2H61C

X-ray structure of human ca2+-loaded s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 34
structure length 90
sequence length 90
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61C00
3AAJA 2PSRA 1TIZA 2ZN8A 2M7LA 1KWOC 2BECA 1AK8A 4I5LB 2KAXA 2L4HA 4PHJA 2H2KA 1NX1A 2EC6C 2LMTA 3EVVA 3LLEA 5BPJA 4A4CA 3OX6A 4ZCVA 2PVBA 1BMOA 1IQ3A 3VRRA 2BBMA 2K61A 4USLA 1CTRA 3EK4A 3KHEA 3JTDC 1BLQA 1DJIA 3SG5A 1BG1A 4GGNA 1XYDA 1IQ5A 2HF5A 4ICBA 1PVAA 4D1EA 1ALVA 4PE0A 2BKIB 1M39A 4YBHB 4GPLB 2K0JA 4QJ5B 1QLSA 3LCPC 3NSIA 2M29A 1NX0A 1K93D 5TNCA 1J1EA 4L9MA 4NDBA 2JNXA 3CLNA 1SNLA 1A75A 4YGAA 1R6PA 1LVCD 1PK0D 3EVUA 3PN7B 1CMFA 1UHNA 3GK2A 2M1KB 1J7QA 4IL1A 2CT9A 3HX4A 2HETA 2KYFA 2M9GA 2Y4QA 3OB1B 4PE7A 1TNPA 4C0JA 3H4SE 1IKUA 3D10A 4CPVA 1LA3A 5D69A 4QJ3B 3OB2B 5CSIA 4OV2A 5KTYA 2KFFA 4M2QA 5AFPA 1MQ1A 3NXAA 2Q91A 2JRFA 1SR6C 1DJXA 2JNFA 3WNXB 1F55A 2KGRA 3GK4X 2I2RE 1AVSA 2E6WA 1IJ5A 1JFKA 2JPTA 2P6BB 4MRYA 1XK4A 1NCYA 2JOJA 2ZRSA 5I2LA 2JXCA 2JT0A 5I2QA 3TDIA 1NYAA 1SRAA 1C07A 1CM1A 1QJTA 2LCPA 1OOJA 2LVVA 4HRGA 1H8BA 2FJUB 2LE9B 1DJZA 1OZOA 1MWNA 1OMRA 1RROA 4DS7A 2LC5A 3VGOA 4HRHA 3TS5B 4DUQA 2WCBA 2KAYA 4E68A 3BQ3A 4JQ0D 3VRNA 2LP2A 4CFQA 1TCOB 1GJYA 5HLVA 1AJ4A 1EXRA 3E3RA 4QJ4B 1PSRA 3FS7A 3PATA 1TRFA 1DF0A 1NP8A 2FCDA 2KI4B 2PRUA 3SG4A 1KQMB 4GAOA 4PDZA 1NX2A 1G33A 4JPZB 3ZWHA 1QS7A 1UURA 3BUXB 2LUCA 1B8RA 2R2IA 1DGUA 1IG5A 4YGCB 4AOMA 3TDZA 1B8CA 1BJFA 2ZRTA 1FPWA 1GGZA 1DJGA 1FBVA 2M3WA 5AANA 1W7JB 1A2XA 1YX8A 2CTNA 3PN7C 4P2YB 1DF0B 1BT6A 4OVNF 2M1UA 2L0PA 4PCWA 4MVFA 3SG6A 1UHHA 2LVKA 1K96A 3KPXA 3PFVA 2KNEA 2BL0C 1CNPA 3VRQA 1WLMA 2ZKMX 1DJHA 4PE4A 4CLNA 3ICBA 1Y1AA 1TTXA 2LLTA 1DT7B 3FIAA 1QIVA 1VRKA 5JJGA 1DVIA 3I5GB 4OKHA 5D7FA 1DGVA 2M0RA 4MN0A 1L2OC 1KFXL 4DRWA 2JU0A 3PALA 1CFFA 1XFVO 1EJ3A 1K2HA 2K8MB 2HPSA 3NSOA 1J7OA 4ORBB 1Y1UA 1YRUB 2Q4UA 2G2BA 2K2FA 5AERA 1PALA 2M7NA 1WRKA 4HREE 4R1EA 2MJWB 3PM8A 5K89A 2WC8A 3CZTX 1FI5A 1SCMB 2BKHB 2F3ZA 1XFUO 2L2EA 2JWWA 2BCBA 1PSBA 3TUYB 1JWDA 4MEWA 5I8NA 2JT3A 1AJ5A 3GOFA 4DCKA 1LKJA 2ISDA 1XK4C 2LANA 1UP5A 3TS5C 2KBIA 1OMVA 3EKJA 1NCXA 3AKBA 2FOTA 3IQOA 2SASA 2LP3A 2WOSA 3IQQA 3KEVA 5JOLA 1EG3A 1WLZA 2COLB 1MR8A 3KO0A 2KDHA 2BBNA 2PALA 2EHBA 3I5HB 1UWOA 2KI4C 5HKWA 1UUSA 2KI6C 1JF0A 2MLFC 1IH0A 2KBMA 2BCXA 1SL9A 1ZACA 3CWGA 2I94A 2VRGA 3EK8A 1K95A 1YVHA 1QIWA 1W7IB 4PE1A 2LMVA 1BU3A 4XJKB 2LUXA 2L5XB 4PHMA 3D0YA 3EK7A 1ZFSA 1B4CA 1Y0VH 1E8AA 4YRUA 2WCFA 2L4IA 1L7ZA 1WDCB 1SK6D 4NDDA 2M8UA 4FTGA 3O78A 1U5IA 1CLLA 3NSLA 4GGFA 1F4QA 1SBJA 2JQ6A 2NXQA 4GUKA 3D0YB 5HYDA 1TNWA 3BUNB 3M0WA 3RM1A 1KK8C 1KQVA 2LNKA 2JT8A 2LVIA 3I5GC 4OCIA 2JC2A 1K9PA 1WY9A 2JTTA 4XYNA 1RECA 5PALA 5J3XA 3ZNIA 4ETOA 2GV5A 1AHRA 2MAZA 5GQQC 4HSZA 1H4BA 2OPOA 2PMYA 4U8DA 3VROA 3SG3A 3MSEB 1U5IB 2K7CA 1S1EA 2LAPA 1CB1A 1J7RA 1OSAA 1TCFA 4AQJA 2HQWA 3LK0A 1K9UA 2ZNEA 3VRPA 1QVIY 1A4PA 4CFRA 1OMDA 1MHOA 1HT9A 1NUBA 1NCZA 1XA5A 2EC6B 3EVRA 3QRXA 4N1FA 4WQ3A 2F33A 1NSHA 2KOTA 1CDLA 4GNKB 5AEQA 1KFXS 2JULA 4YGBB 2CXJA 1AUIB 1G4YR 1QX7A 4Q04A 4BY5A 1B9AA 5HKZA 4N1GA 1YX7A 2NZ0A 4I5JA 1DMOA 1XFYO 1NX3A 1TNQA 2GGZA 5IBWA 2H61A 1S5GY 4C0KA 1F4OA 2K2AA 2BCAA 3RLZA 1OQPA 2K7OA 1FI6A 1SL8A 1K9KA 2M97A 1QXPA 1PVBA 1XFXO 2M49B 3DD4A 3O4YA 1YUTA 2KFHA 2KGBC 1J1DA 2JXLA 1A29A 1J55A 1M63B 3EKHA 4MZJA 5ER4X 1CDPA 1F71A 1YTZC 3WHTB 2NCPA 1QX5B 1LINA 5DKNA 1WDCC 2BE6A 2K7DA 4YGDB 1B8LA 2WCEA 1UHKA 1UHJA 4YI9A 1G8IA 2Y1MA 1MXEA 1F70A 1KFUS 1MUXA 1K94A 2DOQA 4MZLA 4N5XA 3SIBA 1EH2A 1LXFC 3TDUA 3DVJA 4MRXA 1RWYA 5HKYA 1SR6B 2WORA 1B1GA 1V1FA 3O6BA 1SYMA 1XO5A 3HCMA 2NCOA 1SKTA 4UPGA 1SY9A 5DKQA 1F8HA 5B8IB 2MLEC 1KK7Y 2TN4A 2JTZA 1ZMZA 3CTNA 4DIRA 4ORCB 1K8UA 4GGFC 1C7VA 1QLKA 4PHKA 1KK7Z 1JBAA 2OTGB 1KSMA 3SG7A 1F54A 4XJKA 3BOWB 1CKKA 1DJYA 2F8PA 2O5GA 2WNDA 3CR4X 1TN4A 1KSOA 4P5OE 5CPVA 2V53A 3O2PA 3IF7A 4I5KA 1KFUL 2OS8B 1Y6WA 4AQIA 3TUYC 1KQMC 1YUSA 4OR9B 5DKRA 3A8RA 1CDMA 1IRJA 3I5FB 3LL8B 1ODBA 4GFTA 4YI8A 3F45A 3DVKA 2AUCA 1JUOA 3OHMB 2AMIA 1FW4A 2LMUA 3JVTB 2NLNA 2SCPA 2Y5IA 2G9BA 1MF8B 3I5IB 1BOCA 1R2UA 1B7TY 1BR4B 3GK1A 1PRWA 2EGDA 2KYCA 3PSRA 1MXLC 5CSJA 1M45A 3BUWB 4PALA 1SMGA 2O60A 2QPTA 1B7TZ 3A4UB 2MRDA 1UHIA 2L98A 1PULA 1SL7A 2MA2A 1IWQA 1EG4A 2F2PA 1D1OA 4PHNA 3CR2A 1QX2A 3LK1A 1CFDA 2H61C 2LLUA 1JF2A 1WRLA 2LHLA 3PLFB 1OE9B 1CLMA 2BL0B 1XFWO 1CLBA 2KAVA 1M31A 4TNCA 5ER5A 1OZSA 5G08A 1S3PA 4MZKA 1A03A 4MSPA 1J7PA 1NIWA 1A75B 4GBAA 2IS9A 3DF0A 1S6JA 1RFJA 4FQOA 2AAOA 2ZN9A 1BR1B 5FYXA 1L2OB 1C7WA 1TOPA 2CCMA 1V1GA 3BYAA 1NPQA 1QASA 1SCMC 5HLOA 1KWOB 1QTXA 4WQ2A 3CR5X 4YGEB 3BUMB 4I5NB 1EL4A 4A4BA 2QACA 1QVIZ 2Y1NA 1YURA 3DVEA 3BUOB 2KFGA 2OTGC 1S6IA 3C1VA 3DF0B 2MBXA 2I18A 1FF1A 1NWDA 2A4JA 1GGWA 1QV1A 5AXIA 1ZUZA 2LLSA 2LVJA 3JTDB 5CSNA 1ALWA 3SIAA 1WRZA 2RGIA 3DVMA 1YVLA 1K90D 2KI6D 1GQMA 2PASA 1B47A 2LM5A 2E30A 4NQGA 3TZ1A 3I5HC 2OS8C 1KCYA 1SCVA 1DTLA 1IGVA 4NDCA 1QATA 1SPYA 2KQ6A 3I5FC 5F6TA 3WHUB 1QV0A 1BODA 1S5GZ 4ORAB 1BF5A 1N2DA 1AP4A 3FWCA 2KHNA 4M2PA 3OX5A 2MHHA 5KU1A 2GGMA 1CMGA 5KSZA 4MBEA 3CGAA 2K7BA 3JVTC 3KF9A 1CM4A 4F0ZB 2L50A 2LV7A 1JC2A 1JFJA 3FWBA 2FCEA 3I5IC 3BXKA 5CSFA 1LA0A 2KQYA 4JWQA 4BY4A 1CFPA 1RJVA 2D8NA 3K21A 2BE4A 2CBLA 1DJWA 2B1UA 3SJSA 1RK9A 1S6CA 1SW8A 3NSKA 3OP0A 4ZCUA 4WRIA 2CNPA 2L51A 1TNXA 1HQVA 2F2OA 1S36A 4CIDA 2KSPA 2F3YA 4MLWA 1IJ6A 1Y1XA 3AAKA 3SG2A 3BOWA 1N0YA 2I7AA 1CFCA 4C0LA 1S26D 3AKAA 2LHIA 1CDNA 1ZOTB 1Q80A 1XVJA 1X02A 1KK8B 1N65A 1YRTB 1YR5A 2HQ8A 1YUUA 2JZIA 4M2OA 3CS1A 3WXAA 1RTP1 2ZFDA 2ZNDA 5I2OA 1M46A 1XFZO 1JSAA
