A;  4DUQ A;  3PAT A;  1QAS A;  2LAP A;  1S5G Y;  3VRP A;  1SMG A;  1QIW A;  2LP3 A;  3O4Y A;  1L2O C;  1DF0 B;  1SRA A;  1M45 A;  2BEC A;  1PSR A;  3VGO A;  2LM5 A;  1LKJ A;  2KQ6 A;  2LLT A;  3JVT C;  1K2H A;  1B8C A;  1G8I A;  2BCX A;  2H61 A;  1OOJ A;  1K95 A;  2JOJ A;  1TIZ A;  2KQY A;  1CB1 A;  4USL A;  1F4Q A;  1AJ4 A;  1B1G A;  4YGC B;  1B7T Y;  4GGF C;  1CDM A;  1XFX O;  2JXC A;  4OR9 B;  4PE4 A;  1UHK A;  1OZS A;  4JWQ A;  1UHI A;  1NWD A;  1BR1 B;  2ZFD A;  2K2F A;  1JF2 A;  3BUN B;  3F45 A;  2BL0 B;  1PUL A;  3HCM A;  4PE7 A;  1XVJ A;  4XJK B;  4PE0 A;  4ZCV A;  1JC2 A;  1RWY A;  2BCA A;  4NDC A;  4YGB B;  3KHE A;  1RJV A;  2KAY A;  3SG5 A;  2LUX A;  2NCP A;  1K93 D;  2LVI A;  1S6I A;  2LMU A;  4FTG A;  3MSE B;  3NSL A;  4MEW A;  1K8U A;  1NPQ A;  1JFJ A;  1A2X A;  1DF0 A;  1NX0 A;  2HPS A;  4PHM A;  2K7D A;  4E68 A;  4HSZ A;  5CSI A;  2MHH A;  1RTP 1;  1K9P A;  2FJU B;  2MAZ A;  2WOS A;  1KFX L;  2JT0 A;  3CWG A;  4WQ3 A;  4ETO A;  2QAC A;  2D8N A;  2Y1M A;  1UP5 A;  1BR4 B;  2JRF A;  1DGV A;  1KSO A;  3EVR A;  4GPL B;  1CKK A;  1JWD A;  3BUM B;  2E6W A;  5CSN A;  4WRI A;  1ZUZ A;  4ICB A;  1PAL A;  1F4O A;  2V53 A;  1DVI A;  3BYA A;  3FS7 A;  4PAL A;  5AEQ A;  1TNP A;  2EHB A;  4TNC A;  4MSP A;  1IG5 A;  3SIA A;  4NQG A;  1XO5 A;  3BUX B;  1IWQ A;  1PSB A;  1B9A A;  1CLM A;  1TOP A;  2P6B B;  1OZO A;  1SL9 A;  2JXL A;  1IRJ A;  2KBM A;  2G9B A;  2EC6 C;  3DF0 B;  2M0R A;  2M8U A;  1U5I B;  2I2R E;  3I5G B;  5KU1 A;  2LVK A;  1R6P A;  1YTZ C;  2PAL A;  4YGD B;  1B4C A;  2H2K A;  3BOW B;  1ZOT B;  3BUO B;  1QV1 A;  5HKZ A;  4QJ5 B;  1GGW A;  3CZT X;  5I2L A;  2JNX A;  1SR6 C;  2K7C A;  2OS8 B;  2NXQ A;  3TS5 C;  4YGA A;  2AUC A;  3OB1 B;  3GK1 A;  4ORC B;  3TUY B;  4C0J A;  4PHK A;  3HX4 A;  4N5X A;  2MJW B;  2ZNE A;  1JFK A;  2M97 A;  4PDZ A;  4F0Z B;  2M1U A;  5FYX A;  1LA3 A;  4QJ4 B;  2FCD A;  2A4J A;  3ZWH A;  3VRN A;  1CDP A;  1CLB A;  3VRR A;  1XFZ O;  4CLN A;  1QX2 A;  3AKB A;  3I5I B;  1FBV A;  1MUX A;  2LP2 A;  4L9M A;  1K9U A;  3EKJ A;  3PAL A;  1S3P A;  1QS7 A;  3O78 A;  2BCB A;  4DCK A;  3DF0 A;  3LLE A;  4MZJ A;  1KWO B;  1U5I A;  4MZL A;  1XK4 C;  4PHJ A;  2VRG A;  3AAJ A;  1CFF A;  2NZ0 A;  2JU0 A;  2WCF A;  1YVH A;  3O6B A;  1WY9 A;  3FIA A;  1BOD A;  1DJZ A;  2L51 A;  3BOW A;  1DJH A;  2JTT A;  2O60 A;  1NYA A;  1ALW A;  1HT9 A;  4N1F A;  4XJK A;  4HRG A;  4I5N B;  1OE9 B;  1F54 A;  4CID A;  4GBA A;  1S5G Z;  1KSM A;  1NCY A;  1TCF A;  1TNX A;  2BKI B;  4M2O A;  1LA0 A;  1CNP A;  5HLO A;  1F8H A;  5I2Q A;  1N0Y A;  1UHJ A;  3EK4 A;  1WLZ A;  2CTN A;  3BQ3 A;  3DVJ A;  2DOQ A;  2BE4 