2JRFA

Solution nmr structure of tubulin polymerization-promoting protein family member 3 from homo sapiens. northeast structural genomics target hr387.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Tubulin polymerization-promoting protein family member 3
publication title Solution NMR structure of Tubulin polymerization-promoting protein family member 3 from Homo sapiens.
rcsb
source organism Homo sapiens
total genus 45
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05517 p25-alpha p25-alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jrfA01
1TNQA 5HKZA 4DCKA 3JVTB 1K9KA 2LC5A 3I5GC 1L7ZA 1TTXA 1KQMC 2QPTA 1KSOA 1NYAA 2JC2A 2L2EA 1V1GA 2R2IA 2TN4A 4M2OA 1HT9A 1SRAA 2JZIA 3FWBA 4PCWA 2KI4B 1QTXA 4XJKB 2LNKA 1SL9A 2JPTA 1E8AA 2NCOA 1QIVA 3LCPC 2OTGC 3NXAA 3PN7B 2OS8C 5AANA 3VRPA 5KSZA 1K9PA 3M0WA 1F4OA 1CTRA 2WORA 2LM5A 4P5OE 1JFKA 1UWOA 2I2RE 2JTTA 1A75A 2LLSA 1TNXA 2GGZA 3BYAA 1YUUA 1FBVA 1BR4B 1QLSA 1OMDA 1UHJA 3FIAA 1B9AA 1SL7A 3AKBA 1YUTA 4YI8A 1N65A 1BJFA 1QJTA 1XFZO 2FJUB 3LL8B 2KYFA 5JOLA 2WCBA 3O78A 1MF8B 1ALVA 3JVTC 5HLOA 4GAOA 5HYDA 1K8UA 1J55A 2BCBA 4M2QA 1CM1A 1A75B 3I5IB 4YRUA 5ER4X 4BY5A 3KPXA 2KI4C 2KFGA 1ALWA 3EK8A 1AJ4A 3VGOA 1CDPA 1OZSA 5AERA 1EG4A 2L5XB 4AQIA 1OQPA 1D1OA 2OPOA 4CFRA 1H8BA 3PN7C 1DJWA 2HF5A 1WLZA 1B7TY 1KFXS 3LLEA 5J3XA 1QX7A 2WCEA 4PHJA 3IQOA 1QXPA 3I5FB 1BU3A 4PE4A 5B8IB 1PVBA 1JF0A 1K9UA 1TRFA 1UHNA 1OMRA 4IL1A 4YGDB 1F54A 1UURA 1CLMA 1IWQA 1UHHA 2WC8A 2ZFDA 1AVSA 4WQ2A 4NDCA 2LHIA 4CPVA 1L2OB 3TDZA 2M7LA 1KFUL 2LVJA 4ZCUA 2WNDA 2G2BA 4PHNA 1EL4A 4ORBB 2JT0A 2K2FA 5HKWA 1DJIA 2M3WA 4ORAB 1KQVA 1Q80A 2LAPA 3O6BA 3VRQA 1IG5A 4F0ZB 1QV1A 5JJGA 1KCYA 5CSJA 1KK7Z 1MXLC 2KSPA 1W7IB 1CMGA 1SL8A 1NWDA 1SBJA 1AUIB 2PVBA 3I5IC 1XA5A 2KDHA 3LK0A 2MLEC 4ORCB 2NCPA 4GUKA 1FF1A 1XK4C 4TNCA 5I2LA 5K89A 5PALA 2LANA 1JUOA 2D8NA 1A2XA 1C7WA 3SG4A 4OR9B 1CM4A 3BUMB 1DF0A 1BR1B 2AAOA 4U8DA 1IH0A 2BBNA 4N1FA 3CR4X 3DF0B 4OV2A 3ZNIA 2BKIB 3I5FC 1F8HA 2B1UA 2PSRA 3VRRA 3KEVA 4ICBA 2M49B 5AXIA 1QATA 1S5GZ 2NXQA 1M46A 1F71A 3OX5A 2SASA 1CDMA 1TNPA 1Y1UA 1L2OC 1TOPA 2I94A 4GGFC 1K94A 2LP2A 3K21A 1DF0B 1QX2A 3SG6A 2M97A 1ZOTB 1EG3A 4XYNA 1DGVA 1IQ3A 3HX4A 1OOJA 1IJ5A 2JXLA 2K7CA 1FW4A 2MA2A 2KQYA 3SG2A 2JNXA 1KFUS 4MVFA 1K2HA 2AMIA 2M1KB 2EGDA 1YUSA 4HSZA 4PE7A 1Y1AA 2BL0B 2GGMA 1QVIZ 1RFJA 2H2KA 4HRHA 1M39A 1A29A 2LUCA 4I5KA 4CIDA 4D1EA 1AHRA 2H61C 4FQOA 1NCYA 1G4YR 2LVIA 1RECA 1RJVA 2JTZA 2KFHA 2L4IA 4HRGA 2COLB 2LP3A 2KI6C 2EC6B 1DJZA 1WDCB 5CSNA 1R6PA 1BLQA 3NSLA 1S26D 4ZCVA 1NCXA 1WRKA 4MLWA 3H4SE 1FI5A 5CPVA 1SKTA 1YR5A 1YX8A 2LVKA 4A4BA 1IKUA 1S1EA 4YGCB 4YBHB 1PSRA 1RK9A 2BCAA 2IS9A 2QACA 1CLBA 2M0RA 3BUOB 3DVJA 4PHKA 3A4UB 1XO5A 1RTP1 2HQ8A 4QJ5B 1BG1A 1CFFA 1B47A 3SIBA 1RROA 1JF2A 3SG3A 3VROA 1SCMB 2ZNDA 2JU0A 3AAKA 3EVRA 1XFWO 1TCFA 1K93D 1OE9B 1S6CA 1G8IA 3TUYB 3IF7A 2CNPA 1GQMA 1ODBA 1NCZA 1TCOB 1U5IA 3PALA 2BBMA 1X02A 1CKKA 3EKHA 1NX0A 3DVMA 5G08A 1PALA 1PULA 2JOJA 1YVHA 1J7RA 1QV0A 3RLZA 3BUXB 2F2PA 1CB1A 2BL0C 3ICBA 5BPJA 3E3RA 2Q4UA 1M31A 1S36A 2Y1MA 2CT9A 2F8PA 3D10A 2KGBC 1EJ3A 3KF9A 4JPZB 2F2OA 1J7OA 5CSFA 2EC6C 1U5IB 1WDCC 1XFXO 2MHHA 1MQ1A 2ISDA 2ZNEA 4WQ3A 1KK8B 4USLA 2K0JA 2LLUA 4YGAA 4M2PA 4MBEA 2F33A 3BOWA 3CTNA 4PE0A 2F3ZA 4PE1A 3PSRA 3TZ1A 1N2DA 1XYDA 4PDZA 2KBMA 2CTNA 1ZACA 1SCMC 3NSIA 3F45A 1IRJA 2JT8A 3ZWHA 2V53A 3D0YA 2K7BA 3FS7A 3TUYC 4WRIA 4MZJA 3EVVA 1JSAA 1LVCD 1FI6A 2WCFA 2M8UA 1S6JA 2LHLA 4AQJA 3BOWB 1DMOA 1OZOA 1CFPA 4MEWA 2LMUA 1DJGA 1DJHA 2PRUA 3PFVA 1Y0VH 2K8MB 2KAYA 3MSEB 1LXFC 4QJ3B 1EH2A 2MRDA 3WXAA 3IQQA 1DGUA 1B8RA 4OKHA 4ETOA 1NIWA 3KO0A 3D0YB 3EK4A 2A4JA 2LMVA 2AUCA 2ZRTA 1PRWA 3TDUA 4E68A 1KK8C 1M45A 4DUQA 4HREE 3O4YA 1SMGA 2JT3A 3C1VA 1NX3A 1DVIA 1NP8A 1F4QA 3FWCA 4MZKA 1MR8A 5TNCA 3LK1A 2KBIA 3AAJA 1SR6B 1WRZA 4CFQA 4GGNA 1QIWA 5DKQA 1SCVA 2K2AA 2L50A 1DJYA 1B8CA 1UHKA 3WHUB 3CLNA 2G9BA 5I2OA 4YGBB 1F70A 3O2PA 5CSIA 1NPQA 1MHOA 3CR2A 1MXEA 2L51A 2KFFA 4JWQA 3AKAA 1B7TZ 2MAZA 2DOQA 5IBWA 4A4CA 3NSKA 1K90D 1LKJA 1KSMA 3PATA 4JQ0D 1N0YA 2BE6A 1H4BA 1NSHA 1XFUO 4UPGA 1W7JB 2CBLA 5F6TA 3GK1A 4NDBA 1TN4A 3DVKA 5AFPA 1V1FA 2MBXA 4C0JA 4DS7A 2K7DA 1YVLA 1YURA 4MSPA 1JWDA 4GPLB 3CWGA 3GK4X 1B8LA 1KWOB 2Y5IA 2JNFA 1NX1A 1C07A 4PALA 2RGIA 1CDLA 2PASA 3CZTX 5I2QA 4YGEB 1Y6WA 1KFXL 5AEQA 5DKRA 1R2UA 1SR6C 3BUWB 3SIAA 5HKYA 5KU1A 1XFYO 1BT6A 1QX5B 2Q91A 2P6BB 3WNXB 1K96A 4NDDA 3PM8A 4Q04A 1KK7Y 3EVUA 3EKJA 1HQVA 3TS5B 1VRKA 3VRNA 3CGAA 1GGWA 5D7FA 2EHBA 4BY4A 4C0LA 4DIRA 5GQQC 4GFTA 3A8RA 2JWWA 1S6IA 5HLVA 4I5NB 1K95A 4NQGA 2LMTA 1G33A 3SJSA 4FTGA 2L98A 1XK4A 1NX2A 4YI9A 4AOMA 1F55A 1YTZC 3NSOA 2ZN9A 3EK7A 1S5GY 1KWOC 2M9GA 2LUXA 4C0KA 3OB1B 2KQ6A 1SPYA 2BKHB 1J1EA 4N5XA 4GBAA 2M29A 3SG7A 2E6WA 2K7OA 1IQ5A 5D69A 3HCMA 2L0PA 2I7AA 2M1UA 1SK6D 1M63B 1UP5A 3CS1A 2JQ6A 1CMFA 3OB2B 5ER5A 4L9MA 1YRTB 1TIZA 4GGFA 3GK2A 2Y1NA 2PALA 4MN0A 3TS5C 2Y4QA 2BECA 1LA3A 1JFJA 2HETA 4N1GA 2LCPA 1LA0A 1PVAA 3JTDB 1UHIA 1IJ6A 1LINA 1IGVA 1QVIY 3I5HB 1J7PA 4MZLA 1BOCA 2NZ0A 3QRXA 1NUBA 1FPWA 2M7NA 2SCPA 2WOSA 1CNPA 2LV7A 2HPSA 5KTYA 1ZUZA 1PSBA 2FOTA 1WRLA 1DTLA 2H61A 2KGRA 5I8NA 3DVEA 1Y1XA 2F3YA 4GNKB 1EXRA 1SW8A 2KNEA 2KOTA 4DRWA 4MRYA 1WY9A 1A03A 1CLLA 2BCXA 1DT7B 4OVNF 2PMYA 1J7QA 2ZN8A 3DF0A 4R1EA 1TNWA 1XVJA 1BMOA 1GGZA 1B1GA 1BODA 3I5GB 3OX6A 3WHTB 1KQMB 1QASA 1ZMZA 3GOFA 4OCIA 2KYCA 1S3PA 1PK0D 2KAVA 2LLTA 3BXKA 3TDIA 4CLNA 2K61A 2BE4A 1SYMA 1C7VA 3DD4A 1ZFSA 1WLMA 1SNLA 1A4PA 2FCDA 2L4HA 5DKNA 1CFCA 1YX7A 1J1DA 2GV5A 2CXJA 1BF5A 1JBAA 4I5LB 2OTGB 3OP0A 3JTDC 4PHMA 2HQWA 2OS8B 2ZKMX 2JULA 3BUNB 3I5HC 1MWNA 1QS7A 1SY9A 2KAXA 1QLKA 2I18A 2KHNA 2MJWB 2VRGA 1UUSA 3CR5X 4I5JA 2ZRSA 5FYXA 2JXCA 4QJ4B 1RWYA 1AJ5A 1MUXA 1OSAA 3SG5A 1CDNA 1CFDA 3KHEA 1DJXA 2O5GA 4P2YB 2FCEA 2MLFC 2JRFA 2KI6D 3PLFB 1GJYA 2NLNA 3OHMB 4XJKA 4MRXA 2O60A 1AP4A 1JC2A 2CCMA 1XFVO 1OMVA 1YRUB 3BQ3A 3RM1A 2E30A 1B4CA 2LE9B 2LVVA 1AK8A