chains in the Genus database with same CATH superfamily
2YGUA 3AAJA 1W9ZA 2PSRA 1TIZA 2ZN8A 2M7LA 1KWOC 2BECA 5FI2A 1AK8A 4I5LB 2KAXA 3OGNA 2L4HA 4PHJA 2H2KA 1NX1A 2EC6C 2LMTA 3EVVA 3LLEA 5BPJA 4A4CA 3OX6A 4ZCVA 2PVBA 1BMOA 1IQ3A 3VRRA 2BBMA 3DZTA 2K61A 4USLA 1CTRA 3EK4A 3KHEA 3JTDC 4OZDA 1BLQA 1DJIA 3SG5A 1BG1A 4GGNA 1XYDA 1IQ5A 2HF5A 4ICBA 1PVAA 4D1EA 1ALVA 4PE0A 2BKIB 1M39A 4YBHB 4GPLB 2K0JA 4QJ5B 1QLSA 3LCPC 3NSIA 2M29A 1NX0A 1K93D 5TNCA 1J1EA 4L9MA 2QDIA 4NDBA 2JNXA 3CLNA 3BFHA 1SNLA 3PJIA 1A75A 4YGAA 1R6PA 1LVCD 3BFBA 1PK0D 3EVUA 2WC6A 3PN7B 1UHNA 1DEKA 1CMFA 3GK2A 2M1KB 1J7QA 4IL1A 2CT9A 3HX4A 2HETA 3BFAA 2KYFA 2M9GA 2Y4QA 3OB1B 4PE7A 1TNPA 4C0JA 3H4SE 1IKUA 1DQEA 3CDNA 3D10A 4CPVA 1LA3A 5D69A 4QJ3B 5FI7A 3OB2B 5CSIA 4OV2A 5KTYA 2KFFA 2P71A 4M2QA 5AFPA 1MQ1A 3NXAA 2Q91A 2JRFA 1SR6C 1Z2CB 1DJXA 2JNFA 3WNXB 1F55A 2KGRA 3GK4X 2I2RE 1AVSA 2E6WA 1IJ5A 1JFKA 2JPTA 2P6BB 4MRYA 3S0AA 1XK4A 2FJYA 1NCYA 3CZ0A 3B6XA 2JOJA 2ERBA 2ZRSA 5I2LA 2JXCA 2JT0A 5I2QA 4INWA 3TDIA 1NYAA 1SRAA 1C07A 1CM1A 1QJTA 2LCPA 3B88A 2K60A 1OOJA 2LVVA 4HRGA 1H8BA 2FJUB 2LE9B 1DJZA 1OZOA 1MWNA 1OMRA 3VB1A 1RROA 4DS7A 2LC5A 3VGOA 4HRHA 3TS5B 4DUQA 2WCBA 2WCLA 2KAYA 4E68A 3BQ3A 4JQ0D 3VRNA 2LP2A 4CFQA 1TCOB 1GJYA 5HLVA 1AJ4A 1EXRA 3E3RA 2H8VA 4QJ4B 1PSRA 3FS7A 3PATA 3R1VA 1TRFA 1DF0A 1NP8A 2FCDA 2KI4B 2PRUA 3SG4A 1KQMB 4GAOA 4PDZA 3D76A 1NX2A 1OOIX 3NGVA 1G33A 4JPZB 3ZWHA 1QS7A 1UURA 3BUXB 2LUCA 1B8RA 2R2IA 1DGUA 1IG5A 4YGCB 4AOMA 3TDZA 1Z4HA 1B8CA 1BJFA 2ZRTA 1FPWA 1GGZA 1DJGA 1FBVA 3S0BA 2M3WA 5AANA 1W7JB 1A2XA 1YX8A 2CTNA 3PN7C 4P2YB 1DF0B 1BT6A 4OVNF 2M1UA 2L0PA 4PCWA 4MVFA 3SG6A 1UHHA 2LVKA 1K96A 3KPXA 1P28A 2KNEA 3PFVA 2BL0C 3D78A 2L2CA 4FQTA 1CNPA 3VRQA 1WLMA 2ZKMX 1DJHA 4PE4A 4CLNA 2KLDA 3ICBA 1Y1AA 1TTXA 2LLTA 1DT7B 3FIAA 1QIVA 3SS4A 1VRKA 5JJGA 1DVIA 3I5GB 2WCJA 3V2LA 4OKHA 5D7FA 3O4XA 1DGVA 2M0RA 4MN0A 1L2OC 1KFXL 4DRWA 2JU0A 3PALA 1CFFA 1XFVO 1EJ3A 1K2HA 2K8MB 4PT1A 2HPSA 3NSOA 1J7OA 4ORBB 1Y1UA 1YRUB 2Q4UA 2G2BA 2K2FA 3D74A 1PALA 5AERA 2M7NA 1WRKA 4HREE 4R1EA 2MJWB 3PM8A 5K89A 2WC8A 3CZTX 1FI5A 1SCMB 2BKHB 2F3ZA 1XFUO 1TUJA 3SS5A 2L2EA 3PM2A 2JWWA 2BCBA 1PSBA 3TUYB 1JWDA 4MEWA 4INXA 3B7AA 2JT3A 5I8NA 1AJ5A 3GOFA 4DCKA 1LKJA 2ISDA 1XK4C 2LANA 1UP5A 2QEHA 2KBIA 3TS5C 1OMVA 3EKJA 1NCXA 1OW4A 3AKBA 2FOTA 3IQOA 2SASA 2LP3A 2WOSA 3IQQA 3KEVA 5JOLA 3SS3A 1EG3A 1WLZA 2COLB 1MR8A 3KO0A 3RZSA 2KDHA 2BBNA 2PALA 2EHBA 2PYQA 1UWOA 2KI4C 2QEOA 3I5HB 3NHTA 5HKWA 1UUSA 2KI6C 1JF0A 2MLFC 3B87A 2KBMA 2BCXA 1IH0A 1SL9A 1ZACA 3CWGA 2I94A 2VRGA 3DYEA 3EK8A 1K95A 1YVHA 1QIWA 1W7IB 4PE1A 2LMVA 1BU3A 4XJKB 2LUXA 4KYNA 3CABA 2L5XB 4PHMA 3D0YA 3EK7A 1ZFSA 1B4CA 2PQLA 1Y0VH 1E8AA 4YRUA 2BAPA 2WCFA 2L4IA 1L7ZA 2KLEA 1WDCB 1SK6D 4NDDA 2M8UA 1C3YA 4FTGA 3O78A 1DC1A 1U5IA 1CLLA 3NSLA 4GGFA 1F4QA 1SBJA 2JQ6A 2NXQA 4GUKA 3D0YB 5HYDA 1TNWA 3BUNB 3M0WA 3RM1A 1KK8C 1KQVA 1LS8A 3BJHA 2LNKA 2JT8A 2LVIA 3B86A 3I5GC 4OCIA 2JC2A 1K9PA 1WY9A 2JTTA 3IVTA 4XYNA 2WCMA 1RECA 5PALA 5J3XA 3S0DA 3ZNIA 2GV5A 1AHRA 2MAZA 5GQQC 4HSZA 4ETOA 2OPOA 2PMYA 4U8DA 1H4BA 3L4AA 3VROA 3SG3A 3MSEB 1U5IB 2K7CA 1S1EA 2LAPA 1CB1A 2QEVA 1J7RA 1OSAA 1TCFA 4AQJA 2HQWA 3LK0A 1K9UA 3UNWA 3K1EA 2ZNEA 3VRPA 1QVIY 1A4PA 3S0EA 4CFRA 1OMDA 1MHOA 1HT9A 1NUBA 1NCZA 1XA5A 2EC6B 2KPHA 3EVRA 3QRXA 4N1FA 4WQ3A 1OOFA 2F33A 1NSHA 2KOTA 1CDLA 4GNKB 1M46A 5AEQA 1KFXS 2JULA 4YGBB 2CXJA 1AUIB 1G4YR 1QX7A 4Q04A 4BY5A 1B9AA 3CYZA 4N1GA 5HKZA 1YX7A 2NZ0A 4I5JA 1DMOA 1XFYO 1NX3A 1TNQA 2GGZA 5IBWA 1OOGA 2H61A 1S5GY 4C0KA 1F4OA 2K2AA 2BCAA 3RLZA 1OQPA 2K7OA 1FI6A 1SL8A 1K9KA 2M97A 3CZ1A 1QXPA 1PVBA 1XFXO 2P70A 2M49B 3DD4A 3O4YA 1YUTA 2KFHA 2KGBC 1J1DA 2QEBA 2JXLA 1A29A 1J55A 1M63B 3EKHA 4MZJA 5ER4X 1CDPA 3DY9A 1YTZC 1F71A 3WHTB 2NCPA 1QX5B 5EL2A 1LINA 5DKNA 1WDCC 2BE6A 2K7DA 4YGDB 1B8LA 2WCEA 1UHKA 1UHJA 4YI9A 1G8IA 2Y1MA 1MXEA 1F70A 1KFUS 1MUXA 1K94A 2DOQA 3EG5B 4MZLA 4N5XA 3SIBA 5DICA 1EH2A 1LXFC 3TDUA 2JPOA 3DVJA 4MRXA 1RWYA 5HKYA 1SR6B 2WORA 3R1PA 3Q8IA 1B1GA 1V1FA 3O6BA 3D73A 1SYMA 3R1OA 1XO5A 3HCMA 2NCOA 1SKTA 4UPGA 1SY9A 3N7HA 1ORGA 5DKQA 1F8HA 5B8IB 2MLEC 2L5YA 1KK7Y 2TN4A 2JTZA 1ZMZA 3CTNA 4DIRA 4ORCB 1K8UA 4GGFC 1C7VA 1QLKA 4PHKA 1KK7Z 1JBAA 3S0FA 2OTGB 5FI6A 1KSMA 3CZ2A 3SG7A 1F54A 4XJKA 3BOWB 1CKKA 1DJYA 5HL1A 2F8PA 2O5GA 2WNDA 3CR4X 2GTEA 1TN4A 1KSOA 3R72A 4P5OE 5CPVA 2V53A 3O2PA 3IF7A 4I5KA 1KFUL 2OS8B 1Y6WA 4AQIA 1OOHA 3TUYC 1KQMC 1YUSA 4OR9B 5DKRA 3A8RA 1CDMA 1IRJA 3I5FB 3LL8B 1ODBA 4GFTA 4YI8A 3F45A 3DVKA 2AUCA 1JUOA 3OHMB 2AMIA 1FW4A 2LMUA 3JVTB 2NLNA 2SCPA 3D77A 2Y5IA 2G9BA 1MF8B 3I5IB 1BOCA 1R2UA 1B7TY 1BR4B 3GK1A 1PRWA 2EGDA 2KYCA 3PSRA 1MXLC 5CSJA 1M45A 1DELA 3BUWB 4PALA 1SMGA 2O60A 2QPTA 1B7TZ 2WC5A 3A4UB 2MRDA 1UHIA 2L98A 1PULA 1SL7A 2MA2A 1IWQA 1EG4A 2F2PA 1D1OA 4PHNA 3CR2A 1QX2A 3LK1A 1CFDA 2H61C 2LLUA 1JF2A 1TWOA 1WRLA 2LHLA 3PLFB 1OE9B 1CLMA 2BL0B 2BNXA 4JKTA 1XFWO 1CLBA 2KAVA 1M31A 1TUZA 3FE8A 4TNCA 1OZSA 5ER5A 5G08A 1S3PA 4MZKA 1A03A 4MSPA 1J7PA 3NHIA 3OBVA 1NIWA 1A75B 4GBAA 2IS9A 3DF0A 1S6JA 1RFJA 4FQOA 2AAOA 4IJ7A 2ZN9A 1BR1B 5FYXA 1L2OB 1C7WA 1TOPA 2CCMA 1V1GA 3BYAA 1NPQA 1GM0A 1QASA 