2H61C

X-ray structure of human ca2+-loaded s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 34
structure length 90
sequence length 90
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61C00
4XYNA 1YVHA 1KWOC 1QXPA 1SCMB 1F71A 1YUSA 3FWCA 3PALA 3SG3A 1PVBA 3GK1A 4NDDA 2QACA 1NX2A 1MQ1A 5IBWA 1LKJA 1U5IA 1S6JA 3WHUB 2MRDA 1CM1A 2JT0A 2KGRA 1PRWA 1SNLA 3EVRA 3PLFB 1DJIA 4A4CA 1DVIA 1LVCD 2K61A 4PE7A 1SKTA 3O4YA 1B7TY 1SBJA 2KGBC 3O2PA 1NSHA 1OMDA 4GPLB 1XFYO 2JQ6A 1C07A 2ISDA 1C7WA 2KBMA 1XFZO 1SPYA 2PALA 1QX2A 2I94A 2LHLA 2A4JA 3I5IC 2LLUA 1PVAA 1RECA 2HF5A 2PVBA 1HT9A 2LUXA 1QIWA 3BUOB 1DJGA 1K93D 2JT8A 3KF9A 3JTDC 1MXLC 3PSRA 2BCAA 4C0JA 1NX1A 4FQOA 4OCIA 5AFPA 1IQ3A 4N1FA 1YRUB 1UP5A 2I18A 2OPOA 5HYDA 1QIVA 1W7JB 4USLA 1XFUO 3D10A 2K0JA 3CGAA 2COLB 3BUXB 3F45A 1CLLA 1X02A 1CFPA 1QV0A 4XJKA 1ZMZA 1BG1A 1YR5A 3O6BA 3FS7A 5K89A 1XYDA 2JT3A 1PSBA 1BR1B 4YRUA 3HCMA 2JXLA 2BCBA 5CPVA 5HKYA 2KI4C 2PSRA 2KOTA 2KYCA 2LNKA 3SG2A 3DVKA 2BKIB 1M45A 2BKHB 1LINA 3DF0B 4M2OA 3KPXA 1MF8B 2BL0C 1PSRA 1J1EA 1TN4A 1WDCC 1UUSA 2K7DA 1SW8A 2VRGA 3BQ3A 1KCYA 4PHKA 1AJ4A 4AQJA 1GJYA 1SMGA 2EGDA 1ZUZA 2Y1NA 1KK8B 3SG6A 2F33A 4I5NB 1B47A 4MSPA 3IF7A 3K21A 3EK7A 2ZRTA 3BOWA 3CR5X 5BPJA 4P5OE 5I2LA 5J3XA 4C0KA 2K7OA 1LXFC 1B8RA 1Q80A 1V1FA 3D0YB 1FW4A 1K9UA 1L7ZA 2FCDA 1DGUA 2SASA 4M2QA 1ZOTB 5I2OA 1SR6C 2K7CA 1K95A 2KFHA 1Y1AA 4HRGA 1B4CA 1F70A 1M31A 2BCXA 4NDBA 2CXJA 2ZRSA 3C1VA 4PDZA 2LMTA 1CLMA 3LK0A 1SL7A 3AKAA 4TNCA 4YGAA 2JPTA 1TNQA 1DF0A 1QASA 1S6CA 5ER4X 3TDZA 2MJWB 3I5HB 2LVKA 1EG4A 4U8DA 1C7VA 1B8CA 1QX5B 1FI5A 2KFFA 2ZN8A 1HQVA 2FJUB 1KFUS 2JXCA 4WRIA 1PULA 1JFJA 2H2KA 3I5FB 1DJYA 1WRKA 2MLEC 1CDMA 2LHIA 1M46A 4HREE 1NCXA 1NPQA 2ZKMX 3TS5B 2WC8A 3LK1A 1RJVA 4NQGA 1F4OA 2BECA 4ETOA 1B9AA 2MHHA 4ZCVA 2CBLA 2LUCA 2K7BA 5HLOA 1IG5A 1Y1XA 3NSOA 1A75B 1L2OC 4MVFA 3RM1A 1IKUA 2K2FA 2I2RE 3WHTB 1JWDA 1CDLA 1A4PA 1UHJA 2F2PA 5CSIA 2HQWA 3KO0A 2F3ZA 2M97A 1IH0A 3CS1A 3KHEA 5AXIA 3CR4X 4ORCB 2LM5A 3VRPA 4BY4A 3DVEA 1GGWA 1KFUL 4AQIA 1CFDA 3ICBA 3LL8B 3ZWHA 4QJ5B 2WORA 1WRLA 2DOQA 3CTNA 1ALWA 2D8NA 3NSKA 2KAYA 1AHRA 1DGVA 3NSIA 4OKHA 4PHMA 3EKHA 4CPVA 4YGDB 2JULA 1UURA 3DD4A 4N5XA 