2H61C

X-ray structure of human ca2+-loaded s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 34
structure length 90
sequence length 90
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61C00
3FS7A 1UHIA 4I5NB 4WRIA 1BF5A 1M39A 2JTZA 4YI9A 1CFFA 4ZCVA 1K9UA 1ZACA 2K61A 2F8PA 3H4SE 2ZRSA 1MHOA 2JZIA 4GGNA 2WCBA 1TNQA 1NCYA 5JOLA 2CTNA 2JU0A 4AQIA 2KGRA 2LUCA 3CZTX 4ORBB 1XFWO 1OOJA 3C1VA 1Y1AA 1SNLA 3AKBA 4YRUA 1JFKA 2O5GA 1YTZC 3NSLA 4GNKB 2EC6B 3A4UB 4PE7A 2LCPA 1DF0A 1ALVA 4ORAB 1IJ5A 2PVBA 2LVKA 3DVEA 3GOFA 1TNPA 1UUSA 2H61A 4ICBA 1QASA 5B8IB 2CNPA 1XO5A 1JBAA 1NUBA 3CLNA 3TDUA 2EHBA 1BLQA 3VROA 3WHUB 1YR5A 1UHNA 1ZOTB 3CWGA 4MRXA 4CFRA 2OS8C 2VRGA 2H61C 4U8DA 4GUKA 4ORCB 1QV1A 2IS9A 1TNWA 4HRGA 3AKAA 1CLBA 1F54A 2BL0B 3DVMA 2K7BA 2KSPA 1B47A 1TCFA 1DGVA 5PALA 5HKYA 1CKKA 5ER5A 1JUOA 1SR6C 3F45A 2E6WA 1PVAA 2KI6C 1WDCC 2KBIA 3EVVA 1VRKA 1V1FA 1NX2A 5HYDA 2MRDA 4PHNA 2H2KA 2I7AA 2WOSA 2BBNA 1DJHA 1LVCD 1JF0A 1GQMA 3KPXA 1OMRA 1UWOA 2CT9A 1DGUA 1D1OA 3VRPA 2JRFA 5CSJA 1XVJA 1C07A 3I5IC 1OMVA 1BG1A 1CDLA 1EG4A 1K94A 1IG5A 4D1EA 1S6IA 1Y0VH 4MZLA 1FW4A 1WY9A 2BE6A 4I5KA 1KK8C 2EGDA 2LLUA 1EH2A 1B9AA 1QLSA 1FF1A 2KFHA 2V53A 2BCAA 2LMVA 1NPQA 3D0YA 1N2DA 1Q80A 2HQWA 1F55A 4CPVA 3OP0A 3SG6A 1HQVA 3CR2A 3JVTB 1SBJA 2Q4UA 4BY4A 1F71A 2RGIA 3AAJA 2M1UA 2LAPA 4GAOA 1GJYA 2MBXA 4I5JA 1FBVA 1S1EA 4OKHA 1A03A 4PE0A 1Y1XA 1K95A 1EL4A 4MN0A 3SG3A 5TNCA 1CDNA 4GBAA 2BKHB 1RECA 4M2QA 3ZWHA 1YURA 3IQQA 3OHMB 1G33A 3PN7C 1BU3A 1MXLC 2SCPA 2LLTA 1CFDA 1PVBA 1YX7A 5BPJA 3DVJA 1SW8A 2NCPA 2BE4A 1UHKA 1BMOA 2KQ6A 1YX8A 2QPTA 1L7ZA 2JT0A 3PSRA 4PHKA 3CR4X 4OCIA 5CSFA 1DTLA 1C7WA 1QX2A 4HREE 4YGCB 3QRXA 3WXAA 2COLB 3TS5C 2K2AA 2M29A 4MEWA 1RTP1 4CLNA 1OZOA 4A4BA 1CDMA 3I5HC 2WC8A 3BQ3A 2LP3A 2HQ8A 1UHJA 3M0WA 1FI5A 3SIAA 5K89A 4PDZA 3NSOA 5JJGA 1WLZA 1Y6WA 1YRTB 1YUUA 1DF0B 1B8RA 2BCXA 3EK4A 2KBMA 2OS8B 5D7FA 1FI6A 2JNXA 2L50A 2LVIA 1CB1A 1PSBA 1XFZO 2LUXA 5HLOA 5KTYA 1YUSA 5AERA 4YGAA 1SCMC 2G2BA 3BOWA 1SL8A 2OPOA 1SL7A 5DKRA 2P6BB 1S6CA 5AFPA 2HETA 1WRKA 2JC2A 2B1UA 1SR6B 3O2PA 2JT8A 3DF0A 1J55A 2LVJA 2KAXA 3VRNA 1WDCB 1NSHA 5AANA 3EK8A 1QTXA 1CLLA 1UP5A 2M0RA 1QXPA 4AQJA 1S5GY 1DT7B 2KYCA 1MUXA 1EG3A 1QX5B 2JT3A 1EJ3A 1SYMA 1IQ5A 3NSIA 1TN4A 3I5IB 2PASA 1KQVA 4QJ4B 2KYFA 4C0LA 1CTRA 1KFUS 2L5XB 2LV7A 1NP8A 2MA2A 1OZSA 3PATA 4YBHB 2OTGC 1KK8B 2KOTA 3SJSA 2CXJA 2JQ6A 1A4PA 4PALA 1G4YR 2L51A 2NXQA 3HX4A 1MR8A 1MF8B 3DD4A 1CNPA 1KSOA 5FYXA 1F70A 1A2XA 3BUXB 3GK2A 2FOTA 2PRUA 3SG7A 4OVNF 4XYNA 2WORA 4R1EA 2L4IA 1IJ6A 1KCYA 2G9BA 4M2PA 2LANA 4QJ3B 4E68A 1J7PA 2KFGA 2KAVA 4L9MA 3D0YB 1YVLA 1IWQA 3TUYC 1B8CA 1MQ1A 2L98A 4HRHA 3OB1B 3WHTB 3TDIA 1SY9A 4MZKA 1G8IA 1N65A 2KI6D 2Y4QA 4C0JA 4YGBB 4PHJA 1K90D 3ICBA 3RLZA 3RM1A 3PN7B 5D69A 1NX3A 1W7JB 1FPWA 1ODBA 1N0YA 2KAYA 3EK7A 2KQYA 3KO0A 4GFTA 2F2PA 1L2OC 2GGMA 1CLMA 1A29A 2LMUA 4YGEB 2K7DA 3TS5B 1S3PA 1AVSA 2DOQA 2AUCA 1XK4A 2F33A 1TTXA 4MVFA 5F6TA 3I5HB 5IBWA 3EVRA 2K7OA 4MRYA 3SG5A 1F4QA 3LLEA 2WCEA 4OR9B 3LK1A 3BXKA 1SCVA 2BBMA 1IRJA 1XK4C 4DIRA 2LHIA 1BT6A 1OE9B 1PK0D 2LNKA 3E3RA 1TNXA 2LHLA 1LA3A 1CFPA 4Q04A 4JPZB 1DJXA 1NX0A 1CMFA 1K96A 2M3WA 2F3YA 3IQOA 1ZUZA 2M1KB 1SCMB 1IKUA 2M7NA 2M49B 4MBEA 1B8LA 2HPSA 1JF2A 1SL9A 2PSRA 1TIZA 1XA5A 2WCFA 1DJIA 3O78A 4MSPA 3EKJA 5I2LA 3JTDC 4FQOA 2JTTA 1BR4B 1DJYA 1S5GZ 3BOWB 4A4CA 5CSNA 2M8UA 4BY5A 1K2HA 2LM5A 2K8MB 2ISDA 3FWBA 1MXEA 3DF0B 3AAKA 1DJWA 3LCPC 3I5GC 4PCWA 1BR1B 3FWCA 3CTNA 1BJFA 3A8RA 3K21A 3FIAA 4MZJA 2PMYA 2LMTA 1DJZA 5ER4X 1QVIY 1QLKA 1K9PA 2CCMA 4P2YB 5KSZA 3OX6A 4XJKA 1RFJA 1GGZA 1IQ3A 1C7VA 1KK7Z 3O4YA 2OTGB 4I5LB 1R6PA 2JNFA 3CS1A 2L2EA 2L4HA 3DVKA 2L0PA 1KFXS 1U5IA 2JWWA 4DRWA 4OV2A 1Y1UA 4PE1A 1XFUO 3BUNB 4PHMA 5KU1A 1WRLA 2AAOA 1QIVA 4WQ3A 4JQ0D 1K8UA 4NQGA 2K7CA 5HKZA 4NDCA 3BUWB 3MSEB 5CSIA 1J1DA 2Q91A 1A75A 1RROA 4DUQA 1AHRA 3TUYB 4GGFA 2KHNA 1NWDA 3KF9A 1RK9A 1IGVA 1NYAA 4FTGA 3LK0A 5DKNA 1QX7A 4P5OE 2M9GA 1SPYA 2KFFA 3VRRA 1KFXL 3BUMB 4USLA 1M63B 4GGFC 4N1GA 2JXCA 4N5XA 1KWOC 4ETOA 2GV5A 2FJUB 1QATA 2F3ZA 2AMIA 1DMOA 2E30A 5G08A 1L2OB 1PSRA 1CM1A 2JULA 1KK7Y 2FCEA 1B7TZ 1WRZA 3WNXB 2ZN9A 1J7QA 4DS7A 2K0JA 2GGZA 2KI4C 3TZ1A 3I5FC 2BCBA 2NZ0A 1LXFC 1IH0A 1ALWA 2ZRTA 3KHEA 1CMGA 2R2IA 3IF7A 4UPGA 1TRFA 1LA0A 1KFUL 1KQMC 4MLWA 2I2RE 1YRUB 4CFQA 1PRWA 1JC2A 2LP2A 1XFYO 2F2OA 2Y5IA 2JXLA 4YGDB 1V1GA 2JOJA 2ZKMX 3SG2A 2SASA 1AP4A 1BOCA 1ZFSA 1ZMZA 2MLFC 3D10A 1CM4A 1J7RA 5J3XA 2BKIB 1X02A 5I2OA 1DJGA 3CR5X 1CDPA 1J1EA 2MLEC 3GK4X 1M31A 2MJWB 3JTDB 1SKTA 1NCXA 1K93D 5CPVA 1J7OA 1JFJA 1AUIB 1OQPA 2EC6C 3TDZA 4F0ZB 2M7LA 1M45A 1LINA 5I8NA 1AJ5A 2ZFDA 3LL8B 1QVIZ 1F4OA 3PM8A 2KGBC 3I5GB 4N1FA 2CBLA 2TN4A 4HSZA 2BECA 3BUOB 1B7TY 1S26D 2D8NA 3SG4A 5AEQA 2JPTA 2ZN8A 3EKHA 4GPLB 4NDDA 4C0KA 1E8AA 2Y1NA 4QJ5B 4IL1A 2KDHA 1PULA 1S6JA 1KSMA 1QIWA 1QJTA 1XFVO 2FCDA 5GQQC 3SIBA 2A4JA 3OX5A 1K9KA 2BL0C 3HCMA 1PALA 1H4BA 4XJKB 1WLMA 1UHHA 2LVVA 4TNCA 3NSKA 1NIWA 2I18A 3PALA 2O60A 1U5IB 2MAZA 2QACA 1SMGA 1R2UA 4DCKA 4M2OA 1EXRA 1RWYA 1YVHA 1CFCA 3NXAA 1BODA 1JSAA 2Y1MA 1NX1A 1S36A 2ZNDA 1UURA 4JWQA 5AXIA 1A75B 3ZNIA 2PALA 3BYAA 4NDBA 1TOPA 3PLFB 1NCZA 4AOMA 2LLSA 1H8BA 1YUTA 3OB2B 1AJ4A 1W7IB 3VGOA 1KWOB 1AK8A 1XFXO 1F8HA 1SRAA 2WNDA 1OMDA 1MWNA 2K2FA 2KNEA 3CGAA 4CIDA 2HF5A 2MHHA 1RJVA 1LKJA 4PE4A 1SK6D 5HLVA 1B1GA 1HT9A 1GGWA 1TCOB 1JWDA 1QS7A 5HKWA 3EVUA 1B4CA 2ZNEA 2KI4B 3GK1A 3KEVA 2I94A 1OSAA 3JVTC 3I5FB 2LC5A 2M97A 4ZCUA 5I2QA 1QV0A 4WQ2A 2NLNA 1M46A 1XYDA 3PFVA 1DVIA 3O6BA 2LE9B 2NCOA 1KQMB 3VRQA 5DKQA 4YI8A