1SCMC 5HLOA 1KWOB 1QTXA 4WQ2A 3CR5X 4YGEB 3BUMB 4I5NB 1EL4A 4A4BA 2QACA 1QVIZ 2Y1NA 1YURA 3DVEA 3BUOB 2KFGA 2OTGC 1S6IA 3C1VA 3DF0B 2MBXA 2WCKA 5I94A 2I18A 3D75A 3L47A 1NWDA 1FF1A 2A4JA 1GGWA 1QV1A 3FE9A 5AXIA 1ZUZA 2LLSA 2LVJA 3JTDB 5CSNA 1ALWA 3SIAA 1WRZA 2RGIA 3DVMA 1YVLA 1K90D 2KI6D 1GQMA 2PASA 1B47A 2LM5A 2E30A 4NQGA 3TZ1A 3I5HC 5D3OA 2OS8C 2WCHA 1KCYA 1SCVA 1SSEB 3L4LA 1DTLA 1IGVA 4NDCA 1QATA 1SPYA 1IIOA 2KQ6A 3I5FC 5F6TA 3WHUB 1QV0A 1BODA 1S5GZ 3FE6A 4ORAB 1BF5A 1N2DA 1AP4A 3FWCA 2KHNA 4M2PA 3OX5A 3S0GA 2MHHA 5KU1A 2GGMA 3DXLA 1CMGA 5KSZA 4MBEA 3CGAA 2K7BA 3JVTC 3KF9A 1CM4A 4F0ZB 2L50A 2LV7A 1JC2A 1JFJA 3FWBA 2FCEA 3I5IC 3BXKA 5CSFA 1LA0A 2KQYA 4JWQA 4BY4A 1CFPA 1RJVA 2D8NA 3K21A 1QWVA 2BE4A 2CBLA 1DJWA 2B1UA 3SJSA 1RK9A 1S6CA 1SW8A 3NSKA 3OP0A 4ZCUA 4WRIA 2CNPA 2L51A 1TNXA 1HQVA 2F2OA 1S36A 4CIDA 4F7FA 2KSPA 4JD9A 3UO9A 2F3YA 4MLWA 1IJ6A 1Y1XA 3AAKA 3SG2A 3BOWA 1N0YA 3QMEA 2I7AA 1CFCA 4C0LA 1S26D 3AKAA 2LHIA 1CDNA 1ZOTB 1C3ZA 1Q80A 1XVJA 1X02A 1KK8B 1N65A 1YRTB 1YR5A 2HQ8A 1YUUA 2JZIA 4M2OA 3CS1A 3WXAA 1RTP1 2ZFDA 2ZNDA 5I2OA 1XFRA 1T14A 1XFZO 1JSAA
chains in the Genus database with same CATH topology
3AAJA 2PSRA 1TIZA 2ZN8A 2M7LA 1KWOC 2BECA 1AK8A 4I5LB 2KAXA 2L4HA 4PHJA 2H2KA 1NX1A 2EC6C 2LMTA 3EVVA 3LLEA 5BPJA 4A4CA 3OX6A 4ZCVA 2PVBA 1BMOA 1IQ3A 3VRRA 2BBMA 2K61A 4USLA 1CTRA 3EK4A 3KHEA 3JTDC 1BLQA 1DJIA 3SG5A 1BG1A 4GGNA 1XYDA 1IQ5A 2HF5A 4ICBA 1PVAA 4D1EA 1ALVA 4PE0A 2BKIB 1M39A 4YBHB 4GPLB 2K0JA 4QJ5B 1QLSA 3LCPC 3NSIA 2M29A 1NX0A 1K93D 5TNCA 1J1EA 4L9MA 4NDBA 2JNXA 3CLNA 1SNLA 1A75A 4YGAA 1R6PA 1LVCD 1PK0D 3EVUA 3PN7B 1CMFA 1UHNA 3GK2A 2M1KB 1J7QA 4IL1A 2CT9A 3HX4A 2HETA 2KYFA 2M9GA 2Y4QA 3OB1B 4PE7A 1TNPA 4C0JA 3H4SE 1IKUA 3D10A 4CPVA 1LA3A 5D69A 4QJ3B 3OB2B 5CSIA 4OV2A 5KTYA 2KFFA 4M2QA 5AFPA 1MQ1A 3NXAA 2Q91A 2JRFA 1SR6C 1DJXA 2JNFA 3WNXB 1F55A 2KGRA 3GK4X 2I2RE 1AVSA 2E6WA 1IJ5A 1JFKA 2JPTA 2P6BB 4MRYA 1XK4A 1NCYA 2JOJA 2ZRSA 5I2LA 2JXCA 2JT0A 5I2QA 3TDIA 1NYAA 1SRAA 1C07A 1CM1A 1QJTA 2LCPA 1OOJA 2LVVA 4HRGA 1H8BA 2FJUB 2LE9B 1DJZA 1OZOA 1MWNA 1OMRA 1RROA 4DS7A 2LC5A 3VGOA 4HRHA 3TS5B 4DUQA 2WCBA 2KAYA 4E68A 3BQ3A 4JQ0D 3VRNA 2LP2A 4CFQA 1TCOB 1GJYA 5HLVA 1AJ4A 1EXRA 3E3RA 4QJ4B 1PSRA 3FS7A 3PATA 1TRFA 1DF0A 1NP8A 2FCDA 2KI4B 2PRUA 3SG4A 1KQMB 4GAOA 4PDZA 1NX2A 1G33A 4JPZB 3ZWHA 1QS7A 1UURA 3BUXB 2LUCA 1B8RA 2R2IA 1DGUA 1IG5A 4YGCB 4AOMA 3TDZA 1B8CA 1BJFA 2ZRTA 1FPWA 1GGZA 1DJGA 1FBVA 2M3WA 5AANA 1W7JB 1A2XA 1YX8A 2CTNA 3PN7C 4P2YB 1DF0B 1BT6A 4OVNF 2M1UA 2L0PA 4PCWA 4MVFA 3SG6A 1UHHA 2LVKA 1K96A 3KPXA 3PFVA 2KNEA 2BL0C 1CNPA 3VRQA 1WLMA 2ZKMX 1DJHA 4PE4A 4CLNA 3ICBA 1Y1AA 1TTXA 2LLTA 1DT7B 3FIAA 1QIVA 1VRKA 5JJGA 1DVIA 3I5GB 4OKHA 5D7FA 1DGVA 2M0RA 4MN0A 1L2OC 1KFXL 4DRWA 2JU0A 3PALA 1CFFA 1XFVO 1EJ3A 1K2HA 2K8MB 2HPSA 3NSOA 1J7OA 4ORBB 1Y1UA 1YRUB 2Q4UA 2G2BA 2K2FA 5AERA 1PALA 2M7NA 1WRKA 4HREE 4R1EA 2MJWB 3PM8A 5K89A 2WC8A 3CZTX 1FI5A 1SCMB 2BKHB 2F3ZA 1XFUO 2L2EA 2JWWA 2BCBA 1PSBA 3TUYB 1JWDA 4MEWA 5I8NA 2JT3A 1AJ5A 3GOFA 4DCKA 1LKJA 2ISDA 1XK4C 2LANA 1UP5A 3TS5C 2KBIA 1OMVA 3EKJA 1NCXA 3AKBA 2FOTA 3IQOA 2SASA 2LP3A 2WOSA 3IQQA 3KEVA 5JOLA 1EG3A 1WLZA 2COLB 1MR8A 3KO0A 2KDHA 2BBNA 2PALA 2EHBA 3I5HB 1UWOA 2KI4C 5HKWA 1UUSA 2KI6C 1JF0A 2MLFC 1IH0A 2KBMA 2BCXA 1SL9A 1ZACA 3CWGA 2I94A 2VRGA 3EK8A 1K95A 1YVHA 1QIWA 1W7IB 4PE1A 2LMVA 1BU3A 4XJKB 2LUXA 2L5XB 4PHMA 3D0YA 3EK7A 1ZFSA 1B4CA 1Y0VH 1E8AA 4YRUA 2WCFA 2L4IA 1L7ZA 1WDCB 1SK6D 4NDDA 2M8UA 4FTGA 3O78A 1U5IA 1CLLA 3NSLA 4GGFA 1F4QA 1SBJA 2JQ6A 2NXQA 4GUKA 3D0YB 5HYDA 1TNWA 3BUNB 3M0WA 3RM1A 1KK8C 1KQVA 2LNKA 2JT8A 2LVIA 3I5GC 4OCIA 2JC2A 1K9PA 1WY9A 2JTTA 4XYNA 1RECA 5PALA 5J3XA 3ZNIA 4ETOA 2GV5A 1AHRA 2MAZA 5GQQC 4HSZA 1H4BA 2OPOA 2PMYA 4U8DA 3VROA 3SG3A 3MSEB 1U5IB 2K7CA 1S1EA 2LAPA 1CB1A 1J7RA 1OSAA 1TCFA 4AQJA 2HQWA 3LK0A 1K9UA 2ZNEA 3VRPA 1QVIY 1A4PA 4CFRA 1OMDA 1MHOA 1HT9A 1NUBA 1NCZA 1XA5A 2EC6B 3EVRA 3QRXA 4N1FA 4WQ3A 2F33A 1NSHA 2KOTA 1CDLA 4GNKB 5AEQA 1KFXS 2JULA 4YGBB 2CXJA 1AUIB 1G4YR 1QX7A 4Q04A 4BY5A 1B9AA 5HKZA 4N1GA 1YX7A 2NZ0A 4I5JA 1DMOA 1XFYO 1NX3A 1TNQA 2GGZA 5IBWA 2H61A 1S5GY 4C0KA 1F4OA 2K2AA 2BCAA 3RLZA 1OQPA 2K7OA 1FI6A 1SL8A 1K9KA 2M97A 1QXPA 1PVBA 1XFXO 2M49B 3DD4A 3O4YA 1YUTA 2KFHA 2KGBC 1J1DA 2JXLA 1A29A 1J55A 1M63B 3EKHA 4MZJA 5ER4X 1CDPA 1F71A 1YTZC 3WHTB 2NCPA 1QX5B 1LINA 5DKNA 1WDCC 2BE6A 2K7DA 4YGDB 1B8LA 2WCEA 1UHKA 1UHJA 4YI9A 1G8IA 2Y1MA 1MXEA 1F70A 1KFUS 1MUXA 1K94A 2DOQA 4MZLA 4N5XA 3SIBA 1EH2A 1LXFC 3TDUA 3DVJA 4MRXA 1RWYA 5HKYA 1SR6B 2WORA 1B1GA 1V1FA 3O6BA 1SYMA 1XO5A 3HCMA 2NCOA 1SKTA 4UPGA 1SY9A 5DKQA 1F8HA 5B8IB 2MLEC 1KK7Y 2TN4A 2JTZA 1ZMZA 3CTNA 4DIRA 4ORCB 1K8UA 4GGFC 1C7VA 1QLKA 4PHKA 1KK7Z 1JBAA 2OTGB 1KSMA 3SG7A 1F54A 4XJKA 3BOWB 1CKKA 1DJYA 2F8PA 2O5GA 2WNDA 3CR4X 1TN4A 1KSOA 4P5OE 5CPVA 2V53A 3O2PA 3IF7A 4I5KA 1KFUL 2OS8B 1Y6WA 4AQIA 3TUYC 1KQMC 1YUSA 4OR9B 5DKRA 3A8RA 1CDMA 1IRJA 3I5FB 3LL8B 1ODBA 4GFTA 4YI8A 3F45A 3DVKA 2AUCA 1JUOA 3OHMB 2AMIA 1FW4A 2LMUA 3JVTB 2NLNA 2SCPA 2Y5IA 2G9BA 1MF8B 3I5IB 1BOCA 1R2UA 1B7TY 1BR4B 3GK1A 1PRWA 2EGDA 2KYCA 3PSRA 1MXLC 5CSJA 1M45A 3BUWB 4PALA 1SMGA 2O60A 2QPTA 1B7TZ 3A4UB 2MRDA 1UHIA 2L98A 1PULA 1SL7A 2MA2A 1IWQA 1EG4A 2F2PA 1D1OA 4PHNA 3CR2A 1QX2A 3LK1A 1CFDA 2H61C 2LLUA 1JF2A 1WRLA 2LHLA 3PLFB 1OE9B 1CLMA 2BL0B 1XFWO 1CLBA 2KAVA 1M31A 4TNCA 