2JRFA

Solution nmr structure of tubulin polymerization-promoting protein family member 3 from homo sapiens. northeast structural genomics target hr387.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
178
structure length
178
Chain Sequence
MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin polymerization-promoting protein family member 3
publication title Solution NMR structure of Tubulin polymerization-promoting protein family member 3 from Homo sapiens.
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 45
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05517 p25-alpha p25-alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jrfA01
1CLMA 4PE1A 1X02A 4I5NB 4YRUA 1B9AA 2LM5A 3SIAA 2I7AA 2MBXA 5BPJA 2GGZA 1KCYA 3BUMB 1K96A 2LANA 2LVKA 1RFJA 2CXJA 5I2QA 2JZIA 2HQWA 1SRAA 3EVUA 2KOTA 1QLKA 2KFFA 2MHHA 4OR9B 1IRJA 1CDNA 1UURA 1RWYA 3LL8B 1F71A 2PMYA 2BBMA 1KQVA 1FI5A 2JOJA 1K9KA 3HCMA 1UHIA 4GNKB 4MVFA 2AUCA 3JVTB 2A4JA 3K21A 3AKBA 1OMDA 1LKJA 2LP2A 3PATA 4P5OE 1NCXA 4BY4A 1QASA 2JRFA 2KBMA 2MJWB 3DF0A 2KQYA 3ICBA 1GGZA 2KGBC 1SNLA 1FI6A 1OE9B 2LUXA 2QACA 3CGAA 1K90D 5AXIA 1G33A 3TDIA 1C7WA 3DD4A 1TTXA 1DJYA 1S6IA 1FW4A 1XFUO 1UUSA 4DIRA 2EHBA 4ICBA 1IJ5A 5CSFA 3SIBA 2MA2A 5AANA 4CPVA 3ZWHA 1DJWA 1XYDA 1F8HA 1DJXA 1PULA 1CDPA 3JVTC 4ORBB 3SG4A 1J7RA 1IGVA 2BBNA 1NUBA 1SW8A 2WCFA 2LNKA 4DUQA 1DMOA 2LMVA 1DJGA 1PVBA 1W7IB 1K95A 2IS9A 3DVJA 2NCOA 4ZCVA 1WRLA 3EK4A 1JC2A 1NCYA 2KDHA 2VRGA 1JWDA 3MSEB 4DS7A 2LC5A 1XFZO 1NIWA 3E3RA 3OX5A 2PVBA 1F54A 4WQ2A 3O78A 1OZSA 2WNDA 4M2QA 2CNPA 1SL8A 1NX2A 5I2LA 3BOWA 1B8RA 1QTXA 2B1UA 3GK4X 5FYXA 2M7LA 2PRUA 1J1EA 4A4BA 1XO5A 2ZRSA 1OQPA 3BXKA 4DRWA 1EH2A 5K89A 3PSRA 4UPGA 3DF0B 1XA5A 5CSIA 3OB2B 1EL4A 1NWDA 1MR8A 3DVKA 1DJZA 4ZCUA 4C0LA 2HETA 2LHLA 2JTTA 3SG6A 4D1EA 3GOFA 1VRKA 1YUSA 1TCFA 3BUOB 1ZUZA 5GQQC 5JOLA 4PE0A 2I94A 1RTP1 1SCMB 2K7DA 1LA0A 1ZACA 5PALA 1OOJA 1PSRA 2BCAA 2NZ0A 2R2IA 3DVMA 3IQOA 2HQ8A 3WXAA 1KSMA 1YX7A 4GUKA 1G8IA 1YURA 4IL1A 3I5GB 4PE7A 1RROA 3I5HC 3RLZA 4QJ5B 4M2OA 4TNCA 5B8IB 4GPLB 3NSKA 5CSJA 4YGAA 5HLOA 3WHUB 3JTDB 5D69A 1C7VA 1BG1A 5HKZA 2ZN8A 3EKHA 1KSOA 5F6TA 1MHOA 3AAJA 2CBLA 1OMVA 3BOWB 2K7OA 1SMGA 5HKYA 3SJSA 4ORCB 1F70A 2EGDA 1WDCB 1B8CA 1V1GA 4NDCA 4HREE 2O60A 1B1GA 1ZOTB 2M8UA 1JF0A 3PLFB 4NQGA 2K2AA 3TDZA 1EG4A 1SK6D 2WCEA 3I5GC 5KSZA 3SG5A 1QV0A 3KHEA 2Q91A 4GAOA 4I5LB 3BUWB 2HF5A 1S5GY 1CDMA 1OSAA 1QATA 1CM4A 3H4SE 3JTDC 1JF2A 2JNFA 2M49B 1OZOA 2JT3A 2KBIA 1XK4C 3NXAA 4MLWA 4P2YB 1KFUS 1K2HA 1KFXS 1TNPA 1S1EA 3I5IB 4OVNF 1QV1A 2V53A 2I18A 2G2BA 4I5JA 4R1EA 3PALA 1DVIA 1WDCC 3LLEA 2LHIA 1A29A 1AJ4A 1UHNA 2BCXA 1J1DA 2HPSA 5HKWA 1A2XA 4MZLA 1QIVA 2K2FA 1R2UA 4PCWA 4HRHA 2GV5A 1NP8A 3CWGA 3PN7B 3FS7A 1FBVA 1K8UA 1BOCA 2JULA 1DTLA 1CLLA 2JU0A 1BJFA 2WCBA 3GK1A 3C1VA 1YUTA 1JFKA 1AVSA 3VRPA 3I5IC 2NCPA 2LUCA 2JWWA 2P6BB 3GK2A 3KO0A 2M9GA 4MRYA 5KTYA 2LVVA 2FCDA 1B7TZ 4GGNA 2L51A 2KFHA 4HSZA 2WOSA 3TUYB 4XJKA 1DGUA 1LVCD 2OS8B 1SL9A 2JC2A 4YI8A 2H61C 1WRZA 1SKTA 3OHMB 2K7CA 3BYAA 2Q4UA 3VRNA 1KK7Z 4Q04A 3VGOA 1CKKA 3PN7C 1K94A 1NSHA 1TN4A 1Y1UA 1BR1B 1M31A 1M45A 4MZJA 1S3PA 2Y1MA 1KFXL 5D7FA 1V1FA 3RM1A 2L4HA 1XK4A 2OPOA 1YX8A 2M0RA 1XFXO 1IQ5A 2KFGA 1SCVA 3TUYC 5J3XA 1QXPA 1JBAA 2LP3A 2OS8C 5HLVA 2AAOA 2BKHB 3IF7A 1N0YA 4MSPA 4MRXA 3EK7A 4M2PA 1WLZA 3BQ3A 3WNXB 1UP5A 2Y1NA 4OCIA 3I5HB 2LMTA 5JJGA 1ALVA 2K8MB 1A4PA 3IQQA 4PALA 1K93D 4JQ0D 1WRKA 1AK8A 4MBEA 1D1OA 1RK9A 4OV2A 1AHRA 1BU3A 1N2DA 1G4YR 3O4YA 3D10A 1S6JA 2CTNA 1NCZA 2LLUA 2PASA 2KI6D 2ZN9A 4GBAA 4YGEB 5DKRA 2F2PA 2K7BA 3TS5B 1CNPA 3EKJA 1EJ3A 1NYAA 4XJKB 1M63B 1YVLA 3PFVA 2EC6B 3LK0A 2COLB 4JWQA 1YUUA 3EVVA 1L7ZA 2H61A 2KAXA 1TRFA 3VRQA 2NXQA 1SYMA 2KYCA 2ZFDA 1H4BA 1BF5A 1M46A 2O5GA 4QJ4B 2K61A 1F4OA 1S6CA 1PRWA 1QX5B 1UWOA 2KAVA 1M39A 5IBWA 1Q80A 1GGWA 3VRRA 4AQIA 2KI4B 3OX6A 5KU1A 3FIAA 4PE4A 2DOQA 2SCPA 1UHHA 3CZTX 3PM8A 3TS5C 4N5XA 3FWCA 3M0WA 2L2EA 2KQ6A 1IKUA 4CIDA 1XVJA 1IJ6A 2TN4A 2EC6C 1JSAA 1DF0B 1NX3A 2LVJA 4GGFC 3A4UB 1NX0A 1Y6WA 1MWNA 3D0YB 5ER4X 3SG7A 1QS7A 4N1FA 1EXRA 1UHJA 2OTGB 3FWBA 3KEVA 2BCBA 2JTZA 2JPTA 2ISDA 1GQMA 4C0KA 1SR6B 1Y1AA 4YGCB 1BODA 2FJUB 3SG2A 4AOMA 2KNEA 1QVIZ 1F4QA 1KK7Y 2M3WA 2KI4C 2LLTA 1MQ1A 1BMOA 4MZKA 1IG5A 1DT7B 3OP0A 1XFYO 4GFTA 1CFDA 4BY5A 2WC8A 2KHNA 3NSOA 2PSRA 1QLSA 1YRUB 2GGMA 1GJYA 1PVAA 1TOPA 3CR4X 2KSPA 3EK8A 4MN0A 1JUOA 1DJHA 2KYFA 4L9MA 4PHMA 3OB1B 2K0JA 2LE9B 2CCMA 1XFWO 3CLNA 2OTGC 3TZ1A 1MXLC 2QPTA 1TNXA 2JNXA 3CR2A 4JPZB 4AQJA 1DGVA 1KK8B 4I5KA 4C0JA 1NX1A 1SR6C 1U5IA 2FOTA 5DKNA 2Y4QA 1H8BA 1LXFC 3F45A 1KWOB 1MUXA 1IQ3A 1S26D 1NPQA 2KI6C 1A75B 2G9BA 4NDDA 2L50A 1K9UA 1J55A 1DJIA 1SL7A 4E68A 2MLFC 3AAKA 2BE4A 1IWQA 1TNWA 3HX4A 4WRIA 1JFJA 2ZNEA 2FCEA 1TIZA 2KAYA 2WORA 4GGFA 1FPWA 1LINA 2JXLA 1Y1XA 4HRGA 2ZNDA 3VROA 2MRDA 3CTNA 1CMFA 1KK8C 5DKQA 2M29A 4NDBA 1L2OB 5CSNA 3SG3A 1PK0D 1KFUL 1LA3A 1KWOC 2L4IA 1B4CA 2F33A 1F55A 1KQMB 1PSBA 1CFCA 4F0ZB 1TNQA 1RJVA 3NSLA 2LAPA 1CMGA 4YI9A 1S5GZ 2L98A 1RECA 1HQVA 1AJ5A 2KGRA 2MLEC 1DF0A 1WLMA 4N1GA 4PHKA 3CR5X 1AUIB 1S36A 1MF8B 2F3YA 2H2KA 4YGBB 1CB1A 2BL0B 1YVHA 2LV7A 5AERA 1EG3A 2JT8A 3BUXB 3D0YA 3LK1A 1BR4B 1HT9A 1YR5A 3AKAA 3KPXA 1XFVO 1QX2A 1CLBA 1U5IB 2L0PA 2D8NA 1B47A 1L2OC 3CS1A 3BUNB 3WHTB 4ETOA 1CFPA 1J7OA 4FQOA 3NSIA 3O6BA 1R6PA 2MAZA 1KQMC 3O2PA 4ORAB 3KF9A 1ALWA 2BECA 2M97A 5ER5A 2AMIA 5HYDA 2F8PA 4U8DA 5AEQA 2F3ZA 1QVIY 1AP4A 1B8LA 1SBJA 1WY9A 3ZNIA 1ZFSA 2JQ6A 2BL0C 1ODBA 3LCPC 2SASA 2E6WA 4PHNA 5CPVA 2I2RE 1FF1A 1E8AA 2M1UA 3I5FB 2L5XB 1UHKA 1W7JB 2ZKMX 2RGIA 3A8RA 2LVIA 2E30A 1Y0VH 2Y5IA 1TCOB 2F2OA 1MXEA 4CFRA 3DVEA 4YGDB 4PDZA 1CM1A 4XYNA 1CTRA 1C07A 1CDLA 1BLQA 1A75A 4OKHA 1SY9A 1ZMZA 2BKIB 5I2OA 4USLA 4DCKA 1QX7A 5TNCA 1IH0A 4MEWA 2LLSA 2LCPA 5AFPA 1B7TY 2PALA 1N65A 2M1KB 1CFFA 1PALA 1SPYA 1OMRA 2NLNA 3I5FC 4FTGA 1QJTA 1A03A 4YBHB 4CFQA 1YTZC 3TDUA 2M7NA 4WQ3A 4PHJA 1SCMC 2ZRTA 2LMUA 3QRXA 4QJ3B 5G08A 4A4CA 4CLNA 5I8NA 1K9PA 1QIWA 1YRTB 1J7PA 3EVRA 2JT0A 1BT6A 2BE6A 1J7QA 2JXCA 2CT9A