chains in the Genus database with same CATH superfamily
3R1PA 1TNQA 2K60A 5HKZA 4DCKA 3JVTB 1K9KA 2LC5A 3I5GC 1L7ZA 1TTXA 3B88A 1KQMC 2QPTA 1KSOA 1NYAA 2JC2A 3B87A 2L2EA 1V1GA 2R2IA 2TN4A 5DICA 4M2OA 1HT9A 1SRAA 2JZIA 3FWBA 4PCWA 2KI4B 1QTXA 4XJKB 2LNKA 1SL9A 2L5YA 2JPTA 1E8AA 2NCOA 1QIVA 3LCPC 2OTGC 4KYNA 2QDIA 3NXAA 3PN7B 2OS8C 5AANA 3VRPA 2WC5A 5KSZA 1K9PA 3M0WA 1F4OA 1CTRA 2WORA 2LM5A 4P5OE 1LS8A 1JFKA 1OOGA 1UWOA 2I2RE 2JTTA 1A75A 2LLSA 1XFRA 1TNXA 2GGZA 3BYAA 1YUUA 1FBVA 1BR4B 2L2CA 1QLSA 1OMDA 1UHJA 3FIAA 1B9AA 1SL7A 3BJHA 2KLEA 3AKBA 1YUTA 4YI8A 1N65A 1BJFA 1QJTA 1XFZO 2FJUB 3LL8B 2KYFA 2P70A 5JOLA 3FE6A 2WCBA 3O78A 1MF8B 1ALVA 3JVTC 5HLOA 4GAOA 5HYDA 3D77A 1K8UA 1J55A 2BCBA 4M2QA 1CM1A 1A75B 3I5IB 1W9ZA 4YRUA 5ER4X 4BY5A 3KPXA 2KI4C 2KFGA 3CZ0A 1ALWA 3EK8A 1AJ4A 3VGOA 1CDPA 1OZSA 5AERA 1EG4A 2L5XB 4AQIA 1OQPA 1D1OA 2OPOA 4CFRA 1H8BA 3PN7C 1DJWA 2HF5A 1WLZA 1B7TY 1KFXS 3LLEA 5J3XA 1QX7A 2WCEA 4PHJA 3S0EA 3IQOA 1QXPA 3I5FB 1BU3A 4PE4A 5B8IB 1PVBA 1JF0A 1SSEB 1K9UA 1TRFA 1UHNA 1OMRA 4IL1A 4YGDB 1F54A 1UURA 1CLMA 1IWQA 1UHHA 2WC8A 5D3OA 2ZFDA 1AVSA 4WQ2A 4NDCA 2LHIA 4CPVA 1L2OB 3TDZA 2M7LA 1KFUL 2LVJA 4ZCUA 2WNDA 2G2BA 4PHNA 1EL4A 4ORBB 2JT0A 2K2FA 5HKWA 1DJIA 2M3WA 4ORAB 1KQVA 1Q80A 2LAPA 3O6BA 3VRQA 1IG5A 4F0ZB 3R72A 1QV1A 5JJGA 1KCYA 3Q8IA 5CSJA 1KK7Z 1MXLC 3NGVA 1OOFA 2KSPA 1W7IB 1CMGA 1SL8A 1NWDA 1SBJA 1AUIB 2PVBA 3I5IC 1XA5A 2FJYA 2KDHA 2MLEC 3LK0A 2NCPA 4ORCB 4GUKA 1FF1A 1XK4C 4TNCA 5I2LA 5K89A 5PALA 2LANA 1JUOA 2D8NA 1A2XA 1C7WA 3SG4A 4OR9B 1CM4A 3BUMB 3K1EA 3CABA 1DF0A 1BR1B 2AAOA 4IJ7A 4U8DA 1IH0A 2BBNA 4N1FA 3IVTA 3CR4X 3DF0B 4OV2A 3ZNIA 2BKIB 2PYQA 3DY9A 3I5FC 1F8HA 2B1UA 1GM0A 2PSRA 4OZDA 3VRRA 3KEVA 4ICBA 2M49B 5AXIA 1QATA 1S5GZ 2WC6A 2NXQA 1M46A 1F71A 3OX5A 2SASA 1CDMA 1TNPA 1Y1UA 1L2OC 1TOPA 2I94A 4GGFC 1K94A 3D74A 2LP2A 3S0FA 3K21A 1DF0B 1QX2A 3SG6A 3L4LA 2M97A 1ZOTB 1EG3A 4XYNA 1DGVA 2H8VA 1IQ3A 2WCLA 2QEVA 1C3YA 3HX4A 1OOJA 3S0DA 1IJ5A 2JXLA 2K7CA 1FW4A 5FI7A 2MA2A 2KQYA 3SG2A 2JNXA 1KFUS 2WCMA 4MVFA 1K2HA 2AMIA 2BNXA 2EGDA 2M1KB 1YUSA 4HSZA 4PE7A 1Y1AA 2BL0B 2GGMA 1QVIZ 1RFJA 2H2KA 4HRHA 1M39A 1A29A 2LUCA 4I5KA 4CIDA 4D1EA 1AHRA 2H61C 4FQOA 5I94A 1NCYA 1G4YR 2LVIA 1RECA 1RJVA 2JTZA 2KFHA 2L4IA 3R1OA 4HRGA 2COLB 2LP3A 2KI6C 2EC6B 1C3ZA 1DJZA 1TUJA 1WDCB 5CSNA 1R6PA 1BLQA 3NSLA 1S26D 4ZCVA 1NCXA 1WRKA 3BFAA 3H4SE 4MLWA 5CPVA 1SKTA 1YR5A 1YX8A 2LVKA 4A4BA 1IKUA 1FI5A 1S1EA 4YGCB 4YBHB 2KPHA 1PSRA 1RK9A 2BCAA 2IS9A 2QACA 3L47A 2M0RA 3BUOB 3DVJA 4PHKA 1CLBA 3A4UB 1XO5A 1RTP1 2HQ8A 4QJ5B 1BG1A 1CFFA 1B47A 3SIBA 1RROA 1JF2A 4INWA 3SG3A 3VROA 4PT1A 1SCMB 2ZNDA 2JU0A 3AAKA 3EVRA 1XFWO 1TCFA 1K93D 1OE9B 1S6CA 2QEBA 1G8IA 3TUYB 3IF7A 2CNPA 1GQMA 1ODBA 1NCZA 1TCOB 1U5IA 2WCKA 2BBMA 1X02A 3EG5B 3PALA 3EKHA 3SS3A 1CKKA 1NX0A 3B86A 3DVMA 5G08A 1PALA 1PULA 2JOJA 1YVHA 1J7RA 1QV0A 3RLZA 3BUXB 2F2PA 1Z4HA 1CB1A 2BL0C 3DZTA 3ICBA 5BPJA 3NHTA 3E3RA 2Q4UA 1M31A 1S36A 2Y1MA 2CT9A 2F8PA 3D10A 3D75A 2KGBC 1EJ3A 3KF9A 4JPZB 2F2OA 1J7OA 5CSFA 2EC6C 1U5IB 1WDCC 1XFXO 2MHHA 1MQ1A 2ISDA 2ZNEA 4WQ3A 1KK8B 4USLA 2K0JA 2LLUA 4YGAA 4M2PA 4MBEA 2F33A 1DC1A 3BOWA 3CTNA 4PE0A 3CZ1A 2F3ZA 3PM2A 4PE1A 1T14A 3PSRA 3TZ1A 1N2DA 1XYDA 4PDZA 2KBMA 2CTNA 1ZACA 1SCMC 3NSIA 3F45A 1IRJA 2JT8A 3ZWHA 2V53A 3D0YA 2K7BA 3UNWA 3FS7A 3TUYC 4WRIA 3V2LA 4MZJA 3EVVA 1JSAA 1LVCD 3SS4A 4F7FA 1FI6A 2WCFA 3B7AA 2M8UA 1S6JA 2LHLA 4AQJA 3BOWB 1DMOA 5FI6A 1OZOA 1CFPA 4MEWA 2LMUA 1DJGA 1DJHA 2KLDA 2P71A 2PRUA 1Y0VH 2K8MB 2KAYA 3MSEB 3PFVA 1LXFC 4QJ3B 1EH2A 2MRDA 3WXAA 3IQQA 1DGUA 1B8RA 4OKHA 4ETOA 1NIWA 3KO0A 3D0YB 3EK4A 2A4JA 1DEKA 2LMVA 2AUCA 5HL1A 2ZRTA 1PRWA 5FI2A 3TDUA 1CDNA 4E68A 1KK8C 1M45A 4DUQA 2PQLA 4HREE 3O4YA 1SMGA 2JT3A 3C1VA 1NX3A 1DVIA 1NP8A 1F4QA 3FWCA 4MZKA 1MR8A 5TNCA 3LK1A 2KBIA 3AAJA 1SR6B 2QEHA 1WRZA 3R1VA 4CFQA 4GGNA 1QIWA 5DKQA 1SCVA 2K2AA 2L50A 1DJYA 1B8CA 1UHKA 3WHUB 3CLNA 2G9BA 5I2OA 4YGBB 1F70A 1IIOA 3N7HA 3O2PA 1NPQA 1DQEA 5CSIA 1MHOA 3CR2A 1MXEA 2L51A 3OGNA 2KFFA 4JWQA 3AKAA 1B7TZ 2MAZA 2DOQA 5IBWA 3VB1A 3NSKA 1QWVA 4A4CA 1K90D 1LKJA 1KSMA 3PATA 4JQ0D 1N0YA 2BE6A 3BFBA 1H4BA 1NSHA 1XFUO 4UPGA 1W7JB 2CBLA 5F6TA 3GK1A 4NDBA 1TN4A 3DVKA 5AFPA 1V1FA 2MBXA 4C0JA 4DS7A 2K7DA 1YVLA 1YURA 4MSPA 1JWDA 3SS5A 2GTEA 4GPLB 3CWGA 1DELA 1B8LA 1KWOB 2Y5IA 2WCJA 3GK4X 2JNFA 1NX1A 1C07A 4PALA 2RGIA 1CDLA 2PASA 2ERBA 3CZTX 5I2QA 4YGEB 1Y6WA 1KFXL 5AEQA 5DKRA 3D76A 1R2UA 1SR6C 3BUWB 3SIAA 5HKYA 5KU1A 1XFYO 1BT6A 1QX5B 2Q91A 2P6BB 3WNXB 1K96A 4NDDA 3CYZA 3PM8A 4Q04A 1KK7Y 3PJIA 3EVUA 3EKJA 1HQVA 3TS5B 1VRKA 3VRNA 3CGAA 1GGWA 3UO9A 5D7FA 2EHBA 4BY4A 4C0LA 2BAPA 4DIRA 5GQQC 4GFTA 5EL2A 1OOHA 3A8RA 3B6XA 2JWWA 1S6IA 3QMEA 5HLVA 4I5NB 1K95A 4NQGA 2LMTA 1G33A 3NHIA 3SJSA 4FTGA 2L98A 1XK4A 1NX2A 4YI9A 4AOMA 1F55A 1YTZC 3NSOA 2ZN9A 2YGUA 3RZSA 3EK7A 1S5GY 3FE8A 1KWOC 2M9GA 2LUXA 