A;  2KI6 C;  3DVE A;  4IL1 A;  5AAN A;  4CPV A;  1KQM B;  2HET A;  4M2P A;  3JTD C;  1CMG A;  3IF7 A;  2LHL A;  5BPJ A;  5JOL A;  1B7T Z;  1BU3 A;  4PE1 A;  3OX6 A;  1M63 B;  2Q91 A;  1KFU S;  2KNE A;  3H4S E;  3CR4 X;  3I5H B;  3O2P A;  1CFC A;  1Y1X A;  1CFD A;  1IKU A;  2ZKM X;  1OQP A;  3VRQ A;  2K2A A;  2O5G A;  3NSI A;  4MRY A;  2KI4 B;  5DKQ A;  4MLW A;  2GGZ A;  2OTG C;  1QIV A;  1SL8 A;  1CDL A;  1V1G A;  1KQV A;  1MF8 B;  2GV5 A;  2LE9 B;  5B8I B;  3FWB A;  1EG3 A;  3IQQ A;  1EXR A;  1DGU A;  3TZ1 A;  1J7O A;  2L0P A;  1NX1 A;  2K7B A;  1FW4 A;  1A29 A;  1NX2 A;  3I5F C;  3IQO A;  1G4Y R;  2KBI A;  4N1G A;  1YUT A;  4DS7 A;  1AUI B;  5G08 A;  2JUL A;  5HLV A;  4I5J A;  3PN7 C;  1G33 A;  1JUO A;  2KFF A;  2KDH A;  1KK8 C;  5J3X A;  3TDI A;  1KK7 Z;  2F33 A;  1L2O B;  1AP4 A;  2LVV A;  2M49 B;  1IH0 A;  4UPG A;  1KFU L;  3JVT B;  1KK7 Y;  1W7J B;  1SPY A;  1F71 A;  4GAO A;  1RK9 A;  3DD4 A;  3WNX B;  1FPW A;  1M46 A;  2KFH A;  1ZFS A;  5DKN A;  4M2Q A;  1LIN A;  1EG4 A;  1TNW A;  4GUK A;  1GJY A;  2L4I A;  1R2U A;  1LVC D;  4YGE B;  2LAN A;  3DVM A;  1WRZ A;  2QPT A;  1J1E A;  5HYD A;  2JT3 A;  4Q04 A;  4ORB B;  3SJS A;  2L2E A;  2MA2 A;  2ZRT A;  1BMO A;  4P5O E;  4AOM A;  2AAO A;  1UUR A;  4C0K A;  2LV7 A;  2CT9 A;  3CR5 X;  1OMD A;  5IBW A;  3PLF B;  4GNK B;  3GK2 A;  1KCY A;  1OMV A;  1CM4 A;  1CTR A;  1UWO A;  3NSK A;  3RM1 A;  1Q80 A;  4ORA B;  1AVS A;  1JF0 A;  1BOC A;  1J7R A;  2NCO A;  1E8A A;  3BXK A;  3D10 A;  1WDC C;  5D7F A;  2WCE A;  2Y1N A;  2H61 C;  1C7W A;  1TCO B;  1SCM C;  2SAS A;  1BF5 A;  3TDU A;  3SG2 A;  4QJ3 B;  3LCP C;  1RRO A;  3ZNI A;  2BKH B;  4I5L B;  5HKY A;  1B8R A;  2M7N A;  2KFG A;  4WQ2 A;  1L7Z A;  2JQ6 A;  1W7I B;  2MLE C;  2COL B;  4PHN A;  3A8R A;  4I5K A;  1NIW A;  1QX5 B;  2KGR A;  1SNL A;  1PVB A;  2PVB A;  4GGF A;  1ALV A;  1J7P A;  1WLM A;  1XYD A;  2E30 A;  3GOF A;  2CCM A;  2BE6 A;  1LXF C;  1QLK A;  4A4C A;  2MBX A;  1TTX A;  5CSJ A;  4XYN A;  1EJ3 A;  4JPZ B;  1DJX A;  1MQ1 A;  5HKW A;  4D1E A;  1BJF A;  1K9K A;  1A4P A;  2KYF A;  3SIB A;  1YUR A;  1SL7 A;  4JQ0 D;  3AKA A;  3ICB A;  1FI5 A;  1S1E A;  2PSR A;  1YX8 A;  2CNP A;  2K0J A;  2KSP A;  2LCP A;  5F6T A;  1Y1U A;  2IS9 A;  2KAX A;  1B47 A;  2WCB A;  2ZRS A;  3CS1 A;  5AER A;  2EC6 B;  1X02 A;  1CDN A;  1FI6 A;  3TDZ A;  2LVJ A;  1IQ5 A;  1M39 A;  2JNF A;  1H4B A;  1QLS A;  2KAV A;  3CTN A;  1TRF A;  3CR2 A;  2L98 A;  4FQO A;  2BBM A;  2FCE A;  4BY4 A;  2WOR A;  1MR8 A;  1XFV O;  3QRX A;  5ER5 A;  1XA5 A;  1K90 D;  2JZI A;  1Y6W A;  1QV0 A;  4R1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...