chains in the Genus database with same CATH superfamily
1CLMA 4PE1A 4INWA 1OOGA 1X02A 1GM0A 4I5NB 4YRUA 1B9AA 2LM5A 3SIAA 2I7AA 2MBXA 5BPJA 2GGZA 1KCYA 3BUMB 1K96A 2LANA 2LVKA 3L47A 1RFJA 2CXJA 1C3YA 5I2QA 2JZIA 4F7FA 1SSEB 2HQWA 1DC1A 1SRAA 3EVUA 3FE9A 3L4LA 2KOTA 1QLKA 2KFFA 2MHHA 4OR9B 1IRJA 1CDNA 3DXLA 1UURA 1RWYA 3LL8B 1F71A 2PMYA 2BBMA 1KQVA 1FI5A 2JOJA 1K9KA 3HCMA 1UHIA 3BJHA 3B88A 2AUCA 3JVTB 2A4JA 3K21A 4GNKB 3AKBA 4MVFA 1OMDA 1LKJA 2LP2A 3PATA 4P5OE 1NCXA 4BY4A 1QASA 3Q8IA 2JRFA 2KBMA 2MJWB 3DF0A 2KQYA 3ICBA 1IIOA 1GGZA 2KGBC 4KYNA 3V2LA 1SNLA 1FI6A 1OE9B 2LUXA 2QACA 3CGAA 1K90D 5AXIA 1G33A 3TDIA 1C7WA 3CYZA 1TTXA 1DJYA 3DD4A 1S6IA 3CABA 1FW4A 1XFUO 1UUSA 4DIRA 2EHBA 4ICBA 1IJ5A 5CSFA 3SIBA 2MA2A 5AANA 4CPVA 3ZWHA 2BNXA 1DJWA 1XYDA 3D75A 1F8HA 1DJXA 1PULA 1CDPA 3JVTC 4ORBB 3SG4A 1J7RA 1IGVA 2BBNA 1NUBA 1SW8A 3PJIA 2WCFA 2LNKA 4DUQA 1DMOA 2LMVA 1DJGA 1PVBA 1W7IB 2QEOA 1K95A 2IS9A 3K1EA 3DVJA 2NCOA 4ZCVA 1WRLA 3EK4A 1JC2A 1NCYA 2KDHA 2VRGA 1JWDA 3MSEB 4DS7A 3D74A 2LC5A 1XFZO 1NIWA 3E3RA 3OX5A 2PVBA 1F54A 4WQ2A 3O78A 1OZSA 2WNDA 4M2QA 1TUZA 1SL8A 2CNPA 5I94A 1NX2A 5I2LA 3BOWA 1B8RA 1QTXA 2B1UA 3GK4X 5FYXA 3DY9A 2PRUA 2M7LA 1J1EA 4A4BA 1XO5A 2ZRSA 1OQPA 3BXKA 3UO9A 4DRWA 1EH2A 5K89A 3PSRA 4UPGA 3DF0B 1XA5A 5CSIA 3OB2B 1EL4A 1NWDA 1MR8A 3DVKA 1DJZA 4ZCUA 4C0LA 3S0GA 2HETA 2LHLA 2ERBA 2JTTA 3SG6A 4D1EA 3GOFA 1VRKA 1YUSA 1TCFA 3BUOB 1ZUZA 5GQQC 5JOLA 4PE0A 2I94A 3CZ1A 1RTP1 3SS3A 2QEBA 1SCMB 2K7DA 1LA0A 1ZACA 3R1PA 5PALA 1OOJA 1PSRA 2BCAA 2NZ0A 2R2IA 3DVMA 3CZ0A 3IQOA 2HQ8A 3WXAA 1KSMA 1YX7A 4GUKA 1G8IA 2L5YA 1YURA 4IL1A 3I5GB 1Z2CB 1RROA 3I5HC 4PE7A 3RLZA 4QJ5B 4M2OA 4TNCA 3VB1A 4GPLB 3NSKA 1DQEA 5CSJA 5B8IB 3S0DA 4YGAA 5HLOA 3UNWA 3WHUB 4OZDA 2QDIA 3JTDB 2L2CA 1OOFA 5D69A 1BG1A 5HKZA 1C7VA 5EL2A 2ZN8A 3EKHA 1KSOA 5F6TA 1MHOA 3AAJA 2CBLA 1OMVA 3BOWB 2K7OA 1SMGA 5HKYA 3SJSA 4ORCB 1F70A 2EGDA 3CDNA 1WDCB 1B8CA 1V1GA 4NDCA 4HREE 2O60A 1B1GA 1ZOTB 2M8UA 1JF0A 3IVTA 3PLFB 4NQGA 2K2AA 3R1OA 1EG4A 1SK6D 3TDZA 2WCEA 1C3ZA 3I5GC 5KSZA 1ORGA 3SG5A 1QV0A 1TWOA 2WCLA 3KHEA 2Q91A 4GAOA 3S0BA 4I5LB 3BUWB 2HF5A 1S5GY 1CDMA 1OSAA 1QATA 1CM4A 3H4SE 3JTDC 1JF2A 5HL1A 2JNFA 2M49B 1OZOA 2JT3A 2KBIA 1XK4C 3NXAA 4MLWA 4P2YB 1KFUS 1K2HA 1KFXS 1TNPA 1S1EA 3I5IB 4OVNF 1QV1A 2V53A 2I18A 2G2BA 4I5JA 4R1EA 3PALA 1DVIA 1WDCC 3LLEA 2LHIA 1A29A 1AJ4A 1UHNA 2BCXA 1J1DA 2QEVA 1W9ZA 2HPSA 5HKWA 1A2XA 4MZLA 1QIVA 2K2FA 1R2UA 4PCWA 4HRHA 2GV5A 1OOIX 1NP8A 3CWGA 3PN7B 3FS7A 2WC5A 3R1VA 1FBVA 1K8UA 1BOCA 2JULA 1DTLA 1CLLA 2JU0A 1BJFA 2WCBA 3GK1A 3C1VA 1YUTA 1JFKA 1AVSA 3VRPA 3I5IC 2NCPA 2LUCA 2JWWA 2P6BB 3CZ2A 3GK2A 3KO0A 2M9GA 4MRYA 5KTYA 2LVVA 2FCDA 1B7TZ 4GGNA 1DEKA 2L51A 2KFHA 4HSZA 2WOSA 3TUYB 4XJKA 3RZSA 1DGUA 1LVCD 2OS8B 1SL9A 2JC2A 4YI8A 2H61C 1WRZA 1SKTA 3OHMB 2K7CA 3PM2A 3BYAA 4FQTA 3S0AA 2Q4UA 3VRNA 1KK7Z 1DELA 2K60A 4Q04A 3VGOA 1CKKA 3PN7C 1K94A 1NSHA 1TN4A 1Y1UA 1BR1B 1M31A 1M45A 4MZJA 1S3PA 2Y1MA 1KFXL 5D7FA 1V1FA 3RM1A 2L4HA 1XK4A 2OPOA 1YX8A 2M0RA 3B87A 1XFXO 1IQ5A 2KFGA 1SCVA 1T14A 4JKTA 2JPOA 3OGNA 3TUYC 5J3XA 1QXPA 1JBAA 2LP3A 2OS8C 5HLVA 2AAOA 2BKHB 3IF7A 1P28A 1N0YA 1OOHA 2KLEA 1XFRA 4MSPA 4MRXA 3EK7A 4M2PA 3S0EA 1WLZA 3BQ3A 3N7HA 3WNXB 1UP5A 2FJYA 2Y1NA 4OCIA 3I5HB 2LMTA 3B7AA 5JJGA 1ALVA 3EG5B 3NHTA 2K8MB 1A4PA 3IQQA 4PALA 1K93D 2WC6A 4JQ0D 1WRKA 1AK8A 4MBEA 3DZTA 1D1OA 1RK9A 4OV2A 1AHRA 1BU3A 1N2DA 1G4YR 3O4YA 3D10A 1S6JA 2CTNA 1NCZA 2LLUA 2PASA 2KI6D 2ZN9A 4GBAA 4YGEB 5DKRA 2F2PA 2K7BA 1Z4HA 3TS5B 1CNPA 3EKJA 1EJ3A 1NYAA 4XJKB 4JD9A 1M63B 1YVLA 3PFVA 2EC6B 3LK0A 2COLB 4JWQA 3L4AA 1YUUA 3EVVA 1L7ZA 2H61A 2KAXA 1TRFA 3D78A 3B6XA 3VRQA 2NXQA 1SYMA 2KYCA 5FI6A 2ZFDA 1H4BA 1BF5A 1M46A 2O5GA 4QJ4B 5D3OA 2K61A 1F4OA 3OBVA 1S6CA 2WCJA 1PRWA 1QX5B 1UWOA 2KAVA 2P71A 2P70A 2QEHA 2GTEA 1M39A 5IBWA 1Q80A 1QWVA 1GGWA 3VRRA 4AQIA 2KI4B 3OX6A 5KU1A 3FIAA 4PE4A 2DOQA 2SCPA 1UHHA 3CZTX 3PM8A 3TS5C 4N5XA 3FWCA 3M0WA 2L2EA 2KQ6A 3D73A 1IKUA 1LS8A 4CIDA 1XVJA 1IJ6A 2TN4A 2WCHA 2EC6C 1JSAA 1DF0B 1NX3A 2LVJA 4GGFC 3A4UB 1NX0A 3NHIA 1Y6WA 1MWNA 3D0YB 5ER4X 3SG7A 3BFAA 1QS7A 4N1FA 1EXRA 1UHJA 2OTGB 3FWBA 3KEVA 2BCBA 2JTZA 2JPTA 2ISDA 1GQMA 4C0KA 1SR6B 1Y1AA 4YGCB 1BODA 2FJUB 3SG2A 3DYEA 3FE6A 4AOMA 2KNEA 1QVIZ 1F4QA 1KK7Y 2KPHA 2M3WA 2KI4C 2LLTA 1MQ1A 1BMOA 3SS4A 4MZKA 1IG5A 1DT7B 3OP0A 1XFYO 4GFTA 1CFDA 4BY5A 2WC8A 2KHNA 3NSOA 2PSRA 3B86A 1QLSA 1YRUB 2GGMA 1GJYA 1PVAA 1OW4A 1TOPA 3CR4X 2KSPA 3EK8A 4MN0A 1JUOA 1DJHA 2KYFA 4L9MA 4PHMA 3OB1B 2K0JA 2LE9B 2CCMA 1XFWO 3CLNA 2OTGC 1TUJA 3TZ1A 1MXLC 2QPTA 1TNXA 2JNXA 3CR2A 4JPZB 4AQJA 1DGVA 1KK8B 4I5KA 4C0JA 1NX1A 1SR6C 1U5IA 2FOTA 5DKNA 2Y4QA 1H8BA 1LXFC 3F45A 1KWOB 1MUXA 1IQ3A 1S26D 1NPQA 2KI6C 1A75B 2G9BA 4NDDA 2L50A 1K9UA 1J55A 1DJIA 1SL7A 4E68A 2MLFC 