chains in the Genus database with same CATH superfamily
2WCMA 3FS7A 1UHIA 4I5NB 4WRIA 1BF5A 1M39A 2JTZA 4YI9A 1CFFA 4ZCVA 1K9UA 1ZACA 2K61A 3BJHA 3D78A 2F8PA 3H4SE 2ZRSA 1MHOA 2JZIA 4GGNA 2WCBA 1TNQA 1NCYA 5JOLA 2CTNA 2JU0A 3DY9A 2KGRA 2LUCA 3CZTX 4ORBB 1XFWO 4AQIA 1OOJA 3C1VA 1XFRA 1SNLA 1Y1AA 3AKBA 4YRUA 1JFKA 2O5GA 1YTZC 3NSLA 4GNKB 2EC6B 3A4UB 4PE7A 2LCPA 1DF0A 3SS4A 1ALVA 4ORAB 1IJ5A 2PVBA 2LVKA 3DVEA 3GOFA 1TNPA 1UUSA 2H61A 3NGVA 1QASA 4ICBA 4JKTA 3B86A 4ZCUA 2CNPA 1XO5A 3D74A 1JBAA 1NUBA 3CLNA 3TDUA 2EHBA 1BLQA 3VROA 3WHUB 1YR5A 1UHNA 1ZOTB 3CWGA 4MRXA 2WCLA 4CFRA 2OS8C 2VRGA 2H61C 4U8DA 4GUKA 4ORCB 1QV1A 2IS9A 1TNWA 3IVTA 4HRGA 5B8IB 3AKAA 1CLBA 2PYQA 1F54A 2BL0B 3DVMA 2K7BA 2KSPA 1B47A 1TCFA 1DGVA 5PALA 5HKYA 1CKKA 5ER5A 1JUOA 1SR6C 3F45A 2E6WA 2PQLA 2ERBA 1PVAA 2KI6C 1WDCC 2KBIA 3EVVA 1P28A 1VRKA 1V1FA 1NX2A 5HYDA 2MRDA 4PHNA 3VB1A 2H2KA 2I7AA 2WOSA 2BBNA 1DJHA 1LVCD 1JF0A 1GQMA 3KPXA 1OMRA 1UWOA 2CT9A 1DGUA 1D1OA 3VRPA 2JRFA 5CSJA 1XVJA 1C07A 3I5IC 1OMVA 1BG1A 1CDLA 1EG4A 1K94A 3S0FA 1IG5A 4D1EA 1S6IA 1Y0VH 4MZLA 1FW4A 1WY9A 1OOFA 2BE6A 4I5KA 1KK8C 2EGDA 2LLUA 1EH2A 1B9AA 1QLSA 1FF1A 2KFHA 2V53A 2BCAA 2LMVA 1NPQA 3R1PA 3D0YA 1N2DA 1Q80A 3BFAA 2HQWA 1F55A 4CPVA 3OP0A 2KLDA 3SG6A 1OOHA 1HQVA 3CR2A 3EG5B 3JVTB 1SBJA 2Q4UA 3FE8A 4BY4A 1F71A 1Z2CB 2RGIA 2M1UA 2LAPA 3AAJA 1GJYA 4GAOA 2MBXA 4I5JA 1FBVA 1S1EA 4OKHA 1A03A 4PE0A 1Y1XA 1K95A 1EL4A 4MN0A 3FE6A 3SG3A 5TNCA 1CDNA 4GBAA 3CABA 3D73A 2BKHB 2FJYA 3S0GA 2WCKA 1RECA 3DZTA 4M2QA 3ZWHA 1YURA 3IQQA 3K1EA 1G33A 3OHMB 1BU3A 1MXLC 2SCPA 3PN7C 2LLTA 3FE9A 1CFDA 1PVBA 1YX7A 5BPJA 3DVJA 1SW8A 2NCPA 5D3OA 2BE4A 1UHKA 1BMOA 2KQ6A 1DEKA 1YX8A 2QPTA 1L7ZA 2JT0A 2QEOA 3PSRA 4PHKA 3CR4X 4OCIA 5CSFA 1DTLA 1C7WA 1QX2A 4HREE 4YGCB 3QRXA 3WXAA 2COLB 1OOIX 1SSEB 2K2AA 2M29A 4MEWA 3TS5C 1RTP1 4CLNA 1OZOA 3N7HA 4A4BA 1CDMA 3I5HC 2WC8A 3BQ3A 2LP3A 2HQ8A 4OZDA 1UHJA 3M0WA 1FI5A 1TWOA 3SIAA 5K89A 4PDZA 3NSOA 5JJGA 2WC5A 3O4XA 1WLZA 1Y6WA 1YRTB 1YUUA 1DF0B 1B8RA 2BCXA 3EK4A 2KBMA 2OS8B 5D7FA 1FI6A 2JNXA 2L50A 2KLEA 2LVIA 1CB1A 1PSBA 1XFZO 2LUXA 5HLOA 3R1VA 2QEVA 5KTYA 1YUSA 5AERA 4YGAA 1SCMC 2G2BA 2P70A 3BOWA 1SL8A 2OPOA 1SL7A 5DKRA 2P6BB 1S6CA 5AFPA 2HETA 1WRKA 2JC2A 2B1UA 1SR6B 3O2PA 2JT8A 3DF0A 1J55A 2LVJA 2KAXA 3VRNA 1WDCB 1NSHA 3B6XA 5AANA 3EK8A 1QTXA 1CLLA 1UP5A 1ORGA 2M0RA 1QXPA 4AQJA 1S5GY 1DT7B 2KYCA 1MUXA 1EG3A 1QX5B 2JT3A 1DC1A 1EJ3A 1SYMA 1IQ5A 3NSIA 3L4LA 1TN4A 3I5IB 2PASA 1KQVA 4QJ4B 2KYFA 4C0LA 1CTRA 1KFUS 2L5XB 2LV7A 1NP8A 2MA2A 1OZSA 5FI7A 3PATA 4YBHB 2L5YA 2OTGC 4IJ7A 1KK8B 2KOTA 3SJSA 2CXJA 2P71A 2JQ6A 1A4PA 4PALA 2QDIA 1G4YR 2L51A 2NXQA 3HX4A 1MR8A 1MF8B 3DD4A 3B88A 1CNPA 1KSOA 5FYXA 1F70A 1A2XA 3BUXB 2KPHA 3GK2A 2FOTA 2PRUA 3SG7A 1W9ZA 4OVNF 1IIOA 4XYNA 2WORA 4R1EA 2L4IA 1IJ6A 1KCYA 2G9BA 4M2PA 2LANA 4QJ3B 4E68A 1J7PA 2KFGA 2KAVA 4L9MA 3D0YB 1YVLA 1IWQA 3TUYC 1B8CA 1MQ1A 3BFBA 2L98A 4HRHA 3NHIA 3OB1B 3WHTB 3TDIA 1SY9A 3R1OA 4MZKA 1G8IA 1N65A 2KI6D 2Y4QA 3UNWA 4C0JA 4YGBB 4PHJA 1K90D 3ICBA 3RLZA 3RM1A 3PN7B 5D69A 1NX3A 1W7JB 3BFHA 1FPWA 1ODBA 1N0YA 2KAYA 3EK7A 2KQYA 3KO0A 4GFTA 2F2PA 1L2OC 2GGMA 1CLMA 1A29A 2LMUA 4YGEB 2K7DA 3OBVA 1S3PA 1AVSA 2DOQA 2AUCA 1XK4A 2F33A 3TS5B 3NHTA 1TTXA 4MVFA 5F6TA 1DQEA 3I5HB 5IBWA 3EVRA 2K7OA 4MRYA 3R72A 5FI2A 2BNXA 3SG5A 1F4QA 3LLEA 2WCEA 4OR9B 3LK1A 3L4AA 3BXKA 1SCVA 3DXLA 2BBMA 1IRJA 1XK4C 4DIRA 5EL2A 2LHIA 1BT6A 1OE9B 1PK0D 2LNKA 3E3RA 1TNXA 2LHLA 1LA3A 1CFPA 3D76A 4JPZB 1DJXA 1NX0A 4Q04A 1CMFA 1K96A 2M3WA 2F3YA 3IQOA 1ZUZA 2M1KB 3PM2A 1SCMB 1IKUA 2M7NA 2M49B 1T14A 1B8LA 2HPSA 1JF2A 4MBEA 1SL9A 2PSRA 1TIZA 1XA5A 2WCFA 1DJIA 3O78A 4MSPA 3EKJA 5I2LA 3JTDC 4FQOA 2JTTA 1BR4B 1DJYA 1S5GZ 3BOWB 4A4CA 5CSNA 2M8UA 4BY5A 1K2HA 2LM5A 2K8MB 2ISDA 3V2LA 3FWBA 3S0DA 1MXEA 3DF0B 3AAKA 1DJWA 3LCPC 1TUJA 3I5GC 4PCWA 1BR1B 3D75A 3FWCA 3CTNA 1BJFA 3A8RA 3K21A 3FIAA 4MZJA 2PMYA 2LMTA 1C3YA 1DJZA 5ER4X 1QVIY 1QLKA 1K9PA 2CCMA 4P2YB 5KSZA 3OX6A 3S0BA 4XJKA 1RFJA 1GGZA 1IQ3A 1C7VA 1OOGA 3CZ0A 1KK7Z 3O4YA 2OTGB 4I5LB 1R6PA 2JNFA 3CS1A 2L2EA 2L4HA 3DVKA 2L0PA 1KFXS 1U5IA 2JWWA 4DRWA 4OV2A 1Y1UA 4PE1A 1XFUO 3BUNB 4PHMA 5KU1A 1WRLA 2AAOA 1QIVA 4WQ3A 4JQ0D 1K8UA 4NQGA 2K7CA 5HKZA 4NDCA 3BUWB 3MSEB 5CSIA 1J1DA 2Q91A 2JPOA 1A75A 1RROA 4DUQA 1AHRA 3TUYB 5I94A 4GGFA 2KHNA 1NWDA 3KF9A 1RK9A 1IGVA 2YGUA 1NYAA 4FTGA 5HL1A 3LK0A 5DKNA 1QX7A 4P5OE 2M9GA 1C3ZA 1SPYA 2KFFA 3VRRA 1KFXL 3BUMB 4USLA 1M63B 4GGFC 4N1GA 2JXCA 4N5XA 1KWOC 4ETOA 4JD9A 2GV5A 2FJUB 1QATA 2F3ZA 4PT1A 2QEHA 2AMIA 1DMOA 2E30A 5G08A 1L2OB 1PSRA 3CZ2A 1CM1A 1Z4HA 1KK7Y 2JULA 2FCEA 1B7TZ 1WRZA 3WNXB 2ZN9A 1J7QA 4DS7A 2K60A 2K0JA 2GGZA 3DYEA 2KI4C 3TZ1A 3I5FC 2BCBA 2NZ0A 1LXFC 3S0EA 1IH0A 1ALWA 2ZRTA 3KHEA 1CMGA 2R2IA 3IF7A 4UPGA 1LS8A 1TRFA 1LA0A 1KFUL 1KQMC 4MLWA 5FI6A 2L2CA 2I2RE 1YRUB 4CFQA 1PRWA 1JC2A 2LP2A 1XFYO 2F2OA 2Y5IA 2JXLA 4KYNA 1V1GA 2JOJA 2ZKMX 4YGDB 3SG2A 2SASA 1AP4A 1BOCA 1ZFSA 1ZMZA 2MLFC 3D10A 1CM4A 1J7RA 3D77A 5J3XA 2BKIB 1X02A 5I2OA 1DJGA 3RZSA 3CR5X 1CDPA 1J1EA 2MLEC 2WCJA 3GK4X 1M31A 2MJWB 3CZ1A 3JTDB 1SKTA 1NCXA 1K93D 5CPVA 1J7OA 1JFJA 2GTEA 1AUIB 1OQPA 2EC6C 3QMEA 