4C0KA 3OB1B 2KQ6A 3S0AA 1SPYA 2BKHB 1J1EA 4N5XA 3DXLA 4GBAA 2M29A 3SG7A 2E6WA 1TUZA 2K7OA 1IQ5A 5D69A 3HCMA 2L0PA 2I7AA 2M1UA 1SK6D 1M63B 1UP5A 3CS1A 2JQ6A 1CMFA 3OB2B 5ER5A 4L9MA 3S0BA 1YRTB 1TIZA 4GGFA 3GK2A 2Y1NA 2PALA 2QEOA 4MN0A 3TS5C 2Y4QA 2BECA 1LA3A 1JFJA 2HETA 3D78A 2LCPA 4N1GA 1LA0A 1PVAA 3JTDB 1UHIA 1IJ6A 1LINA 1IGVA 1QVIY 3I5HB 4JD9A 1J7PA 4MZLA 1BOCA 1TWOA 2NZ0A 3QRXA 1NUBA 1FPWA 2M7NA 1Z2CB 2SCPA 2WOSA 1CNPA 2JPOA 2LV7A 2HPSA 5KTYA 1OW4A 1ZUZA 1PSBA 2FOTA 1WRLA 1DTLA 2H61A 2KGRA 5I8NA 3DVEA 1Y1XA 2F3YA 3OBVA 4GNKB 1EXRA 1SW8A 2KNEA 2KOTA 4DRWA 4FQTA 1WY9A 4MRYA 3S0GA 1A03A 1CLLA 2BCXA 1DT7B 4OVNF 3CZ2A 2PMYA 1J7QA 2ZN8A 3DF0A 4R1EA 1TNWA 1XVJA 1BMOA 1GGZA 1B1GA 1BODA 3I5GB 3OX6A 3WHTB 1KQMB 1QASA 1ZMZA 3GOFA 4OCIA 2KYCA 1S3PA 1PK0D 2KAVA 1ORGA 2LLTA 3BXKA 3TDIA 4CLNA 2K61A 2BE4A 1SYMA 1C7VA 3DD4A 1ZFSA 1WLMA 1SNLA 1A4PA 2FCDA 2L4HA 5DKNA 1CFCA 3D73A 1YX7A 1J1DA 2GV5A 2CXJA 1BF5A 1JBAA 4I5LB 2OTGB 2WCHA 3OP0A 3JTDC 4PHMA 2HQWA 2OS8B 2ZKMX 2JULA 3BUNB 3I5HC 1MWNA 1QS7A 1SY9A 2KAXA 1QLKA 2I18A 2KHNA 2MJWB 2VRGA 1UUSA 3CR5X 4I5JA 2ZRSA 5FYXA 2JXCA 4QJ4B 1RWYA 1AJ5A 1MUXA 1OSAA 3CDNA 3SG5A 1CFDA 3BFHA 3KHEA 1DJXA 2O5GA 4P2YB 3FE9A 2FCEA 2MLFC 2JRFA 3L4AA 1OOIX 4JKTA 2KI6D 3PLFB 1GJYA 2NLNA 3DYEA 3OHMB 4INXA 4XJKA 4MRXA 2O60A 1AP4A 1JC2A 1P28A 1XFVO 2CCMA 1OMVA 1YRUB 3BQ3A 3RM1A 2E30A 1B4CA 2LE9B 2LVVA 3O4XA 1AK8A
chains in the Genus database with same CATH topology
1TNQA 5HKZA 4DCKA 3JVTB 1K9KA 2LC5A 3I5GC 1L7ZA 1TTXA 1KQMC 2QPTA 1KSOA 1NYAA 2JC2A 2L2EA 1V1GA 2R2IA 2TN4A 4M2OA 1HT9A 1SRAA 2JZIA 3FWBA 4PCWA 2KI4B 1QTXA 4XJKB 2LNKA 1SL9A 2JPTA 1E8AA 2NCOA 1QIVA 3LCPC 2OTGC 3NXAA 3PN7B 2OS8C 5AANA 3VRPA 5KSZA 1K9PA 3M0WA 1F4OA 1CTRA 2WORA 2LM5A 4P5OE 1JFKA 1UWOA 2I2RE 2JTTA 1A75A 2LLSA 1TNXA 2GGZA 3BYAA 1YUUA 1FBVA 1BR4B 1QLSA 1OMDA 1UHJA 3FIAA 1B9AA 1SL7A 3AKBA 1YUTA 4YI8A 1N65A 1BJFA 1QJTA 1XFZO 2FJUB 3LL8B 2KYFA 5JOLA 2WCBA 3O78A 1MF8B 1ALVA 3JVTC 5HLOA 4GAOA 5HYDA 1K8UA 1J55A 2BCBA 4M2QA 1CM1A 1A75B 3I5IB 4YRUA 5ER4X 4BY5A 3KPXA 2KI4C 2KFGA 1ALWA 3EK8A 1AJ4A 3VGOA 1CDPA 1OZSA 5AERA 1EG4A 2L5XB 4AQIA 1OQPA 1D1OA 2OPOA 4CFRA 1H8BA 3PN7C 1DJWA 2HF5A 1WLZA 1B7TY 1KFXS 3LLEA 5J3XA 1QX7A 2WCEA 4PHJA 3IQOA 1QXPA 3I5FB 1BU3A 4PE4A 5B8IB 1PVBA 1JF0A 1K9UA 1TRFA 1UHNA 1OMRA 4IL1A 4YGDB 1F54A 1UURA 1CLMA 1IWQA 1UHHA 2WC8A 2ZFDA 1AVSA 4WQ2A 4NDCA 2LHIA 4CPVA 1L2OB 3TDZA 2M7LA 1KFUL 2LVJA 4ZCUA 2WNDA 2G2BA 4PHNA 1EL4A 4ORBB 2JT0A 2K2FA 5HKWA 1DJIA 2M3WA 4ORAB 1KQVA 1Q80A 2LAPA 3O6BA 3VRQA 1IG5A 4F0ZB 1QV1A 5JJGA 1KCYA 5CSJA 1KK7Z 1MXLC 2KSPA 1W7IB 1CMGA 1SL8A 1NWDA 1SBJA 1AUIB 2PVBA 3I5IC 1XA5A 2KDHA 3LK0A 2MLEC 4ORCB 2NCPA 4GUKA 1FF1A 1XK4C 4TNCA 5I2LA 5K89A 5PALA 2LANA 1JUOA 2D8NA 1A2XA 1C7WA 3SG4A 4OR9B 1CM4A 3BUMB 1DF0A 1BR1B 2AAOA 4U8DA 1IH0A 2BBNA 4N1FA 3CR4X 3DF0B 4OV2A 3ZNIA 2BKIB 3I5FC 1F8HA 2B1UA 2PSRA 3VRRA 3KEVA 4ICBA 2M49B 5AXIA 1QATA 1S5GZ 2NXQA 1M46A 1F71A 3OX5A 2SASA 1CDMA 1TNPA 1Y1UA 1L2OC 1TOPA 2I94A 4GGFC 1K94A 2LP2A 3K21A 1DF0B 1QX2A 3SG6A 2M97A 1ZOTB 1EG3A 4XYNA 1DGVA 1IQ3A 3HX4A 1OOJA 1IJ5A 2JXLA 2K7CA 1FW4A 2MA2A 2KQYA 3SG2A 2JNXA 1KFUS 4MVFA 1K2HA 2AMIA 2M1KB 2EGDA 1YUSA 4HSZA 4PE7A 1Y1AA 2BL0B 2GGMA 1QVIZ 1RFJA 2H2KA 4HRHA 1M39A 1A29A 2LUCA 4I5KA 4CIDA 4D1EA 1AHRA 2H61C 4FQOA 1NCYA 1G4YR 2LVIA 1RECA 1RJVA 2JTZA 2KFHA 2L4IA 4HRGA 2COLB 2LP3A 2KI6C 2EC6B 1DJZA 1WDCB 5CSNA 1R6PA 1BLQA 3NSLA 1S26D 4ZCVA 1NCXA 1WRKA 4MLWA 3H4SE 1FI5A 5CPVA 1SKTA 1YR5A 1YX8A 2LVKA 4A4BA 1IKUA 1S1EA 4YGCB 4YBHB 1PSRA 1RK9A 2BCAA 2IS9A 2QACA 1CLBA 2M0RA 3BUOB 3DVJA 4PHKA 3A4UB 1XO5A 1RTP1 2HQ8A 4QJ5B 1BG1A 1CFFA 1B47A 3SIBA 1RROA 1JF2A 3SG3A 3VROA 1SCMB 2ZNDA 2JU0A 3AAKA 3EVRA 1XFWO 1TCFA 1K93D 1OE9B 1S6CA 1G8IA 3TUYB 3IF7A 2CNPA 1GQMA 1ODBA 1NCZA 1TCOB 1U5IA 3PALA 2BBMA 1X02A 1CKKA 3EKHA 1NX0A 3DVMA 5G08A 1PALA 1PULA 2JOJA 1YVHA 1J7RA 1QV0A 3RLZA 3BUXB 2F2PA 1CB1A 2BL0C 3ICBA 5BPJA 3E3RA 2Q4UA 1M31A 1S36A 2Y1MA 2CT9A 2F8PA 3D10A 2KGBC 1EJ3A 3KF9A 4JPZB 2F2OA 1J7OA 5CSFA 2EC6C 1U5IB 1WDCC 1XFXO 2MHHA 1MQ1A 2ISDA 2ZNEA 4WQ3A 1KK8B 4USLA 2K0JA 2LLUA 4YGAA 4M2PA 4MBEA 2F33A 3BOWA 3CTNA 4PE0A 2F3ZA 4PE1A 3PSRA 3TZ1A 1N2DA 1XYDA 4PDZA 2KBMA 2CTNA 1ZACA 1SCMC 3NSIA 3F45A 1IRJA 2JT8A 3ZWHA 2V53A 3D0YA 2K7BA 3FS7A 3TUYC 4WRIA 4MZJA 3EVVA 1JSAA 1LVCD 1FI6A 2WCFA 2M8UA 1S6JA 2LHLA 4AQJA 3BOWB 1DMOA 1OZOA 1CFPA 4MEWA 2LMUA 1DJGA 1DJHA 2PRUA 3PFVA 1Y0VH 2K8MB 2KAYA 3MSEB 1LXFC 4QJ3B 1EH2A 2MRDA 3WXAA 3IQQA 1DGUA 1B8RA 4OKHA 4ETOA 1NIWA 3KO0A 3D0YB 3EK4A 2A4JA 2LMVA 2AUCA 2ZRTA 1PRWA 3TDUA 4E68A 1KK8C 1M45A 4DUQA 4HREE 3O4YA 1SMGA 2JT3A 3C1VA 1NX3A 1DVIA 1NP8A 1F4QA 3FWCA 4MZKA 1MR8A 5TNCA 3LK1A 2KBIA 3AAJA 1SR6B 1WRZA 4CFQA 4GGNA 1QIWA 5DKQA 1SCVA 2K2AA 2L50A 1DJYA 1B8CA 1UHKA 3WHUB 3CLNA 2G9BA 5I2OA 4YGBB 1F70A 3O2PA 5CSIA 1NPQA 1MHOA 3CR2A 1MXEA 2L51A 2KFFA 4JWQA 3AKAA 1B7TZ 2MAZA 2DOQA 5IBWA 4A4CA 3NSKA 1K90D 1LKJA 1KSMA 3PATA 4JQ0D 1N0YA 2BE6A 1H4BA 1NSHA 1XFUO 4UPGA 1W7JB 2CBLA 5F6TA 3GK1A 4NDBA 1TN4A 3DVKA 5AFPA 1V1FA 2MBXA 4C0JA 4DS7A 2K7DA 1YVLA 1YURA 4MSPA 1JWDA 4GPLB 3CWGA 3GK4X 1B8LA 1KWOB 2Y5IA 2JNFA 1NX1A 1C07A 4PALA 2RGIA 1CDLA 2PASA 3CZTX 5I2QA 4YGEB 1Y6WA 1KFXL 5AEQA 5DKRA 1R2UA 1SR6C 3BUWB 3SIAA 5HKYA 5KU1A 1XFYO 1BT6A 1QX5B 2Q91A 2P6BB 3WNXB 1K96A 4NDDA 3PM8A 4Q04A 1KK7Y 3EVUA 3EKJA 1HQVA 3TS5B 1VRKA 3VRNA 3CGAA 1GGWA 5D7FA 2EHBA 4BY4A 4C0LA 