3AAKA 2BE4A 1IWQA 1TNWA 3HX4A 4WRIA 2KLDA 2YGUA 5FI7A 2ZNEA 1JFJA 2FCEA 1TIZA 2KAYA 2WORA 4GGFA 1FPWA 1LINA 2JXLA 1Y1XA 4HRGA 2ZNDA 3VROA 2MRDA 3CTNA 1CMFA 1KK8C 5DKQA 3S0FA 2PYQA 2M29A 4NDBA 1L2OB 5CSNA 3BFBA 3SG3A 1PK0D 1KFUL 1LA3A 1KWOC 2L4IA 1B4CA 2F33A 1F55A 1KQMB 1PSBA 1CFCA 4F0ZB 3D76A 1TNQA 1RJVA 3NSLA 2LAPA 1CMGA 4YI9A 1S5GZ 2BAPA 2WCMA 2L98A 3O4XA 1RECA 1HQVA 1AJ5A 2KGRA 2MLEC 1DF0A 1WLMA 4N1GA 4PHKA 3CR5X 1AUIB 1S36A 1MF8B 2F3YA 2H2KA 4YGBB 1CB1A 2BL0B 1YVHA 2LV7A 5AERA 1EG3A 2JT8A 2WCKA 3BUXB 3D0YA 3LK1A 1BR4B 3BFHA 1HT9A 1YR5A 3AKAA 3KPXA 1XFVO 1QX2A 1CLBA 1U5IB 2L0PA 2D8NA 1B47A 1L2OC 3CS1A 3BUNB 3NGVA 4INXA 3WHTB 4ETOA 1CFPA 1J7OA 4FQOA 3NSIA 3O6BA 1R6PA 2MAZA 1KQMC 3O2PA 4ORAB 3KF9A 1ALWA 2BECA 2M97A 5ER5A 2AMIA 5HYDA 2F8PA 4U8DA 5AEQA 2F3ZA 1QVIY 1AP4A 1B8LA 1SBJA 1WY9A 3ZNIA 2PQLA 1ZFSA 2JQ6A 2BL0C 1ODBA 3LCPC 5FI2A 2SASA 4IJ7A 2E6WA 4PHNA 5CPVA 2I2RE 1FF1A 1E8AA 2M1UA 3FE8A 3I5FB 2L5XB 1UHKA 1W7JB 2ZKMX 2RGIA 3A8RA 2LVIA 2E30A 1Y0VH 2Y5IA 1TCOB 2F2OA 1MXEA 4CFRA 3DVEA 4YGDB 4PDZA 1CM1A 4XYNA 1CTRA 1C07A 1CDLA 1BLQA 1A75A 4OKHA 5DICA 1SY9A 1ZMZA 2BKIB 5I2OA 4USLA 4DCKA 1QX7A 5TNCA 1IH0A 4MEWA 2LLSA 3D77A 2LCPA 5AFPA 1B7TY 2PALA 1N65A 2M1KB 1CFFA 1PALA 3R72A 1SPYA 1OMRA 2NLNA 3I5FC 4FTGA 1QJTA 3SS5A 1A03A 4YBHB 4CFQA 1YTZC 3TDUA 2M7NA 4WQ3A 4PHJA 4PT1A 1SCMC 2ZRTA 2LMUA 3QRXA 4QJ3B 5G08A 4A4CA 4CLNA 5I8NA 1K9PA 1QIWA 2H8VA 1YRTB 1J7PA 3EVRA 2JT0A 1BT6A 2BE6A 3QMEA 2JXCA 1J7QA 2CT9A
chains in the Genus database with same CATH topology
1CLMA 4PE1A 1X02A 4I5NB 4YRUA 1B9AA 2LM5A 3SIAA 2I7AA 2MBXA 5BPJA 2GGZA 1KCYA 3BUMB 1K96A 2LANA 2LVKA 1RFJA 2CXJA 5I2QA 2JZIA 2HQWA 1SRAA 3EVUA 2KOTA 1QLKA 2KFFA 2MHHA 4OR9B 1IRJA 1CDNA 1UURA 1RWYA 3LL8B 1F71A 2PMYA 2BBMA 1KQVA 1FI5A 2JOJA 1K9KA 3HCMA 1UHIA 4GNKB 4MVFA 2AUCA 3JVTB 2A4JA 3K21A 3AKBA 1OMDA 1LKJA 2LP2A 3PATA 4P5OE 1NCXA 4BY4A 1QASA 2JRFA 2KBMA 2MJWB 3DF0A 2KQYA 3ICBA 1GGZA 2KGBC 1SNLA 1FI6A 1OE9B 2LUXA 2QACA 3CGAA 1K90D 5AXIA 1G33A 3TDIA 1C7WA 3DD4A 1TTXA 1DJYA 1S6IA 1FW4A 1XFUO 1UUSA 4DIRA 2EHBA 4ICBA 1IJ5A 5CSFA 3SIBA 2MA2A 5AANA 4CPVA 3ZWHA 1DJWA 1XYDA 1F8HA 1DJXA 1PULA 1CDPA 3JVTC 4ORBB 3SG4A 1J7RA 1IGVA 2BBNA 1NUBA 1SW8A 2WCFA 2LNKA 4DUQA 1DMOA 2LMVA 1DJGA 1PVBA 1W7IB 1K95A 2IS9A 3DVJA 2NCOA 4ZCVA 1WRLA 3EK4A 1JC2A 1NCYA 2KDHA 2VRGA 1JWDA 3MSEB 4DS7A 2LC5A 1XFZO 1NIWA 3E3RA 3OX5A 2PVBA 1F54A 4WQ2A 3O78A 1OZSA 2WNDA 4M2QA 2CNPA 1SL8A 1NX2A 5I2LA 3BOWA 1B8RA 1QTXA 2B1UA 3GK4X 5FYXA 2M7LA 2PRUA 1J1EA 4A4BA 1XO5A 2ZRSA 1OQPA 3BXKA 4DRWA 1EH2A 5K89A 3PSRA 4UPGA 3DF0B 1XA5A 5CSIA 3OB2B 1EL4A 1NWDA 1MR8A 3DVKA 1DJZA 4ZCUA 4C0LA 2HETA 2LHLA 2JTTA 3SG6A 4D1EA 3GOFA 1VRKA 1YUSA 1TCFA 3BUOB 1ZUZA 5GQQC 5JOLA 4PE0A 2I94A 1RTP1 1SCMB 2K7DA 1LA0A 1ZACA 5PALA 1OOJA 1PSRA 2BCAA 2NZ0A 2R2IA 3DVMA 3IQOA 2HQ8A 3WXAA 1KSMA 1YX7A 4GUKA 1G8IA 1YURA 4IL1A 3I5GB 4PE7A 1RROA 3I5HC 3RLZA 4QJ5B 4M2OA 4TNCA 5B8IB 4GPLB 3NSKA 5CSJA 4YGAA 5HLOA 3WHUB 3JTDB 5D69A 1C7VA 1BG1A 5HKZA 2ZN8A 3EKHA 1KSOA 5F6TA 1MHOA 3AAJA 2CBLA 1OMVA 3BOWB 2K7OA 1SMGA 5HKYA 3SJSA 4ORCB 1F70A 2EGDA 1WDCB 1B8CA 1V1GA 4NDCA 4HREE 2O60A 1B1GA 1ZOTB 2M8UA 1JF0A 3PLFB 4NQGA 2K2AA 3TDZA 1EG4A 1SK6D 2WCEA 3I5GC 5KSZA 3SG5A 1QV0A 3KHEA 2Q91A 4GAOA 4I5LB 3BUWB 2HF5A 1S5GY 1CDMA 1OSAA 1QATA 1CM4A 3H4SE 3JTDC 1JF2A 2JNFA 2M49B 1OZOA 2JT3A 2KBIA 1XK4C 3NXAA 4MLWA 4P2YB 1KFUS 1K2HA 1KFXS 1TNPA 1S1EA 3I5IB 4OVNF 1QV1A 2V53A 2I18A 2G2BA 4I5JA 4R1EA 3PALA 1DVIA 1WDCC 3LLEA 2LHIA 1A29A 1AJ4A 1UHNA 2BCXA 1J1DA 2HPSA 5HKWA 1A2XA 4MZLA 1QIVA 2K2FA 1R2UA 4PCWA 4HRHA 2GV5A 1NP8A 3CWGA 3PN7B 3FS7A 1FBVA 1K8UA 1BOCA 2JULA 1DTLA 1CLLA 2JU0A 1BJFA 2WCBA 3GK1A 3C1VA 1YUTA 1JFKA 1AVSA 3VRPA 3I5IC 2NCPA 2LUCA 2JWWA 2P6BB 3GK2A 3KO0A 2M9GA 4MRYA 5KTYA 2LVVA 2FCDA 1B7TZ 4GGNA 2L51A 2KFHA 4HSZA 2WOSA 3TUYB 4XJKA 1DGUA 1LVCD 2OS8B 1SL9A 2JC2A 4YI8A 2H61C 1WRZA 1SKTA 3OHMB 2K7CA 3BYAA 2Q4UA 3VRNA 1KK7Z 4Q04A 3VGOA 1CKKA 3PN7C 1K94A 1NSHA 1TN4A 1Y1UA 1BR1B 1M31A 1M45A 4MZJA 1S3PA 2Y1MA 1KFXL 5D7FA 1V1FA 3RM1A 2L4HA 1XK4A 2OPOA 1YX8A 2M0RA 1XFXO 1IQ5A 2KFGA 1SCVA 3TUYC 5J3XA 1QXPA 1JBAA 2LP3A 2OS8C 5HLVA 2AAOA 2BKHB 3IF7A 1N0YA 4MSPA 4MRXA 3EK7A 4M2PA 1WLZA 3BQ3A 3WNXB 1UP5A 2Y1NA 4OCIA 3I5HB 2LMTA 5JJGA 1ALVA 2K8MB 1A4PA 3IQQA 4PALA 1K93D 4JQ0D 1WRKA 1AK8A 4MBEA 1D1OA 1RK9A 4OV2A 1AHRA 1BU3A 1N2DA 1G4YR 3O4YA 3D10A 1S6JA 2CTNA 1NCZA 2LLUA 2PASA 2KI6D 2ZN9A 4GBAA 4YGEB 5DKRA 2F2PA 2K7BA 3TS5B 1CNPA 3EKJA 1EJ3A 1NYAA 4XJKB 1M63B 1YVLA 3PFVA 2EC6B 3LK0A 2COLB 4JWQA 1YUUA 3EVVA 1L7ZA 2H61A 2KAXA 1TRFA 3VRQA 2NXQA 1SYMA 2KYCA 2ZFDA 1H4BA 1BF5A 1M46A 2O5GA 4QJ4B 2K61A 1F4OA 1S6CA 1PRWA 1QX5B 1UWOA 2KAVA 1M39A 5IBWA 1Q80A 1GGWA 3VRRA 4AQIA 2KI4B 3OX6A 5KU1A 3FIAA 4PE4A 2DOQA 2SCPA 1UHHA 3CZTX 3PM8A 3TS5C 4N5XA 3FWCA 3M0WA 2L2EA 2KQ6A 1IKUA 4CIDA 1XVJA 1IJ6A 2TN4A 2EC6C 1JSAA 1DF0B 1NX3A 2LVJA 4GGFC 3A4UB 1NX0A 1Y6WA 1MWNA 3D0YB 5ER4X 3SG7A 1QS7A 4N1FA 1EXRA 1UHJA 2OTGB 3FWBA 3KEVA 2BCBA 2JTZA 2JPTA 2ISDA 1GQMA 4C0KA 1SR6B 1Y1AA 4YGCB 1BODA 2FJUB 3SG2A 4AOMA 2KNEA 1QVIZ 1F4QA 1KK7Y 2M3WA 2KI4C 2LLTA 1MQ1A 1BMOA 4MZKA 1IG5A 1DT7B 3OP0A 1XFYO 4GFTA 1CFDA 4BY5A 2WC8A 2KHNA 3NSOA 2PSRA 1QLSA 1YRUB 2GGMA 1GJYA 1PVAA 1TOPA 3CR4X 2KSPA 3EK8A 4MN0A 1JUOA 1DJHA 2KYFA 4L9MA 4PHMA 3OB1B 2K0JA 2LE9B 2CCMA 1XFWO 3CLNA 2OTGC 3TZ1A 1MXLC 2QPTA 1TNXA 2JNXA 3CR2A 4JPZB 4AQJA 1DGVA 1KK8B 4I5KA 4C0JA 1NX1A 1SR6C 