3TDZA 2M7LA 4F0ZB 1M45A 1LINA 1OW4A 5I8NA 1AJ5A 2ZFDA 3LL8B 3OGNA 1QVIZ 1F4OA 3PM8A 2KGBC 3CDNA 3I5GB 4N1FA 2CBLA 2TN4A 4HSZA 2BECA 3BUOB 1B7TY 4INXA 1S26D 2D8NA 1QWVA 3SG4A 5AEQA 2JPTA 4FQTA 2ZN8A 3EKHA 4GPLB 4NDDA 4C0KA 1E8AA 2Y1NA 4QJ5B 4IL1A 2KDHA 1PULA 1S6JA 1KSMA 1QIWA 1QJTA 1XFVO 2FCDA 5GQQC 3SIBA 2A4JA 3OX5A 1K9KA 2BL0C 3B87A 3HCMA 1PALA 1H4BA 4XJKB 1WLMA 1UHHA 2LVVA 4TNCA 3S0AA 3NSKA 1GM0A 1NIWA 2I18A 3UO9A 2WCHA 3PALA 2O60A 1U5IB 2MAZA 2QACA 1SMGA 1R2UA 4DCKA 4M2OA 1EXRA 1RWYA 5DICA 2H8VA 1YVHA 1CFCA 2WC6A 3NXAA 1BODA 1JSAA 2Y1MA 1NX1A 1S36A 3SS3A 2ZNDA 1UURA 4JWQA 5AXIA 3SS5A 1A75B 1DELA 3PJIA 3ZNIA 2PALA 3BYAA 4NDBA 1TOPA 3PLFB 1NCZA 4AOMA 2LLSA 1H8BA 4F7FA 1YUTA 3OB2B 1AJ4A 1W7IB 3VGOA 1KWOB 1AK8A 1XFXO 1F8HA 1SRAA 2WNDA 1OMDA 1MWNA 2K2FA 2KNEA 3CGAA 4CIDA 2HF5A 2MHHA 1RJVA 1LKJA 3CYZA 4PE4A 1SK6D 5HLVA 1B1GA 1TUZA 1HT9A 1GGWA 3B7AA 1TCOB 2QEBA 1JWDA 1QS7A 5HKWA 3EVUA 1B4CA 2ZNEA 2KI4B 3GK1A 3KEVA 2I94A 1OSAA 3JVTC 3I5FB 2LC5A 2M97A 3Q8IA 5I2QA 1QV0A 4WQ2A 2NLNA 4INWA 1M46A 1XYDA 3PFVA 1DVIA 3O6BA 2LE9B 2NCOA 1KQMB 3L47A 3VRQA 5DKQA 2BAPA 4YI8A
chains in the Genus database with same CATH topology
3FS7A 1UHIA 4I5NB 4WRIA 1BF5A 1M39A 2JTZA 4YI9A 1CFFA 4ZCVA 1K9UA 1ZACA 2K61A 2F8PA 3H4SE 2ZRSA 1MHOA 2JZIA 4GGNA 2WCBA 1TNQA 1NCYA 5JOLA 2CTNA 2JU0A 4AQIA 2KGRA 2LUCA 3CZTX 4ORBB 1XFWO 1OOJA 3C1VA 1Y1AA 1SNLA 3AKBA 4YRUA 1JFKA 2O5GA 1YTZC 3NSLA 4GNKB 2EC6B 3A4UB 4PE7A 2LCPA 1DF0A 1ALVA 4ORAB 1IJ5A 2PVBA 2LVKA 3DVEA 3GOFA 1TNPA 1UUSA 2H61A 4ICBA 1QASA 5B8IB 2CNPA 1XO5A 1JBAA 1NUBA 3CLNA 3TDUA 2EHBA 1BLQA 3VROA 3WHUB 1YR5A 1UHNA 1ZOTB 3CWGA 4MRXA 4CFRA 2OS8C 2VRGA 2H61C 4U8DA 4GUKA 4ORCB 1QV1A 2IS9A 1TNWA 4HRGA 3AKAA 1CLBA 1F54A 2BL0B 3DVMA 2K7BA 2KSPA 1B47A 1TCFA 1DGVA 5PALA 5HKYA 1CKKA 5ER5A 1JUOA 1SR6C 3F45A 2E6WA 1PVAA 2KI6C 1WDCC 2KBIA 3EVVA 1VRKA 1V1FA 1NX2A 5HYDA 2MRDA 4PHNA 2H2KA 2I7AA 2WOSA 2BBNA 1DJHA 1LVCD 1JF0A 1GQMA 3KPXA 1OMRA 1UWOA 2CT9A 1DGUA 1D1OA 3VRPA 2JRFA 5CSJA 1XVJA 1C07A 3I5IC 1OMVA 1BG1A 1CDLA 1EG4A 1K94A 1IG5A 4D1EA 1S6IA 1Y0VH 4MZLA 1FW4A 1WY9A 2BE6A 4I5KA 1KK8C 2EGDA 2LLUA 1EH2A 1B9AA 1QLSA 1FF1A 2KFHA 2V53A 2BCAA 2LMVA 1NPQA 3D0YA 1N2DA 1Q80A 2HQWA 1F55A 4CPVA 3OP0A 3SG6A 1HQVA 3CR2A 3JVTB 1SBJA 2Q4UA 4BY4A 1F71A 2RGIA 3AAJA 2M1UA 2LAPA 4GAOA 1GJYA 2MBXA 4I5JA 1FBVA 1S1EA 4OKHA 1A03A 4PE0A 1Y1XA 1K95A 1EL4A 4MN0A 3SG3A 5TNCA 1CDNA 4GBAA 2BKHB 1RECA 4M2QA 3ZWHA 1YURA 3IQQA 3OHMB 1G33A 3PN7C 1BU3A 1MXLC 2SCPA 2LLTA 1CFDA 1PVBA 1YX7A 5BPJA 3DVJA 1SW8A 2NCPA 2BE4A 1UHKA 1BMOA 2KQ6A 1YX8A 2QPTA 1L7ZA 2JT0A 3PSRA 4PHKA 3CR4X 4OCIA 5CSFA 1DTLA 1C7WA 1QX2A 4HREE 4YGCB 3QRXA 3WXAA 2COLB 3TS5C 2K2AA 2M29A 4MEWA 1RTP1 4CLNA 1OZOA 4A4BA 1CDMA 3I5HC 2WC8A 3BQ3A 2LP3A 2HQ8A 1UHJA 3M0WA 1FI5A 3SIAA 5K89A 4PDZA 3NSOA 5JJGA 1WLZA 1Y6WA 1YRTB 1YUUA 1DF0B 1B8RA 2BCXA 3EK4A 2KBMA 2OS8B 5D7FA 1FI6A 2JNXA 2L50A 2LVIA 1CB1A 1PSBA 1XFZO 2LUXA 5HLOA 5KTYA 1YUSA 5AERA 4YGAA 1SCMC 2G2BA 3BOWA 1SL8A 2OPOA 1SL7A 5DKRA 2P6BB 1S6CA 5AFPA 2HETA 1WRKA 2JC2A 2B1UA 1SR6B 3O2PA 2JT8A 3DF0A 1J55A 2LVJA 2KAXA 3VRNA 1WDCB 1NSHA 5AANA 3EK8A 1QTXA 1CLLA 1UP5A 2M0RA 1QXPA 4AQJA 1S5GY 1DT7B 2KYCA 1MUXA 1EG3A 1QX5B 2JT3A 1EJ3A 1SYMA 1IQ5A 3NSIA 1TN4A 3I5IB 2PASA 1KQVA 4QJ4B 2KYFA 4C0LA 1CTRA 1KFUS 2L5XB 2LV7A 1NP8A 2MA2A 1OZSA 3PATA 4YBHB 2OTGC 1KK8B 2KOTA 3SJSA 2CXJA 2JQ6A 1A4PA 4PALA 1G4YR 2L51A 2NXQA 3HX4A 1MR8A 1MF8B 3DD4A 1CNPA 1KSOA 5FYXA 1F70A 1A2XA 3BUXB 3GK2A 2FOTA 2PRUA 3SG7A 4OVNF 4XYNA 2WORA 4R1EA 2L4IA 1IJ6A 1KCYA 2G9BA 4M2PA 2LANA 4QJ3B 4E68A 1J7PA 2KFGA 2KAVA 4L9MA 3D0YB 1YVLA 1IWQA 3TUYC 1B8CA 1MQ1A 2L98A 4HRHA 3OB1B 3WHTB 3TDIA 1SY9A 4MZKA 1G8IA 1N65A 2KI6D 2Y4QA 4C0JA 4YGBB 4PHJA 1K90D 3ICBA 3RLZA 3RM1A 3PN7B 5D69A 1NX3A 1W7JB 1FPWA 1ODBA 1N0YA 2KAYA 3EK7A 2KQYA 3KO0A 4GFTA 2F2PA 1L2OC 2GGMA 1CLMA 1A29A 2LMUA 4YGEB 2K7DA 3TS5B 1S3PA 1AVSA 2DOQA 2AUCA 1XK4A 2F33A 1TTXA 4MVFA 5F6TA 3I5HB 5IBWA 3EVRA 2K7OA 4MRYA 3SG5A 1F4QA 3LLEA 2WCEA 4OR9B 3LK1A 3BXKA 1SCVA 2BBMA 1IRJA 1XK4C 4DIRA 2LHIA 1BT6A 1OE9B 1PK0D 2LNKA 3E3RA 1TNXA 2LHLA 1LA3A 1CFPA 4Q04A 4JPZB 1DJXA 1NX0A 1CMFA 1K96A 2M3WA 2F3YA 3IQOA 1ZUZA 2M1KB 1SCMB 1IKUA 2M7NA 2M49B 4MBEA 1B8LA 2HPSA 1JF2A 1SL9A 2PSRA 1TIZA 1XA5A 2WCFA 1DJIA 3O78A 4MSPA 3EKJA 5I2LA 3JTDC 4FQOA 2JTTA 1BR4B 1DJYA 1S5GZ 3BOWB 4A4CA 5CSNA 2M8UA 4BY5A 1K2HA 2LM5A 2K8MB 2ISDA 3FWBA 1MXEA 3DF0B 3AAKA 1DJWA 3LCPC 3I5GC 4PCWA 1BR1B 3FWCA 3CTNA 1BJFA 3A8RA 3K21A 3FIAA 4MZJA 2PMYA 2LMTA 1DJZA 5ER4X 1QVIY 1QLKA 1K9PA 2CCMA 4P2YB 5KSZA 3OX6A 4XJKA 1RFJA 1GGZA 1IQ3A 1C7VA 1KK7Z 3O4YA 2OTGB 4I5LB 1R6PA 2JNFA 3CS1A 2L2EA 2L4HA 3DVKA 2L0PA 1KFXS 1U5IA 2JWWA 4DRWA 4OV2A 1Y1UA 4PE1A 1XFUO 3BUNB 4PHMA 5KU1A 1WRLA 2AAOA 1QIVA 4WQ3A 4JQ0D 1K8UA 4NQGA 2K7CA 5HKZA 4NDCA 3BUWB 3MSEB 5CSIA 1J1DA 2Q91A 1A75A 1RROA 4DUQA 1AHRA 3TUYB 4GGFA 2KHNA 1NWDA 3KF9A 1RK9A 1IGVA 1NYAA 4FTGA 3LK0A 5DKNA 1QX7A 4P5OE 2M9GA 1SPYA 2KFFA 3VRRA 1KFXL 3BUMB 4USLA 1M63B 4GGFC 4N1GA 2JXCA 4N5XA 1KWOC 4ETOA 2GV5A 2FJUB 1QATA 2F3ZA 2AMIA 1DMOA 2E30A 5G08A 1L2OB 1PSRA 1CM1A 2JULA 1KK7Y 2FCEA 1B7TZ 1WRZA 3WNXB 2ZN9A 1J7QA 4DS7A 2K0JA 2GGZA 2KI4C 3TZ1A 3I5FC 2BCBA 2NZ0A 1LXFC 1IH0A 1ALWA 2ZRTA 3KHEA 1CMGA 2R2IA 3IF7A 4UPGA 1TRFA 1LA0A 1KFUL 1KQMC 4MLWA 2I2RE 1YRUB 4CFQA 1PRWA 1JC2A 2LP2A 1XFYO 2F2OA 2Y5IA 2JXLA 4YGDB 1V1GA 