2H61C

X-ray structure of human ca2+-loaded s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein, signaling protein
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 90
sequence length 90
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61C00
4YGAA 3A8RA 1OZOA 1B47A 4GFTA 2LAPA 4FQOA 1F55A 5ER4X 1TIZA 1YUUA 2F3YA 1CNPA 1DJYA 2O60A 4MSPA 1Y1XA 3LCPC 2JT8A 2LVKA 1M46A 3LK1A 1SL7A 1NP8A 1SR6B 3I5FC 3LLEA 1PULA 5CSNA 1EL4A 1PVBA 4ORBB 4MEWA 5BPJA 1TNQA 2FCEA 2KFFA 1AJ5A 3CR4X 1UUSA 1UURA 1F4QA 3BQ3A 3I5GB 2FCDA 2MHHA 3PFVA 1CDMA 4XJKA 1SKTA 1RJVA 3RM1A 1EG4A 2JT0A 1GQMA 4CFRA 1NUBA 2KGRA 3OP0A 2SCPA 1MXLC 1ZOTB 3I5IB 1ZUZA 1N2DA 4I5LB 1JUOA 1B9AA 1YVLA 1CM1A 2KI4B 1G33A 5HKYA 4IL1A 4CPVA 1U5IB 1CMFA 1KFUS 2EC6B 1RWYA 1S6IA 1V1GA 4OR9B 2KAYA 5AEQA 4C0JA 4YGEB 1UHNA 1KK8B 5B8IB 1H4BA 1NCYA 1WLZA 2HETA 1YRTB 4GUKA 2B1UA 3DD4A 4WRIA 2H2KA 3FWCA 5HKWA 5J3XA 4C0LA 2ZN9A 4DUQA 2L2EA 5AERA 2JT3A 1XFUO 1CB1A 2KBMA 1SL8A 1SR6C 3PATA 1WDCB 4GAOA 4OKHA 2MA2A 3TDZA 1JC2A 1BOCA 1Y6WA 1YR5A 1JFJA 2MAZA 1IH0A 2KFGA 2JNXA 4WQ2A 3VGOA 2L5XB 3I5GC 2F2OA 5I8NA 3DVJA 1NX3A 2OS8B 5I2LA 1RK9A 4PE0A 1MUXA 5DKQA 2WCEA 5AFPA 1IJ5A 2BE4A 1QV0A 2PMYA 1JSAA 1CM4A 5KSZA 1OMRA 1S5GY 1ZACA 3FIAA 3O6BA 1CFFA 1CDPA 4DIRA 3VROA 3TUYB 1CFCA 3BYAA 3I5IC 5D69A 1B8LA 1K9UA 1S5GZ 2KI4C 1QVIY 1FW4A 2CBLA 5AXIA 2E6WA 2M3WA 2EC6C 2KI6C 1QX2A 4N1FA 2LNKA 1M31A 2VRGA 4CIDA 2CT9A 1KK8C 1DJZA 2LVIA 1TNXA 5DKRA 1FI5A 2HQWA 1WLMA 1YRUB 3BUNB 4MLWA 4MZJA 1M39A 1XK4A 2BKIB 1C7VA 2JWWA 1CLBA 1TOPA 4ETOA 3I5FB 4XJKB 3HX4A 1QLKA 1S36A 4P5OE 2GV5A 3AAJA 2KBIA 4MRXA 1UWOA 5I2QA 1M45A 4PALA 1KFXL 1YUSA 3EK4A 4PCWA 2I94A 1AP4A 1R2UA 1F70A 1KQVA 1IWQA 1OMVA 2BCBA 3EK8A 2M7LA 2PALA 3OX6A 1QIVA 1B4CA 5F6TA 2E30A 1QATA 4F0ZB 2OS8C 4I5NB 4OV2A 2BL0B 1J7RA 1DT7B 4GGFC 1AK8A 2M0RA 1B8RA 3BUMB 4ZCUA 1OE9B 1KCYA 5CSFA 3NSKA 2K7BA 1JF0A 4NDCA 2F3ZA 3TUYC 3SJSA 1M63B 1K8UA 2Y4QA 2I7AA 4U8DA 2WCBA 4GGFA 2NXQA 3DVEA 1TCOB 2KQYA 2BCAA 4OVNF 2M8UA 4I5KA 1CDLA 1MWNA 2TN4A 1SCVA 2L50A 1KSOA 2K0JA 2WORA 1MQ1A 1F4OA 2JU0A 4PE7A 3EVUA 4YGBB 1S26D 3LK0A 5G08A 2CTNA 3MSEB 1YTZC 1SCMC 1PSBA 4XYNA 1CFPA 2ZFDA 4GGNA 1C7WA 3F45A 3M0WA 2F2PA 2GGMA 3QRXA 1YVHA 2LM5A 3SIAA 1PVAA 5GQQC 4YGDB 4NDBA 2JZIA 3EVVA 4M2OA 2LUXA 4ICBA 1W7JB 4E68A 1KFXS 2I18A 1DMOA 2AMIA 4ORCB 2KAVA 1Y1UA 3PLFB 3TS5B 1NX0A 4MVFA 1BR4B 1JFKA 5TNCA 2EGDA 1DJXA 2FJUB 2Y5IA 1B8CA 2BL0C 3NSLA 1PK0D 4N1GA 5IBWA 1KWOB 5CSIA 1OSAA 1BT6A 1K95A 1RROA 5HLOA 4DRWA 3O78A 1JBAA 2KOTA 3GK1A 1CDNA 3JVTB 3WNXB 3SIBA 5ER5A 1ODBA 1J7PA 2LMUA 3CR2A 2LLTA 1N0YA 1Y1AA 3WXAA 3DF0A 3C1VA 3JTDC 1NWDA 3GOFA 1CLMA 2COLB 5DKNA 5KTYA 4FTGA 2NLNA 2LANA 3OB1B 4GNKB 1YX8A 1JWDA 1NSHA 1B1GA 2LMVA 2K7OA 4QJ5B 3SG4A 1UHHA 2JC2A 2LUCA 3GK4X 5AANA 1IQ5A 1K96A 2LHLA 2Q4UA 2LP3A 1F71A 3ZWHA 1J55A 2L98A 1S1EA 3TS5C 3E3RA 2OTGC 2JTTA 2BBNA 1CMGA 3KHEA 2K7DA 3PALA 1QV1A 2RGIA 2LLSA 2OPOA 1KWOC 1OMDA 4JPZB 4UPGA 4PE4A 2ZKMX 4MBEA 1J1EA 1K9PA 2JXLA 1XK4C 3CS1A 2PVBA 2KQ6A 2WC8A 1UP5A 2M49B 3HCMA 4MRYA 3JVTC 1K93D 3BOWA 2ZRSA 3CTNA 1K2HA 2K8MB 2HPSA 4BY5A 2LP2A 4TNCA 4HRHA 4ORAB 2KNEA 2LVJA 2KSPA 1E8AA 3BUXB 4NDDA 1SCMB 1L7ZA 1V1FA 3BXKA 1S6CA 2AUCA 3VRQA 1DF0A 1Q80A 1MF8B 1S3PA 1GGWA 1L2OB 1MHOA 1QIWA 1AVSA 1BR1B 1RFJA 1F54A 2ZRTA 2K61A 2Q91A 1MXEA 2V53A 1B7TZ 2CXJA 2KYCA 2NCPA 2FOTA 4N5XA 3VRRA 1EJ3A 2HQ8A 3A4UB 1QXPA 2CNPA 4A4CA 2WCFA 1J7QA 2ZN8A 3EKJA 4CLNA 2KAXA 3I5HC 3PM8A 1ALVA 3DF0B 2EHBA 1GGZA 2BECA 3PSRA 1AHRA 1A75A 1QX5B 2LVVA 1BU3A 1LINA 2LLUA 3DVMA 1K94A 1DVIA 2JTZA 2DOQA 3WHTB 1GJYA 3JTDB 1YURA 4HSZA 1SL9A 3CGAA 4C0KA 1LA0A 1SRAA 2A4JA 3NSIA 1XA5A 1HQVA 3KPXA 1OZSA 2ZNEA 2KFHA 1WY9A 2ISDA 2LE9B 1EH2A 3NXAA 4WQ3A 2F33A 1EG3A 2MJWB 4L9MA 4AQIA 1CFDA 3IF7A 1DJHA 2JPTA 1L2OC 1QS7A 1BJFA 2IS9A 1CLLA 3VRPA 1IQ3A 1CTRA 2MBXA 4PHJA 2LHIA 3AKAA 2OTGB 4MN0A 1J1DA 2H61A 1K90D 3SG2A 1CKKA 1NYAA 3O4YA 1C07A 3FWBA 5KU1A 2PRUA 3TZ1A 1KQMB 2M29A 3IQOA 3BOWB 1G8IA 1QTXA 2L4IA 3SG7A 2L4HA 1XYDA 3PN7B 2MLFC 1EXRA 2SASA 2ZNDA 1A29A 2QPTA 1XFXO 1TNPA 1R6PA 4D1EA 1NX2A 2O5GA 3AKBA 3CR5X 3DVKA 4OCIA 2L0PA 3D0YB 3FS7A 3CZTX 1OOJA 3CWGA 1FF1A 3VRNA 1DF0B 1KSMA 3OHMB 4PE1A 1NPQA 4M2PA 1HT9A 2K7CA 3BUWB 1IG5A 3BUOB 2KHNA 1XO5A 4JWQA 5D7FA 2PSRA 4PHMA 1JF2A 1KK7Y 2LMTA 1NCXA 2M7NA 1XFYO 4YI9A 1XFVO 2G9BA 1FPWA 1DJIA 1SK6D 3KEVA 1BG1A 2LV7A 2PASA 4AQJA 5PALA 4CFQA 3ZNIA 2G2BA 4DCKA 2BBMA 1KK7Z 1SY9A 5HYDA 4USLA 2BCXA 1TRFA 1XFZO 2LCPA 1UHJA 3GK2A 4YBHB 1QX7A 4QJ3B 2NCOA 1A75B 1SW8A 2LC5A 1G4YR 2CCMA 2Y1NA 3EVRA 1A03A 3SG6A 3LL8B 3TDUA 5I2OA 4MZKA 3I5HB 1KQMC 1BF5A 2WOSA 4P2YB 3IQQA 1H8BA 1BODA 3PN7C 4QJ4B 4Q04A 3ICBA 1RTP1 1UHIA 2I2RE 1DGVA 2MRDA 2M1KB 1AUIB 1ZFSA 1LKJA 1IGVA 2JQ6A 2KGBC 1LVCD 1NIWA 1QLSA 4I5JA 1YUTA 1TCFA 1NCZA 3AAKA 2M1UA 3K21A 2P6BB 1WRKA 1TNWA 1W7IB 4PDZA 1TTXA 3EKHA 5JJGA 4YRUA 3EK7A 1VRKA 2JXCA 2NZ0A 2QACA 3D0YA 1IKUA 1N65A 2KI6D 4NQGA 2MLEC 1B7TY 1PALA 1FBVA 4JQ0D 1DJWA 1RECA 4YGCB 5FYXA 2M9GA 1AJ4A 5HLVA 1SBJA 3SG3A 2WNDA 3KO0A 2F8PA 2JOJA 1BMOA 5JOLA 1X02A 1LA3A 5K89A 1XVJA 2HF5A 4YI8A 1FI6A 1QVIZ 3SG5A 1DTLA 2BE6A 1PRWA 2GGZA 3O2PA 1BLQA 5HKZA 2JNFA 1SPYA 1DJGA 3H4SE 2K2AA 1UHKA 1U5IA 1K9KA 1IJ6A 5CSJA 1NX1A 4PHNA 4GBAA 1LXFC 4M2QA 2L51A 1WDCC 1QASA 1PSRA 2AAOA 2BKHB 4MZLA 1DGUA 2M97A 1OQPA 2D8NA 4BY4A 1SNLA 1D1OA 3KF9A 4HREE 4HRGA 1QJTA 3D10A 1F8HA 1A2XA 3RLZA 2K2FA 4PHKA 1A4PA 1WRLA 2JULA 1TN4A 2JRFA 1ALWA 1Y0VH 1SYMA 4ZCVA 3OB2B 4A4BA 1WRZA 1ZMZA 2KDHA 1J7OA 5CPVA 1MR8A 2Y1MA 4DS7A 1S6JA 1IRJA 4GPLB 2KYFA 3OX5A 1KFUL 2H61C 2R2IA 1YX7A 3NSOA 1SMGA 3WHUB 4R1EA 3TDIA 1XFWO 4AOMA 3CLNA