5ER5A 1OZSA 5G08A 1S3PA 4MZKA 1A03A 4MSPA 1J7PA 1NIWA 1A75B 4GBAA 2IS9A 3DF0A 1S6JA 1RFJA 4FQOA 2AAOA 2ZN9A 1BR1B 5FYXA 1L2OB 1C7WA 1TOPA 2CCMA 1V1GA 3BYAA 1NPQA 1QASA 1SCMC 5HLOA 1KWOB 1QTXA 4WQ2A 3CR5X 4YGEB 3BUMB 4I5NB 1EL4A 4A4BA 2QACA 1QVIZ 2Y1NA 1YURA 3DVEA 3BUOB 2KFGA 2OTGC 1S6IA 3C1VA 3DF0B 2MBXA 2I18A 1FF1A 1NWDA 2A4JA 1GGWA 1QV1A 5AXIA 1ZUZA 2LLSA 2LVJA 3JTDB 5CSNA 1ALWA 3SIAA 1WRZA 2RGIA 3DVMA 1YVLA 1K90D 2KI6D 1GQMA 2PASA 1B47A 2LM5A 2E30A 4NQGA 3TZ1A 3I5HC 2OS8C 1KCYA 1SCVA 1DTLA 1IGVA 4NDCA 1QATA 1SPYA 2KQ6A 3I5FC 5F6TA 3WHUB 1QV0A 1BODA 1S5GZ 4ORAB 1BF5A 1N2DA 1AP4A 3FWCA 2KHNA 4M2PA 3OX5A 2MHHA 5KU1A 2GGMA 1CMGA 5KSZA 4MBEA 3CGAA 2K7BA 3JVTC 3KF9A 1CM4A 4F0ZB 2L50A 2LV7A 1JC2A 1JFJA 3FWBA 2FCEA 3I5IC 3BXKA 5CSFA 1LA0A 2KQYA 4JWQA 4BY4A 1CFPA 1RJVA 2D8NA 3K21A 2BE4A 2CBLA 1DJWA 2B1UA 3SJSA 1RK9A 1S6CA 1SW8A 3NSKA 3OP0A 4ZCUA 4WRIA 2CNPA 2L51A 1TNXA 1HQVA 2F2OA 1S36A 4CIDA 2KSPA 2F3YA 4MLWA 1IJ6A 1Y1XA 3AAKA 3SG2A 3BOWA 1N0YA 2I7AA 1CFCA 4C0LA 1S26D 3AKAA 2LHIA 1CDNA 1ZOTB 1Q80A 1XVJA 1X02A 1KK8B 1N65A 1YRTB 1YR5A 2HQ8A 1YUUA 2JZIA 4M2OA 3CS1A 3WXAA 1RTP1 2ZFDA 2ZNDA 5I2OA 1M46A 1XFZO 1JSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAJ A;  2PSR A;  1TIZ A;  2ZN8 A;  2M7L A;  1KWO C;  2BEC A;  1AK8 A;  4I5L B;  2KAX A;  2L4H A;  4PHJ A;  2H2K A;  1NX1 A;  2EC6 C;  2LMT A;  3EVV A;  3LLE A;  5BPJ A;  4A4C A;  3OX6 A;  4ZCV A;  2PVB A;  1BMO A;  1IQ3 A;  3VRR A;  2BBM A;  2K61 A;  4USL A;  1CTR A;  3EK4 A;  3KHE A;  3JTD C;  1BLQ A;  1DJI A;  3SG5 A;  1BG1 A;  4GGN A;  1XYD A;  1IQ5 A;  2HF5 A;  4ICB A;  1PVA A;  4D1E A;  1ALV A;  4PE0 A;  2BKI B;  1M39 A;  4YBH B;  4GPL B;  2K0J A;  4QJ5 B;  1QLS A;  3LCP C;  3NSI A;  2M29 A;  1NX0 A;  1K93 D;  5TNC A;  1J1E A;  4L9M A;  4NDB A;  2JNX A;  3CLN A;  1SNL A;  1A75 A;  4YGA A;  1R6P A;  1LVC D;  1PK0 D;  3EVU A;  3PN7 B;  1CMF A;  1UHN A;  3GK2 A;  2M1K B;  1J7Q A;  4IL1 A;  2CT9 A;  3HX4 A;  2HET A;  2KYF A;  2M9G A;  2Y4Q A;  3OB1 B;  4PE7 A;  1TNP A;  4C0J A;  3H4S E;  1IKU A;  3D10 A;  4CPV A;  1LA3 A;  5D69 A;  4QJ3 B;  3OB2 B;  5CSI A;  4OV2 A;  5KTY A;  2KFF A;  4M2Q A;  5AFP A;  1MQ1 A;  3NXA A;  2Q91 A;  2JRF A;  1SR6 C;  1DJX A;  2JNF A;  3WNX B;  1F55 A;  2KGR A;  3GK4 X;  2I2R E;  1AVS A;  2E6W A;  1IJ5 A;  1JFK A;  2JPT A;  2P6B B;  4MRY A;  1XK4 A;  1NCY A;  2JOJ A;  2ZRS A;  5I2L A;  2JXC A;  2JT0 A;  5I2Q A;  3TDI A;  1NYA A;  1SRA A;  1C07 A;  1CM1 A;  1QJT A;  2LCP A;  1OOJ A;  2LVV A;  4HRG A;  1H8B A;  2FJU B;  2LE9 B;  1DJZ A;  1OZO A;  1MWN A;  1OMR A;  1RRO A;  4DS7 A;  2LC5 A;  3VGO A;  4HRH A;  3TS5 B;  4DUQ A;  2WCB A;  2KAY A;  4E68 A;  3BQ3 A;  4JQ0 D;  3VRN A;  2LP2 A;  4CFQ A;  1TCO B;  1GJY A;  5HLV A;  1AJ4 A;  1EXR A;  3E3R A;  4QJ4 B;  1PSR A;  3FS7 A;  3PAT A;  1TRF A;  1DF0 A;  1NP8 A;  2FCD A;  2KI4 B;  2PRU A;  3SG4 A;  1KQM B;  4GAO A;  4PDZ A;  1NX2 A;  1G33 A;  4JPZ B;  3ZWH A;  1QS7 A;  1UUR A;  3BUX B;  2LUC A;  1B8R A;  2R2I A;  1DGU A;  1IG5 A;  4YGC B;  4AOM A;  3TDZ A;  1B8C A;  1BJF A;  2ZRT A;  1FPW A;  1GGZ A;  1DJG A;  1FBV A;  2M3W A;  5AAN A;  1W7J B;  1A2X A;  1YX8 A;  2CTN A;  3PN7 C;  4P2Y B;  1DF0 B;  1BT6 A;  4OVN F;  2M1U A;  2L0P A;  4PCW A;  4MVF A;  3SG6 A;  1UHH A;  2LVK A;  1K96 A;  3KPX A;  3PFV A;  2KNE A;  2BL0 C;  1CNP A;  3VRQ A;  1WLM A;  2ZKM X;  1DJH A;  4PE4 A;  4CLN A;  3ICB A;  1Y1A A;  1TTX A;  2LLT A;  1DT7 B;  3FIA A;  1QIV A;  1VRK A;  5JJG A;  1DVI A;  3I5G B;  4OKH A;  5D7F A;  1DGV A;  2M0R A;  4MN0 A;  1L2O C;  1KFX L;  4DRW A;  2JU0 A;  3PAL A;  1CFF A;  1XFV O;  1EJ3 A;  1K2H A;  2K8M B;  2HPS A;  3NSO A;  1J7O A;  4ORB B;  1Y1U A;  1YRU B;  2Q4U A;  2G2B A;  2K2F A;  5AER A;  1PAL A;  2M7N A;  1WRK A;  4HRE E;  4R1E A;  2MJW B;  3PM8 A;  5K89 A;  2WC8 A;  3CZT X;  1FI5 A;  1SCM B;  2BKH B;  2F3Z A;  1XFU O;  2L2E A;  2JWW A;  2BCB A;  1PSB A;  3TUY B;  1JWD A;  4MEW A;  5I8N A;  2JT3 A;  1AJ5 A;  3GOF A;  4DCK A;  1LKJ A;  2ISD A;  1XK4 C;  2LAN A;  1UP5 A;  3TS5 C;  2KBI A;  1OMV A;  3EKJ A;  1NCX A;  3AKB A;  2FOT A;  3IQO A;  2SAS A;  2LP3 A;  2WOS A;  3IQQ A;  3KEV A;  5JOL A;  1EG3 A;  1WLZ A;  2COL B;  1MR8 A;  3KO0 A;  2KDH A;  2BBN A;  2PAL A;  2EHB A;  3I5H B;  1UWO A;  2KI4 C;  5HKW A;  1UUS A;  2KI6 C;  1JF0 A;  2MLF C;  1IH0 A;  2KBM A;  2BCX A;  1SL9 A;  1ZAC A;  3CWG A;  2I94 A;  2VRG A;  3EK8 A;  1K95 A;  1YVH A;  1QIW A;  1W7I B;  4PE1 A;  2LMV A;  1BU3 A;  4XJK B;  2LUX A;  2L5X B;  4PHM A;  3D0Y A;  3EK7 A;  1ZFS A;  1B4C A;  1Y0V H;  1E8A A;  4YRU A;  2WCF A;  2L4I A;  1L7Z A;  1WDC B;  1SK6 D;  4NDD A;  2M8U A;  4FTG A;  3O78 A;  1U5I A;  1CLL A;  3NSL A;  4GGF A;  1F4Q A;  1SBJ A;  2JQ6 A;  2NXQ A;  4GUK A;  3D0Y B;  5HYD A;  1TNW A;  3BUN B;  3M0W A;  3RM1 A;  1KK8 C;  1KQV A;  2LNK A;  2JT8 A;  2LVI A;  3I5G C;  4OCI A;  2JC2 A;  1K9P A;  1WY9 A;  2JTT A;  4XYN A;  1REC A;  5PAL A;  5J3X A;  3ZNI A;  4ETO A;  2GV5 A;  1AHR A;  2MAZ A;  5GQQ C;  4HSZ A;  1H4B A;  2OPO A;  2PMY A;  4U8D A;  3VRO A;  3SG3 A;  3MSE B;  1U5I B;  2K7C A;  1S1E A;  2LAP A;  1CB1 A;  1J7R A;  1OSA A;  1TCF A;  4AQJ A;  2HQW A;  3LK0 A;  1K9U A;  2ZNE A;  3VRP A;  1QVI Y;  1A4P A;  4CFR A;  1OMD A;  1MHO A;  1HT9 A;  1NUB A;  1NCZ A;  1XA5 A;  2EC6 B;  3EVR