2JOJA 2ZKMX 3SG2A 2SASA 1AP4A 1BOCA 1ZFSA 1ZMZA 2MLFC 3D10A 1CM4A 1J7RA 5J3XA 2BKIB 1X02A 5I2OA 1DJGA 3CR5X 1CDPA 1J1EA 2MLEC 3GK4X 1M31A 2MJWB 3JTDB 1SKTA 1NCXA 1K93D 5CPVA 1J7OA 1JFJA 1AUIB 1OQPA 2EC6C 3TDZA 4F0ZB 2M7LA 1M45A 1LINA 5I8NA 1AJ5A 2ZFDA 3LL8B 1QVIZ 1F4OA 3PM8A 2KGBC 3I5GB 4N1FA 2CBLA 2TN4A 4HSZA 2BECA 3BUOB 1B7TY 1S26D 2D8NA 3SG4A 5AEQA 2JPTA 2ZN8A 3EKHA 4GPLB 4NDDA 4C0KA 1E8AA 2Y1NA 4QJ5B 4IL1A 2KDHA 1PULA 1S6JA 1KSMA 1QIWA 1QJTA 1XFVO 2FCDA 5GQQC 3SIBA 2A4JA 3OX5A 1K9KA 2BL0C 3HCMA 1PALA 1H4BA 4XJKB 1WLMA 1UHHA 2LVVA 4TNCA 3NSKA 1NIWA 2I18A 3PALA 2O60A 1U5IB 2MAZA 2QACA 1SMGA 1R2UA 4DCKA 4M2OA 1EXRA 1RWYA 1YVHA 1CFCA 3NXAA 1BODA 1JSAA 2Y1MA 1NX1A 1S36A 2ZNDA 1UURA 4JWQA 5AXIA 1A75B 3ZNIA 2PALA 3BYAA 4NDBA 1TOPA 3PLFB 1NCZA 4AOMA 2LLSA 1H8BA 1YUTA 3OB2B 1AJ4A 1W7IB 3VGOA 1KWOB 1AK8A 1XFXO 1F8HA 1SRAA 2WNDA 1OMDA 1MWNA 2K2FA 2KNEA 3CGAA 4CIDA 2HF5A 2MHHA 1RJVA 1LKJA 4PE4A 1SK6D 5HLVA 1B1GA 1HT9A 1GGWA 1TCOB 1JWDA 1QS7A 5HKWA 3EVUA 1B4CA 2ZNEA 2KI4B 3GK1A 3KEVA 2I94A 1OSAA 3JVTC 3I5FB 2LC5A 2M97A 4ZCUA 5I2QA 1QV0A 4WQ2A 2NLNA 1M46A 1XYDA 3PFVA 1DVIA 3O6BA 2LE9B 2NCOA 1KQMB 3VRQA 5DKQA 4YI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FS7 A;  1UHI A;  4I5N B;  4WRI A;  1BF5 A;  1M39 A;  2JTZ A;  4YI9 A;  1CFF A;  4ZCV A;  1K9U A;  1ZAC A;  2K61 A;  2F8P A;  3H4S E;  2ZRS A;  1MHO A;  2JZI A;  4GGN A;  2WCB A;  1TNQ A;  1NCY A;  5JOL A;  2CTN A;  2JU0 A;  4AQI A;  2KGR A;  2LUC A;  3CZT X;  4ORB B;  1XFW O;  1OOJ A;  3C1V A;  1Y1A A;  1SNL A;  3AKB A;  4YRU A;  1JFK A;  2O5G A;  1YTZ C;  3NSL A;  4GNK B;  2EC6 B;  3A4U B;  4PE7 A;  2LCP A;  1DF0 A;  1ALV A;  4ORA B;  1IJ5 A;  2PVB A;  2LVK A;  3DVE A;  3GOF A;  1TNP A;  1UUS A;  2H61 A;  4ICB A;  1QAS A;  5B8I B;  2CNP A;  1XO5 A;  1JBA A;  1NUB A;  3CLN A;  3TDU A;  2EHB A;  1BLQ A;  3VRO A;  3WHU B;  1YR5 A;  1UHN A;  1ZOT B;  3CWG A;  4MRX A;  4CFR A;  2OS8 C;  2VRG A;  2H61 C;  4U8D A;  4GUK A;  4ORC B;  1QV1 A;  2IS9 A;  1TNW A;  4HRG A;  3AKA A;  1CLB A;  1F54 A;  2BL0 B;  3DVM A;  2K7B A;  2KSP A;  1B47 A;  1TCF A;  1DGV A;  5PAL A;  5HKY A;  1CKK A;  5ER5 A;  1JUO A;  1SR6 C;  3F45 A;  2E6W A;  1PVA A;  2KI6 C;  1WDC C;  2KBI A;  3EVV A;  1VRK A;  1V1F A;  1NX2 A;  5HYD A;  2MRD A;  4PHN A;  2H2K A;  2I7A A;  2WOS A;  2BBN A;  1DJH A;  1LVC D;  1JF0 A;  1GQM A;  3KPX A;  1OMR A;  1UWO A;  2CT9 A;  1DGU A;  1D1O A;  3VRP A;  2JRF A;  5CSJ A;  1XVJ A;  1C07 A;  3I5I C;  1OMV A;  1BG1 A;  1CDL A;  1EG4 A;  1K94 A;  1IG5 A;  4D1E A;  1S6I A;  1Y0V H;  4MZL A;  1FW4 A;  1WY9 A;  2BE6 A;  4I5K A;  1KK8 C;  2EGD A;  2LLU A;  1EH2 A;  1B9A A;  1QLS A;  1FF1 A;  2KFH A;  2V53 A;  2BCA A;  2LMV A;  1NPQ A;  3D0Y A;  1N2D A;  1Q80 A;  2HQW A;  1F55 A;  4CPV A;  3OP0 A;  3SG6 A;  1HQV A;  3CR2 A;  3JVT B;  1SBJ A;  2Q4U A;  4BY4 A;  1F71 A;  2RGI A;  3AAJ A;  2M1U A;  2LAP A;  4GAO A;  1GJY A;  2MBX A;  4I5J A;  1FBV A;  1S1E A;  4OKH A;  1A03 A;  4PE0 A;  1Y1X A;  1K95 A;  1EL4 A;  4MN0 A;  3SG3 A;  5TNC A;  1CDN A;  4GBA A;  2BKH B;  1REC A;  4M2Q A;  3ZWH A;  1YUR A;  3IQQ A;  3OHM B;  1G33 A;  3PN7 C;  1BU3 A;  1MXL C;  2SCP A;  2LLT A;  1CFD A;  1PVB A;  1YX7 A;  5BPJ A;  3DVJ A;  1SW8 A;  2NCP A;  2BE4 A;  1UHK A;  1BMO A;  2KQ6 A;  1YX8 A;  2QPT A;  1L7Z A;  2JT0 A;  3PSR A;  4PHK A;  3CR4 X;  4OCI A;  5CSF A;  1DTL A;  1C7W A;  1QX2 A;  4HRE E;  4YGC B;  3QRX A;  3WXA A;  2COL B;  3TS5 C;  2K2A A;  2M29 A;  4MEW A;  1RTP 1;  4CLN A;  1OZO A;  4A4B A;  1CDM A;  3I5H C;  2WC8 A;  3BQ3 A;  2LP3 A;  2HQ8 A;  1UHJ A;  3M0W A;  1FI5 A;  3SIA A;  5K89 A;  4PDZ A;  3NSO A;  5JJG A;  1WLZ A;  1Y6W A;  1YRT B;  1YUU A;  1DF0 B;  1B8R A;  2BCX A;  3EK4 A;  2KBM A;  2OS8 B;  5D7F A;  1FI6 A;  2JNX A;  2L50 A;  2LVI A;  1CB1 A;  1PSB A;  1XFZ O;  2LUX A;  5HLO A;  5KTY A;  1YUS A;  5AER A;  4YGA A;  1SCM C;  2G2B A;  3BOW A;  1SL8 A;  2OPO A;  1SL7 A;  5DKR A;  2P6B B;  1S6C A;  5AFP A;  2HET A;  1WRK A;  2JC2 A;  2B1U A;  1SR6 B;  3O2P A;  2JT8 A;  3DF0 A;  1J55 A;  2LVJ A;  2KAX A;  3VRN A;  1WDC B;  1NSH A;  5AAN A;  3EK8 A;  1QTX A;  1CLL A;  1UP5 A;  2M0R A;  1QXP A;  4AQJ A;  1S5G Y;  1DT7 B;  2KYC A;  1MUX A;  1EG3 A;  1QX5 B;  2JT3 A;  1EJ3 A;  1SYM A;  1IQ5 A;  3NSI A;  1TN4 A;  3I5I B;  2PAS A;  1KQV A;  4QJ4 B;  2KYF A;  4C0L A;  1CTR A;  1KFU S;  2L5X B;  2LV7 A;  1NP8 A;  2MA2 A;  1OZS A;  3PAT A;  4YBH B;  2OTG C;  1KK8 B;  2KOT A;  3SJS A;  2CXJ A;  2JQ6 A;  1A4P A;  4PAL A;  1G4Y R;  2L51 A;  2NXQ A;  3HX4 A;  1MR8 A;  1MF8 B;  3DD4 A;  1CNP A;  1KSO A;  5FYX A;  1F70 A;  1A2X A;  3BUX B;  3GK2 A;  2FOT A;  2PRU A;  3SG7 A;  4OVN F;  4XYN A;  2WOR A;  4R1E A;  2L4I A;  1IJ6 A;  1KCY A;  2G9B A;  4M2P A;  2LAN A;  4QJ3 B;  4E68 A;  1J7P A;  2KFG A;  2KAV A;  4L9M A;  3D0Y B;  1YVL A;  1IWQ A;  3TUY C;  1B8C A;  1MQ1 A;  2L98 A;  4HRH A;  3OB1 B;  3WHT B;  3TDI A;  1SY9 A;  4MZK A;  1G8I A;  1N65 A;  2KI6 D;  2Y4Q A;  4C0J A;  4YGB B;  4PHJ A;  1K90 D;  3ICB A;  3RLZ A;  3RM1 A;  3PN7 B;  5D69 A;  1NX3 A;  1W7J B;  1FPW A;  1ODB A;  1N0Y A;  2KAY A;  3EK7 A;  2KQY A;  3KO0 A;  4GFT A;  2F2P A;  1L2O C;  2GGM A;  1CLM A;  1A29 A;  2LMU A;  4YGE B;  2K7D A;  3TS5 B;  1S3P A;  1AVS A;  2DOQ A;  2AUC A;  1XK4 A;  2F33 A;  1TTX A;  4MVF