chains in the Genus database with same CATH superfamily
4YGAA 3A8RA 1OZOA 1GM0A 3K1EA 1B47A 4GFTA 2LAPA 1C3YA 4FQOA 1F55A 5ER4X 1TIZA 1YUUA 2F3YA 3QMEA 1CNPA 1DJYA 2O60A 4MSPA 1Y1XA 3SS5A 3LCPC 2JT8A 2LVKA 1M46A 3LK1A 3BFHA 3S0AA 1SL7A 1NP8A 1SR6B 3FE6A 3I5FC 3LLEA 1PULA 5CSNA 1EL4A 1PVBA 3EG5B 4ORBB 4MEWA 5BPJA 3D75A 1TNQA 2FCEA 2KFFA 1AJ5A 3CR4X 1UUSA 1UURA 1F4QA 3BQ3A 3I5GB 2FCDA 2MHHA 3PFVA 1CDMA 4XJKA 1SKTA 1RJVA 3RM1A 1EG4A 2JT0A 1GQMA 4IJ7A 4CFRA 1NUBA 2KGRA 3OP0A 2SCPA 1MXLC 1ZOTB 3CZ0A 1ZUZA 1N2DA 3I5IB 4I5LB 5FI7A 1JUOA 1B9AA 1YVLA 1CM1A 2KI4B 3B7AA 3CABA 1G33A 5HL1A 4IL1A 5HKYA 4CPVA 1U5IB 1CMFA 1KFUS 2EC6B 1RWYA 1S6IA 1V1GA 4OR9B 2KAYA 5AEQA 4C0JA 4YGEB 1UHNA 1KK8B 3D76A 5B8IB 1H4BA 1NCYA 1WLZA 2HETA 1YRTB 4GUKA 1W9ZA 2B1UA 3DD4A 4WRIA 2H2KA 3FWCA 5HKWA 5J3XA 4C0LA 2ZN9A 4DUQA 2L2EA 5AERA 2JT3A 1XFUO 1CB1A 4JD9A 2KBMA 1SL8A 3UNWA 1SR6C 3PATA 1WDCB 4GAOA 1TUJA 4OKHA 2MA2A 3TDZA 1JC2A 1BOCA 1Y6WA 1YR5A 2P70A 2MAZA 1JFJA 2KFGA 1IH0A 2JNXA 4WQ2A 3VGOA 2L5XB 3L4LA 3I5GC 2F2OA 5I8NA 3DVJA 1NX3A 2OS8B 5I2LA 1RK9A 4PE0A 1MUXA 5DKQA 1C3ZA 2WCEA 5AFPA 1IJ5A 2BE4A 1QV0A 2PMYA 1DC1A 1JSAA 1CM4A 5KSZA 3NGVA 1OMRA 1S5GY 1ZACA 3FIAA 3O6BA 1CFFA 1CDPA 4DIRA 3VROA 3TUYB 1OOGA 1CFCA 3BYAA 3I5IC 5D69A 2BNXA 1B8LA 1K9UA 1S5GZ 2KI4C 1QVIY 1FW4A 2CBLA 5AXIA 2E6WA 2M3WA 2EC6C 2KI6C 1QX2A 4N1FA 3RZSA 2LNKA 1M31A 2VRGA 4CIDA 2CT9A 1KK8C 1DJZA 2LVIA 1TNXA 3S0EA 5DKRA 1FI5A 2HQWA 1OOHA 1WLMA 1YRUB 3BUNB 4MLWA 1M39A 1XK4A 4MZJA 2BKIB 2PYQA 2JWWA 3D74A 3CZ2A 1TOPA 1C7VA 1CLBA 4ETOA 3I5FB 3CYZA 1SSEB 4XJKB 3HX4A 1QLKA 1S36A 4P5OE 3NHIA 2GV5A 3AAJA 2KBIA 4MRXA 1UWOA 5I2QA 1M45A 4PALA 1KFXL 1YUSA 3EK4A 4PCWA 2I94A 1AP4A 1R2UA 1F70A 1KQVA 2P71A 1IWQA 1OMVA 2BCBA 3EK8A 2M7LA 2PALA 3OX6A 1ORGA 1QIVA 1B4CA 5F6TA 2E30A 1QATA 4F0ZB 2OS8C 4I5NB 4OV2A 2BL0B 1J7RA 1P28A 4GGFC 1DT7B 1AK8A 2M0RA 1B8RA 3BUMB 4ZCUA 1OE9B 1KCYA 5CSFA 3NSKA 2K7BA 1JF0A 4NDCA 2F3ZA 3TUYC 3SJSA 1M63B 1K8UA 2Y4QA 2I7AA 4U8DA 2WCBA 4GGFA 2NXQA 3DVEA 1TCOB 2KQYA 2BCAA 4OZDA 4OVNF 2M8UA 4I5KA 1CDLA 1MWNA 2TN4A 1SCVA 2L50A 1KSOA 2K0JA 4KYNA 2WORA 1MQ1A 1F4OA 2JU0A 4PE7A 3EVUA 4YGBB 1S26D 3LK0A 5G08A 2CTNA 3MSEB 2H8VA 1YTZC 2K60A 3R1VA 1SCMC 1PSBA 4XYNA 1CFPA 2ZFDA 4GGNA 1C7WA 3F45A 3M0WA 2F2PA 2GGMA 3QRXA 1YVHA 2L5YA 2LM5A 4JKTA 1PVAA 5GQQC 3SIAA 4YGDB 4NDBA 3CZ1A 2JZIA 3EVVA 4M2OA 2LUXA 4ICBA 1W7JB 4E68A 1KFXS 3BJHA 2I18A 1DMOA 2AMIA 4ORCB 2KAVA 1Y1UA 3PLFB 3TS5B 1NX0A 4MVFA 1BR4B 1JFKA 5TNCA 2EGDA 1DJXA 2FJUB 2Y5IA 1B8CA 2BL0C 3NSLA 1Z2CB 1PK0D 2YGUA 4N1GA 2WC5A 5IBWA 1KWOB 5CSIA 1OSAA 1BT6A 1K95A 1QWVA 1RROA 3NHTA 3N7HA 5HLOA 3O78A 4DRWA 1JBAA 2KOTA 3GK1A 1CDNA 3JVTB 2KPHA 3SIBA 5ER5A 1ODBA 3WNXB 2LMUA 5I94A 1J7PA 3CR2A 3VB1A 3O4XA 2LLTA 1N0YA 1Y1AA 3WXAA 3DF0A 3C1VA 3Q8IA 3JTDC 1NWDA 2GTEA 3GOFA 3V2LA 1LS8A 2BAPA 1CLMA 2COLB 5DKNA 5KTYA 4FTGA 2NLNA 2LANA 3OB1B 4GNKB 1YX8A 1JWDA 1NSHA 1B1GA 2LMVA 2K7OA 4QJ5B 3SG4A 1UHHA 4F7FA 2JC2A 2LUCA 3GK4X 5AANA 1IQ5A 1K96A 2LHLA 3S0DA 1OOIX 2QEOA 2Q4UA 2LP3A 1F71A 3ZWHA 1J55A 2L98A 1S1EA 3TS5C 3E3RA 2OTGC 5D3OA 2JTTA 2BBNA 1CMGA 3KHEA 2K7DA 3B6XA 2QEVA 3PALA 1QV1A 2RGIA 2LLSA 2OPOA 1KWOC 1OMDA 4JPZB 3D77A 4UPGA 4PE4A 2ZKMX 4MBEA 1J1EA 1K9PA 2JXLA 1XK4C 3CS1A 2PVBA 2KQ6A 2WC8A 1UP5A 2M49B 3HCMA 4MRYA 3BFAA 1K93D 3JVTC 3S0FA 3BOWA 3FE9A 2KLDA 2ZRSA 3CTNA 1K2HA 2K8MB 2HPSA 4BY5A 2LP2A 4TNCA 4HRHA 3DY9A 4ORAB 3B86A 2KNEA 2LVJA 2KSPA 1E8AA 3BUXB 4NDDA 1SCMB 3DZTA 2WC6A 1L7ZA 1V1FA 3BXKA 1S6CA 2AUCA 3VRQA 1DF0A 1Q80A 1MF8B 1S3PA 3S0BA 1GGWA 1L2OB 1MHOA 1QIWA 1AVSA 1BR1B 1RFJA 1F54A 2ZRTA 2K61A 2Q91A 1MXEA 2V53A 1B7TZ 2CXJA 2KYCA 3D78A 2NCPA 2FOTA 4N5XA 3VRRA 1EJ3A 2HQ8A 3DXLA 3A4UB 3L47A 1QXPA 2CNPA 4A4CA 2WCFA 1J7QA 2ZN8A 3D73A 3EKJA 4CLNA 2KAXA 3I5HC 3PM8A 1ALVA 3DF0B 2EHBA 1GGZA 2BECA 3PSRA 1DELA 1AHRA 3OBVA 1A75A 1QX5B 2LVVA 1BU3A 1LINA 2LLUA 3DVMA 5EL2A 1K94A 3FE8A 1DVIA 2JTZA 2DOQA 2WCKA 3WHTB 1GJYA 3JTDB 1YURA 4HSZA 4INWA 1SL9A 3CGAA 4C0KA 1LA0A 1SRAA 2A4JA 3NSIA 2L2CA 1XA5A 1HQVA 3KPXA 1OZSA 2ZNEA 2KFHA 1WY9A 2ISDA 2LE9B 1EH2A 3NXAA 4WQ3A 2F33A 1EG3A 2MJWB 4L9MA 4AQIA 1CFDA 3IF7A 1DJHA 2JPTA 1L2OC 1QS7A 1BJFA 2IS9A 2KLEA 3R1OA 1CLLA 3VRPA 1IQ3A 1CTRA 2MBXA 4PHJA 2LHIA 3AKAA 2OTGB 1T14A 4MN0A 1J1DA 2H61A 1K90D 3CDNA 3SG2A 1CKKA 1NYAA 3O4YA 1C07A 3FWBA 5KU1A 2PRUA 3TZ1A 1KQMB 2M29A 3IQOA 3BOWB 1G8IA 1QTXA 2L4IA 3SG7A 2L4HA 3BFBA 1XYDA 3PN7B 3R72A 2MLFC 1EXRA 2SASA 2ZNDA 1A29A 2QPTA 1XFXO 3DYEA 1TNPA 1R6PA 4D1EA 1NX2A 3S0GA 2O5GA 3AKBA 3CR5X 3B87A 3DVKA 2L0PA 3D0YB 3FS7A 3CZTX 1OOJA 3CWGA 4OCIA 1FF1A 3SS3A 3VRNA 1DF0B 1KSMA 3OHMB 4PE1A 1NPQA 4M2PA 1HT9A 2K7CA 3BUWB 1IG5A 3BUOB 2KHNA 1XO5A 4JWQA 5D7FA 1TUZA 2PSRA 4PHMA 1JF2A 1KK7Y 1OW4A 1NCXA 2LMTA 1XFYO 2M7NA 4YI9A 1XFVO 2G9BA 1FPWA 1DJIA 1SK6D 3KEVA 1BG1A 2LV7A 2PASA 2QEBA 5PALA 4AQJA 3ZNIA 2G2BA 4CFQA 4DCKA 2BBMA 1KK7Z 1SY9A 5HYDA 3UO9A 4USLA 2BCXA 1TRFA 1XFZO 5DICA 2LCPA 1UHJA 3GK2A 4YBHB 1QX7A 3PM2A 2NCOA 4QJ3B 1A75B 1SW8A 2LC5A 1DQEA 1G4YR 2CCMA 2Y1NA 1OOFA 3EVRA 5FI2A 1A03A 3SG6A 3LL8B 3SS4A 3TDUA 5I2OA 4MZKA 3I5HB 3IVTA 1KQMC 