A;  3QRX A;  4N1F A;  4WQ3 A;  2F33 A;  1NSH A;  2KOT A;  1CDL A;  4GNK B;  5AEQ A;  1KFX S;  2JUL A;  4YGB B;  2CXJ A;  1AUI B;  1G4Y R;  1QX7 A;  4Q04 A;  4BY5 A;  1B9A A;  5HKZ A;  4N1G A;  1YX7 A;  2NZ0 A;  4I5J A;  1DMO A;  1XFY O;  1NX3 A;  1TNQ A;  2GGZ A;  5IBW A;  2H61 A;  1S5G Y;  4C0K A;  1F4O A;  2K2A A;  2BCA A;  3RLZ A;  1OQP A;  2K7O A;  1FI6 A;  1SL8 A;  1K9K A;  2M97 A;  1QXP A;  1PVB A;  1XFX O;  2M49 B;  3DD4 A;  3O4Y A;  1YUT A;  2KFH A;  2KGB C;  1J1D A;  2JXL A;  1A29 A;  1J55 A;  1M63 B;  3EKH A;  4MZJ A;  5ER4 X;  1CDP A;  1F71 A;  1YTZ C;  3WHT B;  2NCP A;  1QX5 B;  1LIN A;  5DKN A;  1WDC C;  2BE6 A;  2K7D A;  4YGD B;  1B8L A;  2WCE A;  1UHK A;  1UHJ A;  4YI9 A;  1G8I A;  2Y1M A;  1MXE A;  1F70 A;  1KFU S;  1MUX A;  1K94 A;  2DOQ A;  4MZL A;  4N5X A;  3SIB A;  1EH2 A;  1LXF C;  3TDU A;  3DVJ A;  4MRX A;  1RWY A;  5HKY A;  1SR6 B;  2WOR A;  1B1G A;  1V1F A;  3O6B A;  1SYM A;  1XO5 A;  3HCM A;  2NCO A;  1SKT A;  4UPG A;  1SY9 A;  5DKQ A;  1F8H A;  5B8I B;  2MLE C;  1KK7 Y;  2TN4 A;  2JTZ A;  1ZMZ A;  3CTN A;  4DIR A;  4ORC B;  1K8U A;  4GGF C;  1C7V A;  1QLK A;  4PHK A;  1KK7 Z;  1JBA A;  2OTG B;  1KSM A;  3SG7 A;  1F54 A;  4XJK A;  3BOW B;  1CKK A;  1DJY A;  2F8P A;  2O5G A;  2WND A;  3CR4 X;  1TN4 A;  1KSO A;  4P5O E;  5CPV A;  2V53 A;  3O2P A;  3IF7 A;  4I5K A;  1KFU L;  2OS8 B;  1Y6W A;  4AQI A;  3TUY C;  1KQM C;  1YUS A;  4OR9 B;  5DKR A;  3A8R A;  1CDM A;  1IRJ A;  3I5F B;  3LL8 B;  1ODB A;  4GFT A;  4YI8 A;  3F45 A;  3DVK A;  2AUC A;  1JUO A;  3OHM B;  2AMI A;  1FW4 A;  2LMU A;  3JVT B;  2NLN A;  2SCP A;  2Y5I A;  2G9B A;  1MF8 B;  3I5I B;  1BOC A;  1R2U A;  1B7T Y;  1BR4 B;  3GK1 A;  1PRW A;  2EGD A;  2KYC A;  3PSR A;  1MXL C;  5CSJ A;  1M45 A;  3BUW B;  4PAL A;  1SMG A;  2O60 A;  2QPT A;  1B7T Z;  3A4U B;  2MRD A;  1UHI A;  2L98 A;  1PUL A;  1SL7 A;  2MA2 A;  1IWQ A;  1EG4 A;  2F2P A;  1D1O A;  4PHN A;  3CR2 A;  1QX2 A;  3LK1 A;  1CFD A;  2H61 C;  2LLU A;  1JF2 A;  1WRL A;  2LHL A;  3PLF B;  1OE9 B;  1CLM A;  2BL0 B;  1XFW O;  1CLB A;  2KAV A;  1M31 A;  4TNC A;  5ER5 A;  1OZS A;  5G08 A;  1S3P A;  4MZK A;  1A03 A;  4MSP A;  1J7P A;  1NIW A;  1A75 B;  4GBA A;  2IS9 A;  3DF0 A;  1S6J A;  1RFJ A;  4FQO A;  2AAO A;  2ZN9 A;  1BR1 B;  5FYX A;  1L2O B;  1C7W A;  1TOP A;  2CCM A;  1V1G A;  3BYA A;  1NPQ A;  1QAS A;  1SCM C;  5HLO A;  1KWO B;  1QTX A;  4WQ2 A;  3CR5 X;  4YGE B;  3BUM B;  4I5N B;  1EL4 A;  4A4B A;  2QAC A;  1QVI Z;  2Y1N A;  1YUR A;  3DVE A;  3BUO B;  2KFG A;  2OTG C;  1S6I A;  3C1V A;  3DF0 B;  2MBX A;  2I18 A;  1FF1 A;  1NWD A;  2A4J A;  1GGW A;  1QV1 A;  5AXI A;  1ZUZ A;  2LLS A;  2LVJ A;  3JTD B;  5CSN A;  1ALW A;  3SIA A;  1WRZ A;  2RGI A;  3DVM A;  1YVL A;  1K90 D;  2KI6 D;  1GQM A;  2PAS A;  1B47 A;  2LM5 A;  2E30 A;  4NQG A;  3TZ1 A;  3I5H C;  2OS8 C;  1KCY A;  1SCV A;  1DTL A;  1IGV A;  4NDC A;  1QAT A;  1SPY A;  2KQ6 A;  3I5F C;  5F6T A;  3WHU B;  1QV0 A;  1BOD A;  1S5G Z;  4ORA B;  1BF5 A;  1N2D A;  1AP4 A;  3FWC A;  2KHN A;  4M2P A;  3OX5 A;  2MHH A;  5KU1 A;  2GGM A;  1CMG A;  5KSZ A;  4MBE A;  3CGA A;  2K7B A;  3JVT C;  3KF9 A;  1CM4 A;  4F0Z B;  2L50 A;  2LV7 A;  1JC2 A;  1JFJ A;  3FWB A;  2FCE A;  3I5I C;  3BXK A;  5CSF A;  1LA0 A;  2KQY A;  4JWQ A;  4BY4 A;  1CFP A;  1RJV A;  2D8N A;  3K21 A;  2BE4 A;  2CBL A;  1DJW A;  2B1U A;  3SJS A;  1RK9 A;  1S6C A;  1SW8 A;  3NSK A;  3OP0 A;  4ZCU A;  4WRI A;  2CNP A;  2L51 A;  1TNX A;  1HQV A;  2F2O A;  1S36 A;  4CID A;  2KSP A;  2F3Y A;  4MLW A;  1IJ6 A;  1Y1X A;  3AAK A;  3SG2 A;  3BOW A;  1N0Y A;  2I7A A;  1CFC A;  4C0L A;  1S26 D;  3AKA A;  2LHI A;  1CDN A;  1ZOT B;  1Q80 A;  1XVJ A;  1X02 A;  1KK8 B;  1N65 A;  1YRT B;  1YR5 A;  2HQ8 A;  1YUU A;  2JZI A;  4M2O A;  3CS1 A;  3WXA A;  1RTP 1;  2ZFD A;  2ZND A;  5I2O A;  1M46 A;  1XFZ O;  1JSA A; 
#chains in the Genus database with same CATH topology
 2YGU A;  3AAJ A;  1W9Z A;  2PSR A;  1TIZ A;  2ZN8 A;  2M7L A;  1KWO C;  2BEC A;  5FI2 A;  1AK8 A;  4I5L B;  2KAX A;  3OGN A;  2L4H A;  4PHJ A;  2H2K A;  1NX1 A;  2EC6 C;  2LMT A;  3EVV A;  3LLE A;  5BPJ A;  4A4C A;  3OX6 A;  4ZCV A;  2PVB A;  1BMO A;  1IQ3 A;  3VRR A;  2BBM A;  3DZT A;  2K61 A;  4USL A;  1CTR A;  3EK4 A;  3KHE A;  3JTD C;  4OZD A;  1BLQ A;  1DJI A;  3SG5 A;  1BG1 A;  4GGN A;  1XYD A;  1IQ5 A;  2HF5 A;  4ICB A;  1PVA A;  4D1E A;  1ALV A;  4PE0 A;  2BKI B;  1M39 A;  4YBH B;  4GPL B;  2K0J A;  4QJ5 B;  1QLS A;  3LCP C;  3NSI A;  2M29 A;  1NX0 A;  1K93 D;  5TNC A;  1J1E A;  4L9M A;  2QDI A;  4NDB A;  2JNX A;  3CLN A;  3BFH A;  1SNL A;  3PJI A;  1A75 A;  4YGA A;  1R6P A;  1LVC D;  3BFB A;  1PK0 D;  3EVU A;  2WC6 A;  3PN7 B;  1UHN A;  1DEK A;  1CMF A;  3GK2 A;  2M1K B;  1J7Q A;  4IL1 A;  2CT9 A;  3HX4 A;  2HET A;  3BFA A;  2KYF A;  2M9G A;  2Y4Q A;  3OB1 B;  4PE7 A;  1TNP A;  4C0J A;  3H4S E;  1IKU A;  1DQE A;  3CDN A;  3D10 A;  4CPV A;  1LA3 A;  5D69 A;  4QJ3 B;  5FI7 A;  3OB2 B;  5CSI A;  4OV2 A;  5KTY A;  2KFF A;  2P71 A;  4M2Q A;  5AFP A;  1MQ1 A;  3NXA A;  2Q91 A;  2JRF A;  1SR6 C;  1Z2C B;  1DJX A;  2JNF A;  3WNX B;  1F55 A;  2KGR A;  3GK4 X;  2I2R E;  1AVS A;  2E6W A;  1IJ5 A;  1JFK A;  2JPT A;  2P6B B;  4MRY A;  3S0A A;  1XK4 A;  2FJY A;  1NCY A;  3CZ0 A;  3B6X A;  2JOJ A;  2ERB A;  2ZRS