1U5IA 2FOTA 5DKNA 2Y4QA 1H8BA 1LXFC 3F45A 1KWOB 1MUXA 1IQ3A 1S26D 1NPQA 2KI6C 1A75B 2G9BA 4NDDA 2L50A 1K9UA 1J55A 1DJIA 1SL7A 4E68A 2MLFC 3AAKA 2BE4A 1IWQA 1TNWA 3HX4A 4WRIA 1JFJA 2ZNEA 2FCEA 1TIZA 2KAYA 2WORA 4GGFA 1FPWA 1LINA 2JXLA 1Y1XA 4HRGA 2ZNDA 3VROA 2MRDA 3CTNA 1CMFA 1KK8C 5DKQA 2M29A 4NDBA 1L2OB 5CSNA 3SG3A 1PK0D 1KFUL 1LA3A 1KWOC 2L4IA 1B4CA 2F33A 1F55A 1KQMB 1PSBA 1CFCA 4F0ZB 1TNQA 1RJVA 3NSLA 2LAPA 1CMGA 4YI9A 1S5GZ 2L98A 1RECA 1HQVA 1AJ5A 2KGRA 2MLEC 1DF0A 1WLMA 4N1GA 4PHKA 3CR5X 1AUIB 1S36A 1MF8B 2F3YA 2H2KA 4YGBB 1CB1A 2BL0B 1YVHA 2LV7A 5AERA 1EG3A 2JT8A 3BUXB 3D0YA 3LK1A 1BR4B 1HT9A 1YR5A 3AKAA 3KPXA 1XFVO 1QX2A 1CLBA 1U5IB 2L0PA 2D8NA 1B47A 1L2OC 3CS1A 3BUNB 3WHTB 4ETOA 1CFPA 1J7OA 4FQOA 3NSIA 3O6BA 1R6PA 2MAZA 1KQMC 3O2PA 4ORAB 3KF9A 1ALWA 2BECA 2M97A 5ER5A 2AMIA 5HYDA 2F8PA 4U8DA 5AEQA 2F3ZA 1QVIY 1AP4A 1B8LA 1SBJA 1WY9A 3ZNIA 1ZFSA 2JQ6A 2BL0C 1ODBA 3LCPC 2SASA 2E6WA 4PHNA 5CPVA 2I2RE 1FF1A 1E8AA 2M1UA 3I5FB 2L5XB 1UHKA 1W7JB 2ZKMX 2RGIA 3A8RA 2LVIA 2E30A 1Y0VH 2Y5IA 1TCOB 2F2OA 1MXEA 4CFRA 3DVEA 4YGDB 4PDZA 1CM1A 4XYNA 1CTRA 1C07A 1CDLA 1BLQA 1A75A 4OKHA 1SY9A 1ZMZA 2BKIB 5I2OA 4USLA 4DCKA 1QX7A 5TNCA 1IH0A 4MEWA 2LLSA 2LCPA 5AFPA 1B7TY 2PALA 1N65A 2M1KB 1CFFA 1PALA 1SPYA 1OMRA 2NLNA 3I5FC 4FTGA 1QJTA 1A03A 4YBHB 4CFQA 1YTZC 3TDUA 2M7NA 4WQ3A 4PHJA 1SCMC 2ZRTA 2LMUA 3QRXA 4QJ3B 5G08A 4A4CA 4CLNA 5I8NA 1K9PA 1QIWA 1YRTB 1J7PA 3EVRA 2JT0A 1BT6A 2BE6A 1J7QA 2JXCA 2CT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLM A;  4PE1 A;  1X02 A;  4I5N B;  4YRU A;  1B9A A;  2LM5 A;  3SIA A;  2I7A A;  2MBX A;  5BPJ A;  2GGZ A;  1KCY A;  3BUM B;  1K96 A;  2LAN A;  2LVK A;  1RFJ A;  2CXJ A;  5I2Q A;  2JZI A;  2HQW A;  1SRA A;  3EVU A;  2KOT A;  1QLK A;  2KFF A;  2MHH A;  4OR9 B;  1IRJ A;  1CDN A;  1UUR A;  1RWY A;  3LL8 B;  1F71 A;  2PMY A;  2BBM A;  1KQV A;  1FI5 A;  2JOJ A;  1K9K A;  3HCM A;  1UHI A;  4GNK B;  4MVF A;  2AUC A;  3JVT B;  2A4J A;  3K21 A;  3AKB A;  1OMD A;  1LKJ A;  2LP2 A;  3PAT A;  4P5O E;  1NCX A;  4BY4 A;  1QAS A;  2JRF A;  2KBM A;  2MJW B;  3DF0 A;  2KQY A;  3ICB A;  1GGZ A;  2KGB C;  1SNL A;  1FI6 A;  1OE9 B;  2LUX A;  2QAC A;  3CGA A;  1K90 D;  5AXI A;  1G33 A;  3TDI A;  1C7W A;  3DD4 A;  1TTX A;  1DJY A;  1S6I A;  1FW4 A;  1XFU O;  1UUS A;  4DIR A;  2EHB A;  4ICB A;  1IJ5 A;  5CSF A;  3SIB A;  2MA2 A;  5AAN A;  4CPV A;  3ZWH A;  1DJW A;  1XYD A;  1F8H A;  1DJX A;  1PUL A;  1CDP A;  3JVT C;  4ORB B;  3SG4 A;  1J7R A;  1IGV A;  2BBN A;  1NUB A;  1SW8 A;  2WCF A;  2LNK A;  4DUQ A;  1DMO A;  2LMV A;  1DJG A;  1PVB A;  1W7I B;  1K95 A;  2IS9 A;  3DVJ A;  2NCO A;  4ZCV A;  1WRL A;  3EK4 A;  1JC2 A;  1NCY A;  2KDH A;  2VRG A;  1JWD A;  3MSE B;  4DS7 A;  2LC5 A;  1XFZ O;  1NIW A;  3E3R A;  3OX5 A;  2PVB A;  1F54 A;  4WQ2 A;  3O78 A;  1OZS A;  2WND A;  4M2Q A;  2CNP A;  1SL8 A;  1NX2 A;  5I2L A;  3BOW A;  1B8R A;  1QTX A;  2B1U A;  3GK4 X;  5FYX A;  2M7L A;  2PRU A;  1J1E A;  4A4B A;  1XO5 A;  2ZRS A;  1OQP A;  3BXK A;  4DRW A;  1EH2 A;  5K89 A;  3PSR A;  4UPG A;  3DF0 B;  1XA5 A;  5CSI A;  3OB2 B;  1EL4 A;  1NWD A;  1MR8 A;  3DVK A;  1DJZ A;  4ZCU A;  4C0L A;  2HET A;  2LHL A;  2JTT A;  3SG6 A;  4D1E A;  3GOF A;  1VRK A;  1YUS A;  1TCF A;  3BUO B;  1ZUZ A;  5GQQ C;  5JOL A;  4PE0 A;  2I94 A;  1RTP 1;  1SCM B;  2K7D A;  1LA0 A;  1ZAC A;  5PAL A;  1OOJ A;  1PSR A;  2BCA A;  2NZ0 A;  2R2I A;  3DVM A;  3IQO A;  2HQ8 A;  3WXA A;  1KSM A;  1YX7 A;  4GUK A;  1G8I A;  1YUR A;  4IL1 A;  3I5G B;  4PE7 A;  1RRO A;  3I5H C;  3RLZ A;  4QJ5 B;  4M2O A;  4TNC A;  5B8I B;  4GPL B;  3NSK A;  5CSJ A;  4YGA A;  5HLO A;  3WHU B;  3JTD B;  5D69 A;  1C7V A;  1BG1 A;  5HKZ A;  2ZN8 A;  3EKH A;  1KSO A;  5F6T A;  1MHO A;  3AAJ A;  2CBL A;  1OMV A;  3BOW B;  2K7O A;  1SMG A;  5HKY A;  3SJS A;  4ORC B;  1F70 A;  2EGD A;  1WDC B;  1B8C A;  1V1G A;  4NDC A;  4HRE E;  2O60 A;  1B1G A;  1ZOT B;  2M8U A;  1JF0 A;  3PLF B;  4NQG A;  2K2A A;  3TDZ A;  1EG4 A;  1SK6 D;  2WCE A;  3I5G C;  5KSZ A;  3SG5 A;  1QV0 A;  3KHE A;  2Q91 A;  4GAO A;  4I5L B;  3BUW B;  2HF5 A;  1S5G Y;  1CDM A;  1OSA A;  1QAT A;  1CM4 A;  3H4S E;  3JTD C;  1JF2 A;  2JNF A;  2M49 B;  1OZO A;  2JT3 A;  2KBI A;  1XK4 C;  3NXA A;  4MLW A;  4P2Y B;  1KFU S;  1K2H A;  1KFX S;  1TNP A;  1S1E A;  3I5I B;  4OVN F;  1QV1 A;  2V53 A;  2I18 A;  2G2B A;  4I5J A;  4R1E A;  3PAL A;  1DVI A;  1WDC C;  3LLE A;  2LHI A;  1A29 A;  1AJ4 A;  1UHN A;  2BCX A;  1J1D A;  2HPS A;  5HKW A;  1A2X A;  4MZL A;  1QIV A;  2K2F A;  1R2U A;  4PCW A;  4HRH A;  2GV5 A;  1NP8 A;  3CWG A;  3PN7 B;  3FS7 A;  1FBV A;  1K8U A;  1BOC A;  2JUL A;  1DTL A;  1CLL A;  2JU0 A;  1BJF A;  2WCB A;  3GK1 A;  3C1V A;  1YUT A;  1JFK A;  1AVS A;  3VRP A;  3I5I C;  2NCP A;  2LUC A;  2JWW A;  2P6B B;  3GK2 A;  3KO0 A;  2M9G A;  4MRY A;  5KTY A;  2LVV A;  2FCD A;  1B7T Z;  4GGN A;  2L51 A;  2KFH A;  4HSZ A;  2WOS A;  3TUY B;  4XJK A;  1DGU A;  1LVC D;  2OS8 B;  1SL9 A;  2JC2 A;  4YI8 A;  2H61 C;  1WRZ A;  1SKT A;  3OHM B;  2K7C A;  3BYA A;  2Q4U A;  3VRN A;  1KK7 Z;  4Q04 A;  3VGO A;  1CKK A;  3PN7 C;  1K94 A;  1NSH A;  1TN4 A;  1Y1U A;  1BR1 B;  1M31 A;  1M45 A;  4MZJ A;  1S3P A;  2Y1M A;  1KFX L;  5D7F A;  1V1F A;  3RM1 A;  2L4H A;  1XK4 A;  2OPO A;  1YX8 A;  2M0R A;  1XFX O;  1IQ5 A;  2KFG A;  1SCV A;  3TUY C;  5J3X A;  1QXP A;  1JBA A;  2LP3 