1BF5A 2WOSA 4P2YB 3IQQA 1H8BA 1BODA 3PN7C 4QJ4B 4Q04A 3ICBA 1RTP1 1UHIA 2I2RE 1DGVA 2MRDA 2M1KB 1AUIB 1ZFSA 2WCJA 2QDIA 1LKJA 3L4AA 1IGVA 2JQ6A 2KGBC 1LVCD 1NIWA 1QLSA 2ERBA 4I5JA 1YUTA 1TCFA 1NCZA 1TWOA 2M1UA 3AAKA 2P6BB 3K21A 1WRKA 1TNWA 1W7IB 2FJYA 4INXA 1TTXA 4FQTA 3EKHA 1XFRA 4PDZA 5JJGA 4YRUA 1Z4HA 3EK7A 1VRKA 2JXCA 2NZ0A 2QACA 3D0YA 1IKUA 1N65A 2KI6D 4NQGA 2MLEC 1B7TY 1PALA 1FBVA 4JQ0D 1DJWA 1RECA 4YGCB 5FYXA 2M9GA 1AJ4A 5HLVA 1SBJA 2WCMA 5FI6A 3SG3A 2WNDA 3KO0A 2F8PA 2JOJA 1BMOA 5JOLA 1X02A 1LA3A 5K89A 1XVJA 2HF5A 4YI8A 1FI6A 1QVIZ 3SG5A 1DTLA 2BE6A 1PRWA 2GGZA 3O2PA 1BLQA 5HKZA 2JNFA 1SPYA 1DJGA 2QEHA 2K2AA 3H4SE 1UHKA 1U5IA 1DEKA 1K9KA 1IJ6A 5CSJA 1NX1A 4PHNA 4GBAA 1LXFC 2WCHA 4M2QA 2L51A 3PJIA 1WDCC 1QASA 1PSRA 2AAOA 2BKHB 4MZLA 1DGUA 2M97A 1OQPA 2D8NA 4BY4A 1SNLA 1D1OA 3KF9A 4HREE 3B88A 4HRGA 3R1PA 1QJTA 3D10A 1F8HA 1A2XA 3RLZA 2K2FA 4PHKA 1A4PA 1WRLA 2JULA 1TN4A 2JRFA 1ALWA 1Y0VH 1IIOA 1SYMA 2WCLA 3OB2B 4ZCVA 4A4BA 1WRZA 1ZMZA 2KDHA 1J7OA 5CPVA 1MR8A 2Y1MA 4DS7A 1S6JA 1IRJA 4GPLB 2KYFA 3OX5A 1KFUL 2H61C 2R2IA 1YX7A 3NSOA 1SMGA 3WHUB 2JPOA 2PQLA 4PT1A 1XFWO 3OGNA 4R1EA 3CLNA 3TDIA 4AOMA
chains in the Genus database with same CATH topology
4YGAA 3A8RA 1OZOA 1B47A 4GFTA 2LAPA 4FQOA 1F55A 5ER4X 1TIZA 1YUUA 2F3YA 1CNPA 1DJYA 2O60A 4MSPA 1Y1XA 3LCPC 2JT8A 2LVKA 1M46A 3LK1A 1SL7A 1NP8A 1SR6B 3I5FC 3LLEA 1PULA 5CSNA 1EL4A 1PVBA 4ORBB 4MEWA 5BPJA 1TNQA 2FCEA 2KFFA 1AJ5A 3CR4X 1UUSA 1UURA 1F4QA 3BQ3A 3I5GB 2FCDA 2MHHA 3PFVA 1CDMA 4XJKA 1SKTA 1RJVA 3RM1A 1EG4A 2JT0A 1GQMA 4CFRA 1NUBA 2KGRA 3OP0A 2SCPA 1MXLC 1ZOTB 3I5IB 1ZUZA 1N2DA 4I5LB 1JUOA 1B9AA 1YVLA 1CM1A 2KI4B 1G33A 5HKYA 4IL1A 4CPVA 1U5IB 1CMFA 1KFUS 2EC6B 1RWYA 1S6IA 1V1GA 4OR9B 2KAYA 5AEQA 4C0JA 4YGEB 1UHNA 1KK8B 5B8IB 1H4BA 1NCYA 1WLZA 2HETA 1YRTB 4GUKA 2B1UA 3DD4A 4WRIA 2H2KA 3FWCA 5HKWA 5J3XA 4C0LA 2ZN9A 4DUQA 2L2EA 5AERA 2JT3A 1XFUO 1CB1A 2KBMA 1SL8A 1SR6C 3PATA 1WDCB 4GAOA 4OKHA 2MA2A 3TDZA 1JC2A 1BOCA 1Y6WA 1YR5A 1JFJA 2MAZA 1IH0A 2KFGA 2JNXA 4WQ2A 3VGOA 2L5XB 3I5GC 2F2OA 5I8NA 3DVJA 1NX3A 2OS8B 5I2LA 1RK9A 4PE0A 1MUXA 5DKQA 2WCEA 5AFPA 1IJ5A 2BE4A 1QV0A 2PMYA 1JSAA 1CM4A 5KSZA 1OMRA 1S5GY 1ZACA 3FIAA 3O6BA 1CFFA 1CDPA 4DIRA 3VROA 3TUYB 1CFCA 3BYAA 3I5IC 5D69A 1B8LA 1K9UA 1S5GZ 2KI4C 1QVIY 1FW4A 2CBLA 5AXIA 2E6WA 2M3WA 2EC6C 2KI6C 1QX2A 4N1FA 2LNKA 1M31A 2VRGA 4CIDA 2CT9A 1KK8C 1DJZA 2LVIA 1TNXA 5DKRA 1FI5A 2HQWA 1WLMA 1YRUB 3BUNB 4MLWA 4MZJA 1M39A 1XK4A 2BKIB 1C7VA 2JWWA 1CLBA 1TOPA 4ETOA 3I5FB 4XJKB 3HX4A 1QLKA 1S36A 4P5OE 2GV5A 3AAJA 2KBIA 4MRXA 1UWOA 5I2QA 1M45A 4PALA 1KFXL 1YUSA 3EK4A 4PCWA 2I94A 1AP4A 1R2UA 1F70A 1KQVA 1IWQA 1OMVA 2BCBA 3EK8A 2M7LA 2PALA 3OX6A 1QIVA 1B4CA 5F6TA 2E30A 1QATA 4F0ZB 2OS8C 4I5NB 4OV2A 2BL0B 1J7RA 1DT7B 4GGFC 1AK8A 2M0RA 1B8RA 3BUMB 4ZCUA 1OE9B 1KCYA 5CSFA 3NSKA 2K7BA 1JF0A 4NDCA 2F3ZA 3TUYC 3SJSA 1M63B 1K8UA 2Y4QA 2I7AA 4U8DA 2WCBA 4GGFA 2NXQA 3DVEA 1TCOB 2KQYA 2BCAA 4OVNF 2M8UA 4I5KA 1CDLA 1MWNA 2TN4A 1SCVA 2L50A 1KSOA 2K0JA 2WORA 1MQ1A 1F4OA 2JU0A 4PE7A 3EVUA 4YGBB 1S26D 3LK0A 5G08A 2CTNA 3MSEB 1YTZC 1SCMC 1PSBA 4XYNA 1CFPA 2ZFDA 4GGNA 1C7WA 3F45A 3M0WA 2F2PA 2GGMA 3QRXA 1YVHA 2LM5A 3SIAA 1PVAA 5GQQC 4YGDB 4NDBA 2JZIA 3EVVA 4M2OA 2LUXA 4ICBA 1W7JB 4E68A 1KFXS 2I18A 1DMOA 2AMIA 4ORCB 2KAVA 1Y1UA 3PLFB 3TS5B 1NX0A 4MVFA 1BR4B 1JFKA 5TNCA 2EGDA 1DJXA 2FJUB 2Y5IA 1B8CA 2BL0C 3NSLA 1PK0D 4N1GA 5IBWA 1KWOB 5CSIA 1OSAA 1BT6A 1K95A 1RROA 5HLOA 4DRWA 3O78A 1JBAA 2KOTA 3GK1A 1CDNA 3JVTB 3WNXB 3SIBA 5ER5A 1ODBA 1J7PA 2LMUA 3CR2A 2LLTA 1N0YA 1Y1AA 3WXAA 3DF0A 3C1VA 3JTDC 1NWDA 3GOFA 1CLMA 2COLB 5DKNA 5KTYA 4FTGA 2NLNA 2LANA 3OB1B 4GNKB 1YX8A 1JWDA 1NSHA 1B1GA 2LMVA 2K7OA 4QJ5B 3SG4A 1UHHA 2JC2A 2LUCA 3GK4X 5AANA 1IQ5A 1K96A 2LHLA 2Q4UA 2LP3A 1F71A 3ZWHA 1J55A 2L98A 1S1EA 3TS5C 3E3RA 2OTGC 2JTTA 2BBNA 1CMGA 3KHEA 2K7DA 3PALA 1QV1A 2RGIA 2LLSA 2OPOA 1KWOC 1OMDA 4JPZB 4UPGA 4PE4A 2ZKMX 4MBEA 1J1EA 1K9PA 2JXLA 1XK4C 3CS1A 2PVBA 2KQ6A 2WC8A 1UP5A 2M49B 3HCMA 4MRYA 3JVTC 1K93D 3BOWA 2ZRSA 3CTNA 1K2HA 2K8MB 2HPSA 4BY5A 2LP2A 4TNCA 4HRHA 4ORAB 2KNEA 2LVJA 2KSPA 1E8AA 3BUXB 4NDDA 1SCMB 1L7ZA 1V1FA 3BXKA 1S6CA 2AUCA 3VRQA 1DF0A 1Q80A 1MF8B 1S3PA 1GGWA 1L2OB 1MHOA 1QIWA 1AVSA 1BR1B 1RFJA 1F54A 2ZRTA 2K61A 2Q91A 1MXEA 2V53A 1B7TZ 2CXJA 2KYCA 2NCPA 2FOTA 4N5XA 3VRRA 1EJ3A 2HQ8A 3A4UB 1QXPA 2CNPA 4A4CA 2WCFA 1J7QA 2ZN8A 3EKJA 4CLNA 2KAXA 3I5HC 3PM8A 1ALVA 3DF0B 2EHBA 1GGZA 2BECA 3PSRA 1AHRA 1A75A 1QX5B 2LVVA 1BU3A 1LINA 2LLUA 3DVMA 1K94A 1DVIA 2JTZA 2DOQA 3WHTB 1GJYA 3JTDB 1YURA 4HSZA 1SL9A 3CGAA 4C0KA 1LA0A 1SRAA 2A4JA 3NSIA 1XA5A 1HQVA 3KPXA 1OZSA 2ZNEA 2KFHA 1WY9A 2ISDA 2LE9B 1EH2A 3NXAA 4WQ3A 2F33A 1EG3A 2MJWB 4L9MA 4AQIA 1CFDA 3IF7A 1DJHA 2JPTA 1L2OC 1QS7A 1BJFA 2IS9A 1CLLA 3VRPA 1IQ3A 1CTRA 2MBXA 4PHJA 2LHIA 3AKAA 2OTGB 4MN0A 1J1DA 2H61A 1K90D 3SG2A 1CKKA 1NYAA 3O4YA 1C07A 3FWBA 5KU1A 2PRUA 3TZ1A 1KQMB 2M29A 3IQOA 3BOWB 1G8IA 1QTXA 2L4IA 3SG7A 2L4HA 1XYDA 3PN7B 2MLFC 1EXRA 2SASA 2ZNDA 1A29A 2QPTA 1XFXO 1TNPA 1R6PA 4D1EA 1NX2A 2O5GA 3AKBA 3CR5X 3DVKA 4OCIA 2L0PA 3D0YB 3FS7A 3CZTX 1OOJA 3CWGA 1FF1A 3VRNA 1DF0B 1KSMA 3OHMB 4PE1A 1NPQA 4M2PA 1HT9A 2K7CA 3BUWB 1IG5A 3BUOB 2KHNA 1XO5A 4JWQA 5D7FA 2PSRA 4PHMA 1JF2A 1KK7Y 2LMTA 1NCXA 2M7NA 1XFYO 4YI9A 1XFVO 2G9BA 1FPWA 1DJIA 1SK6D 3KEVA 1BG1A 2LV7A 2PASA 4AQJA 5PALA 4CFQA 3ZNIA 2G2BA 