A;  5I2L A;  2JXC A;  2JT0 A;  5I2Q A;  4INW A;  3TDI A;  1NYA A;  1SRA A;  1C07 A;  1CM1 A;  1QJT A;  2LCP A;  3B88 A;  2K60 A;  1OOJ A;  2LVV A;  4HRG A;  1H8B A;  2FJU B;  2LE9 B;  1DJZ A;  1OZO A;  1MWN A;  1OMR A;  3VB1 A;  1RRO A;  4DS7 A;  2LC5 A;  3VGO A;  4HRH A;  3TS5 B;  4DUQ A;  2WCB A;  2WCL A;  2KAY A;  4E68 A;  3BQ3 A;  4JQ0 D;  3VRN A;  2LP2 A;  4CFQ A;  1TCO B;  1GJY A;  5HLV A;  1AJ4 A;  1EXR A;  3E3R A;  2H8V A;  4QJ4 B;  1PSR A;  3FS7 A;  3PAT A;  3R1V A;  1TRF A;  1DF0 A;  1NP8 A;  2FCD A;  2KI4 B;  2PRU A;  3SG4 A;  1KQM B;  4GAO A;  4PDZ A;  3D76 A;  1NX2 A;  1OOI X;  3NGV A;  1G33 A;  4JPZ B;  3ZWH A;  1QS7 A;  1UUR A;  3BUX B;  2LUC A;  1B8R A;  2R2I A;  1DGU A;  1IG5 A;  4YGC B;  4AOM A;  3TDZ A;  1Z4H A;  1B8C A;  1BJF A;  2ZRT A;  1FPW A;  1GGZ A;  1DJG A;  1FBV A;  3S0B A;  2M3W A;  5AAN A;  1W7J B;  1A2X A;  1YX8 A;  2CTN A;  3PN7 C;  4P2Y B;  1DF0 B;  1BT6 A;  4OVN F;  2M1U A;  2L0P A;  4PCW A;  4MVF A;  3SG6 A;  1UHH A;  2LVK A;  1K96 A;  3KPX A;  1P28 A;  2KNE A;  3PFV A;  2BL0 C;  3D78 A;  2L2C A;  4FQT A;  1CNP A;  3VRQ A;  1WLM A;  2ZKM X;  1DJH A;  4PE4 A;  4CLN A;  2KLD A;  3ICB A;  1Y1A A;  1TTX A;  2LLT A;  1DT7 B;  3FIA A;  1QIV A;  3SS4 A;  1VRK A;  5JJG A;  1DVI A;  3I5G B;  2WCJ A;  3V2L A;  4OKH A;  5D7F A;  3O4X A;  1DGV A;  2M0R A;  4MN0 A;  1L2O C;  1KFX L;  4DRW A;  2JU0 A;  3PAL A;  1CFF A;  1XFV O;  1EJ3 A;  1K2H A;  2K8M B;  4PT1 A;  2HPS A;  3NSO A;  1J7O A;  4ORB B;  1Y1U A;  1YRU B;  2Q4U A;  2G2B A;  2K2F A;  3D74 A;  1PAL A;  5AER A;  2M7N A;  1WRK A;  4HRE E;  4R1E A;  2MJW B;  3PM8 A;  5K89 A;  2WC8 A;  3CZT X;  1FI5 A;  1SCM B;  2BKH B;  2F3Z A;  1XFU O;  1TUJ A;  3SS5 A;  2L2E A;  3PM2 A;  2JWW A;  2BCB A;  1PSB A;  3TUY B;  1JWD A;  4MEW A;  4INX A;  3B7A A;  2JT3 A;  5I8N A;  1AJ5 A;  3GOF A;  4DCK A;  1LKJ A;  2ISD A;  1XK4 C;  2LAN A;  1UP5 A;  2QEH A;  2KBI A;  3TS5 C;  1OMV A;  3EKJ A;  1NCX A;  1OW4 A;  3AKB A;  2FOT A;  3IQO A;  2SAS A;  2LP3 A;  2WOS A;  3IQQ A;  3KEV A;  5JOL A;  3SS3 A;  1EG3 A;  1WLZ A;  2COL B;  1MR8 A;  3KO0 A;  3RZS A;  2KDH A;  2BBN A;  2PAL A;  2EHB A;  2PYQ A;  1UWO A;  2KI4 C;  2QEO A;  3I5H B;  3NHT A;  5HKW A;  1UUS A;  2KI6 C;  1JF0 A;  2MLF C;  3B87 A;  2KBM A;  2BCX A;  1IH0 A;  1SL9 A;  1ZAC A;  3CWG A;  2I94 A;  2VRG A;  3DYE A;  3EK8 A;  1K95 A;  1YVH A;  1QIW A;  1W7I B;  4PE1 A;  2LMV A;  1BU3 A;  4XJK B;  2LUX A;  4KYN A;  3CAB A;  2L5X B;  4PHM A;  3D0Y A;  3EK7 A;  1ZFS A;  1B4C A;  2PQL A;  1Y0V H;  1E8A A;  4YRU A;  2BAP A;  2WCF A;  2L4I A;  1L7Z A;  2KLE A;  1WDC B;  1SK6 D;  4NDD A;  2M8U A;  1C3Y A;  4FTG A;  3O78 A;  1DC1 A;  1U5I A;  1CLL A;  3NSL A;  4GGF A;  1F4Q A;  1SBJ A;  2JQ6 A;  2NXQ A;  4GUK A;  3D0Y B;  5HYD A;  1TNW A;  3BUN B;  3M0W A;  3RM1 A;  1KK8 C;  1KQV A;  1LS8 A;  3BJH A;  2LNK A;  2JT8 A;  2LVI A;  3B86 A;  3I5G C;  4OCI A;  2JC2 A;  1K9P A;  1WY9 A;  2JTT A;  3IVT A;  4XYN A;  2WCM A;  1REC A;  5PAL A;  5J3X A;  3S0D A;  3ZNI A;  2GV5 A;  1AHR A;  2MAZ A;  5GQQ C;  4HSZ A;  4ETO A;  2OPO A;  2PMY A;  4U8D A;  1H4B A;  3L4A A;  3VRO A;  3SG3 A;  3MSE B;  1U5I B;  2K7C A;  1S1E A;  2LAP A;  1CB1 A;  2QEV A;  1J7R A;  1OSA A;  1TCF A;  4AQJ A;  2HQW A;  3LK0 A;  1K9U A;  3UNW A;  3K1E A;  2ZNE A;  3VRP A;  1QVI Y;  1A4P A;  3S0E A;  4CFR A;  1OMD A;  1MHO A;  1HT9 A;  1NUB A;  1NCZ A;  1XA5 A;  2EC6 B;  2KPH A;  3EVR A;  3QRX A;  4N1F A;  4WQ3 A;  1OOF A;  2F33 A;  1NSH A;  2KOT A;  1CDL A;  4GNK B;  1M46 A;  5AEQ A;  1KFX S;  2JUL A;  4YGB B;  2CXJ A;  1AUI B;  1G4Y R;  1QX7 A;  4Q04 A;  4BY5 A;  1B9A A;  3CYZ A;  4N1G A;  5HKZ A;  1YX7 A;  2NZ0 A;  4I5J A;  1DMO A;  1XFY O;  1NX3 A;  1TNQ A;  2GGZ A;  5IBW A;  1OOG A;  2H61 A;  1S5G Y;  4C0K A;  1F4O A;  2K2A A;  2BCA A;  3RLZ A;  1OQP A;  2K7O A;  1FI6 A;  1SL8 A;  1K9K A;  2M97 A;  3CZ1 A;  1QXP A;  1PVB A;  1XFX O;  2P70 A;  2M49 B;  3DD4 A;  3O4Y A;  1YUT A;  2KFH A;  2KGB C;  1J1D A;  2QEB A;  2JXL A;  1A29 A;  1J55 A;  1M63 B;  3EKH A;  4MZJ A;  5ER4 X;  1CDP A;  3DY9 A;  1YTZ C;  1F71 A;  3WHT B;  2NCP A;  1QX5 B;  5EL2 A;  1LIN A;  5DKN A;  1WDC C;  2BE6 A;  2K7D A;  4YGD B;  1B8L A;  2WCE A;  1UHK A;  1UHJ A;  4YI9 A;  1G8I A;  2Y1M A;  1MXE A;  1F70 A;  1KFU S;  1MUX A;  1K94 A;  2DOQ A;  3EG5 B;  4MZL A;  4N5X A;  3SIB A;  5DIC A;  1EH2 A;  1LXF C;  3TDU A;  2JPO A;  3DVJ A;  4MRX A;  1RWY A;  5HKY A;  1SR6 B;  2WOR A;  3R1P A;  3Q8I A;  1B1G A;  1V1F A;  3O6B A;  3D73 A;  1SYM A;  3R1O A;  1XO5 A;  3HCM A;  2NCO A;  1SKT A;  4UPG A;  1SY9 A;  3N7H A;  1ORG A;  5DKQ A;  1F8H A;  5B8I B;  2MLE C;  2L5Y A;  1KK7 Y;  2TN4 A;  2JTZ A;  1ZMZ A;  3CTN A;  4DIR A;  4ORC B;  1K8U A;  4GGF C;  1C7V A;  1QLK A;  4PHK A;  1KK7 Z;  1JBA A;  3S0F A;  2OTG B;  5FI6 A;  1KSM A;  3CZ2 A;  3SG7 A;  1F54 A;  4XJK A;  3BOW B;  1CKK A;  1DJY A;  5HL1 A;  2F8P A;  2O5G A;  2WND A;  3CR4 X;  2GTE A;  1TN4 A;  1KSO A;  3R72 A;  4P5O E;  5CPV A;  2V53 A;  3O2P A;  3IF7 A;  4I5K A;  1KFU L;  2OS8 B;  1Y6W A;  4AQI A;  1OOH A;  3TUY C;  1KQM C;  1YUS A;  4OR9 B;  5DKR A;  3A8R A;  1CDM A;  1IRJ A;  3I5F B;  3LL8 B;  1ODB A;  4GFT A;  4YI8 A;  3F45 A;  3DVK A;  2AUC A;  1JUO A;  3OHM B;  2AMI A;  1FW4 A;  2LMU A;  3JVT B;  2NLN A;  