A;  2OS8 C;  5HLV A;  2AAO A;  2BKH B;  3IF7 A;  1N0Y A;  4MSP A;  4MRX A;  3EK7 A;  4M2P A;  1WLZ A;  3BQ3 A;  3WNX B;  1UP5 A;  2Y1N A;  4OCI A;  3I5H B;  2LMT A;  5JJG A;  1ALV A;  2K8M B;  1A4P A;  3IQQ A;  4PAL A;  1K93 D;  4JQ0 D;  1WRK A;  1AK8 A;  4MBE A;  1D1O A;  1RK9 A;  4OV2 A;  1AHR A;  1BU3 A;  1N2D A;  1G4Y R;  3O4Y A;  3D10 A;  1S6J A;  2CTN A;  1NCZ A;  2LLU A;  2PAS A;  2KI6 D;  2ZN9 A;  4GBA A;  4YGE B;  5DKR A;  2F2P A;  2K7B A;  3TS5 B;  1CNP A;  3EKJ A;  1EJ3 A;  1NYA A;  4XJK B;  1M63 B;  1YVL A;  3PFV A;  2EC6 B;  3LK0 A;  2COL B;  4JWQ A;  1YUU A;  3EVV A;  1L7Z A;  2H61 A;  2KAX A;  1TRF A;  3VRQ A;  2NXQ A;  1SYM A;  2KYC A;  2ZFD A;  1H4B A;  1BF5 A;  1M46 A;  2O5G A;  4QJ4 B;  2K61 A;  1F4O A;  1S6C A;  1PRW A;  1QX5 B;  1UWO A;  2KAV A;  1M39 A;  5IBW A;  1Q80 A;  1GGW A;  3VRR A;  4AQI A;  2KI4 B;  3OX6 A;  5KU1 A;  3FIA A;  4PE4 A;  2DOQ A;  2SCP A;  1UHH A;  3CZT X;  3PM8 A;  3TS5 C;  4N5X A;  3FWC A;  3M0W A;  2L2E A;  2KQ6 A;  1IKU A;  4CID A;  1XVJ A;  1IJ6 A;  2TN4 A;  2EC6 C;  1JSA A;  1DF0 B;  1NX3 A;  2LVJ A;  4GGF C;  3A4U B;  1NX0 A;  1Y6W A;  1MWN A;  3D0Y B;  5ER4 X;  3SG7 A;  1QS7 A;  4N1F A;  1EXR A;  1UHJ A;  2OTG B;  3FWB A;  3KEV A;  2BCB A;  2JTZ A;  2JPT A;  2ISD A;  1GQM A;  4C0K A;  1SR6 B;  1Y1A A;  4YGC B;  1BOD A;  2FJU B;  3SG2 A;  4AOM A;  2KNE A;  1QVI Z;  1F4Q A;  1KK7 Y;  2M3W A;  2KI4 C;  2LLT A;  1MQ1 A;  1BMO A;  4MZK A;  1IG5 A;  1DT7 B;  3OP0 A;  1XFY O;  4GFT A;  1CFD A;  4BY5 A;  2WC8 A;  2KHN A;  3NSO A;  2PSR A;  1QLS A;  1YRU B;  2GGM A;  1GJY A;  1PVA A;  1TOP A;  3CR4 X;  2KSP A;  3EK8 A;  4MN0 A;  1JUO A;  1DJH A;  2KYF A;  4L9M A;  4PHM A;  3OB1 B;  2K0J A;  2LE9 B;  2CCM A;  1XFW O;  3CLN A;  2OTG C;  3TZ1 A;  1MXL C;  2QPT A;  1TNX A;  2JNX A;  3CR2 A;  4JPZ B;  4AQJ A;  1DGV A;  1KK8 B;  4I5K A;  4C0J A;  1NX1 A;  1SR6 C;  1U5I A;  2FOT A;  5DKN A;  2Y4Q A;  1H8B A;  1LXF C;  3F45 A;  1KWO B;  1MUX A;  1IQ3 A;  1S26 D;  1NPQ A;  2KI6 C;  1A75 B;  2G9B A;  4NDD A;  2L50 A;  1K9U A;  1J55 A;  1DJI A;  1SL7 A;  4E68 A;  2MLF C;  3AAK A;  2BE4 A;  1IWQ A;  1TNW A;  3HX4 A;  4WRI A;  1JFJ A;  2ZNE A;  2FCE A;  1TIZ A;  2KAY A;  2WOR A;  4GGF A;  1FPW A;  1LIN A;  2JXL A;  1Y1X A;  4HRG A;  2ZND A;  3VRO A;  2MRD A;  3CTN A;  1CMF A;  1KK8 C;  5DKQ A;  2M29 A;  4NDB A;  1L2O B;  5CSN A;  3SG3 A;  1PK0 D;  1KFU L;  1LA3 A;  1KWO C;  2L4I A;  1B4C A;  2F33 A;  1F55 A;  1KQM B;  1PSB A;  1CFC A;  4F0Z B;  1TNQ A;  1RJV A;  3NSL A;  2LAP A;  1CMG A;  4YI9 A;  1S5G Z;  2L98 A;  1REC A;  1HQV A;  1AJ5 A;  2KGR A;  2MLE C;  1DF0 A;  1WLM A;  4N1G A;  4PHK A;  3CR5 X;  1AUI B;  1S36 A;  1MF8 B;  2F3Y A;  2H2K A;  4YGB B;  1CB1 A;  2BL0 B;  1YVH A;  2LV7 A;  5AER A;  1EG3 A;  2JT8 A;  3BUX B;  3D0Y A;  3LK1 A;  1BR4 B;  1HT9 A;  1YR5 A;  3AKA A;  3KPX A;  1XFV O;  1QX2 A;  1CLB A;  1U5I B;  2L0P A;  2D8N A;  1B47 A;  1L2O C;  3CS1 A;  3BUN B;  3WHT B;  4ETO A;  1CFP A;  1J7O A;  4FQO A;  3NSI A;  3O6B A;  1R6P A;  2MAZ A;  1KQM C;  3O2P A;  4ORA B;  3KF9 A;  1ALW A;  2BEC A;  2M97 A;  5ER5 A;  2AMI A;  5HYD A;  2F8P A;  4U8D A;  5AEQ A;  2F3Z A;  1QVI Y;  1AP4 A;  1B8L A;  1SBJ A;  1WY9 A;  3ZNI A;  1ZFS A;  2JQ6 A;  2BL0 C;  1ODB A;  3LCP C;  2SAS A;  2E6W A;  4PHN A;  5CPV A;  2I2R E;  1FF1 A;  1E8A A;  2M1U A;  3I5F B;  2L5X B;  1UHK A;  1W7J B;  2ZKM X;  2RGI A;  3A8R A;  2LVI A;  2E30 A;  1Y0V H;  2Y5I A;  1TCO B;  2F2O A;  1MXE A;  4CFR A;  3DVE A;  4YGD B;  4PDZ A;  1CM1 A;  4XYN A;  1CTR A;  1C07 A;  1CDL A;  1BLQ A;  1A75 A;  4OKH A;  1SY9 A;  1ZMZ A;  2BKI B;  5I2O A;  4USL A;  4DCK A;  1QX7 A;  5TNC A;  1IH0 A;  4MEW A;  2LLS A;  2LCP A;  5AFP A;  1B7T Y;  2PAL A;  1N65 A;  2M1K B;  1CFF A;  1PAL A;  1SPY A;  1OMR A;  2NLN A;  3I5F C;  4FTG A;  1QJT A;  1A03 A;  4YBH B;  4CFQ A;  1YTZ C;  3TDU A;  2M7N A;  4WQ3 A;  4PHJ A;  1SCM C;  2ZRT A;  2LMU A;  3QRX A;  4QJ3 B;  5G08 A;  4A4C A;  4CLN A;  5I8N A;  1K9P A;  1QIW A;  1YRT B;  1J7P A;  3EVR A;  2JT0 A;  1BT6 A;  2BE6 A;  1J7Q A;  2JXC A;  2CT9 A; 
#chains in the Genus database with same CATH topology
 1CLM A;  4PE1 A;  4INW A;  1OOG A;  1X02 A;  1GM0 A;  4I5N B;  4YRU A;  1B9A A;  2LM5 A;  3SIA A;  2I7A A;  2MBX A;  5BPJ A;  2GGZ A;  1KCY A;  3BUM B;  1K96 A;  2LAN A;  2LVK A;  3L47 A;  1RFJ A;  2CXJ A;  1C3Y A;  5I2Q A;  2JZI A;  4F7F A;  1SSE B;  2HQW A;  1DC1 A;  1SRA A;  3EVU A;  3FE9 A;  3L4L A;  2KOT A;  1QLK A;  2KFF A;  2MHH A;  4OR9 B;  1IRJ A;  1CDN A;  3DXL A;  1UUR A;  1RWY A;  3LL8 B;  1F71 A;  2PMY A;  2BBM A;  1KQV A;  1FI5 A;  2JOJ A;  1K9K A;  3HCM A;  1UHI A;  3BJH A;  3B88 A;  2AUC A;  3JVT B;  2A4J A;  3K21 A;  4GNK B;  3AKB A;  4MVF A;  1OMD A;  1LKJ A;  2LP2 A;  3PAT A;  4P5O E;  1NCX A;  4BY4 A;  1QAS A;  3Q8I A;  2JRF A;  2KBM A;  2MJW B;  3DF0 A;  2KQY A;  3ICB A;  1IIO A;  1GGZ A;  2KGB C;  4KYN A;  3V2L A;  1SNL A;  1FI6 A;  1OE9 B;  2LUX A;  2QAC A;  3CGA A;  1K90 D;  5AXI A;  1G33 A;  3TDI A;  1C7W A;  3CYZ A;  1TTX A;  1DJY A;  3DD4 A;  1S6I A;  3CAB A;  1FW4 A;  1XFU O;  1UUS A;  4DIR A;  2EHB A;  4ICB A;  1IJ5 A;  5CSF A;  3SIB A;  2MA2 A;  5AAN A;  4CPV A;  3ZWH A;  2BNX A;  1DJW A;  1XYD A;  3D75 A;  1F8H A;  1DJX A;  1PUL A;  1CDP A;  3JVT C;  4ORB B;  3SG4 A;  1J7R A;  1IGV A;  2BBN A;  1NUB A;  1SW8 