4DCKA 2BBMA 1KK7Z 1SY9A 5HYDA 4USLA 2BCXA 1TRFA 1XFZO 2LCPA 1UHJA 3GK2A 4YBHB 1QX7A 4QJ3B 2NCOA 1A75B 1SW8A 2LC5A 1G4YR 2CCMA 2Y1NA 3EVRA 1A03A 3SG6A 3LL8B 3TDUA 5I2OA 4MZKA 3I5HB 1KQMC 1BF5A 2WOSA 4P2YB 3IQQA 1H8BA 1BODA 3PN7C 4QJ4B 4Q04A 3ICBA 1RTP1 1UHIA 2I2RE 1DGVA 2MRDA 2M1KB 1AUIB 1ZFSA 1LKJA 1IGVA 2JQ6A 2KGBC 1LVCD 1NIWA 1QLSA 4I5JA 1YUTA 1TCFA 1NCZA 3AAKA 2M1UA 3K21A 2P6BB 1WRKA 1TNWA 1W7IB 4PDZA 1TTXA 3EKHA 5JJGA 4YRUA 3EK7A 1VRKA 2JXCA 2NZ0A 2QACA 3D0YA 1IKUA 1N65A 2KI6D 4NQGA 2MLEC 1B7TY 1PALA 1FBVA 4JQ0D 1DJWA 1RECA 4YGCB 5FYXA 2M9GA 1AJ4A 5HLVA 1SBJA 3SG3A 2WNDA 3KO0A 2F8PA 2JOJA 1BMOA 5JOLA 1X02A 1LA3A 5K89A 1XVJA 2HF5A 4YI8A 1FI6A 1QVIZ 3SG5A 1DTLA 2BE6A 1PRWA 2GGZA 3O2PA 1BLQA 5HKZA 2JNFA 1SPYA 1DJGA 3H4SE 2K2AA 1UHKA 1U5IA 1K9KA 1IJ6A 5CSJA 1NX1A 4PHNA 4GBAA 1LXFC 4M2QA 2L51A 1WDCC 1QASA 1PSRA 2AAOA 2BKHB 4MZLA 1DGUA 2M97A 1OQPA 2D8NA 4BY4A 1SNLA 1D1OA 3KF9A 4HREE 4HRGA 1QJTA 3D10A 1F8HA 1A2XA 3RLZA 2K2FA 4PHKA 1A4PA 1WRLA 2JULA 1TN4A 2JRFA 1ALWA 1Y0VH 1SYMA 4ZCVA 3OB2B 4A4BA 1WRZA 1ZMZA 2KDHA 1J7OA 5CPVA 1MR8A 2Y1MA 4DS7A 1S6JA 1IRJA 4GPLB 2KYFA 3OX5A 1KFUL 2H61C 2R2IA 1YX7A 3NSOA 1SMGA 3WHUB 4R1EA 3TDIA 1XFWO 4AOMA 3CLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGA A;  3A8R A;  1OZO A;  1B47 A;  4GFT A;  2LAP A;  4FQO A;  1F55 A;  5ER4 X;  1TIZ A;  1YUU A;  2F3Y A;  1CNP A;  1DJY A;  2O60 A;  4MSP A;  1Y1X A;  3LCP C;  2JT8 A;  2LVK A;  1M46 A;  3LK1 A;  1SL7 A;  1NP8 A;  1SR6 B;  3I5F C;  3LLE A;  1PUL A;  5CSN A;  1EL4 A;  1PVB A;  4ORB B;  4MEW A;  5BPJ A;  1TNQ A;  2FCE A;  2KFF A;  1AJ5 A;  3CR4 X;  1UUS A;  1UUR A;  1F4Q A;  3BQ3 A;  3I5G B;  2FCD A;  2MHH A;  3PFV A;  1CDM A;  4XJK A;  1SKT A;  1RJV A;  3RM1 A;  1EG4 A;  2JT0 A;  1GQM A;  4CFR A;  1NUB A;  2KGR A;  3OP0 A;  2SCP A;  1MXL C;  1ZOT B;  3I5I B;  1ZUZ A;  1N2D A;  4I5L B;  1JUO A;  1B9A A;  1YVL A;  1CM1 A;  2KI4 B;  1G33 A;  5HKY A;  4IL1 A;  4CPV A;  1U5I B;  1CMF A;  1KFU S;  2EC6 B;  1RWY A;  1S6I A;  1V1G A;  4OR9 B;  2KAY A;  5AEQ A;  4C0J A;  4YGE B;  1UHN A;  1KK8 B;  5B8I B;  1H4B A;  1NCY A;  1WLZ A;  2HET A;  1YRT B;  4GUK A;  2B1U A;  3DD4 A;  4WRI A;  2H2K A;  3FWC A;  5HKW A;  5J3X A;  4C0L A;  2ZN9 A;  4DUQ A;  2L2E A;  5AER A;  2JT3 A;  1XFU O;  1CB1 A;  2KBM A;  1SL8 A;  1SR6 C;  3PAT A;  1WDC B;  4GAO A;  4OKH A;  2MA2 A;  3TDZ A;  1JC2 A;  1BOC A;  1Y6W A;  1YR5 A;  1JFJ A;  2MAZ A;  1IH0 A;  2KFG A;  2JNX A;  4WQ2 A;  3VGO A;  2L5X B;  3I5G C;  2F2O A;  5I8N A;  3DVJ A;  1NX3 A;  2OS8 B;  5I2L A;  1RK9 A;  4PE0 A;  1MUX A;  5DKQ A;  2WCE A;  5AFP A;  1IJ5 A;  2BE4 A;  1QV0 A;  2PMY A;  1JSA A;  1CM4 A;  5KSZ A;  1OMR A;  1S5G Y;  1ZAC A;  3FIA A;  3O6B A;  1CFF A;  1CDP A;  4DIR A;  3VRO A;  3TUY B;  1CFC A;  3BYA A;  3I5I C;  5D69 A;  1B8L A;  1K9U A;  1S5G Z;  2KI4 C;  1QVI Y;  1FW4 A;  2CBL A;  5AXI A;  2E6W A;  2M3W A;  2EC6 C;  2KI6 C;  1QX2 A;  4N1F A;  2LNK A;  1M31 A;  2VRG A;  4CID A;  2CT9 A;  1KK8 C;  1DJZ A;  2LVI A;  1TNX A;  5DKR A;  1FI5 A;  2HQW A;  1WLM A;  1YRU B;  3BUN B;  4MLW A;  4MZJ A;  1M39 A;  1XK4 A;  2BKI B;  1C7V A;  2JWW A;  1CLB A;  1TOP A;  4ETO A;  3I5F B;  4XJK B;  3HX4 A;  1QLK A;  1S36 A;  4P5O E;  2GV5 A;  3AAJ A;  2KBI A;  4MRX A;  1UWO A;  5I2Q A;  1M45 A;  4PAL A;  1KFX L;  1YUS A;  3EK4 A;  4PCW A;  2I94 A;  1AP4 A;  1R2U A;  1F70 A;  1KQV A;  1IWQ A;  1OMV A;  2BCB A;  3EK8 A;  2M7L A;  2PAL A;  3OX6 A;  1QIV A;  1B4C A;  5F6T A;  2E30 A;  1QAT A;  4F0Z B;  2OS8 C;  4I5N B;  4OV2 A;  2BL0 B;  1J7R A;  1DT7 B;  4GGF C;  1AK8 A;  2M0R A;  1B8R A;  3BUM B;  4ZCU A;  1OE9 B;  1KCY A;  5CSF A;  3NSK A;  2K7B A;  1JF0 A;  4NDC A;  2F3Z A;  3TUY C;  3SJS A;  1M63 B;  1K8U A;  2Y4Q A;  2I7A A;  4U8D A;  2WCB A;  4GGF A;  2NXQ A;  3DVE A;  1TCO B;  2KQY A;  2BCA A;  4OVN F;  2M8U A;  4I5K A;  1CDL A;  1MWN A;  2TN4 A;  1SCV A;  2L50 A;  1KSO A;  2K0J A;  2WOR A;  1MQ1 A;  1F4O A;  2JU0 A;  4PE7 A;  3EVU A;  4YGB B;  1S26 D;  3LK0 A;  5G08 A;  2CTN A;  3MSE B;  1YTZ C;  1SCM C;  1PSB A;  4XYN A;  1CFP A;  2ZFD A;  4GGN A;  1C7W A;  3F45 A;  3M0W A;  2F2P A;  2GGM A;  3QRX A;  1YVH A;  2LM5 A;  3SIA A;  1PVA A;  5GQQ C;  4YGD B;  4NDB A;  2JZI A;  3EVV A;  4M2O A;  2LUX A;  4ICB A;  1W7J B;  4E68 A;  1KFX S;  2I18 A;  1DMO A;  2AMI A;  4ORC B;  2KAV A;  1Y1U A;  3PLF B;  3TS5 B;  1NX0 A;  4MVF A;  1BR4 B;  1JFK A;  5TNC A;  2EGD A;  1DJX A;  2FJU B;  2Y5I A;  1B8C A;  2BL0 C;  3NSL A;  1PK0 D;  4N1G A;  5IBW A;  1KWO B;  5CSI A;  1OSA A;  1BT6 A;  1K95 A;  1RRO A;  5HLO A;  4DRW A;  3O78 A;  1JBA A;  2KOT A;  3GK1 A;  1CDN A;  3JVT B;  3WNX B;  3SIB A;  5ER5 A;  1ODB A;  1J7P A;  2LMU A;  3CR2 A;  2LLT A;  1N0Y A;  1Y1A A;  3WXA A;  3DF0 A;  3C1V A;  3JTD C;  1NWD A;  3GOF A;  1CLM A;  2COL B;  5DKN A;  5KTY A;  4FTG A;  2NLN A;  2LAN A;  3OB1 B;  4GNK B;  1YX8 A;  1JWD A;  1NSH A;  1B1G A;  2LMV A;  2K7O A;  4QJ5 B;  3SG4 A;  1UHH A;  2JC2 A;  2LUC A;  3GK4 X;  5AAN A;  1IQ5 A;  1K96 A;  2LHL A;  2Q4U A;  2LP3 A;  1F71 A;  3ZWH A;  1J55 A;  2L98 A;  1S1E A;  3TS5 C;  3E3R A;  2OTG C;  2JTT A;  2BBN A;  1CMG A;  3KHE A;  2K7D A;  3PAL A;  1QV1 A;  2RGI A;  2LLS A;  2OPO A;  1KWO C;  1OMD A;  4JPZ B;  4UPG A;  4PE4 A;  2ZKM X;  4MBE A;  1J1E A;  1K9P A;  2JXL A;  