2SCP A;  3D77 A;  2Y5I A;  2G9B A;  1MF8 B;  3I5I B;  1BOC A;  1R2U A;  1B7T Y;  1BR4 B;  3GK1 A;  1PRW A;  2EGD A;  2KYC A;  3PSR A;  1MXL C;  5CSJ A;  1M45 A;  1DEL A;  3BUW B;  4PAL A;  1SMG A;  2O60 A;  2QPT A;  1B7T Z;  2WC5 A;  3A4U B;  2MRD A;  1UHI A;  2L98 A;  1PUL A;  1SL7 A;  2MA2 A;  1IWQ A;  1EG4 A;  2F2P A;  1D1O A;  4PHN A;  3CR2 A;  1QX2 A;  3LK1 A;  1CFD A;  2H61 C;  2LLU A;  1JF2 A;  1TWO A;  1WRL A;  2LHL A;  3PLF B;  1OE9 B;  1CLM A;  2BL0 B;  2BNX A;  4JKT A;  1XFW O;  1CLB A;  2KAV A;  1M31 A;  1TUZ A;  3FE8 A;  4TNC A;  1OZS A;  5ER5 A;  5G08 A;  1S3P A;  4MZK A;  1A03 A;  4MSP A;  1J7P A;  3NHI A;  3OBV A;  1NIW A;  1A75 B;  4GBA A;  2IS9 A;  3DF0 A;  1S6J A;  1RFJ A;  4FQO A;  2AAO A;  4IJ7 A;  2ZN9 A;  1BR1 B;  5FYX A;  1L2O B;  1C7W A;  1TOP A;  2CCM A;  1V1G A;  3BYA A;  1NPQ A;  1GM0 A;  1QAS A;  1SCM C;  5HLO A;  1KWO B;  1QTX A;  4WQ2 A;  3CR5 X;  4YGE B;  3BUM B;  4I5N B;  1EL4 A;  4A4B A;  2QAC A;  1QVI Z;  2Y1N A;  1YUR A;  3DVE A;  3BUO B;  2KFG A;  2OTG C;  1S6I A;  3C1V A;  3DF0 B;  2MBX A;  2WCK A;  5I94 A;  2I18 A;  3D75 A;  3L47 A;  1NWD A;  1FF1 A;  2A4J A;  1GGW A;  1QV1 A;  3FE9 A;  5AXI A;  1ZUZ A;  2LLS A;  2LVJ A;  3JTD B;  5CSN A;  1ALW A;  3SIA A;  1WRZ A;  2RGI A;  3DVM A;  1YVL A;  1K90 D;  2KI6 D;  1GQM A;  2PAS A;  1B47 A;  2LM5 A;  2E30 A;  4NQG A;  3TZ1 A;  3I5H C;  5D3O A;  2OS8 C;  2WCH A;  1KCY A;  1SCV A;  1SSE B;  3L4L A;  1DTL A;  1IGV A;  4NDC A;  1QAT A;  1SPY A;  1IIO A;  2KQ6 A;  3I5F C;  5F6T A;  3WHU B;  1QV0 A;  1BOD A;  1S5G Z;  3FE6 A;  4ORA B;  1BF5 A;  1N2D A;  1AP4 A;  3FWC A;  2KHN A;  4M2P A;  3OX5 A;  3S0G A;  2MHH A;  5KU1 A;  2GGM A;  3DXL A;  1CMG A;  5KSZ A;  4MBE A;  3CGA A;  2K7B A;  3JVT C;  3KF9 A;  1CM4 A;  4F0Z B;  2L50 A;  2LV7 A;  1JC2 A;  1JFJ A;  3FWB A;  2FCE A;  3I5I C;  3BXK A;  5CSF A;  1LA0 A;  2KQY A;  4JWQ A;  4BY4 A;  1CFP A;  1RJV A;  2D8N A;  3K21 A;  1QWV A;  2BE4 A;  2CBL A;  1DJW A;  2B1U A;  3SJS A;  1RK9 A;  1S6C A;  1SW8 A;  3NSK A;  3OP0 A;  4ZCU A;  4WRI A;  2CNP A;  2L51 A;  1TNX A;  1HQV A;  2F2O A;  1S36 A;  4CID A;  4F7F A;  2KSP A;  4JD9 A;  3UO9 A;  2F3Y A;  4MLW A;  1IJ6 A;  1Y1X A;  3AAK A;  3SG2 A;  3BOW A;  1N0Y A;  3QME A;  2I7A A;  1CFC A;  4C0L A;  1S26 D;  3AKA A;  2LHI A;  1CDN A;  1ZOT B;  1C3Z A;  1Q80 A;  1XVJ A;  1X02 A;  1KK8 B;  1N65 A;  1YRT B;  1YR5 A;  2HQ8 A;  1YUU A;  2JZI A;  4M2O A;  3CS1 A;  3WXA A;  1RTP 1;  2ZFD A;  2ZND A;  5I2O A;  1XFR A;  1T14 A;  1XFZ O;  1JSA A; 
#chains in the Genus database with same CATH homology
 3AAJ A;  2PSR A;  1TIZ A;  2ZN8 A;  2M7L A;  1KWO C;  2BEC A;  1AK8 A;  4I5L B;  2KAX A;  2L4H A;  4PHJ A;  2H2K A;  1NX1 A;  2EC6 C;  2LMT A;  3EVV A;  3LLE A;  5BPJ A;  4A4C A;  3OX6 A;  4ZCV A;  2PVB A;  1BMO A;  1IQ3 A;  3VRR A;  2BBM A;  2K61 A;  4USL A;  1CTR A;  3EK4 A;  3KHE A;  3JTD C;  1BLQ A;  1DJI A;  3SG5 A;  1BG1 A;  4GGN A;  1XYD A;  1IQ5 A;  2HF5 A;  4ICB A;  1PVA A;  4D1E A;  1ALV A;  4PE0 A;  2BKI B;  1M39 A;  4YBH B;  4GPL B;  2K0J A;  4QJ5 B;  1QLS A;  3LCP C;  3NSI A;  2M29 A;  1NX0 A;  1K93 D;  5TNC A;  1J1E A;  4L9M A;  4NDB A;  2JNX A;  3CLN A;  1SNL A;  1A75 A;  4YGA A;  1R6P A;  1LVC D;  1PK0 D;  3EVU A;  3PN7 B;  1CMF A;  1UHN A;  3GK2 A;  2M1K B;  1J7Q A;  4IL1 A;  2CT9 A;  3HX4 A;  2HET A;  2KYF A;  2M9G A;  2Y4Q A;  3OB1 B;  4PE7 A;  1TNP A;  4C0J A;  3H4S E;  1IKU A;  3D10 A;  4CPV A;  1LA3 A;  5D69 A;  4QJ3 B;  3OB2 B;  5CSI A;  4OV2 A;  5KTY A;  2KFF A;  4M2Q A;  5AFP A;  1MQ1 A;  3NXA A;  2Q91 A;  2JRF A;  1SR6 C;  1DJX A;  2JNF A;  3WNX B;  1F55 A;  2KGR A;  3GK4 X;  2I2R E;  1AVS A;  2E6W A;  1IJ5 A;  1JFK A;  2JPT A;  2P6B B;  4MRY A;  1XK4 A;  1NCY A;  2JOJ A;  2ZRS A;  5I2L A;  2JXC A;  2JT0 A;  5I2Q A;  3TDI A;  1NYA A;  1SRA A;  1C07 A;  1CM1 A;  1QJT A;  2LCP A;  1OOJ A;  2LVV A;  4HRG A;  1H8B A;  2FJU B;  2LE9 B;  1DJZ A;  1OZO A;  1MWN A;  1OMR A;  1RRO A;  4DS7 A;  2LC5 A;  3VGO A;  4HRH A;  3TS5 B;  4DUQ A;  2WCB A;  2KAY A;  4E68 A;  3BQ3 A;  4JQ0 D;  3VRN A;  2LP2 A;  4CFQ A;  1TCO B;  1GJY A;  5HLV A;  1AJ4 A;  1EXR A;  3E3R A;  4QJ4 B;  1PSR A;  3FS7 A;  3PAT A;  1TRF A;  1DF0 A;  1NP8 A;  2FCD A;  2KI4 B;  2PRU A;  3SG4 A;  1KQM B;  4GAO A;  4PDZ A;  1NX2 A;  1G33 A;  4JPZ B;  3ZWH A;  1QS7 A;  1UUR A;  3BUX B;  2LUC A;  1B8R A;  2R2I A;  1DGU A;  1IG5 A;  4YGC B;  4AOM A;  3TDZ A;  1B8C A;  1BJF A;  2ZRT A;  1FPW A;  1GGZ A;  1DJG A;  1FBV A;  2M3W A;  5AAN A;  1W7J B;  1A2X A;  1YX8 A;  2CTN A;  3PN7 C;  4P2Y B;  1DF0 B;  1BT6 A;  4OVN F;  2M1U A;  2L0P A;  4PCW A;  4MVF A;  3SG6 A;  1UHH A;  2LVK A;  1K96 A;  3KPX A;  3PFV A;  2KNE A;  2BL0 C;  1CNP A;  3VRQ A;  1WLM A;  2ZKM X;  1DJH A;  4PE4 A;  4CLN A;  3ICB A;  1Y1A A;  1TTX A;  2LLT A;  1DT7 B;  3FIA A;  1QIV A;  1VRK A;  5JJG A;  1DVI A;  3I5G B;  4OKH A;  5D7F A;  1DGV A;  2M0R A;  4MN0 A;  1L2O C;  1KFX L;  4DRW A;  2JU0 A;  3PAL A;  1CFF A;  1XFV O;  1EJ3 A;  1K2H A;  2K8M B;  2HPS A;  3NSO A;  1J7O A;  4ORB B;  1Y1U A;  1YRU B;  2Q4U A;  2G2B A;  2K2F A;  5AER A;  1PAL A;  2M7N A;  1WRK A;  4HRE E;  4R1E A;  2MJW B;  3PM8 A;  5K89 A;  2WC8 A;  3CZT X;  1FI5 A;  1SCM B;  2BKH B;  2F3Z A;  1XFU O;  2L2E A;  2JWW A;  2BCB A;  1PSB A;  