A;  5F6T A;  3I5H B;  5IBW A;  3EVR A;  2K7O A;  4MRY A;  3SG5 A;  1F4Q A;  3LLE A;  2WCE A;  4OR9 B;  3LK1 A;  3BXK A;  1SCV A;  2BBM A;  1IRJ A;  1XK4 C;  4DIR A;  2LHI A;  1BT6 A;  1OE9 B;  1PK0 D;  2LNK A;  3E3R A;  1TNX A;  2LHL A;  1LA3 A;  1CFP A;  4Q04 A;  4JPZ B;  1DJX A;  1NX0 A;  1CMF A;  1K96 A;  2M3W A;  2F3Y A;  3IQO A;  1ZUZ A;  2M1K B;  1SCM B;  1IKU A;  2M7N A;  2M49 B;  4MBE A;  1B8L A;  2HPS A;  1JF2 A;  1SL9 A;  2PSR A;  1TIZ A;  1XA5 A;  2WCF A;  1DJI A;  3O78 A;  4MSP A;  3EKJ A;  5I2L A;  3JTD C;  4FQO A;  2JTT A;  1BR4 B;  1DJY A;  1S5G Z;  3BOW B;  4A4C A;  5CSN A;  2M8U A;  4BY5 A;  1K2H A;  2LM5 A;  2K8M B;  2ISD A;  3FWB A;  1MXE A;  3DF0 B;  3AAK A;  1DJW A;  3LCP C;  3I5G C;  4PCW A;  1BR1 B;  3FWC A;  3CTN A;  1BJF A;  3A8R A;  3K21 A;  3FIA A;  4MZJ A;  2PMY A;  2LMT A;  1DJZ A;  5ER4 X;  1QVI Y;  1QLK A;  1K9P A;  2CCM A;  4P2Y B;  5KSZ A;  3OX6 A;  4XJK A;  1RFJ A;  1GGZ A;  1IQ3 A;  1C7V A;  1KK7 Z;  3O4Y A;  2OTG B;  4I5L B;  1R6P A;  2JNF A;  3CS1 A;  2L2E A;  2L4H A;  3DVK A;  2L0P A;  1KFX S;  1U5I A;  2JWW A;  4DRW A;  4OV2 A;  1Y1U A;  4PE1 A;  1XFU O;  3BUN B;  4PHM A;  5KU1 A;  1WRL A;  2AAO A;  1QIV A;  4WQ3 A;  4JQ0 D;  1K8U A;  4NQG A;  2K7C A;  5HKZ A;  4NDC A;  3BUW B;  3MSE B;  5CSI A;  1J1D A;  2Q91 A;  1A75 A;  1RRO A;  4DUQ A;  1AHR A;  3TUY B;  4GGF A;  2KHN A;  1NWD A;  3KF9 A;  1RK9 A;  1IGV A;  1NYA A;  4FTG A;  3LK0 A;  5DKN A;  1QX7 A;  4P5O E;  2M9G A;  1SPY A;  2KFF A;  3VRR A;  1KFX L;  3BUM B;  4USL A;  1M63 B;  4GGF C;  4N1G A;  2JXC A;  4N5X A;  1KWO C;  4ETO A;  2GV5 A;  2FJU B;  1QAT A;  2F3Z A;  2AMI A;  1DMO A;  2E30 A;  5G08 A;  1L2O B;  1PSR A;  1CM1 A;  2JUL A;  1KK7 Y;  2FCE A;  1B7T Z;  1WRZ A;  3WNX B;  2ZN9 A;  1J7Q A;  4DS7 A;  2K0J A;  2GGZ A;  2KI4 C;  3TZ1 A;  3I5F C;  2BCB A;  2NZ0 A;  1LXF C;  1IH0 A;  1ALW A;  2ZRT A;  3KHE A;  1CMG A;  2R2I A;  3IF7 A;  4UPG A;  1TRF A;  1LA0 A;  1KFU L;  1KQM C;  4MLW A;  2I2R E;  1YRU B;  4CFQ A;  1PRW A;  1JC2 A;  2LP2 A;  1XFY O;  2F2O A;  2Y5I A;  2JXL A;  4YGD B;  1V1G A;  2JOJ A;  2ZKM X;  3SG2 A;  2SAS A;  1AP4 A;  1BOC A;  1ZFS A;  1ZMZ A;  2MLF C;  3D10 A;  1CM4 A;  1J7R A;  5J3X A;  2BKI B;  1X02 A;  5I2O A;  1DJG A;  3CR5 X;  1CDP A;  1J1E A;  2MLE C;  3GK4 X;  1M31 A;  2MJW B;  3JTD B;  1SKT A;  1NCX A;  1K93 D;  5CPV A;  1J7O A;  1JFJ A;  1AUI B;  1OQP A;  2EC6 C;  3TDZ A;  4F0Z B;  2M7L A;  1M45 A;  1LIN A;  5I8N A;  1AJ5 A;  2ZFD A;  3LL8 B;  1QVI Z;  1F4O A;  3PM8 A;  2KGB C;  3I5G B;  4N1F A;  2CBL A;  2TN4 A;  4HSZ A;  2BEC A;  3BUO B;  1B7T Y;  1S26 D;  2D8N A;  3SG4 A;  5AEQ A;  2JPT A;  2ZN8 A;  3EKH A;  4GPL B;  4NDD A;  4C0K A;  1E8A A;  2Y1N A;  4QJ5 B;  4IL1 A;  2KDH A;  1PUL A;  1S6J A;  1KSM A;  1QIW A;  1QJT A;  1XFV O;  2FCD A;  5GQQ C;  3SIB A;  2A4J A;  3OX5 A;  1K9K A;  2BL0 C;  3HCM A;  1PAL A;  1H4B A;  4XJK B;  1WLM A;  1UHH A;  2LVV A;  4TNC A;  3NSK A;  1NIW A;  2I18 A;  3PAL A;  2O60 A;  1U5I B;  2MAZ A;  2QAC A;  1SMG A;  1R2U A;  4DCK A;  4M2O A;  1EXR A;  1RWY A;  1YVH A;  1CFC A;  3NXA A;  1BOD A;  1JSA A;  2Y1M A;  1NX1 A;  1S36 A;  2ZND A;  1UUR A;  4JWQ A;  5AXI A;  1A75 B;  3ZNI A;  2PAL A;  3BYA A;  4NDB A;  1TOP A;  3PLF B;  1NCZ A;  4AOM A;  2LLS A;  1H8B A;  1YUT A;  3OB2 B;  1AJ4 A;  1W7I B;  3VGO A;  1KWO B;  1AK8 A;  1XFX O;  1F8H A;  1SRA A;  2WND A;  1OMD A;  1MWN A;  2K2F A;  2KNE A;  3CGA A;  4CID A;  2HF5 A;  2MHH A;  1RJV A;  1LKJ A;  4PE4 A;  1SK6 D;  5HLV A;  1B1G A;  1HT9 A;  1GGW A;  1TCO B;  1JWD A;  1QS7 A;  5HKW A;  3EVU A;  1B4C A;  2ZNE A;  2KI4 B;  3GK1 A;  3KEV A;  2I94 A;  1OSA A;  3JVT C;  3I5F B;  2LC5 A;  2M97 A;  4ZCU A;  5I2Q A;  1QV0 A;  4WQ2 A;  2NLN A;  1M46 A;  1XYD A;  3PFV A;  1DVI A;  3O6B A;  2LE9 B;  2NCO A;  1KQM B;  3VRQ A;  5DKQ A;  4YI8 A; 
#chains in the Genus database with same CATH topology
 2WCM A;  3FS7 A;  1UHI A;  4I5N B;  4WRI A;  1BF5 A;  1M39 A;  2JTZ A;  4YI9 A;  1CFF A;  4ZCV A;  1K9U A;  1ZAC A;  2K61 A;  3BJH A;  3D78 A;  2F8P A;  3H4S E;  2ZRS A;  1MHO A;  2JZI A;  4GGN A;  2WCB A;  1TNQ A;  1NCY A;  5JOL A;  2CTN A;  2JU0 A;  3DY9 A;  2KGR A;  2LUC A;  3CZT X;  4ORB B;  1XFW O;  4AQI A;  1OOJ A;  3C1V A;  1XFR A;  1SNL A;  1Y1A A;  3AKB A;  4YRU A;  1JFK A;  2O5G A;  1YTZ C;  3NSL A;  4GNK B;  2EC6 B;  3A4U B;  4PE7 A;  2LCP A;  1DF0 A;  3SS4 A;  1ALV A;  4ORA B;  1IJ5 A;  2PVB A;  2LVK A;  3DVE A;  3GOF A;  1TNP A;  1UUS A;  2H61 A;  3NGV A;  1QAS A;  4ICB A;  4JKT A;  3B86 A;  4ZCU A;  2CNP A;  1XO5 A;  3D74 A;  1JBA A;  1NUB A;  3CLN A;  3TDU A;  2EHB A;  1BLQ A;  3VRO A;  3WHU B;  1YR5 A;  1UHN A;  1ZOT B;  3CWG A;  4MRX A;  2WCL A;  4CFR A;  2OS8 C;  2VRG A;  2H61 C;  4U8D A;  4GUK A;  4ORC B;  1QV1 A;  2IS9 A;  1TNW A;  3IVT A;  4HRG A;  5B8I B;  3AKA A;  1CLB A;  2PYQ A;  1F54 A;  2BL0 B;  3DVM A;  2K7B A;  2KSP A;  1B47 A;  1TCF A;  1DGV A;  5PAL A;  5HKY A;  1CKK A;  5ER5 A;  1JUO A;  1SR6 C;  3F45 A;  2E6W A;  2PQL A;  2ERB A;  1PVA A;  2KI6 C;  1WDC C;  2KBI A;  3EVV A;  1P28 A;  1VRK A;  1V1F A;  1NX2 A;  5HYD A;  2MRD A;  4PHN A;  3VB1 A;  2H2K A;  2I7A A;  2WOS A;  2BBN A;  1DJH A;  1LVC D;  1JF0 A;  1GQM A;  3KPX A;  1OMR A;  1UWO A;  2CT9 A;  1DGU A;  1D1O A;  3VRP