A;  3PJI A;  2WCF A;  2LNK A;  4DUQ A;  1DMO A;  2LMV A;  1DJG A;  1PVB A;  1W7I B;  2QEO A;  1K95 A;  2IS9 A;  3K1E A;  3DVJ A;  2NCO A;  4ZCV A;  1WRL A;  3EK4 A;  1JC2 A;  1NCY A;  2KDH A;  2VRG A;  1JWD A;  3MSE B;  4DS7 A;  3D74 A;  2LC5 A;  1XFZ O;  1NIW A;  3E3R A;  3OX5 A;  2PVB A;  1F54 A;  4WQ2 A;  3O78 A;  1OZS A;  2WND A;  4M2Q A;  1TUZ A;  1SL8 A;  2CNP A;  5I94 A;  1NX2 A;  5I2L A;  3BOW A;  1B8R A;  1QTX A;  2B1U A;  3GK4 X;  5FYX A;  3DY9 A;  2PRU A;  2M7L A;  1J1E A;  4A4B A;  1XO5 A;  2ZRS A;  1OQP A;  3BXK A;  3UO9 A;  4DRW A;  1EH2 A;  5K89 A;  3PSR A;  4UPG A;  3DF0 B;  1XA5 A;  5CSI A;  3OB2 B;  1EL4 A;  1NWD A;  1MR8 A;  3DVK A;  1DJZ A;  4ZCU A;  4C0L A;  3S0G A;  2HET A;  2LHL A;  2ERB A;  2JTT A;  3SG6 A;  4D1E A;  3GOF A;  1VRK A;  1YUS A;  1TCF A;  3BUO B;  1ZUZ A;  5GQQ C;  5JOL A;  4PE0 A;  2I94 A;  3CZ1 A;  1RTP 1;  3SS3 A;  2QEB A;  1SCM B;  2K7D A;  1LA0 A;  1ZAC A;  3R1P A;  5PAL A;  1OOJ A;  1PSR A;  2BCA A;  2NZ0 A;  2R2I A;  3DVM A;  3CZ0 A;  3IQO A;  2HQ8 A;  3WXA A;  1KSM A;  1YX7 A;  4GUK A;  1G8I A;  2L5Y A;  1YUR A;  4IL1 A;  3I5G B;  1Z2C B;  1RRO A;  3I5H C;  4PE7 A;  3RLZ A;  4QJ5 B;  4M2O A;  4TNC A;  3VB1 A;  4GPL B;  3NSK A;  1DQE A;  5CSJ A;  5B8I B;  3S0D A;  4YGA A;  5HLO A;  3UNW A;  3WHU B;  4OZD A;  2QDI A;  3JTD B;  2L2C A;  1OOF A;  5D69 A;  1BG1 A;  5HKZ A;  1C7V A;  5EL2 A;  2ZN8 A;  3EKH A;  1KSO A;  5F6T A;  1MHO A;  3AAJ A;  2CBL A;  1OMV A;  3BOW B;  2K7O A;  1SMG A;  5HKY A;  3SJS A;  4ORC B;  1F70 A;  2EGD A;  3CDN A;  1WDC B;  1B8C A;  1V1G A;  4NDC A;  4HRE E;  2O60 A;  1B1G A;  1ZOT B;  2M8U A;  1JF0 A;  3IVT A;  3PLF B;  4NQG A;  2K2A A;  3R1O A;  1EG4 A;  1SK6 D;  3TDZ A;  2WCE A;  1C3Z A;  3I5G C;  5KSZ A;  1ORG A;  3SG5 A;  1QV0 A;  1TWO A;  2WCL A;  3KHE A;  2Q91 A;  4GAO A;  3S0B A;  4I5L B;  3BUW B;  2HF5 A;  1S5G Y;  1CDM A;  1OSA A;  1QAT A;  1CM4 A;  3H4S E;  3JTD C;  1JF2 A;  5HL1 A;  2JNF A;  2M49 B;  1OZO A;  2JT3 A;  2KBI A;  1XK4 C;  3NXA A;  4MLW A;  4P2Y B;  1KFU S;  1K2H A;  1KFX S;  1TNP A;  1S1E A;  3I5I B;  4OVN F;  1QV1 A;  2V53 A;  2I18 A;  2G2B A;  4I5J A;  4R1E A;  3PAL A;  1DVI A;  1WDC C;  3LLE A;  2LHI A;  1A29 A;  1AJ4 A;  1UHN A;  2BCX A;  1J1D A;  2QEV A;  1W9Z A;  2HPS A;  5HKW A;  1A2X A;  4MZL A;  1QIV A;  2K2F A;  1R2U A;  4PCW A;  4HRH A;  2GV5 A;  1OOI X;  1NP8 A;  3CWG A;  3PN7 B;  3FS7 A;  2WC5 A;  3R1V A;  1FBV A;  1K8U A;  1BOC A;  2JUL A;  1DTL A;  1CLL A;  2JU0 A;  1BJF A;  2WCB A;  3GK1 A;  3C1V A;  1YUT A;  1JFK A;  1AVS A;  3VRP A;  3I5I C;  2NCP A;  2LUC A;  2JWW A;  2P6B B;  3CZ2 A;  3GK2 A;  3KO0 A;  2M9G A;  4MRY A;  5KTY A;  2LVV A;  2FCD A;  1B7T Z;  4GGN A;  1DEK A;  2L51 A;  2KFH A;  4HSZ A;  2WOS A;  3TUY B;  4XJK A;  3RZS A;  1DGU A;  1LVC D;  2OS8 B;  1SL9 A;  2JC2 A;  4YI8 A;  2H61 C;  1WRZ A;  1SKT A;  3OHM B;  2K7C A;  3PM2 A;  3BYA A;  4FQT A;  3S0A A;  2Q4U A;  3VRN A;  1KK7 Z;  1DEL A;  2K60 A;  4Q04 A;  3VGO A;  1CKK A;  3PN7 C;  1K94 A;  1NSH A;  1TN4 A;  1Y1U A;  1BR1 B;  1M31 A;  1M45 A;  4MZJ A;  1S3P A;  2Y1M A;  1KFX L;  5D7F A;  1V1F A;  3RM1 A;  2L4H A;  1XK4 A;  2OPO A;  1YX8 A;  2M0R A;  3B87 A;  1XFX O;  1IQ5 A;  2KFG A;  1SCV A;  1T14 A;  4JKT A;  2JPO A;  3OGN A;  3TUY C;  5J3X A;  1QXP A;  1JBA A;  2LP3 A;  2OS8 C;  5HLV A;  2AAO A;  2BKH B;  3IF7 A;  1P28 A;  1N0Y A;  1OOH A;  2KLE A;  1XFR A;  4MSP A;  4MRX A;  3EK7 A;  4M2P A;  3S0E A;  1WLZ A;  3BQ3 A;  3N7H A;  3WNX B;  1UP5 A;  2FJY A;  2Y1N A;  4OCI A;  3I5H B;  2LMT A;  3B7A A;  5JJG A;  1ALV A;  3EG5 B;  3NHT A;  2K8M B;  1A4P A;  3IQQ A;  4PAL A;  1K93 D;  2WC6 A;  4JQ0 D;  1WRK A;  1AK8 A;  4MBE A;  3DZT A;  1D1O A;  1RK9 A;  4OV2 A;  1AHR A;  1BU3 A;  1N2D A;  1G4Y R;  3O4Y A;  3D10 A;  1S6J A;  2CTN A;  1NCZ A;  2LLU A;  2PAS A;  2KI6 D;  2ZN9 A;  4GBA A;  4YGE B;  5DKR A;  2F2P A;  2K7B A;  1Z4H A;  3TS5 B;  1CNP A;  3EKJ A;  1EJ3 A;  1NYA A;  4XJK B;  4JD9 A;  1M63 B;  1YVL A;  3PFV A;  2EC6 B;  3LK0 A;  2COL B;  4JWQ A;  3L4A A;  1YUU A;  3EVV A;  1L7Z A;  2H61 A;  2KAX A;  1TRF A;  3D78 A;  3B6X A;  3VRQ A;  2NXQ A;  1SYM A;  2KYC A;  5FI6 A;  2ZFD A;  1H4B A;  1BF5 A;  1M46 A;  2O5G A;  4QJ4 B;  5D3O A;  2K61 A;  1F4O A;  3OBV A;  1S6C A;  2WCJ A;  1PRW A;  1QX5 B;  1UWO A;  2KAV A;  2P71 A;  2P70 A;  2QEH A;  2GTE A;  1M39 A;  5IBW A;  1Q80 A;  1QWV A;  1GGW A;  3VRR A;  4AQI A;  2KI4 B;  3OX6 A;  5KU1 A;  3FIA A;  4PE4 A;  2DOQ A;  2SCP A;  1UHH A;  3CZT X;  3PM8 A;  3TS5 C;  4N5X A;  3FWC A;  3M0W A;  2L2E A;  2KQ6 A;  3D73 A;  1IKU A;  1LS8 A;  4CID A;  1XVJ A;  1IJ6 A;  2TN4 A;  2WCH A;  2EC6 C;  1JSA A;  1DF0 B;  1NX3 A;  2LVJ A;  4GGF C;  3A4U B;  1NX0 A;  3NHI A;  1Y6W A;  1MWN A;  3D0Y B;  5ER4 X;  3SG7 A;  3BFA A;  1QS7 A;  4N1F A;  1EXR A;  1UHJ A;  2OTG B;  3FWB A;  3KEV A;  2BCB A;  2JTZ A;  2JPT A;  2ISD A;  1GQM A;  4C0K A;  1SR6 B;  1Y1A A;  4YGC B;  1BOD A;  2FJU B;  3SG2 A;  3DYE A;  3FE6 A;  4AOM A;  2KNE A;  1QVI Z;  1F4Q A;  1KK7 Y;  2KPH A;  2M3W A;  2KI4 C;  2LLT A;  1MQ1 A;  1BMO A;  3SS4 A;  4MZK A;  1IG5 A;  1DT7 B;  3OP0 A;  1XFY O;  4GFT A;  1CFD A;  4BY5 A;  2WC8 A;  2KHN A;  3NSO A;  2PSR A;  3B86 A;  1QLS A;  1YRU B;  2GGM A;  1GJY A;  1PVA A;  1OW4 A;  1TOP A;  3CR4 X;  2KSP A;  3EK8 A;  4MN0 A;  1JUO A;  1DJH A;  