3TUY B;  1JWD A;  4MEW A;  5I8N A;  2JT3 A;  1AJ5 A;  3GOF A;  4DCK A;  1LKJ A;  2ISD A;  1XK4 C;  2LAN A;  1UP5 A;  3TS5 C;  2KBI A;  1OMV A;  3EKJ A;  1NCX A;  3AKB A;  2FOT A;  3IQO A;  2SAS A;  2LP3 A;  2WOS A;  3IQQ A;  3KEV A;  5JOL A;  1EG3 A;  1WLZ A;  2COL B;  1MR8 A;  3KO0 A;  2KDH A;  2BBN A;  2PAL A;  2EHB A;  3I5H B;  1UWO A;  2KI4 C;  5HKW A;  1UUS A;  2KI6 C;  1JF0 A;  2MLF C;  1IH0 A;  2KBM A;  2BCX A;  1SL9 A;  1ZAC A;  3CWG A;  2I94 A;  2VRG A;  3EK8 A;  1K95 A;  1YVH A;  1QIW A;  1W7I B;  4PE1 A;  2LMV A;  1BU3 A;  4XJK B;  2LUX A;  2L5X B;  4PHM A;  3D0Y A;  3EK7 A;  1ZFS A;  1B4C A;  1Y0V H;  1E8A A;  4YRU A;  2WCF A;  2L4I A;  1L7Z A;  1WDC B;  1SK6 D;  4NDD A;  2M8U A;  4FTG A;  3O78 A;  1U5I A;  1CLL A;  3NSL A;  4GGF A;  1F4Q A;  1SBJ A;  2JQ6 A;  2NXQ A;  4GUK A;  3D0Y B;  5HYD A;  1TNW A;  3BUN B;  3M0W A;  3RM1 A;  1KK8 C;  1KQV A;  2LNK A;  2JT8 A;  2LVI A;  3I5G C;  4OCI A;  2JC2 A;  1K9P A;  1WY9 A;  2JTT A;  4XYN A;  1REC A;  5PAL A;  5J3X A;  3ZNI A;  4ETO A;  2GV5 A;  1AHR A;  2MAZ A;  5GQQ C;  4HSZ A;  1H4B A;  2OPO A;  2PMY A;  4U8D A;  3VRO A;  3SG3 A;  3MSE B;  1U5I B;  2K7C A;  1S1E A;  2LAP A;  1CB1 A;  1J7R A;  1OSA A;  1TCF A;  4AQJ A;  2HQW A;  3LK0 A;  1K9U A;  2ZNE A;  3VRP A;  1QVI Y;  1A4P A;  4CFR A;  1OMD A;  1MHO A;  1HT9 A;  1NUB A;  1NCZ A;  1XA5 A;  2EC6 B;  3EVR A;  3QRX A;  4N1F A;  4WQ3 A;  2F33 A;  1NSH A;  2KOT A;  1CDL A;  4GNK B;  5AEQ A;  1KFX S;  2JUL A;  4YGB B;  2CXJ A;  1AUI B;  1G4Y R;  1QX7 A;  4Q04 A;  4BY5 A;  1B9A A;  5HKZ A;  4N1G A;  1YX7 A;  2NZ0 A;  4I5J A;  1DMO A;  1XFY O;  1NX3 A;  1TNQ A;  2GGZ A;  5IBW A;  2H61 A;  1S5G Y;  4C0K A;  1F4O A;  2K2A A;  2BCA A;  3RLZ A;  1OQP A;  2K7O A;  1FI6 A;  1SL8 A;  1K9K A;  2M97 A;  1QXP A;  1PVB A;  1XFX O;  2M49 B;  3DD4 A;  3O4Y A;  1YUT A;  2KFH A;  2KGB C;  1J1D A;  2JXL A;  1A29 A;  1J55 A;  1M63 B;  3EKH A;  4MZJ A;  5ER4 X;  1CDP A;  1F71 A;  1YTZ C;  3WHT B;  2NCP A;  1QX5 B;  1LIN A;  5DKN A;  1WDC C;  2BE6 A;  2K7D A;  4YGD B;  1B8L A;  2WCE A;  1UHK A;  1UHJ A;  4YI9 A;  1G8I A;  2Y1M A;  1MXE A;  1F70 A;  1KFU S;  1MUX A;  1K94 A;  2DOQ A;  4MZL A;  4N5X A;  3SIB A;  1EH2 A;  1LXF C;  3TDU A;  3DVJ A;  4MRX A;  1RWY A;  5HKY A;  1SR6 B;  2WOR A;  1B1G A;  1V1F A;  3O6B A;  1SYM A;  1XO5 A;  3HCM A;  2NCO A;  1SKT A;  4UPG A;  1SY9 A;  5DKQ A;  1F8H A;  5B8I B;  2MLE C;  1KK7 Y;  2TN4 A;  2JTZ A;  1ZMZ A;  3CTN A;  4DIR A;  4ORC B;  1K8U A;  4GGF C;  1C7V A;  1QLK A;  4PHK A;  1KK7 Z;  1JBA A;  2OTG B;  1KSM A;  3SG7 A;  1F54 A;  4XJK A;  3BOW B;  1CKK A;  1DJY A;  2F8P A;  2O5G A;  2WND A;  3CR4 X;  1TN4 A;  1KSO A;  4P5O E;  5CPV A;  2V53 A;  3O2P A;  3IF7 A;  4I5K A;  1KFU L;  2OS8 B;  1Y6W A;  4AQI A;  3TUY C;  1KQM C;  1YUS A;  4OR9 B;  5DKR A;  3A8R A;  1CDM A;  1IRJ A;  3I5F B;  3LL8 B;  1ODB A;  4GFT A;  4YI8 A;  3F45 A;  3DVK A;  2AUC A;  1JUO A;  3OHM B;  2AMI A;  1FW4 A;  2LMU A;  3JVT B;  2NLN A;  2SCP A;  2Y5I A;  2G9B A;  1MF8 B;  3I5I B;  1BOC A;  1R2U A;  1B7T Y;  1BR4 B;  3GK1 A;  1PRW A;  2EGD A;  2KYC A;  3PSR A;  1MXL C;  5CSJ A;  1M45 A;  3BUW B;  4PAL A;  1SMG A;  2O60 A;  2QPT A;  1B7T Z;  3A4U B;  2MRD A;  1UHI A;  2L98 A;  1PUL A;  1SL7 A;  2MA2 A;  1IWQ A;  1EG4 A;  2F2P A;  1D1O A;  4PHN A;  3CR2 A;  1QX2 A;  3LK1 A;  1CFD A;  2H61 C;  2LLU A;  1JF2 A;  1WRL A;  2LHL A;  3PLF B;  1OE9 B;  1CLM A;  2BL0 B;  1XFW O;  1CLB A;  2KAV A;  1M31 A;  4TNC A;  5ER5 A;  1OZS A;  5G08 A;  1S3P A;  4MZK A;  1A03 A;  4MSP A;  1J7P A;  1NIW A;  1A75 B;  4GBA A;  2IS9 A;  3DF0 A;  1S6J A;  1RFJ A;  4FQO A;  2AAO A;  2ZN9 A;  1BR1 B;  5FYX A;  1L2O B;  1C7W A;  1TOP A;  2CCM A;  1V1G A;  3BYA A;  1NPQ A;  1QAS A;  1SCM C;  5HLO A;  1KWO B;  1QTX A;  4WQ2 A;  3CR5 X;  4YGE B;  3BUM B;  4I5N B;  1EL4 A;  4A4B A;  2QAC A;  1QVI Z;  2Y1N A;  1YUR A;  3DVE A;  3BUO B;  2KFG A;  2OTG C;  1S6I A;  3C1V A;  3DF0 B;  2MBX A;  2I18 A;  1FF1 A;  1NWD A;  2A4J A;  1GGW A;  1QV1 A;  5AXI A;  1ZUZ A;  2LLS A;  2LVJ A;  3JTD B;  5CSN A;  1ALW A;  3SIA A;  1WRZ A;  2RGI A;  3DVM A;  1YVL A;  1K90 D;  2KI6 D;  1GQM A;  2PAS A;  1B47 A;  2LM5 A;  2E30 A;  4NQG A;  3TZ1 A;  3I5H C;  2OS8 C;  1KCY A;  1SCV A;  1DTL A;  1IGV A;  4NDC A;  1QAT A;  1SPY A;  2KQ6 A;  3I5F C;  5F6T A;  3WHU B;  1QV0 A;  1BOD A;  1S5G Z;  4ORA B;  1BF5 A;  1N2D A;  1AP4 A;  3FWC A;  2KHN A;  4M2P A;  3OX5 A;  2MHH A;  5KU1 A;  2GGM A;  1CMG A;  5KSZ A;  4MBE A;  3CGA A;  2K7B A;  3JVT C;  3KF9 A;  1CM4 A;  4F0Z B;  2L50 A;  2LV7 A;  1JC2 A;  1JFJ A;  3FWB A;  2FCE A;  3I5I C;  3BXK A;  5CSF A;  1LA0 A;  2KQY A;  4JWQ A;  4BY4 A;  1CFP A;  1RJV A;  2D8N A;  3K21 A;  2BE4 A;  2CBL A;  1DJW A;  2B1U A;  3SJS A;  1RK9 A;  1S6C A;  1SW8 A;  3NSK A;  3OP0 A;  4ZCU A;  4WRI A;  2CNP A;  2L51 A;  1TNX A;  1HQV A;  2F2O A;  1S36 A;  4CID A;  2KSP A;  2F3Y A;  4MLW A;  1IJ6 A;  1Y1X A;  3AAK A;  3SG2 A;  3BOW A;  1N0Y A;  2I7A A;  1CFC A;  4C0L A;  1S26 D;  3AKA A;  2LHI A;  1CDN A;  1ZOT B;  1Q80 A;  1XVJ A;  1X02 A;  1KK8 B;  1N65 A;  1YRT B;  1YR5 A;  2HQ8 A;  1YUU A;  2JZI A;  4M2O A;  3CS1 A;  3WXA A;  1RTP 1;  2ZFD A;  2ZND A;  5I2O A;  1M46 A;  1XFZ O;  1JSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...