1XK4 C;  3CS1 A;  2PVB A;  2KQ6 A;  2WC8 A;  1UP5 A;  2M49 B;  3HCM A;  4MRY A;  3JVT C;  1K93 D;  3BOW A;  2ZRS A;  3CTN A;  1K2H A;  2K8M B;  2HPS A;  4BY5 A;  2LP2 A;  4TNC A;  4HRH A;  4ORA B;  2KNE A;  2LVJ A;  2KSP A;  1E8A A;  3BUX B;  4NDD A;  1SCM B;  1L7Z A;  1V1F A;  3BXK A;  1S6C A;  2AUC A;  3VRQ A;  1DF0 A;  1Q80 A;  1MF8 B;  1S3P A;  1GGW A;  1L2O B;  1MHO A;  1QIW A;  1AVS A;  1BR1 B;  1RFJ A;  1F54 A;  2ZRT A;  2K61 A;  2Q91 A;  1MXE A;  2V53 A;  1B7T Z;  2CXJ A;  2KYC A;  2NCP A;  2FOT A;  4N5X A;  3VRR A;  1EJ3 A;  2HQ8 A;  3A4U B;  1QXP A;  2CNP A;  4A4C A;  2WCF A;  1J7Q A;  2ZN8 A;  3EKJ A;  4CLN A;  2KAX A;  3I5H C;  3PM8 A;  1ALV A;  3DF0 B;  2EHB A;  1GGZ A;  2BEC A;  3PSR A;  1AHR A;  1A75 A;  1QX5 B;  2LVV A;  1BU3 A;  1LIN A;  2LLU A;  3DVM A;  1K94 A;  1DVI A;  2JTZ A;  2DOQ A;  3WHT B;  1GJY A;  3JTD B;  1YUR A;  4HSZ A;  1SL9 A;  3CGA A;  4C0K A;  1LA0 A;  1SRA A;  2A4J A;  3NSI A;  1XA5 A;  1HQV A;  3KPX A;  1OZS A;  2ZNE A;  2KFH A;  1WY9 A;  2ISD A;  2LE9 B;  1EH2 A;  3NXA A;  4WQ3 A;  2F33 A;  1EG3 A;  2MJW B;  4L9M A;  4AQI A;  1CFD A;  3IF7 A;  1DJH A;  2JPT A;  1L2O C;  1QS7 A;  1BJF A;  2IS9 A;  1CLL A;  3VRP A;  1IQ3 A;  1CTR A;  2MBX A;  4PHJ A;  2LHI A;  3AKA A;  2OTG B;  4MN0 A;  1J1D A;  2H61 A;  1K90 D;  3SG2 A;  1CKK A;  1NYA A;  3O4Y A;  1C07 A;  3FWB A;  5KU1 A;  2PRU A;  3TZ1 A;  1KQM B;  2M29 A;  3IQO A;  3BOW B;  1G8I A;  1QTX A;  2L4I A;  3SG7 A;  2L4H A;  1XYD A;  3PN7 B;  2MLF C;  1EXR A;  2SAS A;  2ZND A;  1A29 A;  2QPT A;  1XFX O;  1TNP A;  1R6P A;  4D1E A;  1NX2 A;  2O5G A;  3AKB A;  3CR5 X;  3DVK A;  4OCI A;  2L0P A;  3D0Y B;  3FS7 A;  3CZT X;  1OOJ A;  3CWG A;  1FF1 A;  3VRN A;  1DF0 B;  1KSM A;  3OHM B;  4PE1 A;  1NPQ A;  4M2P A;  1HT9 A;  2K7C A;  3BUW B;  1IG5 A;  3BUO B;  2KHN A;  1XO5 A;  4JWQ A;  5D7F A;  2PSR A;  4PHM A;  1JF2 A;  1KK7 Y;  2LMT A;  1NCX A;  2M7N A;  1XFY O;  4YI9 A;  1XFV O;  2G9B A;  1FPW A;  1DJI A;  1SK6 D;  3KEV A;  1BG1 A;  2LV7 A;  2PAS A;  4AQJ A;  5PAL A;  4CFQ A;  3ZNI A;  2G2B A;  4DCK A;  2BBM A;  1KK7 Z;  1SY9 A;  5HYD A;  4USL A;  2BCX A;  1TRF A;  1XFZ O;  2LCP A;  1UHJ A;  3GK2 A;  4YBH B;  1QX7 A;  4QJ3 B;  2NCO A;  1A75 B;  1SW8 A;  2LC5 A;  1G4Y R;  2CCM A;  2Y1N A;  3EVR A;  1A03 A;  3SG6 A;  3LL8 B;  3TDU A;  5I2O A;  4MZK A;  3I5H B;  1KQM C;  1BF5 A;  2WOS A;  4P2Y B;  3IQQ A;  1H8B A;  1BOD A;  3PN7 C;  4QJ4 B;  4Q04 A;  3ICB A;  1RTP 1;  1UHI A;  2I2R E;  1DGV A;  2MRD A;  2M1K B;  1AUI B;  1ZFS A;  1LKJ A;  1IGV A;  2JQ6 A;  2KGB C;  1LVC D;  1NIW A;  1QLS A;  4I5J A;  1YUT A;  1TCF A;  1NCZ A;  3AAK A;  2M1U A;  3K21 A;  2P6B B;  1WRK A;  1TNW A;  1W7I B;  4PDZ A;  1TTX A;  3EKH A;  5JJG A;  4YRU A;  3EK7 A;  1VRK A;  2JXC A;  2NZ0 A;  2QAC A;  3D0Y A;  1IKU A;  1N65 A;  2KI6 D;  4NQG A;  2MLE C;  1B7T Y;  1PAL A;  1FBV A;  4JQ0 D;  1DJW A;  1REC A;  4YGC B;  5FYX A;  2M9G A;  1AJ4 A;  5HLV A;  1SBJ A;  3SG3 A;  2WND A;  3KO0 A;  2F8P A;  2JOJ A;  1BMO A;  5JOL A;  1X02 A;  1LA3 A;  5K89 A;  1XVJ A;  2HF5 A;  4YI8 A;  1FI6 A;  1QVI Z;  3SG5 A;  1DTL A;  2BE6 A;  1PRW A;  2GGZ A;  3O2P A;  1BLQ A;  5HKZ A;  2JNF A;  1SPY A;  1DJG A;  3H4S E;  2K2A A;  1UHK A;  1U5I A;  1K9K A;  1IJ6 A;  5CSJ A;  1NX1 A;  4PHN A;  4GBA A;  1LXF C;  4M2Q A;  2L51 A;  1WDC C;  1QAS A;  1PSR A;  2AAO A;  2BKH B;  4MZL A;  1DGU A;  2M97 A;  1OQP A;  2D8N A;  4BY4 A;  1SNL A;  1D1O A;  3KF9 A;  4HRE E;  4HRG A;  1QJT A;  3D10 A;  1F8H A;  1A2X A;  3RLZ A;  2K2F A;  4PHK A;  1A4P A;  1WRL A;  2JUL A;  1TN4 A;  2JRF A;  1ALW A;  1Y0V H;  1SYM A;  4ZCV A;  3OB2 B;  4A4B A;  1WRZ A;  1ZMZ A;  2KDH A;  1J7O A;  5CPV A;  1MR8 A;  2Y1M A;  4DS7 A;  1S6J A;  1IRJ A;  4GPL B;  2KYF A;  3OX5 A;  1KFU L;  2H61 C;  2R2I A;  1YX7 A;  3NSO A;  1SMG A;  3WHU B;  4R1E A;  3TDI A;  1XFW O;  4AOM A;  3CLN A; 
#chains in the Genus database with same CATH topology
 4YGA A;  3A8R A;  1OZO A;  1GM0 A;  3K1E A;  1B47 A;  4GFT A;  2LAP A;  1C3Y A;  4FQO A;  1F55 A;  5ER4 X;  1TIZ A;  1YUU A;  2F3Y A;  3QME A;  1CNP A;  1DJY A;  2O60 A;  4MSP A;  1Y1X A;  3SS5 A;  3LCP C;  2JT8 A;  2LVK A;  1M46 A;  3LK1 A;  3BFH A;  3S0A A;  1SL7 A;  1NP8 A;  1SR6 B;  3FE6 A;  3I5F C;  3LLE A;  1PUL A;  5CSN A;  1EL4 A;  1PVB A;  3EG5 B;  4ORB B;  4MEW A;  5BPJ A;  3D75 A;  1TNQ A;  2FCE A;  2KFF A;  1AJ5 A;  3CR4 X;  1UUS A;  1UUR A;  1F4Q A;  3BQ3 A;  3I5G B;  2FCD A;  2MHH A;  3PFV A;  1CDM A;  4XJK A;  1SKT A;  1RJV A;  3RM1 A;  1EG4 A;  2JT0 A;  1GQM A;  4IJ7 A;  4CFR A;  1NUB A;  2KGR A;  3OP0 A;  2SCP A;  1MXL C;  1ZOT B;  3CZ0 A;  1ZUZ A;  1N2D A;  3I5I B;  4I5L B;  5FI7 A;  1JUO A;  1B9A A;  1YVL A;  1CM1 A;  2KI4 B;  3B7A A;  3CAB A;  1G33 A;  5HL1 A;  4IL1 A;  5HKY A;  4CPV A;  1U5I B;  1CMF A;  1KFU S;  2EC6 B;  1RWY A;  1S6I A;  1V1G A;  4OR9 B;  2KAY A;  5AEQ A;  4C0J A;  4YGE B;  1UHN A;  1KK8 B;  3D76 A;  5B8I B;  1H4B A;  1NCY A;  1WLZ A;  2HET A;  1YRT B;  4GUK A;  1W9Z A;  2B1U A;  3DD4 A;  4WRI A;  2H2K A;  3FWC A;  5HKW A;  5J3X A;  4C0L A;  2ZN9 A;  4DUQ A;  2L2E A;  5AER A;  2JT3 A;  1XFU O;  1CB1 A;  4JD9 A;  2KBM A;  1SL8 A;  3UNW A;  1SR6 C;  3PAT A;  1WDC B;  4GAO A;  1TUJ A;  4OKH A;  2MA2 A;  3TDZ A;  1JC2 A;  1BOC A;  1Y6W A;  1YR5 A;  2P70 