A;  2JRF A;  5CSJ A;  1XVJ A;  1C07 A;  3I5I C;  1OMV A;  1BG1 A;  1CDL A;  1EG4 A;  1K94 A;  3S0F A;  1IG5 A;  4D1E A;  1S6I A;  1Y0V H;  4MZL A;  1FW4 A;  1WY9 A;  1OOF A;  2BE6 A;  4I5K A;  1KK8 C;  2EGD A;  2LLU A;  1EH2 A;  1B9A A;  1QLS A;  1FF1 A;  2KFH A;  2V53 A;  2BCA A;  2LMV A;  1NPQ A;  3R1P A;  3D0Y A;  1N2D A;  1Q80 A;  3BFA A;  2HQW A;  1F55 A;  4CPV A;  3OP0 A;  2KLD A;  3SG6 A;  1OOH A;  1HQV A;  3CR2 A;  3EG5 B;  3JVT B;  1SBJ A;  2Q4U A;  3FE8 A;  4BY4 A;  1F71 A;  1Z2C B;  2RGI A;  2M1U A;  2LAP A;  3AAJ A;  1GJY A;  4GAO A;  2MBX A;  4I5J A;  1FBV A;  1S1E A;  4OKH A;  1A03 A;  4PE0 A;  1Y1X A;  1K95 A;  1EL4 A;  4MN0 A;  3FE6 A;  3SG3 A;  5TNC A;  1CDN A;  4GBA A;  3CAB A;  3D73 A;  2BKH B;  2FJY A;  3S0G A;  2WCK A;  1REC A;  3DZT A;  4M2Q A;  3ZWH A;  1YUR A;  3IQQ A;  3K1E A;  1G33 A;  3OHM B;  1BU3 A;  1MXL C;  2SCP A;  3PN7 C;  2LLT A;  3FE9 A;  1CFD A;  1PVB A;  1YX7 A;  5BPJ A;  3DVJ A;  1SW8 A;  2NCP A;  5D3O A;  2BE4 A;  1UHK A;  1BMO A;  2KQ6 A;  1DEK A;  1YX8 A;  2QPT A;  1L7Z A;  2JT0 A;  2QEO A;  3PSR A;  4PHK A;  3CR4 X;  4OCI A;  5CSF A;  1DTL A;  1C7W A;  1QX2 A;  4HRE E;  4YGC B;  3QRX A;  3WXA A;  2COL B;  1OOI X;  1SSE B;  2K2A A;  2M29 A;  4MEW A;  3TS5 C;  1RTP 1;  4CLN A;  1OZO A;  3N7H A;  4A4B A;  1CDM A;  3I5H C;  2WC8 A;  3BQ3 A;  2LP3 A;  2HQ8 A;  4OZD A;  1UHJ A;  3M0W A;  1FI5 A;  1TWO A;  3SIA A;  5K89 A;  4PDZ A;  3NSO A;  5JJG A;  2WC5 A;  3O4X A;  1WLZ A;  1Y6W A;  1YRT B;  1YUU A;  1DF0 B;  1B8R A;  2BCX A;  3EK4 A;  2KBM A;  2OS8 B;  5D7F A;  1FI6 A;  2JNX A;  2L50 A;  2KLE A;  2LVI A;  1CB1 A;  1PSB A;  1XFZ O;  2LUX A;  5HLO A;  3R1V A;  2QEV A;  5KTY A;  1YUS A;  5AER A;  4YGA A;  1SCM C;  2G2B A;  2P70 A;  3BOW A;  1SL8 A;  2OPO A;  1SL7 A;  5DKR A;  2P6B B;  1S6C A;  5AFP A;  2HET A;  1WRK A;  2JC2 A;  2B1U A;  1SR6 B;  3O2P A;  2JT8 A;  3DF0 A;  1J55 A;  2LVJ A;  2KAX A;  3VRN A;  1WDC B;  1NSH A;  3B6X A;  5AAN A;  3EK8 A;  1QTX A;  1CLL A;  1UP5 A;  1ORG A;  2M0R A;  1QXP A;  4AQJ A;  1S5G Y;  1DT7 B;  2KYC A;  1MUX A;  1EG3 A;  1QX5 B;  2JT3 A;  1DC1 A;  1EJ3 A;  1SYM A;  1IQ5 A;  3NSI A;  3L4L A;  1TN4 A;  3I5I B;  2PAS A;  1KQV A;  4QJ4 B;  2KYF A;  4C0L A;  1CTR A;  1KFU S;  2L5X B;  2LV7 A;  1NP8 A;  2MA2 A;  1OZS A;  5FI7 A;  3PAT A;  4YBH B;  2L5Y A;  2OTG C;  4IJ7 A;  1KK8 B;  2KOT A;  3SJS A;  2CXJ A;  2P71 A;  2JQ6 A;  1A4P A;  4PAL A;  2QDI A;  1G4Y R;  2L51 A;  2NXQ A;  3HX4 A;  1MR8 A;  1MF8 B;  3DD4 A;  3B88 A;  1CNP A;  1KSO A;  5FYX A;  1F70 A;  1A2X A;  3BUX B;  2KPH A;  3GK2 A;  2FOT A;  2PRU A;  3SG7 A;  1W9Z A;  4OVN F;  1IIO A;  4XYN A;  2WOR A;  4R1E A;  2L4I A;  1IJ6 A;  1KCY A;  2G9B A;  4M2P A;  2LAN A;  4QJ3 B;  4E68 A;  1J7P A;  2KFG A;  2KAV A;  4L9M A;  3D0Y B;  1YVL A;  1IWQ A;  3TUY C;  1B8C A;  1MQ1 A;  3BFB A;  2L98 A;  4HRH A;  3NHI A;  3OB1 B;  3WHT B;  3TDI A;  1SY9 A;  3R1O A;  4MZK A;  1G8I A;  1N65 A;  2KI6 D;  2Y4Q A;  3UNW A;  4C0J A;  4YGB B;  4PHJ A;  1K90 D;  3ICB A;  3RLZ A;  3RM1 A;  3PN7 B;  5D69 A;  1NX3 A;  1W7J B;  3BFH A;  1FPW A;  1ODB A;  1N0Y A;  2KAY A;  3EK7 A;  2KQY A;  3KO0 A;  4GFT A;  2F2P A;  1L2O C;  2GGM A;  1CLM A;  1A29 A;  2LMU A;  4YGE B;  2K7D A;  3OBV A;  1S3P A;  1AVS A;  2DOQ A;  2AUC A;  1XK4 A;  2F33 A;  3TS5 B;  3NHT A;  1TTX A;  4MVF A;  5F6T A;  1DQE A;  3I5H B;  5IBW A;  3EVR A;  2K7O A;  4MRY A;  3R72 A;  5FI2 A;  2BNX A;  3SG5 A;  1F4Q A;  3LLE A;  2WCE A;  4OR9 B;  3LK1 A;  3L4A A;  3BXK A;  1SCV A;  3DXL A;  2BBM A;  1IRJ A;  1XK4 C;  4DIR A;  5EL2 A;  2LHI A;  1BT6 A;  1OE9 B;  1PK0 D;  2LNK A;  3E3R A;  1TNX A;  2LHL A;  1LA3 A;  1CFP A;  3D76 A;  4JPZ B;  1DJX A;  1NX0 A;  4Q04 A;  1CMF A;  1K96 A;  2M3W A;  2F3Y A;  3IQO A;  1ZUZ A;  2M1K B;  3PM2 A;  1SCM B;  1IKU A;  2M7N A;  2M49 B;  1T14 A;  1B8L A;  2HPS A;  1JF2 A;  4MBE A;  1SL9 A;  2PSR A;  1TIZ A;  1XA5 A;  2WCF A;  1DJI A;  3O78 A;  4MSP A;  3EKJ A;  5I2L A;  3JTD C;  4FQO A;  2JTT A;  1BR4 B;  1DJY A;  1S5G Z;  3BOW B;  4A4C A;  5CSN A;  2M8U A;  4BY5 A;  1K2H A;  2LM5 A;  2K8M B;  2ISD A;  3V2L A;  3FWB A;  3S0D A;  1MXE A;  3DF0 B;  3AAK A;  1DJW A;  3LCP C;  1TUJ A;  3I5G C;  4PCW A;  1BR1 B;  3D75 A;  3FWC A;  3CTN A;  1BJF A;  3A8R A;  3K21 A;  3FIA A;  4MZJ A;  2PMY A;  2LMT A;  1C3Y A;  1DJZ A;  5ER4 X;  1QVI Y;  1QLK A;  1K9P A;  2CCM A;  4P2Y B;  5KSZ A;  3OX6 A;  3S0B A;  4XJK A;  1RFJ A;  1GGZ A;  1IQ3 A;  1C7V A;  1OOG A;  3CZ0 A;  1KK7 Z;  3O4Y A;  2OTG B;  4I5L B;  1R6P A;  2JNF A;  3CS1 A;  2L2E A;  2L4H A;  3DVK A;  2L0P A;  1KFX S;  1U5I A;  2JWW A;  4DRW A;  4OV2 A;  1Y1U A;  4PE1 A;  1XFU O;  3BUN B;  4PHM A;  5KU1 A;  1WRL A;  2AAO A;  1QIV A;  4WQ3 A;  4JQ0 D;  1K8U A;  4NQG A;  2K7C A;  5HKZ A;  4NDC A;  3BUW B;  3MSE B;  5CSI A;  1J1D A;  2Q91 A;  2JPO A;  1A75 A;  1RRO A;  4DUQ A;  1AHR A;  3TUY B;  5I94 A;  4GGF A;  2KHN A;  1NWD A;  3KF9 A;  1RK9 A;  1IGV A;  2YGU A;  1NYA A;  4FTG A;  5HL1 A;  3LK0 A;  5DKN A;  1QX7 A;  4P5O E;  2M9G A;  1C3Z A;  1SPY A;  2KFF A;  3VRR A;  1KFX L;  3BUM B;  4USL A;  1M63 B;  4GGF C;  4N1G A;  2JXC A;  4N5X A;  1KWO C;  4ETO A;  4JD9 A;  2GV5 A;  2FJU B;  1QAT A;  2F3Z A;  4PT1 A;  2QEH A;  2AMI A;  1DMO A;  2E30 A;  5G08 A;  1L2O B;  