4DIRA 5GQQC 4GFTA 3A8RA 2JWWA 1S6IA 5HLVA 4I5NB 1K95A 4NQGA 2LMTA 1G33A 3SJSA 4FTGA 2L98A 1XK4A 1NX2A 4YI9A 4AOMA 1F55A 1YTZC 3NSOA 2ZN9A 3EK7A 1S5GY 1KWOC 2M9GA 2LUXA 4C0KA 3OB1B 2KQ6A 1SPYA 2BKHB 1J1EA 4N5XA 4GBAA 2M29A 3SG7A 2E6WA 2K7OA 1IQ5A 5D69A 3HCMA 2L0PA 2I7AA 2M1UA 1SK6D 1M63B 1UP5A 3CS1A 2JQ6A 1CMFA 3OB2B 5ER5A 4L9MA 1YRTB 1TIZA 4GGFA 3GK2A 2Y1NA 2PALA 4MN0A 3TS5C 2Y4QA 2BECA 1LA3A 1JFJA 2HETA 4N1GA 2LCPA 1LA0A 1PVAA 3JTDB 1UHIA 1IJ6A 1LINA 1IGVA 1QVIY 3I5HB 1J7PA 4MZLA 1BOCA 2NZ0A 3QRXA 1NUBA 1FPWA 2M7NA 2SCPA 2WOSA 1CNPA 2LV7A 2HPSA 5KTYA 1ZUZA 1PSBA 2FOTA 1WRLA 1DTLA 2H61A 2KGRA 5I8NA 3DVEA 1Y1XA 2F3YA 4GNKB 1EXRA 1SW8A 2KNEA 2KOTA 4DRWA 4MRYA 1WY9A 1A03A 1CLLA 2BCXA 1DT7B 4OVNF 2PMYA 1J7QA 2ZN8A 3DF0A 4R1EA 1TNWA 1XVJA 1BMOA 1GGZA 1B1GA 1BODA 3I5GB 3OX6A 3WHTB 1KQMB 1QASA 1ZMZA 3GOFA 4OCIA 2KYCA 1S3PA 1PK0D 2KAVA 2LLTA 3BXKA 3TDIA 4CLNA 2K61A 2BE4A 1SYMA 1C7VA 3DD4A 1ZFSA 1WLMA 1SNLA 1A4PA 2FCDA 2L4HA 5DKNA 1CFCA 1YX7A 1J1DA 2GV5A 2CXJA 1BF5A 1JBAA 4I5LB 2OTGB 3OP0A 3JTDC 4PHMA 2HQWA 2OS8B 2ZKMX 2JULA 3BUNB 3I5HC 1MWNA 1QS7A 1SY9A 2KAXA 1QLKA 2I18A 2KHNA 2MJWB 2VRGA 1UUSA 3CR5X 4I5JA 2ZRSA 5FYXA 2JXCA 4QJ4B 1RWYA 1AJ5A 1MUXA 1OSAA 3SG5A 1CDNA 1CFDA 3KHEA 1DJXA 2O5GA 4P2YB 2FCEA 2MLFC 2JRFA 2KI6D 3PLFB 1GJYA 2NLNA 3OHMB 4XJKA 4MRXA 2O60A 1AP4A 1JC2A 2CCMA 1XFVO 1OMVA 1YRUB 3BQ3A 3RM1A 2E30A 1B4CA 2LE9B 2LVVA 1AK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNQ A;  5HKZ A;  4DCK A;  3JVT B;  1K9K A;  2LC5 A;  3I5G C;  1L7Z A;  1TTX A;  1KQM C;  2QPT A;  1KSO A;  1NYA A;  2JC2 A;  2L2E A;  1V1G A;  2R2I A;  2TN4 A;  4M2O A;  1HT9 A;  1SRA A;  2JZI A;  3FWB A;  4PCW A;  2KI4 B;  1QTX A;  4XJK B;  2LNK A;  1SL9 A;  2JPT A;  1E8A A;  2NCO A;  1QIV A;  3LCP C;  2OTG C;  3NXA A;  3PN7 B;  2OS8 C;  5AAN A;  3VRP A;  5KSZ A;  1K9P A;  3M0W A;  1F4O A;  1CTR A;  2WOR A;  2LM5 A;  4P5O E;  1JFK A;  1UWO A;  2I2R E;  2JTT A;  1A75 A;  2LLS A;  1TNX A;  2GGZ A;  3BYA A;  1YUU A;  1FBV A;  1BR4 B;  1QLS A;  1OMD A;  1UHJ A;  3FIA A;  1B9A A;  1SL7 A;  3AKB A;  1YUT A;  4YI8 A;  1N65 A;  1BJF A;  1QJT A;  1XFZ O;  2FJU B;  3LL8 B;  2KYF A;  5JOL A;  2WCB A;  3O78 A;  1MF8 B;  1ALV A;  3JVT C;  5HLO A;  4GAO A;  5HYD A;  1K8U A;  1J55 A;  2BCB A;  4M2Q A;  1CM1 A;  1A75 B;  3I5I B;  4YRU A;  5ER4 X;  4BY5 A;  3KPX A;  2KI4 C;  2KFG A;  1ALW A;  3EK8 A;  1AJ4 A;  3VGO A;  1CDP A;  1OZS A;  5AER A;  1EG4 A;  2L5X B;  4AQI A;  1OQP A;  1D1O A;  2OPO A;  4CFR A;  1H8B A;  3PN7 C;  1DJW A;  2HF5 A;  1WLZ A;  1B7T Y;  1KFX S;  3LLE A;  5J3X A;  1QX7 A;  2WCE A;  4PHJ A;  3IQO A;  1QXP A;  3I5F B;  1BU3 A;  4PE4 A;  5B8I B;  1PVB A;  1JF0 A;  1K9U A;  1TRF A;  1UHN A;  1OMR A;  4IL1 A;  4YGD B;  1F54 A;  1UUR A;  1CLM A;  1IWQ A;  1UHH A;  2WC8 A;  2ZFD A;  1AVS A;  4WQ2 A;  4NDC A;  2LHI A;  4CPV A;  1L2O B;  3TDZ A;  2M7L A;  1KFU L;  2LVJ A;  4ZCU A;  2WND A;  2G2B A;  4PHN A;  1EL4 A;  4ORB B;  2JT0 A;  2K2F A;  5HKW A;  1DJI A;  2M3W A;  4ORA B;  1KQV A;  1Q80 A;  2LAP A;  3O6B A;  3VRQ A;  1IG5 A;  4F0Z B;  1QV1 A;  5JJG A;  1KCY A;  5CSJ A;  1KK7 Z;  1MXL C;  2KSP A;  1W7I B;  1CMG A;  1SL8 A;  1NWD A;  1SBJ A;  1AUI B;  2PVB A;  3I5I C;  1XA5 A;  2KDH A;  3LK0 A;  2MLE C;  4ORC B;  2NCP A;  4GUK A;  1FF1 A;  1XK4 C;  4TNC A;  5I2L A;  5K89 A;  5PAL A;  2LAN A;  1JUO A;  2D8N A;  1A2X A;  1C7W A;  3SG4 A;  4OR9 B;  1CM4 A;  3BUM B;  1DF0 A;  1BR1 B;  2AAO A;  4U8D A;  1IH0 A;  2BBN A;  4N1F A;  3CR4 X;  3DF0 B;  4OV2 A;  3ZNI A;  2BKI B;  3I5F C;  1F8H A;  2B1U A;  2PSR A;  3VRR A;  3KEV A;  4ICB A;  2M49 B;  5AXI A;  1QAT A;  1S5G Z;  2NXQ A;  1M46 A;  1F71 A;  3OX5 A;  2SAS A;  1CDM A;  1TNP A;  1Y1U A;  1L2O C;  1TOP A;  2I94 A;  4GGF C;  1K94 A;  2LP2 A;  3K21 A;  1DF0 B;  1QX2 A;  3SG6 A;  2M97 A;  1ZOT B;  1EG3 A;  4XYN A;  1DGV A;  1IQ3 A;  3HX4 A;  1OOJ A;  1IJ5 A;  2JXL A;  2K7C A;  1FW4 A;  2MA2 A;  2KQY A;  3SG2 A;  2JNX A;  1KFU S;  4MVF A;  1K2H A;  2AMI A;  2M1K B;  2EGD A;  1YUS A;  4HSZ A;  4PE7 A;  1Y1A A;  2BL0 B;  2GGM A;  1QVI Z;  1RFJ A;  2H2K A;  4HRH A;  1M39 A;  1A29 A;  2LUC A;  4I5K A;  4CID A;  4D1E A;  1AHR A;  2H61 C;  4FQO A;  1NCY A;  1G4Y R;  2LVI A;  1REC A;  1RJV A;  2JTZ A;  2KFH A;  2L4I A;  4HRG A;  2COL B;  2LP3 A;  2KI6 C;  2EC6 B;  1DJZ A;  1WDC B;  5CSN A;  1R6P A;  1BLQ A;  3NSL A;  1S26 D;  4ZCV A;  1NCX A;  1WRK A;  4MLW A;  3H4S E;  1FI5 A;  5CPV A;  1SKT A;  1YR5 A;  1YX8 A;  2LVK A;  4A4B A;  1IKU A;  1S1E A;  4YGC B;  4YBH B;  1PSR A;  1RK9 A;  2BCA A;  2IS9 A;  2QAC A;  1CLB A;  2M0R A;  3BUO B;  3DVJ A;  4PHK A;  3A4U B;  1XO5 A;  1RTP 1;  2HQ8 A;  4QJ5 B;  1BG1 A;  1CFF A;  1B47 A;  3SIB A;  1RRO A;  1JF2 A;  3SG3 A;  3VRO A;  1SCM B;  2ZND A;  2JU0 A;  3AAK A;  3EVR A;  1XFW O;  1TCF A;  1K93 D;  1OE9 B;  1S6C A;  1G8I A;  3TUY B;  3IF7 A;  2CNP A;  1GQM A;  1ODB A;  1NCZ A;  1TCO B;  1U5I A;  3PAL A;  2BBM A;  1X02 A;  1CKK A;  3EKH A;  1NX0 A;  3DVM A;  5G08 A;  1PAL A;  1PUL A;  2JOJ A;  1YVH A;  1J7R A;  1QV0 A;  3RLZ A;  3BUX B;  2F2P A;  1CB1 A;  2BL0 C;  3ICB A;  5BPJ A;  3E3R A;  2Q4U A;  1M31 A;  1S36 A;  2Y1M A;  2CT9 A;  2F8P A;  3D10 A;  2KGB C;  1EJ3 A;  3KF9 A;  4JPZ B;  2F2O A;  1J7O A;  5CSF A;  2EC6 C;  1U5I B;  1WDC C;  1XFX O;  2MHH A;  1MQ1 A;  2ISD A;  2ZNE A;  4WQ3 A;  