A;  2MAZ A;  1JFJ A;  2KFG A;  1IH0 A;  2JNX A;  4WQ2 A;  3VGO A;  2L5X B;  3L4L A;  3I5G C;  2F2O A;  5I8N A;  3DVJ A;  1NX3 A;  2OS8 B;  5I2L A;  1RK9 A;  4PE0 A;  1MUX A;  5DKQ A;  1C3Z A;  2WCE A;  5AFP A;  1IJ5 A;  2BE4 A;  1QV0 A;  2PMY A;  1DC1 A;  1JSA A;  1CM4 A;  5KSZ A;  3NGV A;  1OMR A;  1S5G Y;  1ZAC A;  3FIA A;  3O6B A;  1CFF A;  1CDP A;  4DIR A;  3VRO A;  3TUY B;  1OOG A;  1CFC A;  3BYA A;  3I5I C;  5D69 A;  2BNX A;  1B8L A;  1K9U A;  1S5G Z;  2KI4 C;  1QVI Y;  1FW4 A;  2CBL A;  5AXI A;  2E6W A;  2M3W A;  2EC6 C;  2KI6 C;  1QX2 A;  4N1F A;  3RZS A;  2LNK A;  1M31 A;  2VRG A;  4CID A;  2CT9 A;  1KK8 C;  1DJZ A;  2LVI A;  1TNX A;  3S0E A;  5DKR A;  1FI5 A;  2HQW A;  1OOH A;  1WLM A;  1YRU B;  3BUN B;  4MLW A;  1M39 A;  1XK4 A;  4MZJ A;  2BKI B;  2PYQ A;  2JWW A;  3D74 A;  3CZ2 A;  1TOP A;  1C7V A;  1CLB A;  4ETO A;  3I5F B;  3CYZ A;  1SSE B;  4XJK B;  3HX4 A;  1QLK A;  1S36 A;  4P5O E;  3NHI A;  2GV5 A;  3AAJ A;  2KBI A;  4MRX A;  1UWO A;  5I2Q A;  1M45 A;  4PAL A;  1KFX L;  1YUS A;  3EK4 A;  4PCW A;  2I94 A;  1AP4 A;  1R2U A;  1F70 A;  1KQV A;  2P71 A;  1IWQ A;  1OMV A;  2BCB A;  3EK8 A;  2M7L A;  2PAL A;  3OX6 A;  1ORG A;  1QIV A;  1B4C A;  5F6T A;  2E30 A;  1QAT A;  4F0Z B;  2OS8 C;  4I5N B;  4OV2 A;  2BL0 B;  1J7R A;  1P28 A;  4GGF C;  1DT7 B;  1AK8 A;  2M0R A;  1B8R A;  3BUM B;  4ZCU A;  1OE9 B;  1KCY A;  5CSF A;  3NSK A;  2K7B A;  1JF0 A;  4NDC A;  2F3Z A;  3TUY C;  3SJS A;  1M63 B;  1K8U A;  2Y4Q A;  2I7A A;  4U8D A;  2WCB A;  4GGF A;  2NXQ A;  3DVE A;  1TCO B;  2KQY A;  2BCA A;  4OZD A;  4OVN F;  2M8U A;  4I5K A;  1CDL A;  1MWN A;  2TN4 A;  1SCV A;  2L50 A;  1KSO A;  2K0J A;  4KYN A;  2WOR A;  1MQ1 A;  1F4O A;  2JU0 A;  4PE7 A;  3EVU A;  4YGB B;  1S26 D;  3LK0 A;  5G08 A;  2CTN A;  3MSE B;  2H8V A;  1YTZ C;  2K60 A;  3R1V A;  1SCM C;  1PSB A;  4XYN A;  1CFP A;  2ZFD A;  4GGN A;  1C7W A;  3F45 A;  3M0W A;  2F2P A;  2GGM A;  3QRX A;  1YVH A;  2L5Y A;  2LM5 A;  4JKT A;  1PVA A;  5GQQ C;  3SIA A;  4YGD B;  4NDB A;  3CZ1 A;  2JZI A;  3EVV A;  4M2O A;  2LUX A;  4ICB A;  1W7J B;  4E68 A;  1KFX S;  3BJH A;  2I18 A;  1DMO A;  2AMI A;  4ORC B;  2KAV A;  1Y1U A;  3PLF B;  3TS5 B;  1NX0 A;  4MVF A;  1BR4 B;  1JFK A;  5TNC A;  2EGD A;  1DJX A;  2FJU B;  2Y5I A;  1B8C A;  2BL0 C;  3NSL A;  1Z2C B;  1PK0 D;  2YGU A;  4N1G A;  2WC5 A;  5IBW A;  1KWO B;  5CSI A;  1OSA A;  1BT6 A;  1K95 A;  1QWV A;  1RRO A;  3NHT A;  3N7H A;  5HLO A;  3O78 A;  4DRW A;  1JBA A;  2KOT A;  3GK1 A;  1CDN A;  3JVT B;  2KPH A;  3SIB A;  5ER5 A;  1ODB A;  3WNX B;  2LMU A;  5I94 A;  1J7P A;  3CR2 A;  3VB1 A;  3O4X A;  2LLT A;  1N0Y A;  1Y1A A;  3WXA A;  3DF0 A;  3C1V A;  3Q8I A;  3JTD C;  1NWD A;  2GTE A;  3GOF A;  3V2L A;  1LS8 A;  2BAP A;  1CLM A;  2COL B;  5DKN A;  5KTY A;  4FTG A;  2NLN A;  2LAN A;  3OB1 B;  4GNK B;  1YX8 A;  1JWD A;  1NSH A;  1B1G A;  2LMV A;  2K7O A;  4QJ5 B;  3SG4 A;  1UHH A;  4F7F A;  2JC2 A;  2LUC A;  3GK4 X;  5AAN A;  1IQ5 A;  1K96 A;  2LHL A;  3S0D A;  1OOI X;  2QEO A;  2Q4U A;  2LP3 A;  1F71 A;  3ZWH A;  1J55 A;  2L98 A;  1S1E A;  3TS5 C;  3E3R A;  2OTG C;  5D3O A;  2JTT A;  2BBN A;  1CMG A;  3KHE A;  2K7D A;  3B6X A;  2QEV A;  3PAL A;  1QV1 A;  2RGI A;  2LLS A;  2OPO A;  1KWO C;  1OMD A;  4JPZ B;  3D77 A;  4UPG A;  4PE4 A;  2ZKM X;  4MBE A;  1J1E A;  1K9P A;  2JXL A;  1XK4 C;  3CS1 A;  2PVB A;  2KQ6 A;  2WC8 A;  1UP5 A;  2M49 B;  3HCM A;  4MRY A;  3BFA A;  1K93 D;  3JVT C;  3S0F A;  3BOW A;  3FE9 A;  2KLD A;  2ZRS A;  3CTN A;  1K2H A;  2K8M B;  2HPS A;  4BY5 A;  2LP2 A;  4TNC A;  4HRH A;  3DY9 A;  4ORA B;  3B86 A;  2KNE A;  2LVJ A;  2KSP A;  1E8A A;  3BUX B;  4NDD A;  1SCM B;  3DZT A;  2WC6 A;  1L7Z A;  1V1F A;  3BXK A;  1S6C A;  2AUC A;  3VRQ A;  1DF0 A;  1Q80 A;  1MF8 B;  1S3P A;  3S0B A;  1GGW A;  1L2O B;  1MHO A;  1QIW A;  1AVS A;  1BR1 B;  1RFJ A;  1F54 A;  2ZRT A;  2K61 A;  2Q91 A;  1MXE A;  2V53 A;  1B7T Z;  2CXJ A;  2KYC A;  3D78 A;  2NCP A;  2FOT A;  4N5X A;  3VRR A;  1EJ3 A;  2HQ8 A;  3DXL A;  3A4U B;  3L47 A;  1QXP A;  2CNP A;  4A4C A;  2WCF A;  1J7Q A;  2ZN8 A;  3D73 A;  3EKJ A;  4CLN A;  2KAX A;  3I5H C;  3PM8 A;  1ALV A;  3DF0 B;  2EHB A;  1GGZ A;  2BEC A;  3PSR A;  1DEL A;  1AHR A;  3OBV A;  1A75 A;  1QX5 B;  2LVV A;  1BU3 A;  1LIN A;  2LLU A;  3DVM A;  5EL2 A;  1K94 A;  3FE8 A;  1DVI A;  2JTZ A;  2DOQ A;  2WCK A;  3WHT B;  1GJY A;  3JTD B;  1YUR A;  4HSZ A;  4INW A;  1SL9 A;  3CGA A;  4C0K A;  1LA0 A;  1SRA A;  2A4J A;  3NSI A;  2L2C A;  1XA5 A;  1HQV A;  3KPX A;  1OZS A;  2ZNE A;  2KFH A;  1WY9 A;  2ISD A;  2LE9 B;  1EH2 A;  3NXA A;  4WQ3 A;  2F33 A;  1EG3 A;  2MJW B;  4L9M A;  4AQI A;  1CFD A;  3IF7 A;  1DJH A;  2JPT A;  1L2O C;  1QS7 A;  1BJF A;  2IS9 A;  2KLE A;  3R1O A;  1CLL A;  3VRP A;  1IQ3 A;  1CTR A;  2MBX A;  4PHJ A;  2LHI A;  3AKA A;  2OTG B;  1T14 A;  4MN0 A;  1J1D A;  2H61 A;  1K90 D;  3CDN A;  3SG2 A;  1CKK A;  1NYA A;  3O4Y A;  1C07 A;  3FWB A;  5KU1 A;  2PRU A;  3TZ1 A;  1KQM B;  2M29 A;  3IQO A;  3BOW B;  1G8I A;  1QTX A;  2L4I A;  3SG7 A;  2L4H A;  3BFB A;  1XYD A;  3PN7 B;  3R72 A;  2MLF C;  1EXR A;  2SAS A;  2ZND A;  1A29 A;  2QPT A;  1XFX O;  3DYE A;  1TNP A;  1R6P A;  4D1E A;  1NX2 A;  3S0G A;  2O5G A;  3AKB A;  3CR5 X;  3B87 A;  3DVK A;  2L0P A;  3D0Y B;  3FS7 