1PSR A;  3CZ2 A;  1CM1 A;  1Z4H A;  1KK7 Y;  2JUL A;  2FCE A;  1B7T Z;  1WRZ A;  3WNX B;  2ZN9 A;  1J7Q A;  4DS7 A;  2K60 A;  2K0J A;  2GGZ A;  3DYE A;  2KI4 C;  3TZ1 A;  3I5F C;  2BCB A;  2NZ0 A;  1LXF C;  3S0E A;  1IH0 A;  1ALW A;  2ZRT A;  3KHE A;  1CMG A;  2R2I A;  3IF7 A;  4UPG A;  1LS8 A;  1TRF A;  1LA0 A;  1KFU L;  1KQM C;  4MLW A;  5FI6 A;  2L2C A;  2I2R E;  1YRU B;  4CFQ A;  1PRW A;  1JC2 A;  2LP2 A;  1XFY O;  2F2O A;  2Y5I A;  2JXL A;  4KYN A;  1V1G A;  2JOJ A;  2ZKM X;  4YGD B;  3SG2 A;  2SAS A;  1AP4 A;  1BOC A;  1ZFS A;  1ZMZ A;  2MLF C;  3D10 A;  1CM4 A;  1J7R A;  3D77 A;  5J3X A;  2BKI B;  1X02 A;  5I2O A;  1DJG A;  3RZS A;  3CR5 X;  1CDP A;  1J1E A;  2MLE C;  2WCJ A;  3GK4 X;  1M31 A;  2MJW B;  3CZ1 A;  3JTD B;  1SKT A;  1NCX A;  1K93 D;  5CPV A;  1J7O A;  1JFJ A;  2GTE A;  1AUI B;  1OQP A;  2EC6 C;  3QME A;  3TDZ A;  2M7L A;  4F0Z B;  1M45 A;  1LIN A;  1OW4 A;  5I8N A;  1AJ5 A;  2ZFD A;  3LL8 B;  3OGN A;  1QVI Z;  1F4O A;  3PM8 A;  2KGB C;  3CDN A;  3I5G B;  4N1F A;  2CBL A;  2TN4 A;  4HSZ A;  2BEC A;  3BUO B;  1B7T Y;  4INX A;  1S26 D;  2D8N A;  1QWV A;  3SG4 A;  5AEQ A;  2JPT A;  4FQT A;  2ZN8 A;  3EKH A;  4GPL B;  4NDD A;  4C0K A;  1E8A A;  2Y1N A;  4QJ5 B;  4IL1 A;  2KDH A;  1PUL A;  1S6J A;  1KSM A;  1QIW A;  1QJT A;  1XFV O;  2FCD A;  5GQQ C;  3SIB A;  2A4J A;  3OX5 A;  1K9K A;  2BL0 C;  3B87 A;  3HCM A;  1PAL A;  1H4B A;  4XJK B;  1WLM A;  1UHH A;  2LVV A;  4TNC A;  3S0A A;  3NSK A;  1GM0 A;  1NIW A;  2I18 A;  3UO9 A;  2WCH A;  3PAL A;  2O60 A;  1U5I B;  2MAZ A;  2QAC A;  1SMG A;  1R2U A;  4DCK A;  4M2O A;  1EXR A;  1RWY A;  5DIC A;  2H8V A;  1YVH A;  1CFC A;  2WC6 A;  3NXA A;  1BOD A;  1JSA A;  2Y1M A;  1NX1 A;  1S36 A;  3SS3 A;  2ZND A;  1UUR A;  4JWQ A;  5AXI A;  3SS5 A;  1A75 B;  1DEL A;  3PJI A;  3ZNI A;  2PAL A;  3BYA A;  4NDB A;  1TOP A;  3PLF B;  1NCZ A;  4AOM A;  2LLS A;  1H8B A;  4F7F A;  1YUT A;  3OB2 B;  1AJ4 A;  1W7I B;  3VGO A;  1KWO B;  1AK8 A;  1XFX O;  1F8H A;  1SRA A;  2WND A;  1OMD A;  1MWN A;  2K2F A;  2KNE A;  3CGA A;  4CID A;  2HF5 A;  2MHH A;  1RJV A;  1LKJ A;  3CYZ A;  4PE4 A;  1SK6 D;  5HLV A;  1B1G A;  1TUZ A;  1HT9 A;  1GGW A;  3B7A A;  1TCO B;  2QEB A;  1JWD A;  1QS7 A;  5HKW A;  3EVU A;  1B4C A;  2ZNE A;  2KI4 B;  3GK1 A;  3KEV A;  2I94 A;  1OSA A;  3JVT C;  3I5F B;  2LC5 A;  2M97 A;  3Q8I A;  5I2Q A;  1QV0 A;  4WQ2 A;  2NLN A;  4INW A;  1M46 A;  1XYD A;  3PFV A;  1DVI A;  3O6B A;  2LE9 B;  2NCO A;  1KQM B;  3L47 A;  3VRQ A;  5DKQ A;  2BAP A;  4YI8 A; 
#chains in the Genus database with same CATH homology
 3FS7 A;  1UHI A;  4I5N B;  4WRI A;  1BF5 A;  1M39 A;  2JTZ A;  4YI9 A;  1CFF A;  4ZCV A;  1K9U A;  1ZAC A;  2K61 A;  2F8P A;  3H4S E;  2ZRS A;  1MHO A;  2JZI A;  4GGN A;  2WCB A;  1TNQ A;  1NCY A;  5JOL A;  2CTN A;  2JU0 A;  4AQI A;  2KGR A;  2LUC A;  3CZT X;  4ORB B;  1XFW O;  1OOJ A;  3C1V A;  1Y1A A;  1SNL A;  3AKB A;  4YRU A;  1JFK A;  2O5G A;  1YTZ C;  3NSL A;  4GNK B;  2EC6 B;  3A4U B;  4PE7 A;  2LCP A;  1DF0 A;  1ALV A;  4ORA B;  1IJ5 A;  2PVB A;  2LVK A;  3DVE A;  3GOF A;  1TNP A;  1UUS A;  2H61 A;  4ICB A;  1QAS A;  5B8I B;  2CNP A;  1XO5 A;  1JBA A;  1NUB A;  3CLN A;  3TDU A;  2EHB A;  1BLQ A;  3VRO A;  3WHU B;  1YR5 A;  1UHN A;  1ZOT B;  3CWG A;  4MRX A;  4CFR A;  2OS8 C;  2VRG A;  2H61 C;  4U8D A;  4GUK A;  4ORC B;  1QV1 A;  2IS9 A;  1TNW A;  4HRG A;  3AKA A;  1CLB A;  1F54 A;  2BL0 B;  3DVM A;  2K7B A;  2KSP A;  1B47 A;  1TCF A;  1DGV A;  5PAL A;  5HKY A;  1CKK A;  5ER5 A;  1JUO A;  1SR6 C;  3F45 A;  2E6W A;  1PVA A;  2KI6 C;  1WDC C;  2KBI A;  3EVV A;  1VRK A;  1V1F A;  1NX2 A;  5HYD A;  2MRD A;  4PHN A;  2H2K A;  2I7A A;  2WOS A;  2BBN A;  1DJH A;  1LVC D;  1JF0 A;  1GQM A;  3KPX A;  1OMR A;  1UWO A;  2CT9 A;  1DGU A;  1D1O A;  3VRP A;  2JRF A;  5CSJ A;  1XVJ A;  1C07 A;  3I5I C;  1OMV A;  1BG1 A;  1CDL A;  1EG4 A;  1K94 A;  1IG5 A;  4D1E A;  1S6I A;  1Y0V H;  4MZL A;  1FW4 A;  1WY9 A;  2BE6 A;  4I5K A;  1KK8 C;  2EGD A;  2LLU A;  1EH2 A;  1B9A A;  1QLS A;  1FF1 A;  2KFH A;  2V53 A;  2BCA A;  2LMV A;  1NPQ A;  3D0Y A;  1N2D A;  1Q80 A;  2HQW A;  1F55 A;  4CPV A;  3OP0 A;  3SG6 A;  1HQV A;  3CR2 A;  3JVT B;  1SBJ A;  2Q4U A;  4BY4 A;  1F71 A;  2RGI A;  3AAJ A;  2M1U A;  2LAP A;  4GAO A;  1GJY A;  2MBX A;  4I5J A;  1FBV A;  1S1E A;  4OKH A;  1A03 A;  4PE0 A;  1Y1X A;  1K95 A;  1EL4 A;  4MN0 A;  3SG3 A;  5TNC A;  1CDN A;  4GBA A;  2BKH B;  1REC A;  4M2Q A;  3ZWH A;  1YUR A;  3IQQ A;  3OHM B;  1G33 A;  3PN7 C;  1BU3 A;  1MXL C;  2SCP A;  2LLT A;  1CFD A;  1PVB A;  1YX7 A;  5BPJ A;  3DVJ A;  1SW8 A;  2NCP A;  2BE4 A;  1UHK A;  1BMO A;  2KQ6 A;  1YX8 A;  2QPT A;  1L7Z A;  2JT0 A;  3PSR A;  4PHK A;  3CR4 X;  4OCI A;  5CSF A;  1DTL A;  1C7W A;  1QX2 A;  4HRE E;  4YGC B;  3QRX A;  3WXA A;  2COL B;  3TS5 C;  2K2A A;  2M29 A;  4MEW A;  1RTP 1;  4CLN A;  1OZO A;  4A4B A;  1CDM A;  3I5H C;  2WC8 A;  3BQ3 A;  2LP3 A;  2HQ8 A;  1UHJ A;  3M0W A;  1FI5 A;  3SIA A;  5K89 A;  4PDZ A;  3NSO A;  5JJG A;  1WLZ A;  1Y6W A;  1YRT B;  1YUU A;  1DF0 B;  1B8R A;  2BCX A;  3EK4 A;  2KBM A;  2OS8 B;  5D7F A;  1FI6 A;  2JNX A;  2L50 A;  2LVI A;  1CB1 A;  1PSB A;  1XFZ O;  2LUX A;  5HLO A;  5KTY A;  1YUS A;  5AER A;  4YGA A;  1SCM C;  2G2B A;  3BOW A;  1SL8 A;  