1KK8 B;  4USL A;  2K0J A;  2LLU A;  4YGA A;  4M2P A;  4MBE A;  2F33 A;  3BOW A;  3CTN A;  4PE0 A;  2F3Z A;  4PE1 A;  3PSR A;  3TZ1 A;  1N2D A;  1XYD A;  4PDZ A;  2KBM A;  2CTN A;  1ZAC A;  1SCM C;  3NSI A;  3F45 A;  1IRJ A;  2JT8 A;  3ZWH A;  2V53 A;  3D0Y A;  2K7B A;  3FS7 A;  3TUY C;  4WRI A;  4MZJ A;  3EVV A;  1JSA A;  1LVC D;  1FI6 A;  2WCF A;  2M8U A;  1S6J A;  2LHL A;  4AQJ A;  3BOW B;  1DMO A;  1OZO A;  1CFP A;  4MEW A;  2LMU A;  1DJG A;  1DJH A;  2PRU A;  3PFV A;  1Y0V H;  2K8M B;  2KAY A;  3MSE B;  1LXF C;  4QJ3 B;  1EH2 A;  2MRD A;  3WXA A;  3IQQ A;  1DGU A;  1B8R A;  4OKH A;  4ETO A;  1NIW A;  3KO0 A;  3D0Y B;  3EK4 A;  2A4J A;  2LMV A;  2AUC A;  2ZRT A;  1PRW A;  3TDU A;  4E68 A;  1KK8 C;  1M45 A;  4DUQ A;  4HRE E;  3O4Y A;  1SMG A;  2JT3 A;  3C1V A;  1NX3 A;  1DVI A;  1NP8 A;  1F4Q A;  3FWC A;  4MZK A;  1MR8 A;  5TNC A;  3LK1 A;  2KBI A;  3AAJ A;  1SR6 B;  1WRZ A;  4CFQ A;  4GGN A;  1QIW A;  5DKQ A;  1SCV A;  2K2A A;  2L50 A;  1DJY A;  1B8C A;  1UHK A;  3WHU B;  3CLN A;  2G9B A;  5I2O A;  4YGB B;  1F70 A;  3O2P A;  5CSI A;  1NPQ A;  1MHO A;  3CR2 A;  1MXE A;  2L51 A;  2KFF A;  4JWQ A;  3AKA A;  1B7T Z;  2MAZ A;  2DOQ A;  5IBW A;  4A4C A;  3NSK A;  1K90 D;  1LKJ A;  1KSM A;  3PAT A;  4JQ0 D;  1N0Y A;  2BE6 A;  1H4B A;  1NSH A;  1XFU O;  4UPG A;  1W7J B;  2CBL A;  5F6T A;  3GK1 A;  4NDB A;  1TN4 A;  3DVK A;  5AFP A;  1V1F A;  2MBX A;  4C0J A;  4DS7 A;  2K7D A;  1YVL A;  1YUR A;  4MSP A;  1JWD A;  4GPL B;  3CWG A;  3GK4 X;  1B8L A;  1KWO B;  2Y5I A;  2JNF A;  1NX1 A;  1C07 A;  4PAL A;  2RGI A;  1CDL A;  2PAS A;  3CZT X;  5I2Q A;  4YGE B;  1Y6W A;  1KFX L;  5AEQ A;  5DKR A;  1R2U A;  1SR6 C;  3BUW B;  3SIA A;  5HKY A;  5KU1 A;  1XFY O;  1BT6 A;  1QX5 B;  2Q91 A;  2P6B B;  3WNX B;  1K96 A;  4NDD A;  3PM8 A;  4Q04 A;  1KK7 Y;  3EVU A;  3EKJ A;  1HQV A;  3TS5 B;  1VRK A;  3VRN A;  3CGA A;  1GGW A;  5D7F A;  2EHB A;  4BY4 A;  4C0L A;  4DIR A;  5GQQ C;  4GFT A;  3A8R A;  2JWW A;  1S6I A;  5HLV A;  4I5N B;  1K95 A;  4NQG A;  2LMT A;  1G33 A;  3SJS A;  4FTG A;  2L98 A;  1XK4 A;  1NX2 A;  4YI9 A;  4AOM A;  1F55 A;  1YTZ C;  3NSO A;  2ZN9 A;  3EK7 A;  1S5G Y;  1KWO C;  2M9G A;  2LUX A;  4C0K A;  3OB1 B;  2KQ6 A;  1SPY A;  2BKH B;  1J1E A;  4N5X A;  4GBA A;  2M29 A;  3SG7 A;  2E6W A;  2K7O A;  1IQ5 A;  5D69 A;  3HCM A;  2L0P A;  2I7A A;  2M1U A;  1SK6 D;  1M63 B;  1UP5 A;  3CS1 A;  2JQ6 A;  1CMF A;  3OB2 B;  5ER5 A;  4L9M A;  1YRT B;  1TIZ A;  4GGF A;  3GK2 A;  2Y1N A;  2PAL A;  4MN0 A;  3TS5 C;  2Y4Q A;  2BEC A;  1LA3 A;  1JFJ A;  2HET A;  4N1G A;  2LCP A;  1LA0 A;  1PVA A;  3JTD B;  1UHI A;  1IJ6 A;  1LIN A;  1IGV A;  1QVI Y;  3I5H B;  1J7P A;  4MZL A;  1BOC A;  2NZ0 A;  3QRX A;  1NUB A;  1FPW A;  2M7N A;  2SCP A;  2WOS A;  1CNP A;  2LV7 A;  2HPS A;  5KTY A;  1ZUZ A;  1PSB A;  2FOT A;  1WRL A;  1DTL A;  2H61 A;  2KGR A;  5I8N A;  3DVE A;  1Y1X A;  2F3Y A;  4GNK B;  1EXR A;  1SW8 A;  2KNE A;  2KOT A;  4DRW A;  4MRY A;  1WY9 A;  1A03 A;  1CLL A;  2BCX A;  1DT7 B;  4OVN F;  2PMY A;  1J7Q A;  2ZN8 A;  3DF0 A;  4R1E A;  1TNW A;  1XVJ A;  1BMO A;  1GGZ A;  1B1G A;  1BOD A;  3I5G B;  3OX6 A;  3WHT B;  1KQM B;  1QAS A;  1ZMZ A;  3GOF A;  4OCI A;  2KYC A;  1S3P A;  1PK0 D;  2KAV A;  2LLT A;  3BXK A;  3TDI A;  4CLN A;  2K61 A;  2BE4 A;  1SYM A;  1C7V A;  3DD4 A;  1ZFS A;  1WLM A;  1SNL A;  1A4P A;  2FCD A;  2L4H A;  5DKN A;  1CFC A;  1YX7 A;  1J1D A;  2GV5 A;  2CXJ A;  1BF5 A;  1JBA A;  4I5L B;  2OTG B;  3OP0 A;  3JTD C;  4PHM A;  2HQW A;  2OS8 B;  2ZKM X;  2JUL A;  3BUN B;  3I5H C;  1MWN A;  1QS7 A;  1SY9 A;  2KAX A;  1QLK A;  2I18 A;  2KHN A;  2MJW B;  2VRG A;  1UUS A;  3CR5 X;  4I5J A;  2ZRS A;  5FYX A;  2JXC A;  4QJ4 B;  1RWY A;  1AJ5 A;  1MUX A;  1OSA A;  3SG5 A;  1CDN A;  1CFD A;  3KHE A;  1DJX A;  2O5G A;  4P2Y B;  2FCE A;  2MLF C;  2JRF A;  2KI6 D;  3PLF B;  1GJY A;  2NLN A;  3OHM B;  4XJK A;  4MRX A;  2O60 A;  1AP4 A;  1JC2 A;  2CCM A;  1XFV O;  1OMV A;  1YRU B;  3BQ3 A;  3RM1 A;  2E30 A;  1B4C A;  2LE9 B;  2LVV A;  1AK8 A; 
#chains in the Genus database with same CATH topology
 3R1P A;  1TNQ A;  2K60 A;  5HKZ A;  4DCK A;  3JVT B;  1K9K A;  2LC5 A;  3I5G C;  1L7Z A;  1TTX A;  3B88 A;  1KQM C;  2QPT A;  1KSO A;  1NYA A;  2JC2 A;  3B87 A;  2L2E A;  1V1G A;  2R2I A;  2TN4 A;  5DIC A;  4M2O A;  1HT9 A;  1SRA A;  2JZI A;  3FWB A;  4PCW A;  2KI4 B;  1QTX A;  4XJK B;  2LNK A;  1SL9 A;  2L5Y A;  2JPT A;  1E8A A;  2NCO A;  1QIV A;  3LCP C;  2OTG C;  4KYN A;  2QDI A;  3NXA A;  3PN7 B;  2OS8 C;  5AAN A;  3VRP A;  2WC5 A;  5KSZ A;  1K9P A;  3M0W A;  1F4O A;  1CTR A;  2WOR A;  2LM5 A;  4P5O E;  1LS8 A;  1JFK A;  1OOG A;  1UWO A;  2I2R E;  2JTT A;  1A75 A;  2LLS A;  1XFR A;  1TNX A;  2GGZ A;  3BYA A;  1YUU A;  1FBV A;  1BR4 B;  2L2C A;  1QLS A;  1OMD A;  1UHJ A;  3FIA A;  1B9A A;  1SL7 A;  3BJH A;  2KLE A;  3AKB A;  1YUT A;  4YI8 A;  1N65 A;  1BJF A;  1QJT A;  1XFZ O;  2FJU B;  3LL8 B;  2KYF A;  2P70 A;  5JOL A;  3FE6 A;  2WCB A;  3O78 A;  1MF8 B;  1ALV A;  3JVT C;  5HLO A;  4GAO A;  5HYD A;  3D77 A;  1K8U A;  1J55 A;  2BCB A;  4M2Q A;  1CM1 A;  1A75 B;  3I5I B;  1W9Z A;  4YRU A;  5ER4 X;  4BY5 A;  3KPX A;  2KI4 C;  2KFG A;  3CZ0 A;  1ALW A;  3EK8 A;  1AJ4 A;  3VGO A;  1CDP A;  1OZS A;  5AER A;  1EG4 A;  2L5X B;  4AQI A;  1OQP A;  1D1O A;  2OPO A;  4CFR A;  1H8B