A;  3CZT X;  1OOJ A;  3CWG A;  4OCI A;  1FF1 A;  3SS3 A;  3VRN A;  1DF0 B;  1KSM A;  3OHM B;  4PE1 A;  1NPQ A;  4M2P A;  1HT9 A;  2K7C A;  3BUW B;  1IG5 A;  3BUO B;  2KHN A;  1XO5 A;  4JWQ A;  5D7F A;  1TUZ A;  2PSR A;  4PHM A;  1JF2 A;  1KK7 Y;  1OW4 A;  1NCX A;  2LMT A;  1XFY O;  2M7N A;  4YI9 A;  1XFV O;  2G9B A;  1FPW A;  1DJI A;  1SK6 D;  3KEV A;  1BG1 A;  2LV7 A;  2PAS A;  2QEB A;  5PAL A;  4AQJ A;  3ZNI A;  2G2B A;  4CFQ A;  4DCK A;  2BBM A;  1KK7 Z;  1SY9 A;  5HYD A;  3UO9 A;  4USL A;  2BCX A;  1TRF A;  1XFZ O;  5DIC A;  2LCP A;  1UHJ A;  3GK2 A;  4YBH B;  1QX7 A;  3PM2 A;  2NCO A;  4QJ3 B;  1A75 B;  1SW8 A;  2LC5 A;  1DQE A;  1G4Y R;  2CCM A;  2Y1N A;  1OOF A;  3EVR A;  5FI2 A;  1A03 A;  3SG6 A;  3LL8 B;  3SS4 A;  3TDU A;  5I2O A;  4MZK A;  3I5H B;  3IVT A;  1KQM C;  1BF5 A;  2WOS A;  4P2Y B;  3IQQ A;  1H8B A;  1BOD A;  3PN7 C;  4QJ4 B;  4Q04 A;  3ICB A;  1RTP 1;  1UHI A;  2I2R E;  1DGV A;  2MRD A;  2M1K B;  1AUI B;  1ZFS A;  2WCJ A;  2QDI A;  1LKJ A;  3L4A A;  1IGV A;  2JQ6 A;  2KGB C;  1LVC D;  1NIW A;  1QLS A;  2ERB A;  4I5J A;  1YUT A;  1TCF A;  1NCZ A;  1TWO A;  2M1U A;  3AAK A;  2P6B B;  3K21 A;  1WRK A;  1TNW A;  1W7I B;  2FJY A;  4INX A;  1TTX A;  4FQT A;  3EKH A;  1XFR A;  4PDZ A;  5JJG A;  4YRU A;  1Z4H A;  3EK7 A;  1VRK A;  2JXC A;  2NZ0 A;  2QAC A;  3D0Y A;  1IKU A;  1N65 A;  2KI6 D;  4NQG A;  2MLE C;  1B7T Y;  1PAL A;  1FBV A;  4JQ0 D;  1DJW A;  1REC A;  4YGC B;  5FYX A;  2M9G A;  1AJ4 A;  5HLV A;  1SBJ A;  2WCM A;  5FI6 A;  3SG3 A;  2WND A;  3KO0 A;  2F8P A;  2JOJ A;  1BMO A;  5JOL A;  1X02 A;  1LA3 A;  5K89 A;  1XVJ A;  2HF5 A;  4YI8 A;  1FI6 A;  1QVI Z;  3SG5 A;  1DTL A;  2BE6 A;  1PRW A;  2GGZ A;  3O2P A;  1BLQ A;  5HKZ A;  2JNF A;  1SPY A;  1DJG A;  2QEH A;  2K2A A;  3H4S E;  1UHK A;  1U5I A;  1DEK A;  1K9K A;  1IJ6 A;  5CSJ A;  1NX1 A;  4PHN A;  4GBA A;  1LXF C;  2WCH A;  4M2Q A;  2L51 A;  3PJI A;  1WDC C;  1QAS A;  1PSR A;  2AAO A;  2BKH B;  4MZL A;  1DGU A;  2M97 A;  1OQP A;  2D8N A;  4BY4 A;  1SNL A;  1D1O A;  3KF9 A;  4HRE E;  3B88 A;  4HRG A;  3R1P A;  1QJT A;  3D10 A;  1F8H A;  1A2X A;  3RLZ A;  2K2F A;  4PHK A;  1A4P A;  1WRL A;  2JUL A;  1TN4 A;  2JRF A;  1ALW A;  1Y0V H;  1IIO A;  1SYM A;  2WCL A;  3OB2 B;  4ZCV A;  4A4B A;  1WRZ A;  1ZMZ A;  2KDH A;  1J7O A;  5CPV A;  1MR8 A;  2Y1M A;  4DS7 A;  1S6J A;  1IRJ A;  4GPL B;  2KYF A;  3OX5 A;  1KFU L;  2H61 C;  2R2I A;  1YX7 A;  3NSO A;  1SMG A;  3WHU B;  2JPO A;  2PQL A;  4PT1 A;  1XFW O;  3OGN A;  4R1E A;  3CLN A;  3TDI A;  4AOM A; 
#chains in the Genus database with same CATH homology
 4YGA A;  3A8R A;  1OZO A;  1B47 A;  4GFT A;  2LAP A;  4FQO A;  1F55 A;  5ER4 X;  1TIZ A;  1YUU A;  2F3Y A;  1CNP A;  1DJY A;  2O60 A;  4MSP A;  1Y1X A;  3LCP C;  2JT8 A;  2LVK A;  1M46 A;  3LK1 A;  1SL7 A;  1NP8 A;  1SR6 B;  3I5F C;  3LLE A;  1PUL A;  5CSN A;  1EL4 A;  1PVB A;  4ORB B;  4MEW A;  5BPJ A;  1TNQ A;  2FCE A;  2KFF A;  1AJ5 A;  3CR4 X;  1UUS A;  1UUR A;  1F4Q A;  3BQ3 A;  3I5G B;  2FCD A;  2MHH A;  3PFV A;  1CDM A;  4XJK A;  1SKT A;  1RJV A;  3RM1 A;  1EG4 A;  2JT0 A;  1GQM A;  4CFR A;  1NUB A;  2KGR A;  3OP0 A;  2SCP A;  1MXL C;  1ZOT B;  3I5I B;  1ZUZ A;  1N2D A;  4I5L B;  1JUO A;  1B9A A;  1YVL A;  1CM1 A;  2KI4 B;  1G33 A;  5HKY A;  4IL1 A;  4CPV A;  1U5I B;  1CMF A;  1KFU S;  2EC6 B;  1RWY A;  1S6I A;  1V1G A;  4OR9 B;  2KAY A;  5AEQ A;  4C0J A;  4YGE B;  1UHN A;  1KK8 B;  5B8I B;  1H4B A;  1NCY A;  1WLZ A;  2HET A;  1YRT B;  4GUK A;  2B1U A;  3DD4 A;  4WRI A;  2H2K A;  3FWC A;  5HKW A;  5J3X A;  4C0L A;  2ZN9 A;  4DUQ A;  2L2E A;  5AER A;  2JT3 A;  1XFU O;  1CB1 A;  2KBM A;  1SL8 A;  1SR6 C;  3PAT A;  1WDC B;  4GAO A;  4OKH A;  2MA2 A;  3TDZ A;  1JC2 A;  1BOC A;  1Y6W A;  1YR5 A;  1JFJ A;  2MAZ A;  1IH0 A;  2KFG A;  2JNX A;  4WQ2 A;  3VGO A;  2L5X B;  3I5G C;  2F2O A;  5I8N A;  3DVJ A;  1NX3 A;  2OS8 B;  5I2L A;  1RK9 A;  4PE0 A;  1MUX A;  5DKQ A;  2WCE A;  5AFP A;  1IJ5 A;  2BE4 A;  1QV0 A;  2PMY A;  1JSA A;  1CM4 A;  5KSZ A;  1OMR A;  1S5G Y;  1ZAC A;  3FIA A;  3O6B A;  1CFF A;  1CDP A;  4DIR A;  3VRO A;  3TUY B;  1CFC A;  3BYA A;  3I5I C;  5D69 A;  1B8L A;  1K9U A;  1S5G Z;  2KI4 C;  1QVI Y;  1FW4 A;  2CBL A;  5AXI A;  2E6W A;  2M3W A;  2EC6 C;  2KI6 C;  1QX2 A;  4N1F A;  2LNK A;  1M31 A;  2VRG A;  4CID A;  2CT9 A;  1KK8 C;  1DJZ A;  2LVI A;  1TNX A;  5DKR A;  1FI5 A;  2HQW A;  1WLM A;  1YRU B;  3BUN B;  4MLW A;  4MZJ A;  1M39 A;  1XK4 A;  2BKI B;  1C7V A;  2JWW A;  1CLB A;  1TOP A;  4ETO A;  3I5F B;  4XJK B;  3HX4 A;  1QLK A;  1S36 A;  4P5O E;  2GV5 A;  3AAJ A;  2KBI A;  4MRX A;  1UWO A;  5I2Q A;  1M45 A;  4PAL A;  1KFX L;  1YUS A;  3EK4 A;  4PCW A;  2I94 A;  1AP4 A;  1R2U A;  1F70 A;  1KQV A;  1IWQ A;  1OMV A;  2BCB A;  3EK8 A;  2M7L A;  2PAL A;  3OX6 A;  1QIV A;  1B4C A;  5F6T A;  2E30 A;  1QAT A;  4F0Z B;  2OS8 C;  4I5N B;  4OV2 A;  2BL0 B;  1J7R A;  1DT7 B;  4GGF C;  1AK8 A;  2M0R A;  1B8R A;  3BUM B;  4ZCU A;  1OE9 B;  1KCY A;  5CSF A;  3NSK A;  2K7B A;  1JF0 A;  4NDC A;  2F3Z A;  3TUY C;  3SJS A;  1M63 B;  1K8U A;  2Y4Q A;  2I7A A;  4U8D A;  2WCB A;  4GGF A;  2NXQ A;  3DVE A;  1TCO B;  2KQY A;  2BCA A;  4OVN F;  2M8U A;  4I5K A;  1CDL A;  1MWN A;  2TN4 A;  1SCV A;  2L50 A;  1KSO A;  2K0J A;  2WOR A;  1MQ1 A;  1F4O