2KYF A;  4L9M A;  4PHM A;  3OB1 B;  2K0J A;  2LE9 B;  2CCM A;  1XFW O;  3CLN A;  2OTG C;  1TUJ A;  3TZ1 A;  1MXL C;  2QPT A;  1TNX A;  2JNX A;  3CR2 A;  4JPZ B;  4AQJ A;  1DGV A;  1KK8 B;  4I5K A;  4C0J A;  1NX1 A;  1SR6 C;  1U5I A;  2FOT A;  5DKN A;  2Y4Q A;  1H8B A;  1LXF C;  3F45 A;  1KWO B;  1MUX A;  1IQ3 A;  1S26 D;  1NPQ A;  2KI6 C;  1A75 B;  2G9B A;  4NDD A;  2L50 A;  1K9U A;  1J55 A;  1DJI A;  1SL7 A;  4E68 A;  2MLF C;  3AAK A;  2BE4 A;  1IWQ A;  1TNW A;  3HX4 A;  4WRI A;  2KLD A;  2YGU A;  5FI7 A;  2ZNE A;  1JFJ A;  2FCE A;  1TIZ A;  2KAY A;  2WOR A;  4GGF A;  1FPW A;  1LIN A;  2JXL A;  1Y1X A;  4HRG A;  2ZND A;  3VRO A;  2MRD A;  3CTN A;  1CMF A;  1KK8 C;  5DKQ A;  3S0F A;  2PYQ A;  2M29 A;  4NDB A;  1L2O B;  5CSN A;  3BFB A;  3SG3 A;  1PK0 D;  1KFU L;  1LA3 A;  1KWO C;  2L4I A;  1B4C A;  2F33 A;  1F55 A;  1KQM B;  1PSB A;  1CFC A;  4F0Z B;  3D76 A;  1TNQ A;  1RJV A;  3NSL A;  2LAP A;  1CMG A;  4YI9 A;  1S5G Z;  2BAP A;  2WCM A;  2L98 A;  3O4X A;  1REC A;  1HQV A;  1AJ5 A;  2KGR A;  2MLE C;  1DF0 A;  1WLM A;  4N1G A;  4PHK A;  3CR5 X;  1AUI B;  1S36 A;  1MF8 B;  2F3Y A;  2H2K A;  4YGB B;  1CB1 A;  2BL0 B;  1YVH A;  2LV7 A;  5AER A;  1EG3 A;  2JT8 A;  2WCK A;  3BUX B;  3D0Y A;  3LK1 A;  1BR4 B;  3BFH A;  1HT9 A;  1YR5 A;  3AKA A;  3KPX A;  1XFV O;  1QX2 A;  1CLB A;  1U5I B;  2L0P A;  2D8N A;  1B47 A;  1L2O C;  3CS1 A;  3BUN B;  3NGV A;  4INX A;  3WHT B;  4ETO A;  1CFP A;  1J7O A;  4FQO A;  3NSI A;  3O6B A;  1R6P A;  2MAZ A;  1KQM C;  3O2P A;  4ORA B;  3KF9 A;  1ALW A;  2BEC A;  2M97 A;  5ER5 A;  2AMI A;  5HYD A;  2F8P A;  4U8D A;  5AEQ A;  2F3Z A;  1QVI Y;  1AP4 A;  1B8L A;  1SBJ A;  1WY9 A;  3ZNI A;  2PQL A;  1ZFS A;  2JQ6 A;  2BL0 C;  1ODB A;  3LCP C;  5FI2 A;  2SAS A;  4IJ7 A;  2E6W A;  4PHN A;  5CPV A;  2I2R E;  1FF1 A;  1E8A A;  2M1U A;  3FE8 A;  3I5F B;  2L5X B;  1UHK A;  1W7J B;  2ZKM X;  2RGI A;  3A8R A;  2LVI A;  2E30 A;  1Y0V H;  2Y5I A;  1TCO B;  2F2O A;  1MXE A;  4CFR A;  3DVE A;  4YGD B;  4PDZ A;  1CM1 A;  4XYN A;  1CTR A;  1C07 A;  1CDL A;  1BLQ A;  1A75 A;  4OKH A;  5DIC A;  1SY9 A;  1ZMZ A;  2BKI B;  5I2O A;  4USL A;  4DCK A;  1QX7 A;  5TNC A;  1IH0 A;  4MEW A;  2LLS A;  3D77 A;  2LCP A;  5AFP A;  1B7T Y;  2PAL A;  1N65 A;  2M1K B;  1CFF A;  1PAL A;  3R72 A;  1SPY A;  1OMR A;  2NLN A;  3I5F C;  4FTG A;  1QJT A;  3SS5 A;  1A03 A;  4YBH B;  4CFQ A;  1YTZ C;  3TDU A;  2M7N A;  4WQ3 A;  4PHJ A;  4PT1 A;  1SCM C;  2ZRT A;  2LMU A;  3QRX A;  4QJ3 B;  5G08 A;  4A4C A;  4CLN A;  5I8N A;  1K9P A;  1QIW A;  2H8V A;  1YRT B;  1J7P A;  3EVR A;  2JT0 A;  1BT6 A;  2BE6 A;  3QME A;  2JXC A;  1J7Q A;  2CT9 A; 
#chains in the Genus database with same CATH homology
 1CLM A;  4PE1 A;  1X02 A;  4I5N B;  4YRU A;  1B9A A;  2LM5 A;  3SIA A;  2I7A A;  2MBX A;  5BPJ A;  2GGZ A;  1KCY A;  3BUM B;  1K96 A;  2LAN A;  2LVK A;  1RFJ A;  2CXJ A;  5I2Q A;  2JZI A;  2HQW A;  1SRA A;  3EVU A;  2KOT A;  1QLK A;  2KFF A;  2MHH A;  4OR9 B;  1IRJ A;  1CDN A;  1UUR A;  1RWY A;  3LL8 B;  1F71 A;  2PMY A;  2BBM A;  1KQV A;  1FI5 A;  2JOJ A;  1K9K A;  3HCM A;  1UHI A;  4GNK B;  4MVF A;  2AUC A;  3JVT B;  2A4J A;  3K21 A;  3AKB A;  1OMD A;  1LKJ A;  2LP2 A;  3PAT A;  4P5O E;  1NCX A;  4BY4 A;  1QAS A;  2JRF A;  2KBM A;  2MJW B;  3DF0 A;  2KQY A;  3ICB A;  1GGZ A;  2KGB C;  1SNL A;  1FI6 A;  1OE9 B;  2LUX A;  2QAC A;  3CGA A;  1K90 D;  5AXI A;  1G33 A;  3TDI A;  1C7W A;  3DD4 A;  1TTX A;  1DJY A;  1S6I A;  1FW4 A;  1XFU O;  1UUS A;  4DIR A;  2EHB A;  4ICB A;  1IJ5 A;  5CSF A;  3SIB A;  2MA2 A;  5AAN A;  4CPV A;  3ZWH A;  1DJW A;  1XYD A;  1F8H A;  1DJX A;  1PUL A;  1CDP A;  3JVT C;  4ORB B;  3SG4 A;  1J7R A;  1IGV A;  2BBN A;  1NUB A;  1SW8 A;  2WCF A;  2LNK A;  4DUQ A;  1DMO A;  2LMV A;  1DJG A;  1PVB A;  1W7I B;  1K95 A;  2IS9 A;  3DVJ A;  2NCO A;  4ZCV A;  1WRL A;  3EK4 A;  1JC2 A;  1NCY A;  2KDH A;  2VRG A;  1JWD A;  3MSE B;  4DS7 A;  2LC5 A;  1XFZ O;  1NIW A;  3E3R A;  3OX5 A;  2PVB A;  1F54 A;  4WQ2 A;  3O78 A;  1OZS A;  2WND A;  4M2Q A;  2CNP A;  1SL8 A;  1NX2 A;  5I2L A;  3BOW A;  1B8R A;  1QTX A;  2B1U A;  3GK4 X;  5FYX A;  2M7L A;  2PRU A;  1J1E A;  4A4B A;  1XO5 A;  2ZRS A;  1OQP A;  3BXK A;  4DRW A;  1EH2 A;  5K89 A;  3PSR A;  4UPG A;  3DF0 B;  1XA5 A;  5CSI A;  3OB2 B;  1EL4 A;  1NWD A;  1MR8 A;  3DVK A;  1DJZ A;  4ZCU A;  4C0L A;  2HET A;  2LHL A;  2JTT A;  3SG6 A;  4D1E A;  3GOF A;  1VRK A;  1YUS A;  1TCF A;  3BUO B;  1ZUZ A;  5GQQ C;  5JOL A;  4PE0 A;  2I94 A;  1RTP 1;  1SCM B;  2K7D A;  1LA0 A;  1ZAC A;  5PAL A;  1OOJ A;  1PSR A;  2BCA A;  2NZ0 A;  2R2I A;  3DVM A;  3IQO A;  2HQ8 A;  3WXA A;  1KSM A;  1YX7 A;  4GUK A;  1G8I A;  1YUR A;  4IL1 A;  3I5G B;  4PE7 A;  1RRO A;  3I5H C;  3RLZ A;  4QJ5 B;  4M2O A;  4TNC A;  5B8I B;  4GPL B;  3NSK A;  5CSJ A;  4YGA A;  5HLO A;  3WHU B;  3JTD B;  5D69 A;  1C7V A;  1BG1 A;  5HKZ A;  2ZN8 A;  3EKH A;  1KSO A;  5F6T A;  1MHO A;  3AAJ A;  2CBL A;  1OMV A;  3BOW B;  2K7O A;  1SMG A;  5HKY A;  3SJS A;  4ORC B;  1F70 A;  2EGD A;  1WDC B;  1B8C A;  1V1G A;  4NDC A;  4HRE E;  2O60 A;  1B1G A;  1ZOT B;  2M8U A;  1JF0 A;  3PLF B;  4NQG A;  2K2A A;  3TDZ A;  1EG4 A;  1SK6 D;  2WCE A;  3I5G C;  5KSZ A;  3SG5 A;  1QV0 A;  3KHE A;  2Q91 A;  4GAO A;  4I5L B;  3BUW B;  2HF5 A;  1S5G Y;  1CDM A;  1OSA A;  1QAT A;  1CM4 A;  3H4S E;  3JTD