A;  3PN7 C;  1DJW A;  2HF5 A;  1WLZ A;  1B7T Y;  1KFX S;  3LLE A;  5J3X A;  1QX7 A;  2WCE A;  4PHJ A;  3S0E A;  3IQO A;  1QXP A;  3I5F B;  1BU3 A;  4PE4 A;  5B8I B;  1PVB A;  1JF0 A;  1SSE B;  1K9U A;  1TRF A;  1UHN A;  1OMR A;  4IL1 A;  4YGD B;  1F54 A;  1UUR A;  1CLM A;  1IWQ A;  1UHH A;  2WC8 A;  5D3O A;  2ZFD A;  1AVS A;  4WQ2 A;  4NDC A;  2LHI A;  4CPV A;  1L2O B;  3TDZ A;  2M7L A;  1KFU L;  2LVJ A;  4ZCU A;  2WND A;  2G2B A;  4PHN A;  1EL4 A;  4ORB B;  2JT0 A;  2K2F A;  5HKW A;  1DJI A;  2M3W A;  4ORA B;  1KQV A;  1Q80 A;  2LAP A;  3O6B A;  3VRQ A;  1IG5 A;  4F0Z B;  3R72 A;  1QV1 A;  5JJG A;  1KCY A;  3Q8I A;  5CSJ A;  1KK7 Z;  1MXL C;  3NGV A;  1OOF A;  2KSP A;  1W7I B;  1CMG A;  1SL8 A;  1NWD A;  1SBJ A;  1AUI B;  2PVB A;  3I5I C;  1XA5 A;  2FJY A;  2KDH A;  2MLE C;  3LK0 A;  2NCP A;  4ORC B;  4GUK A;  1FF1 A;  1XK4 C;  4TNC A;  5I2L A;  5K89 A;  5PAL A;  2LAN A;  1JUO A;  2D8N A;  1A2X A;  1C7W A;  3SG4 A;  4OR9 B;  1CM4 A;  3BUM B;  3K1E A;  3CAB A;  1DF0 A;  1BR1 B;  2AAO A;  4IJ7 A;  4U8D A;  1IH0 A;  2BBN A;  4N1F A;  3IVT A;  3CR4 X;  3DF0 B;  4OV2 A;  3ZNI A;  2BKI B;  2PYQ A;  3DY9 A;  3I5F C;  1F8H A;  2B1U A;  1GM0 A;  2PSR A;  4OZD A;  3VRR A;  3KEV A;  4ICB A;  2M49 B;  5AXI A;  1QAT A;  1S5G Z;  2WC6 A;  2NXQ A;  1M46 A;  1F71 A;  3OX5 A;  2SAS A;  1CDM A;  1TNP A;  1Y1U A;  1L2O C;  1TOP A;  2I94 A;  4GGF C;  1K94 A;  3D74 A;  2LP2 A;  3S0F A;  3K21 A;  1DF0 B;  1QX2 A;  3SG6 A;  3L4L A;  2M97 A;  1ZOT B;  1EG3 A;  4XYN A;  1DGV A;  2H8V A;  1IQ3 A;  2WCL A;  2QEV A;  1C3Y A;  3HX4 A;  1OOJ A;  3S0D A;  1IJ5 A;  2JXL A;  2K7C A;  1FW4 A;  5FI7 A;  2MA2 A;  2KQY A;  3SG2 A;  2JNX A;  1KFU S;  2WCM A;  4MVF A;  1K2H A;  2AMI A;  2BNX A;  2EGD A;  2M1K B;  1YUS A;  4HSZ A;  4PE7 A;  1Y1A A;  2BL0 B;  2GGM A;  1QVI Z;  1RFJ A;  2H2K A;  4HRH A;  1M39 A;  1A29 A;  2LUC A;  4I5K A;  4CID A;  4D1E A;  1AHR A;  2H61 C;  4FQO A;  5I94 A;  1NCY A;  1G4Y R;  2LVI A;  1REC A;  1RJV A;  2JTZ A;  2KFH A;  2L4I A;  3R1O A;  4HRG A;  2COL B;  2LP3 A;  2KI6 C;  2EC6 B;  1C3Z A;  1DJZ A;  1TUJ A;  1WDC B;  5CSN A;  1R6P A;  1BLQ A;  3NSL A;  1S26 D;  4ZCV A;  1NCX A;  1WRK A;  3BFA A;  3H4S E;  4MLW A;  5CPV A;  1SKT A;  1YR5 A;  1YX8 A;  2LVK A;  4A4B A;  1IKU A;  1FI5 A;  1S1E A;  4YGC B;  4YBH B;  2KPH A;  1PSR A;  1RK9 A;  2BCA A;  2IS9 A;  2QAC A;  3L47 A;  2M0R A;  3BUO B;  3DVJ A;  4PHK A;  1CLB A;  3A4U B;  1XO5 A;  1RTP 1;  2HQ8 A;  4QJ5 B;  1BG1 A;  1CFF A;  1B47 A;  3SIB A;  1RRO A;  1JF2 A;  4INW A;  3SG3 A;  3VRO A;  4PT1 A;  1SCM B;  2ZND A;  2JU0 A;  3AAK A;  3EVR A;  1XFW O;  1TCF A;  1K93 D;  1OE9 B;  1S6C A;  2QEB A;  1G8I A;  3TUY B;  3IF7 A;  2CNP A;  1GQM A;  1ODB A;  1NCZ A;  1TCO B;  1U5I A;  2WCK A;  2BBM A;  1X02 A;  3EG5 B;  3PAL A;  3EKH A;  3SS3 A;  1CKK A;  1NX0 A;  3B86 A;  3DVM A;  5G08 A;  1PAL A;  1PUL A;  2JOJ A;  1YVH A;  1J7R A;  1QV0 A;  3RLZ A;  3BUX B;  2F2P A;  1Z4H A;  1CB1 A;  2BL0 C;  3DZT A;  3ICB A;  5BPJ A;  3NHT A;  3E3R A;  2Q4U A;  1M31 A;  1S36 A;  2Y1M A;  2CT9 A;  2F8P A;  3D10 A;  3D75 A;  2KGB C;  1EJ3 A;  3KF9 A;  4JPZ B;  2F2O A;  1J7O A;  5CSF A;  2EC6 C;  1U5I B;  1WDC C;  1XFX O;  2MHH A;  1MQ1 A;  2ISD A;  2ZNE A;  4WQ3 A;  1KK8 B;  4USL A;  2K0J A;  2LLU A;  4YGA A;  4M2P A;  4MBE A;  2F33 A;  1DC1 A;  3BOW A;  3CTN A;  4PE0 A;  3CZ1 A;  2F3Z A;  3PM2 A;  4PE1 A;  1T14 A;  3PSR A;  3TZ1 A;  1N2D A;  1XYD A;  4PDZ A;  2KBM A;  2CTN A;  1ZAC A;  1SCM C;  3NSI A;  3F45 A;  1IRJ A;  2JT8 A;  3ZWH A;  2V53 A;  3D0Y A;  2K7B A;  3UNW A;  3FS7 A;  3TUY C;  4WRI A;  3V2L A;  4MZJ A;  3EVV A;  1JSA A;  1LVC D;  3SS4 A;  4F7F A;  1FI6 A;  2WCF A;  3B7A A;  2M8U A;  1S6J A;  2LHL A;  4AQJ A;  3BOW B;  1DMO A;  5FI6 A;  1OZO A;  1CFP A;  4MEW A;  2LMU A;  1DJG A;  1DJH A;  2KLD A;  2P71 A;  2PRU A;  1Y0V H;  2K8M B;  2KAY A;  3MSE B;  3PFV A;  1LXF C;  4QJ3 B;  1EH2 A;  2MRD A;  3WXA A;  3IQQ A;  1DGU A;  1B8R A;  4OKH A;  4ETO A;  1NIW A;  3KO0 A;  3D0Y B;  3EK4 A;  2A4J A;  1DEK A;  2LMV A;  2AUC A;  5HL1 A;  2ZRT A;  1PRW A;  5FI2 A;  3TDU A;  1CDN A;  4E68 A;  1KK8 C;  1M45 A;  4DUQ A;  2PQL A;  4HRE E;  3O4Y A;  1SMG A;  2JT3 A;  3C1V A;  1NX3 A;  1DVI A;  1NP8 A;  1F4Q A;  3FWC A;  4MZK A;  1MR8 A;  5TNC A;  3LK1 A;  2KBI A;  3AAJ A;  1SR6 B;  2QEH A;  1WRZ A;  3R1V A;  4CFQ A;  4GGN A;  1QIW A;  5DKQ A;  1SCV A;  2K2A A;  2L50 A;  1DJY A;  1B8C A;  1UHK A;  3WHU B;  3CLN A;  2G9B A;  5I2O A;  4YGB B;  1F70 A;  1IIO A;  3N7H A;  3O2P A;  1NPQ A;  1DQE A;  5CSI A;  1MHO A;  3CR2 A;  1MXE A;  2L51 A;  3OGN A;  2KFF A;  4JWQ A;  3AKA A;  1B7T Z;  2MAZ A;  2DOQ A;  5IBW A;  3VB1 A;  3NSK A;  1QWV A;  4A4C A;  1K90 D;  1LKJ A;  1KSM A;  3PAT A;  4JQ0 D;  1N0Y A;  2BE6 A;  3BFB A;  1H4B A;  1NSH A;  1XFU O;  4UPG A;  1W7J B;  2CBL A;  5F6T A;  3GK1 A;  4NDB A;  1TN4 A;  3DVK A;  5AFP A;  1V1F A;  2MBX A;  4C0J A;  4DS7 A;  2K7D A;  1YVL A;  1YUR A;  4MSP A;  1JWD A;  3SS5 A;  2GTE A;  4GPL B;  3CWG A;  1DEL A;  1B8L A;  1KWO B;  2Y5I A;  2WCJ A;  3GK4 X;  2JNF A;  1NX1 A;  1C07 A;  4PAL A;  2RGI A;  1CDL A;  2PAS A;  2ERB A;  3CZT X;  5I2Q A;  4YGE B;  1Y6W A;  1KFX L;  5AEQ A;  5DKR A;  3D76 A;  1R2U A;  1SR6 C;  3BUW B;  3SIA A;  5HKY A;  5KU1 A;  1XFY O;  1BT6 A;  1QX5 B;  2Q91 A;  2P6B B;  