A;  2JU0 A;  4PE7 A;  3EVU A;  4YGB B;  1S26 D;  3LK0 A;  5G08 A;  2CTN A;  3MSE B;  1YTZ C;  1SCM C;  1PSB A;  4XYN A;  1CFP A;  2ZFD A;  4GGN A;  1C7W A;  3F45 A;  3M0W A;  2F2P A;  2GGM A;  3QRX A;  1YVH A;  2LM5 A;  3SIA A;  1PVA A;  5GQQ C;  4YGD B;  4NDB A;  2JZI A;  3EVV A;  4M2O A;  2LUX A;  4ICB A;  1W7J B;  4E68 A;  1KFX S;  2I18 A;  1DMO A;  2AMI A;  4ORC B;  2KAV A;  1Y1U A;  3PLF B;  3TS5 B;  1NX0 A;  4MVF A;  1BR4 B;  1JFK A;  5TNC A;  2EGD A;  1DJX A;  2FJU B;  2Y5I A;  1B8C A;  2BL0 C;  3NSL A;  1PK0 D;  4N1G A;  5IBW A;  1KWO B;  5CSI A;  1OSA A;  1BT6 A;  1K95 A;  1RRO A;  5HLO A;  4DRW A;  3O78 A;  1JBA A;  2KOT A;  3GK1 A;  1CDN A;  3JVT B;  3WNX B;  3SIB A;  5ER5 A;  1ODB A;  1J7P A;  2LMU A;  3CR2 A;  2LLT A;  1N0Y A;  1Y1A A;  3WXA A;  3DF0 A;  3C1V A;  3JTD C;  1NWD A;  3GOF A;  1CLM A;  2COL B;  5DKN A;  5KTY A;  4FTG A;  2NLN A;  2LAN A;  3OB1 B;  4GNK B;  1YX8 A;  1JWD A;  1NSH A;  1B1G A;  2LMV A;  2K7O A;  4QJ5 B;  3SG4 A;  1UHH A;  2JC2 A;  2LUC A;  3GK4 X;  5AAN A;  1IQ5 A;  1K96 A;  2LHL A;  2Q4U A;  2LP3 A;  1F71 A;  3ZWH A;  1J55 A;  2L98 A;  1S1E A;  3TS5 C;  3E3R A;  2OTG C;  2JTT A;  2BBN A;  1CMG A;  3KHE A;  2K7D A;  3PAL A;  1QV1 A;  2RGI A;  2LLS A;  2OPO A;  1KWO C;  1OMD A;  4JPZ B;  4UPG A;  4PE4 A;  2ZKM X;  4MBE A;  1J1E A;  1K9P A;  2JXL A;  1XK4 C;  3CS1 A;  2PVB A;  2KQ6 A;  2WC8 A;  1UP5 A;  2M49 B;  3HCM A;  4MRY A;  3JVT C;  1K93 D;  3BOW A;  2ZRS A;  3CTN A;  1K2H A;  2K8M B;  2HPS A;  4BY5 A;  2LP2 A;  4TNC A;  4HRH A;  4ORA B;  2KNE A;  2LVJ A;  2KSP A;  1E8A A;  3BUX B;  4NDD A;  1SCM B;  1L7Z A;  1V1F A;  3BXK A;  1S6C A;  2AUC A;  3VRQ A;  1DF0 A;  1Q80 A;  1MF8 B;  1S3P A;  1GGW A;  1L2O B;  1MHO A;  1QIW A;  1AVS A;  1BR1 B;  1RFJ A;  1F54 A;  2ZRT A;  2K61 A;  2Q91 A;  1MXE A;  2V53 A;  1B7T Z;  2CXJ A;  2KYC A;  2NCP A;  2FOT A;  4N5X A;  3VRR A;  1EJ3 A;  2HQ8 A;  3A4U B;  1QXP A;  2CNP A;  4A4C A;  2WCF A;  1J7Q A;  2ZN8 A;  3EKJ A;  4CLN A;  2KAX A;  3I5H C;  3PM8 A;  1ALV A;  3DF0 B;  2EHB A;  1GGZ A;  2BEC A;  3PSR A;  1AHR A;  1A75 A;  1QX5 B;  2LVV A;  1BU3 A;  1LIN A;  2LLU A;  3DVM A;  1K94 A;  1DVI A;  2JTZ A;  2DOQ A;  3WHT B;  1GJY A;  3JTD B;  1YUR A;  4HSZ A;  1SL9 A;  3CGA A;  4C0K A;  1LA0 A;  1SRA A;  2A4J A;  3NSI A;  1XA5 A;  1HQV A;  3KPX A;  1OZS A;  2ZNE A;  2KFH A;  1WY9 A;  2ISD A;  2LE9 B;  1EH2 A;  3NXA A;  4WQ3 A;  2F33 A;  1EG3 A;  2MJW B;  4L9M A;  4AQI A;  1CFD A;  3IF7 A;  1DJH A;  2JPT A;  1L2O C;  1QS7 A;  1BJF A;  2IS9 A;  1CLL A;  3VRP A;  1IQ3 A;  1CTR A;  2MBX A;  4PHJ A;  2LHI A;  3AKA A;  2OTG B;  4MN0 A;  1J1D A;  2H61 A;  1K90 D;  3SG2 A;  1CKK A;  1NYA A;  3O4Y A;  1C07 A;  3FWB A;  5KU1 A;  2PRU A;  3TZ1 A;  1KQM B;  2M29 A;  3IQO A;  3BOW B;  1G8I A;  1QTX A;  2L4I A;  3SG7 A;  2L4H A;  1XYD A;  3PN7 B;  2MLF C;  1EXR A;  2SAS A;  2ZND A;  1A29 A;  2QPT A;  1XFX O;  1TNP A;  1R6P A;  4D1E A;  1NX2 A;  2O5G A;  3AKB A;  3CR5 X;  3DVK A;  4OCI A;  2L0P A;  3D0Y B;  3FS7 A;  3CZT X;  1OOJ A;  3CWG A;  1FF1 A;  3VRN A;  1DF0 B;  1KSM A;  3OHM B;  4PE1 A;  1NPQ A;  4M2P A;  1HT9 A;  2K7C A;  3BUW B;  1IG5 A;  3BUO B;  2KHN A;  1XO5 A;  4JWQ A;  5D7F A;  2PSR A;  4PHM A;  1JF2 A;  1KK7 Y;  2LMT A;  1NCX A;  2M7N A;  1XFY O;  4YI9 A;  1XFV O;  2G9B A;  1FPW A;  1DJI A;  1SK6 D;  3KEV A;  1BG1 A;  2LV7 A;  2PAS A;  4AQJ A;  5PAL A;  4CFQ A;  3ZNI A;  2G2B A;  4DCK A;  2BBM A;  1KK7 Z;  1SY9 A;  5HYD A;  4USL A;  2BCX A;  1TRF A;  1XFZ O;  2LCP A;  1UHJ A;  3GK2 A;  4YBH B;  1QX7 A;  4QJ3 B;  2NCO A;  1A75 B;  1SW8 A;  2LC5 A;  1G4Y R;  2CCM A;  2Y1N A;  3EVR A;  1A03 A;  3SG6 A;  3LL8 B;  3TDU A;  5I2O A;  4MZK A;  3I5H B;  1KQM C;  1BF5 A;  2WOS A;  4P2Y B;  3IQQ A;  1H8B A;  1BOD A;  3PN7 C;  4QJ4 B;  4Q04 A;  3ICB A;  1RTP 1;  1UHI A;  2I2R E;  1DGV A;  2MRD A;  2M1K B;  1AUI B;  1ZFS A;  1LKJ A;  1IGV A;  2JQ6 A;  2KGB C;  1LVC D;  1NIW A;  1QLS A;  4I5J A;  1YUT A;  1TCF A;  1NCZ A;  3AAK A;  2M1U A;  3K21 A;  2P6B B;  1WRK A;  1TNW A;  1W7I B;  4PDZ A;  1TTX A;  3EKH A;  5JJG A;  4YRU A;  3EK7 A;  1VRK A;  2JXC A;  2NZ0 A;  2QAC A;  3D0Y A;  1IKU A;  1N65 A;  2KI6 D;  4NQG A;  2MLE C;  1B7T Y;  1PAL A;  1FBV A;  4JQ0 D;  1DJW A;  1REC A;  4YGC B;  5FYX A;  2M9G A;  1AJ4 A;  5HLV A;  1SBJ A;  3SG3 A;  2WND A;  3KO0 A;  2F8P A;  2JOJ A;  1BMO A;  5JOL A;  1X02 A;  1LA3 A;  5K89 A;  1XVJ A;  2HF5 A;  4YI8 A;  1FI6 A;  1QVI Z;  3SG5 A;  1DTL A;  2BE6 A;  1PRW A;  2GGZ A;  3O2P A;  1BLQ A;  5HKZ A;  2JNF A;  1SPY A;  1DJG A;  3H4S E;  2K2A A;  1UHK A;  1U5I A;  1K9K A;  1IJ6 A;  5CSJ A;  1NX1 A;  4PHN A;  4GBA A;  1LXF C;  4M2Q A;  2L51 A;  1WDC C;  1QAS A;  1PSR A;  2AAO A;  2BKH B;  4MZL A;  1DGU A;  2M97 A;  1OQP A;  2D8N A;  4BY4 A;  1SNL A;  1D1O A;  3KF9 A;  4HRE E;  4HRG A;  1QJT A;  3D10 A;  1F8H A;  1A2X A;  3RLZ A;  2K2F A;  4PHK A;  1A4P A;  1WRL A;  2JUL A;  1TN4 A;  2JRF A;  1ALW A;  1Y0V H;  1SYM A;  4ZCV A;  3OB2 B;  4A4B A;  1WRZ A;  1ZMZ A;  2KDH A;  1J7O A;  5CPV A;  1MR8 A;  2Y1M A;  4DS7 A;  1S6J A;  1IRJ A;  4GPL B;  2KYF A;  3OX5 A;  1KFU L;  2H61 C;  2R2I A;  1YX7 A;  3NSO A;  1SMG A;  3WHU B;  4R1E A;  3TDI A;  1XFW O;  4AOM A;  3CLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...