C;  1JF2 A;  2JNF A;  2M49 B;  1OZO A;  2JT3 A;  2KBI A;  1XK4 C;  3NXA A;  4MLW A;  4P2Y B;  1KFU S;  1K2H A;  1KFX S;  1TNP A;  1S1E A;  3I5I B;  4OVN F;  1QV1 A;  2V53 A;  2I18 A;  2G2B A;  4I5J A;  4R1E A;  3PAL A;  1DVI A;  1WDC C;  3LLE A;  2LHI A;  1A29 A;  1AJ4 A;  1UHN A;  2BCX A;  1J1D A;  2HPS A;  5HKW A;  1A2X A;  4MZL A;  1QIV A;  2K2F A;  1R2U A;  4PCW A;  4HRH A;  2GV5 A;  1NP8 A;  3CWG A;  3PN7 B;  3FS7 A;  1FBV A;  1K8U A;  1BOC A;  2JUL A;  1DTL A;  1CLL A;  2JU0 A;  1BJF A;  2WCB A;  3GK1 A;  3C1V A;  1YUT A;  1JFK A;  1AVS A;  3VRP A;  3I5I C;  2NCP A;  2LUC A;  2JWW A;  2P6B B;  3GK2 A;  3KO0 A;  2M9G A;  4MRY A;  5KTY A;  2LVV A;  2FCD A;  1B7T Z;  4GGN A;  2L51 A;  2KFH A;  4HSZ A;  2WOS A;  3TUY B;  4XJK A;  1DGU A;  1LVC D;  2OS8 B;  1SL9 A;  2JC2 A;  4YI8 A;  2H61 C;  1WRZ A;  1SKT A;  3OHM B;  2K7C A;  3BYA A;  2Q4U A;  3VRN A;  1KK7 Z;  4Q04 A;  3VGO A;  1CKK A;  3PN7 C;  1K94 A;  1NSH A;  1TN4 A;  1Y1U A;  1BR1 B;  1M31 A;  1M45 A;  4MZJ A;  1S3P A;  2Y1M A;  1KFX L;  5D7F A;  1V1F A;  3RM1 A;  2L4H A;  1XK4 A;  2OPO A;  1YX8 A;  2M0R A;  1XFX O;  1IQ5 A;  2KFG A;  1SCV A;  3TUY C;  5J3X A;  1QXP A;  1JBA A;  2LP3 A;  2OS8 C;  5HLV A;  2AAO A;  2BKH B;  3IF7 A;  1N0Y A;  4MSP A;  4MRX A;  3EK7 A;  4M2P A;  1WLZ A;  3BQ3 A;  3WNX B;  1UP5 A;  2Y1N A;  4OCI A;  3I5H B;  2LMT A;  5JJG A;  1ALV A;  2K8M B;  1A4P A;  3IQQ A;  4PAL A;  1K93 D;  4JQ0 D;  1WRK A;  1AK8 A;  4MBE A;  1D1O A;  1RK9 A;  4OV2 A;  1AHR A;  1BU3 A;  1N2D A;  1G4Y R;  3O4Y A;  3D10 A;  1S6J A;  2CTN A;  1NCZ A;  2LLU A;  2PAS A;  2KI6 D;  2ZN9 A;  4GBA A;  4YGE B;  5DKR A;  2F2P A;  2K7B A;  3TS5 B;  1CNP A;  3EKJ A;  1EJ3 A;  1NYA A;  4XJK B;  1M63 B;  1YVL A;  3PFV A;  2EC6 B;  3LK0 A;  2COL B;  4JWQ A;  1YUU A;  3EVV A;  1L7Z A;  2H61 A;  2KAX A;  1TRF A;  3VRQ A;  2NXQ A;  1SYM A;  2KYC A;  2ZFD A;  1H4B A;  1BF5 A;  1M46 A;  2O5G A;  4QJ4 B;  2K61 A;  1F4O A;  1S6C A;  1PRW A;  1QX5 B;  1UWO A;  2KAV A;  1M39 A;  5IBW A;  1Q80 A;  1GGW A;  3VRR A;  4AQI A;  2KI4 B;  3OX6 A;  5KU1 A;  3FIA A;  4PE4 A;  2DOQ A;  2SCP A;  1UHH A;  3CZT X;  3PM8 A;  3TS5 C;  4N5X A;  3FWC A;  3M0W A;  2L2E A;  2KQ6 A;  1IKU A;  4CID A;  1XVJ A;  1IJ6 A;  2TN4 A;  2EC6 C;  1JSA A;  1DF0 B;  1NX3 A;  2LVJ A;  4GGF C;  3A4U B;  1NX0 A;  1Y6W A;  1MWN A;  3D0Y B;  5ER4 X;  3SG7 A;  1QS7 A;  4N1F A;  1EXR A;  1UHJ A;  2OTG B;  3FWB A;  3KEV A;  2BCB A;  2JTZ A;  2JPT A;  2ISD A;  1GQM A;  4C0K A;  1SR6 B;  1Y1A A;  4YGC B;  1BOD A;  2FJU B;  3SG2 A;  4AOM A;  2KNE A;  1QVI Z;  1F4Q A;  1KK7 Y;  2M3W A;  2KI4 C;  2LLT A;  1MQ1 A;  1BMO A;  4MZK A;  1IG5 A;  1DT7 B;  3OP0 A;  1XFY O;  4GFT A;  1CFD A;  4BY5 A;  2WC8 A;  2KHN A;  3NSO A;  2PSR A;  1QLS A;  1YRU B;  2GGM A;  1GJY A;  1PVA A;  1TOP A;  3CR4 X;  2KSP A;  3EK8 A;  4MN0 A;  1JUO A;  1DJH A;  2KYF A;  4L9M A;  4PHM A;  3OB1 B;  2K0J A;  2LE9 B;  2CCM A;  1XFW O;  3CLN A;  2OTG C;  3TZ1 A;  1MXL C;  2QPT A;  1TNX A;  2JNX A;  3CR2 A;  4JPZ B;  4AQJ A;  1DGV A;  1KK8 B;  4I5K A;  4C0J A;  1NX1 A;  1SR6 C;  1U5I A;  2FOT A;  5DKN A;  2Y4Q A;  1H8B A;  1LXF C;  3F45 A;  1KWO B;  1MUX A;  1IQ3 A;  1S26 D;  1NPQ A;  2KI6 C;  1A75 B;  2G9B A;  4NDD A;  2L50 A;  1K9U A;  1J55 A;  1DJI A;  1SL7 A;  4E68 A;  2MLF C;  3AAK A;  2BE4 A;  1IWQ A;  1TNW A;  3HX4 A;  4WRI A;  1JFJ A;  2ZNE A;  2FCE A;  1TIZ A;  2KAY A;  2WOR A;  4GGF A;  1FPW A;  1LIN A;  2JXL A;  1Y1X A;  4HRG A;  2ZND A;  3VRO A;  2MRD A;  3CTN A;  1CMF A;  1KK8 C;  5DKQ A;  2M29 A;  4NDB A;  1L2O B;  5CSN A;  3SG3 A;  1PK0 D;  1KFU L;  1LA3 A;  1KWO C;  2L4I A;  1B4C A;  2F33 A;  1F55 A;  1KQM B;  1PSB A;  1CFC A;  4F0Z B;  1TNQ A;  1RJV A;  3NSL A;  2LAP A;  1CMG A;  4YI9 A;  1S5G Z;  2L98 A;  1REC A;  1HQV A;  1AJ5 A;  2KGR A;  2MLE C;  1DF0 A;  1WLM A;  4N1G A;  4PHK A;  3CR5 X;  1AUI B;  1S36 A;  1MF8 B;  2F3Y A;  2H2K A;  4YGB B;  1CB1 A;  2BL0 B;  1YVH A;  2LV7 A;  5AER A;  1EG3 A;  2JT8 A;  3BUX B;  3D0Y A;  3LK1 A;  1BR4 B;  1HT9 A;  1YR5 A;  3AKA A;  3KPX A;  1XFV O;  1QX2 A;  1CLB A;  1U5I B;  2L0P A;  2D8N A;  1B47 A;  1L2O C;  3CS1 A;  3BUN B;  3WHT B;  4ETO A;  1CFP A;  1J7O A;  4FQO A;  3NSI A;  3O6B A;  1R6P A;  2MAZ A;  1KQM C;  3O2P A;  4ORA B;  3KF9 A;  1ALW A;  2BEC A;  2M97 A;  5ER5 A;  2AMI A;  5HYD A;  2F8P A;  4U8D A;  5AEQ A;  2F3Z A;  1QVI Y;  1AP4 A;  1B8L A;  1SBJ A;  1WY9 A;  3ZNI A;  1ZFS A;  2JQ6 A;  2BL0 C;  1ODB A;  3LCP C;  2SAS A;  2E6W A;  4PHN A;  5CPV A;  2I2R E;  1FF1 A;  1E8A A;  2M1U A;  3I5F B;  2L5X B;  1UHK A;  1W7J B;  2ZKM X;  2RGI A;  3A8R A;  2LVI A;  2E30 A;  1Y0V H;  2Y5I A;  1TCO B;  2F2O A;  1MXE A;  4CFR A;  3DVE A;  4YGD B;  4PDZ A;  1CM1 A;  4XYN A;  1CTR A;  1C07 A;  1CDL A;  1BLQ A;  1A75 A;  4OKH A;  1SY9 A;  1ZMZ A;  2BKI B;  5I2O A;  4USL A;  4DCK A;  1QX7 A;  5TNC A;  1IH0 A;  4MEW A;  2LLS A;  2LCP A;  5AFP A;  1B7T Y;  2PAL A;  1N65 A;  2M1K B;  1CFF A;  1PAL A;  1SPY A;  1OMR A;  2NLN A;  3I5F C;  4FTG A;  1QJT A;  1A03 A;  4YBH B;  4CFQ A;  1YTZ C;  3TDU A;  2M7N A;  4WQ3 A;  4PHJ A;  1SCM C;  2ZRT A;  2LMU A;  3QRX A;  4QJ3 B;  5G08 A;  4A4C A;  4CLN A;  5I8N A;  1K9P A;  1QIW A;  1YRT B;  1J7P A;  3EVR A;  2JT0 A;  1BT6 A;  2BE6 A;  1J7Q A;  2JXC A;  2CT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...