3WNX B;  1K96 A;  4NDD A;  3CYZ A;  3PM8 A;  4Q04 A;  1KK7 Y;  3PJI A;  3EVU A;  3EKJ A;  1HQV A;  3TS5 B;  1VRK A;  3VRN A;  3CGA A;  1GGW A;  3UO9 A;  5D7F A;  2EHB A;  4BY4 A;  4C0L A;  2BAP A;  4DIR A;  5GQQ C;  4GFT A;  5EL2 A;  1OOH A;  3A8R A;  3B6X A;  2JWW A;  1S6I A;  3QME A;  5HLV A;  4I5N B;  1K95 A;  4NQG A;  2LMT A;  1G33 A;  3NHI A;  3SJS A;  4FTG A;  2L98 A;  1XK4 A;  1NX2 A;  4YI9 A;  4AOM A;  1F55 A;  1YTZ C;  3NSO A;  2ZN9 A;  2YGU A;  3RZS A;  3EK7 A;  1S5G Y;  3FE8 A;  1KWO C;  2M9G A;  2LUX A;  4C0K A;  3OB1 B;  2KQ6 A;  3S0A A;  1SPY A;  2BKH B;  1J1E A;  4N5X A;  3DXL A;  4GBA A;  2M29 A;  3SG7 A;  2E6W A;  1TUZ A;  2K7O A;  1IQ5 A;  5D69 A;  3HCM A;  2L0P A;  2I7A A;  2M1U A;  1SK6 D;  1M63 B;  1UP5 A;  3CS1 A;  2JQ6 A;  1CMF A;  3OB2 B;  5ER5 A;  4L9M A;  3S0B A;  1YRT B;  1TIZ A;  4GGF A;  3GK2 A;  2Y1N A;  2PAL A;  2QEO A;  4MN0 A;  3TS5 C;  2Y4Q A;  2BEC A;  1LA3 A;  1JFJ A;  2HET A;  3D78 A;  2LCP A;  4N1G A;  1LA0 A;  1PVA A;  3JTD B;  1UHI A;  1IJ6 A;  1LIN A;  1IGV A;  1QVI Y;  3I5H B;  4JD9 A;  1J7P A;  4MZL A;  1BOC A;  1TWO A;  2NZ0 A;  3QRX A;  1NUB A;  1FPW A;  2M7N A;  1Z2C B;  2SCP A;  2WOS A;  1CNP A;  2JPO A;  2LV7 A;  2HPS A;  5KTY A;  1OW4 A;  1ZUZ A;  1PSB A;  2FOT A;  1WRL A;  1DTL A;  2H61 A;  2KGR A;  5I8N A;  3DVE A;  1Y1X A;  2F3Y A;  3OBV A;  4GNK B;  1EXR A;  1SW8 A;  2KNE A;  2KOT A;  4DRW A;  4FQT A;  1WY9 A;  4MRY A;  3S0G A;  1A03 A;  1CLL A;  2BCX A;  1DT7 B;  4OVN F;  3CZ2 A;  2PMY A;  1J7Q A;  2ZN8 A;  3DF0 A;  4R1E A;  1TNW A;  1XVJ A;  1BMO A;  1GGZ A;  1B1G A;  1BOD A;  3I5G B;  3OX6 A;  3WHT B;  1KQM B;  1QAS A;  1ZMZ A;  3GOF A;  4OCI A;  2KYC A;  1S3P A;  1PK0 D;  2KAV A;  1ORG A;  2LLT A;  3BXK A;  3TDI A;  4CLN A;  2K61 A;  2BE4 A;  1SYM A;  1C7V A;  3DD4 A;  1ZFS A;  1WLM A;  1SNL A;  1A4P A;  2FCD A;  2L4H A;  5DKN A;  1CFC A;  3D73 A;  1YX7 A;  1J1D A;  2GV5 A;  2CXJ A;  1BF5 A;  1JBA A;  4I5L B;  2OTG B;  2WCH A;  3OP0 A;  3JTD C;  4PHM A;  2HQW A;  2OS8 B;  2ZKM X;  2JUL A;  3BUN B;  3I5H C;  1MWN A;  1QS7 A;  1SY9 A;  2KAX A;  1QLK A;  2I18 A;  2KHN A;  2MJW B;  2VRG A;  1UUS A;  3CR5 X;  4I5J A;  2ZRS A;  5FYX A;  2JXC A;  4QJ4 B;  1RWY A;  1AJ5 A;  1MUX A;  1OSA A;  3CDN A;  3SG5 A;  1CFD A;  3BFH A;  3KHE A;  1DJX A;  2O5G A;  4P2Y B;  3FE9 A;  2FCE A;  2MLF C;  2JRF A;  3L4A A;  1OOI X;  4JKT A;  2KI6 D;  3PLF B;  1GJY A;  2NLN A;  3DYE A;  3OHM B;  4INX A;  4XJK A;  4MRX A;  2O60 A;  1AP4 A;  1JC2 A;  1P28 A;  1XFV O;  2CCM A;  1OMV A;  1YRU B;  3BQ3 A;  3RM1 A;  2E30 A;  1B4C A;  2LE9 B;  2LVV A;  3O4X A;  1AK8 A; 
#chains in the Genus database with same CATH homology
 1TNQ A;  5HKZ A;  4DCK A;  3JVT B;  1K9K A;  2LC5 A;  3I5G C;  1L7Z A;  1TTX A;  1KQM C;  2QPT A;  1KSO A;  1NYA A;  2JC2 A;  2L2E A;  1V1G A;  2R2I A;  2TN4 A;  4M2O A;  1HT9 A;  1SRA A;  2JZI A;  3FWB A;  4PCW A;  2KI4 B;  1QTX A;  4XJK B;  2LNK A;  1SL9 A;  2JPT A;  1E8A A;  2NCO A;  1QIV A;  3LCP C;  2OTG C;  3NXA A;  3PN7 B;  2OS8 C;  5AAN A;  3VRP A;  5KSZ A;  1K9P A;  3M0W A;  1F4O A;  1CTR A;  2WOR A;  2LM5 A;  4P5O E;  1JFK A;  1UWO A;  2I2R E;  2JTT A;  1A75 A;  2LLS A;  1TNX A;  2GGZ A;  3BYA A;  1YUU A;  1FBV A;  1BR4 B;  1QLS A;  1OMD A;  1UHJ A;  3FIA A;  1B9A A;  1SL7 A;  3AKB A;  1YUT A;  4YI8 A;  1N65 A;  1BJF A;  1QJT A;  1XFZ O;  2FJU B;  3LL8 B;  2KYF A;  5JOL A;  2WCB A;  3O78 A;  1MF8 B;  1ALV A;  3JVT C;  5HLO A;  4GAO A;  5HYD A;  1K8U A;  1J55 A;  2BCB A;  4M2Q A;  1CM1 A;  1A75 B;  3I5I B;  4YRU A;  5ER4 X;  4BY5 A;  3KPX A;  2KI4 C;  2KFG A;  1ALW A;  3EK8 A;  1AJ4 A;  3VGO A;  1CDP A;  1OZS A;  5AER A;  1EG4 A;  2L5X B;  4AQI A;  1OQP A;  1D1O A;  2OPO A;  4CFR A;  1H8B A;  3PN7 C;  1DJW A;  2HF5 A;  1WLZ A;  1B7T Y;  1KFX S;  3LLE A;  5J3X A;  1QX7 A;  2WCE A;  4PHJ A;  3IQO A;  1QXP A;  3I5F B;  1BU3 A;  4PE4 A;  5B8I B;  1PVB A;  1JF0 A;  1K9U A;  1TRF A;  1UHN A;  1OMR A;  4IL1 A;  4YGD B;  1F54 A;  1UUR A;  1CLM A;  1IWQ A;  1UHH A;  2WC8 A;  2ZFD A;  1AVS A;  4WQ2 A;  4NDC A;  2LHI A;  4CPV A;  1L2O B;  3TDZ A;  2M7L A;  1KFU L;  2LVJ A;  4ZCU A;  2WND A;  2G2B A;  4PHN A;  1EL4 A;  4ORB B;  2JT0 A;  2K2F A;  5HKW A;  1DJI A;  2M3W A;  4ORA B;  1KQV A;  1Q80 A;  2LAP A;  3O6B A;  3VRQ A;  1IG5 A;  4F0Z B;  1QV1 A;  5JJG A;  1KCY A;  5CSJ A;  1KK7 Z;  1MXL C;  2KSP A;  1W7I B;  1CMG A;  1SL8 A;  1NWD A;  1SBJ A;  1AUI B;  2PVB A;  3I5I C;  1XA5 A;  2KDH A;  3LK0 A;  2MLE C;  4ORC B;  2NCP A;  4GUK A;  1FF1 A;  1XK4 C;  4TNC A;  5I2L A;  5K89 A;  5PAL A;  2LAN A;  1JUO A;  2D8N A;  1A2X A;  1C7W A;  3SG4 A;  4OR9 B;  1CM4 A;  3BUM B;  1DF0 A;  1BR1 B;  2AAO A;  4U8D A;  1IH0 A;  2BBN A;  4N1F A;  3CR4 X;  3DF0 B;  4OV2 A;  3ZNI A;  2BKI B;  3I5F C;  1F8H A;  2B1U A;  2PSR A;  3VRR A;  3KEV A;  4ICB A;  2M49 B;  5AXI A;  1QAT A;  1S5G Z;  2NXQ A;  1M46 A;  1F71 A;  3OX5 A;  2SAS A;  1CDM A;  1TNP A;  1Y1U A;  1L2O C;  1TOP A;  2I94 A;  4GGF C;  1K94 A;  2LP2 A;  3K21 A;  1DF0 B;  1QX2 A;  3SG6 A;  2M97 A;  1ZOT B;  1EG3 A;  4XYN A;  1DGV A;  1IQ3 A;  3HX4 A;  1OOJ A;  1IJ5 A;  2JXL A;  2K7C A;  1FW4 A;  2MA2 A;  2KQY A;  3SG2 A;  2JNX A;  1KFU S;  4MVF A;  1K2H A;  2AMI A;  2M1K B;  2EGD A;  1YUS A;  4HSZ A;  4PE7 A;  1Y1A A;  2BL0 B;  2GGM A;  1QVI Z;  1RFJ A;  2H2K A;  