2OPO A;  1SL7 A;  5DKR A;  2P6B B;  1S6C A;  5AFP A;  2HET A;  1WRK A;  2JC2 A;  2B1U A;  1SR6 B;  3O2P A;  2JT8 A;  3DF0 A;  1J55 A;  2LVJ A;  2KAX A;  3VRN A;  1WDC B;  1NSH A;  5AAN A;  3EK8 A;  1QTX A;  1CLL A;  1UP5 A;  2M0R A;  1QXP A;  4AQJ A;  1S5G Y;  1DT7 B;  2KYC A;  1MUX A;  1EG3 A;  1QX5 B;  2JT3 A;  1EJ3 A;  1SYM A;  1IQ5 A;  3NSI A;  1TN4 A;  3I5I B;  2PAS A;  1KQV A;  4QJ4 B;  2KYF A;  4C0L A;  1CTR A;  1KFU S;  2L5X B;  2LV7 A;  1NP8 A;  2MA2 A;  1OZS A;  3PAT A;  4YBH B;  2OTG C;  1KK8 B;  2KOT A;  3SJS A;  2CXJ A;  2JQ6 A;  1A4P A;  4PAL A;  1G4Y R;  2L51 A;  2NXQ A;  3HX4 A;  1MR8 A;  1MF8 B;  3DD4 A;  1CNP A;  1KSO A;  5FYX A;  1F70 A;  1A2X A;  3BUX B;  3GK2 A;  2FOT A;  2PRU A;  3SG7 A;  4OVN F;  4XYN A;  2WOR A;  4R1E A;  2L4I A;  1IJ6 A;  1KCY A;  2G9B A;  4M2P A;  2LAN A;  4QJ3 B;  4E68 A;  1J7P A;  2KFG A;  2KAV A;  4L9M A;  3D0Y B;  1YVL A;  1IWQ A;  3TUY C;  1B8C A;  1MQ1 A;  2L98 A;  4HRH A;  3OB1 B;  3WHT B;  3TDI A;  1SY9 A;  4MZK A;  1G8I A;  1N65 A;  2KI6 D;  2Y4Q A;  4C0J A;  4YGB B;  4PHJ A;  1K90 D;  3ICB A;  3RLZ A;  3RM1 A;  3PN7 B;  5D69 A;  1NX3 A;  1W7J B;  1FPW A;  1ODB A;  1N0Y A;  2KAY A;  3EK7 A;  2KQY A;  3KO0 A;  4GFT A;  2F2P A;  1L2O C;  2GGM A;  1CLM A;  1A29 A;  2LMU A;  4YGE B;  2K7D A;  3TS5 B;  1S3P A;  1AVS A;  2DOQ A;  2AUC A;  1XK4 A;  2F33 A;  1TTX A;  4MVF A;  5F6T A;  3I5H B;  5IBW A;  3EVR A;  2K7O A;  4MRY A;  3SG5 A;  1F4Q A;  3LLE A;  2WCE A;  4OR9 B;  3LK1 A;  3BXK A;  1SCV A;  2BBM A;  1IRJ A;  1XK4 C;  4DIR A;  2LHI A;  1BT6 A;  1OE9 B;  1PK0 D;  2LNK A;  3E3R A;  1TNX A;  2LHL A;  1LA3 A;  1CFP A;  4Q04 A;  4JPZ B;  1DJX A;  1NX0 A;  1CMF A;  1K96 A;  2M3W A;  2F3Y A;  3IQO A;  1ZUZ A;  2M1K B;  1SCM B;  1IKU A;  2M7N A;  2M49 B;  4MBE A;  1B8L A;  2HPS A;  1JF2 A;  1SL9 A;  2PSR A;  1TIZ A;  1XA5 A;  2WCF A;  1DJI A;  3O78 A;  4MSP A;  3EKJ A;  5I2L A;  3JTD C;  4FQO A;  2JTT A;  1BR4 B;  1DJY A;  1S5G Z;  3BOW B;  4A4C A;  5CSN A;  2M8U A;  4BY5 A;  1K2H A;  2LM5 A;  2K8M B;  2ISD A;  3FWB A;  1MXE A;  3DF0 B;  3AAK A;  1DJW A;  3LCP C;  3I5G C;  4PCW A;  1BR1 B;  3FWC A;  3CTN A;  1BJF A;  3A8R A;  3K21 A;  3FIA A;  4MZJ A;  2PMY A;  2LMT A;  1DJZ A;  5ER4 X;  1QVI Y;  1QLK A;  1K9P A;  2CCM A;  4P2Y B;  5KSZ A;  3OX6 A;  4XJK A;  1RFJ A;  1GGZ A;  1IQ3 A;  1C7V A;  1KK7 Z;  3O4Y A;  2OTG B;  4I5L B;  1R6P A;  2JNF A;  3CS1 A;  2L2E A;  2L4H A;  3DVK A;  2L0P A;  1KFX S;  1U5I A;  2JWW A;  4DRW A;  4OV2 A;  1Y1U A;  4PE1 A;  1XFU O;  3BUN B;  4PHM A;  5KU1 A;  1WRL A;  2AAO A;  1QIV A;  4WQ3 A;  4JQ0 D;  1K8U A;  4NQG A;  2K7C A;  5HKZ A;  4NDC A;  3BUW B;  3MSE B;  5CSI A;  1J1D A;  2Q91 A;  1A75 A;  1RRO A;  4DUQ A;  1AHR A;  3TUY B;  4GGF A;  2KHN A;  1NWD A;  3KF9 A;  1RK9 A;  1IGV A;  1NYA A;  4FTG A;  3LK0 A;  5DKN A;  1QX7 A;  4P5O E;  2M9G A;  1SPY A;  2KFF A;  3VRR A;  1KFX L;  3BUM B;  4USL A;  1M63 B;  4GGF C;  4N1G A;  2JXC A;  4N5X A;  1KWO C;  4ETO A;  2GV5 A;  2FJU B;  1QAT A;  2F3Z A;  2AMI A;  1DMO A;  2E30 A;  5G08 A;  1L2O B;  1PSR A;  1CM1 A;  2JUL A;  1KK7 Y;  2FCE A;  1B7T Z;  1WRZ A;  3WNX B;  2ZN9 A;  1J7Q A;  4DS7 A;  2K0J A;  2GGZ A;  2KI4 C;  3TZ1 A;  3I5F C;  2BCB A;  2NZ0 A;  1LXF C;  1IH0 A;  1ALW A;  2ZRT A;  3KHE A;  1CMG A;  2R2I A;  3IF7 A;  4UPG A;  1TRF A;  1LA0 A;  1KFU L;  1KQM C;  4MLW A;  2I2R E;  1YRU B;  4CFQ A;  1PRW A;  1JC2 A;  2LP2 A;  1XFY O;  2F2O A;  2Y5I A;  2JXL A;  4YGD B;  1V1G A;  2JOJ A;  2ZKM X;  3SG2 A;  2SAS A;  1AP4 A;  1BOC A;  1ZFS A;  1ZMZ A;  2MLF C;  3D10 A;  1CM4 A;  1J7R A;  5J3X A;  2BKI B;  1X02 A;  5I2O A;  1DJG A;  3CR5 X;  1CDP A;  1J1E A;  2MLE C;  3GK4 X;  1M31 A;  2MJW B;  3JTD B;  1SKT A;  1NCX A;  1K93 D;  5CPV A;  1J7O A;  1JFJ A;  1AUI B;  1OQP A;  2EC6 C;  3TDZ A;  4F0Z B;  2M7L A;  1M45 A;  1LIN A;  5I8N A;  1AJ5 A;  2ZFD A;  3LL8 B;  1QVI Z;  1F4O A;  3PM8 A;  2KGB C;  3I5G B;  4N1F A;  2CBL A;  2TN4 A;  4HSZ A;  2BEC A;  3BUO B;  1B7T Y;  1S26 D;  2D8N A;  3SG4 A;  5AEQ A;  2JPT A;  2ZN8 A;  3EKH A;  4GPL B;  4NDD A;  4C0K A;  1E8A A;  2Y1N A;  4QJ5 B;  4IL1 A;  2KDH A;  1PUL A;  1S6J A;  1KSM A;  1QIW A;  1QJT A;  1XFV O;  2FCD A;  5GQQ C;  3SIB A;  2A4J A;  3OX5 A;  1K9K A;  2BL0 C;  3HCM A;  1PAL A;  1H4B A;  4XJK B;  1WLM A;  1UHH A;  2LVV A;  4TNC A;  3NSK A;  1NIW A;  2I18 A;  3PAL A;  2O60 A;  1U5I B;  2MAZ A;  2QAC A;  1SMG A;  1R2U A;  4DCK A;  4M2O A;  1EXR A;  1RWY A;  1YVH A;  1CFC A;  3NXA A;  1BOD A;  1JSA A;  2Y1M A;  1NX1 A;  1S36 A;  2ZND A;  1UUR A;  4JWQ A;  5AXI A;  1A75 B;  3ZNI A;  2PAL A;  3BYA A;  4NDB A;  1TOP A;  3PLF B;  1NCZ A;  4AOM A;  2LLS A;  1H8B A;  1YUT A;  3OB2 B;  1AJ4 A;  1W7I B;  3VGO A;  1KWO B;  1AK8 A;  1XFX O;  1F8H A;  1SRA A;  2WND A;  1OMD A;  1MWN A;  2K2F A;  2KNE A;  3CGA A;  4CID A;  2HF5 A;  2MHH A;  1RJV A;  1LKJ A;  4PE4 A;  1SK6 D;  5HLV A;  1B1G A;  1HT9 A;  1GGW A;  1TCO B;  1JWD A;  1QS7 A;  5HKW A;  3EVU A;  1B4C A;  2ZNE A;  2KI4 B;  3GK1 A;  3KEV A;  2I94 A;  1OSA A;  3JVT C;  3I5F B;  2LC5 A;  2M97 A;  4ZCU A;  5I2Q A;  1QV0 A;  4WQ2 A;  2NLN A;  1M46 A;  1XYD A;  3PFV A;  1DVI A;  3O6B A;  2LE9 B;  2NCO A;  1KQM B;  3VRQ A;  5DKQ A;  4YI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...