4HRH A;  1M39 A;  1A29 A;  2LUC A;  4I5K A;  4CID A;  4D1E A;  1AHR A;  2H61 C;  4FQO A;  1NCY A;  1G4Y R;  2LVI A;  1REC A;  1RJV A;  2JTZ A;  2KFH A;  2L4I A;  4HRG A;  2COL B;  2LP3 A;  2KI6 C;  2EC6 B;  1DJZ A;  1WDC B;  5CSN A;  1R6P A;  1BLQ A;  3NSL A;  1S26 D;  4ZCV A;  1NCX A;  1WRK A;  4MLW A;  3H4S E;  1FI5 A;  5CPV A;  1SKT A;  1YR5 A;  1YX8 A;  2LVK A;  4A4B A;  1IKU A;  1S1E A;  4YGC B;  4YBH B;  1PSR A;  1RK9 A;  2BCA A;  2IS9 A;  2QAC A;  1CLB A;  2M0R A;  3BUO B;  3DVJ A;  4PHK A;  3A4U B;  1XO5 A;  1RTP 1;  2HQ8 A;  4QJ5 B;  1BG1 A;  1CFF A;  1B47 A;  3SIB A;  1RRO A;  1JF2 A;  3SG3 A;  3VRO A;  1SCM B;  2ZND A;  2JU0 A;  3AAK A;  3EVR A;  1XFW O;  1TCF A;  1K93 D;  1OE9 B;  1S6C A;  1G8I A;  3TUY B;  3IF7 A;  2CNP A;  1GQM A;  1ODB A;  1NCZ A;  1TCO B;  1U5I A;  3PAL A;  2BBM A;  1X02 A;  1CKK A;  3EKH A;  1NX0 A;  3DVM A;  5G08 A;  1PAL A;  1PUL A;  2JOJ A;  1YVH A;  1J7R A;  1QV0 A;  3RLZ A;  3BUX B;  2F2P A;  1CB1 A;  2BL0 C;  3ICB A;  5BPJ A;  3E3R A;  2Q4U A;  1M31 A;  1S36 A;  2Y1M A;  2CT9 A;  2F8P A;  3D10 A;  2KGB C;  1EJ3 A;  3KF9 A;  4JPZ B;  2F2O A;  1J7O A;  5CSF A;  2EC6 C;  1U5I B;  1WDC C;  1XFX O;  2MHH A;  1MQ1 A;  2ISD A;  2ZNE A;  4WQ3 A;  1KK8 B;  4USL A;  2K0J A;  2LLU A;  4YGA A;  4M2P A;  4MBE A;  2F33 A;  3BOW A;  3CTN A;  4PE0 A;  2F3Z A;  4PE1 A;  3PSR A;  3TZ1 A;  1N2D A;  1XYD A;  4PDZ A;  2KBM A;  2CTN A;  1ZAC A;  1SCM C;  3NSI A;  3F45 A;  1IRJ A;  2JT8 A;  3ZWH A;  2V53 A;  3D0Y A;  2K7B A;  3FS7 A;  3TUY C;  4WRI A;  4MZJ A;  3EVV A;  1JSA A;  1LVC D;  1FI6 A;  2WCF A;  2M8U A;  1S6J A;  2LHL A;  4AQJ A;  3BOW B;  1DMO A;  1OZO A;  1CFP A;  4MEW A;  2LMU A;  1DJG A;  1DJH A;  2PRU A;  3PFV A;  1Y0V H;  2K8M B;  2KAY A;  3MSE B;  1LXF C;  4QJ3 B;  1EH2 A;  2MRD A;  3WXA A;  3IQQ A;  1DGU A;  1B8R A;  4OKH A;  4ETO A;  1NIW A;  3KO0 A;  3D0Y B;  3EK4 A;  2A4J A;  2LMV A;  2AUC A;  2ZRT A;  1PRW A;  3TDU A;  4E68 A;  1KK8 C;  1M45 A;  4DUQ A;  4HRE E;  3O4Y A;  1SMG A;  2JT3 A;  3C1V A;  1NX3 A;  1DVI A;  1NP8 A;  1F4Q A;  3FWC A;  4MZK A;  1MR8 A;  5TNC A;  3LK1 A;  2KBI A;  3AAJ A;  1SR6 B;  1WRZ A;  4CFQ A;  4GGN A;  1QIW A;  5DKQ A;  1SCV A;  2K2A A;  2L50 A;  1DJY A;  1B8C A;  1UHK A;  3WHU B;  3CLN A;  2G9B A;  5I2O A;  4YGB B;  1F70 A;  3O2P A;  5CSI A;  1NPQ A;  1MHO A;  3CR2 A;  1MXE A;  2L51 A;  2KFF A;  4JWQ A;  3AKA A;  1B7T Z;  2MAZ A;  2DOQ A;  5IBW A;  4A4C A;  3NSK A;  1K90 D;  1LKJ A;  1KSM A;  3PAT A;  4JQ0 D;  1N0Y A;  2BE6 A;  1H4B A;  1NSH A;  1XFU O;  4UPG A;  1W7J B;  2CBL A;  5F6T A;  3GK1 A;  4NDB A;  1TN4 A;  3DVK A;  5AFP A;  1V1F A;  2MBX A;  4C0J A;  4DS7 A;  2K7D A;  1YVL A;  1YUR A;  4MSP A;  1JWD A;  4GPL B;  3CWG A;  3GK4 X;  1B8L A;  1KWO B;  2Y5I A;  2JNF A;  1NX1 A;  1C07 A;  4PAL A;  2RGI A;  1CDL A;  2PAS A;  3CZT X;  5I2Q A;  4YGE B;  1Y6W A;  1KFX L;  5AEQ A;  5DKR A;  1R2U A;  1SR6 C;  3BUW B;  3SIA A;  5HKY A;  5KU1 A;  1XFY O;  1BT6 A;  1QX5 B;  2Q91 A;  2P6B B;  3WNX B;  1K96 A;  4NDD A;  3PM8 A;  4Q04 A;  1KK7 Y;  3EVU A;  3EKJ A;  1HQV A;  3TS5 B;  1VRK A;  3VRN A;  3CGA A;  1GGW A;  5D7F A;  2EHB A;  4BY4 A;  4C0L A;  4DIR A;  5GQQ C;  4GFT A;  3A8R A;  2JWW A;  1S6I A;  5HLV A;  4I5N B;  1K95 A;  4NQG A;  2LMT A;  1G33 A;  3SJS A;  4FTG A;  2L98 A;  1XK4 A;  1NX2 A;  4YI9 A;  4AOM A;  1F55 A;  1YTZ C;  3NSO A;  2ZN9 A;  3EK7 A;  1S5G Y;  1KWO C;  2M9G A;  2LUX A;  4C0K A;  3OB1 B;  2KQ6 A;  1SPY A;  2BKH B;  1J1E A;  4N5X A;  4GBA A;  2M29 A;  3SG7 A;  2E6W A;  2K7O A;  1IQ5 A;  5D69 A;  3HCM A;  2L0P A;  2I7A A;  2M1U A;  1SK6 D;  1M63 B;  1UP5 A;  3CS1 A;  2JQ6 A;  1CMF A;  3OB2 B;  5ER5 A;  4L9M A;  1YRT B;  1TIZ A;  4GGF A;  3GK2 A;  2Y1N A;  2PAL A;  4MN0 A;  3TS5 C;  2Y4Q A;  2BEC A;  1LA3 A;  1JFJ A;  2HET A;  4N1G A;  2LCP A;  1LA0 A;  1PVA A;  3JTD B;  1UHI A;  1IJ6 A;  1LIN A;  1IGV A;  1QVI Y;  3I5H B;  1J7P A;  4MZL A;  1BOC A;  2NZ0 A;  3QRX A;  1NUB A;  1FPW A;  2M7N A;  2SCP A;  2WOS A;  1CNP A;  2LV7 A;  2HPS A;  5KTY A;  1ZUZ A;  1PSB A;  2FOT A;  1WRL A;  1DTL A;  2H61 A;  2KGR A;  5I8N A;  3DVE A;  1Y1X A;  2F3Y A;  4GNK B;  1EXR A;  1SW8 A;  2KNE A;  2KOT A;  4DRW A;  4MRY A;  1WY9 A;  1A03 A;  1CLL A;  2BCX A;  1DT7 B;  4OVN F;  2PMY A;  1J7Q A;  2ZN8 A;  3DF0 A;  4R1E A;  1TNW A;  1XVJ A;  1BMO A;  1GGZ A;  1B1G A;  1BOD A;  3I5G B;  3OX6 A;  3WHT B;  1KQM B;  1QAS A;  1ZMZ A;  3GOF A;  4OCI A;  2KYC A;  1S3P A;  1PK0 D;  2KAV A;  2LLT A;  3BXK A;  3TDI A;  4CLN A;  2K61 A;  2BE4 A;  1SYM A;  1C7V A;  3DD4 A;  1ZFS A;  1WLM A;  1SNL A;  1A4P A;  2FCD A;  2L4H A;  5DKN A;  1CFC A;  1YX7 A;  1J1D A;  2GV5 A;  2CXJ A;  1BF5 A;  1JBA A;  4I5L B;  2OTG B;  3OP0 A;  3JTD C;  4PHM A;  2HQW A;  2OS8 B;  2ZKM X;  2JUL A;  3BUN B;  3I5H C;  1MWN A;  1QS7 A;  1SY9 A;  2KAX A;  1QLK A;  2I18 A;  2KHN A;  2MJW B;  2VRG A;  1UUS A;  3CR5 X;  4I5J A;  2ZRS A;  5FYX A;  2JXC A;  4QJ4 B;  1RWY A;  1AJ5 A;  1MUX A;  1OSA A;  3SG5 A;  1CDN A;  1CFD A;  3KHE A;  1DJX A;  2O5G A;  4P2Y B;  2FCE A;  2MLF C;  2JRF A;  2KI6 D;  3PLF B;  1GJY A;  2NLN A;  3OHM B;  4XJK A;  4MRX A;  2O60 A;  1AP4 A;  1JC2 A;  2CCM A;  1XFV O;  1OMV A;  1YRU B;  3BQ3 A;  3RM1 A;  2E30 A;  1B4C A;  2LE9 B;  2LVV A;  1AK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...