4I5JA 4M2PA 1EJ3A 1SL9A 1EL4A 2OTGC 4C0LA 2LVVA 4JPZB 4MEWA 5HKWA 3OB1B 1MXEA 2M0RA 2JOJA 4CFRA 1SRAA 1SL8A 1OZSA 1CFCA 2EC6B 2TN4A 1IJ6A 1RWYA 4YGBB 1MWNA 4R1EA 1B1GA 2LC5A 2CT9A 4GGFC 1U5IB 2JWWA 1YVLA 2AUCA 3A8RA 3OHMB 1S5GZ 3TUYB 2AAOA 2JZIA 1OMVA 2BBNA 2F2OA 1FF1A 2KAXA 2OS8C 1GQMA 1SCVA 2HETA 1M63B 3WXAA 1WY9A 1OOJA 1SCMC 2BE4A 3O78A 1DMOA 5G08A 1F4QA 2WNDA 1S3PA 1MHOA 2L51A 1RFJA 2LCPA 3BXKA 2E30A 4MBEA 2QPTA 5KSZA 1IRJA 2JNFA 1IGVA 1AK8A 1IQ5A 1CNPA 5HKZA 5D69A 1PK0D 1ZACA 2MA2A 1BLQA 1NX3A 2MBXA 1XK4A 3BYAA 1B8LA 1F54A 1OSAA 1QTXA 3EK8A 3BUWB 1D1OA 1WRZA 1KQMB 2L50A 3SG7A 2JU0A 2HQ8A 1B7TZ 1KK7Y 1R6PA 2BBMA 3FIAA 1VRKA 4L9MA 3EKJA 1QVIY 2KBIA 2HPSA 2M1UA 1K2HA 3I5GB 3DVJA 3JVTB 3OX5A 4PALA 1AJ5A 2M9GA 2LMUA 1IWQA 1TNXA 3GOFA 2G9BA 2LVIA 3SG4A 3E3RA 2E6WA 1Y1UA 1PALA 1W7IB 2JTZA 4PE1A 1DJZA 1JFKA 3AAJA 3AKBA 2L5XB 3EVUA 4YGEB 1BODA 1JBAA 1OQPA 1BMOA 1CKKA 2M8UA 4ORAB 1KSOA 1KQVA 5ER5A 3PN7B 1N0YA 5CSNA 4MRYA 2KI6C 3OP0A 4GUKA 2JNXA 1KWOB 1G8IA 3BOWB 3LLEA 3NSLA 4GBAA 3PATA 2Y5IA 1YX7A 2ZN9A 4HRHA 4GGFA 2NLNA 4I5LB 2LV7A 1JC2A 1YURA 1CFFA 2KSPA 3AAKA 2KNEA 1KK8C 1K9PA 4ORBB 1J55A 3TDUA 1ZFSA 2WCFA 1XK4C 2WCBA 1XA5A 3VRRA 3BUMB 3CZTX 2F3YA 4QJ3B 1JSAA 1S5GY 1UHHA 4CFQA 1G4YR 1K94A 3I5IB 1J7RA 1S1EA 5DKNA 2LANA 1TIZA 1Y6WA 3DVMA 4D1EA 2M3WA 1BR4B 1SYMA 2NXQA 4DIRA 5AEQA 3JTDB 4MZKA 2LP3A 4HSZA 1J7OA 4GFTA 4MLWA 1AUIB 2Y1MA 2CNPA 2IS9A 1FI6A 1NUBA 2LVJA 2KYFA 1RTP1 4MZJA 2EHBA 2KQ6A 3IQOA 4I5KA 1BT6A 3I5HC 1UHKA 1BU3A 3HX4A 4ZCUA 4DS7A 1H8BA 1NWDA 1TCOB 3A4UB 4PHNA 1FBVA 1K96A 2P6BB 2ZFDA 1XFVO 4QJ4B 5KU1A 2L0PA 3PFVA 4A4BA 3EK4A 4N1GA 2O5GA 2I7AA 3I5FC 2Q91A 2LP2A 4MZLA 1N2DA 1TTXA 2KI4B 2Y4QA 1A29A 3TS5C 4OV2A 4F0ZB 2KQYA 4ICBA 3VRNA 5DKRA 3VGOA 1R2UA 3FWBA 3IQQA 2WCEA 2BL0B 5KTYA 1WDCB 1V1GA 1YUTA 3QRXA 1JF0A 5CSFA 1GGZA 3CLNA 4DRWA 3TZ1A 5B8IB 1S36A 1QS7A 2KDHA 2MLFC 1M39A 5PALA 2M7LA 1SK6D 4YI9A 3LCPC 1NP8A 3MSEB 1SY9A 3CWGA 2LLSA 5DKQA 4BY5A 5AERA 1J7PA 3DF0A 1MR8A 2GGZA 4FTGA 1CLBA 1AVSA 1DJWA 4OR9B 1YUUA 1CTRA 3TDIA 1NX0A 1NCZA 3EVVA 1SR6B 4JQ0D 1G33A 4DUQA 3VROA 1ODBA 1NCYA 2FOTA 1OE9B 1S6IA 1QLSA 4AOMA 1J7QA 1DTLA 2H61C 4PHJA 2AMIA 2GV5A 1NIWA 1BJFA 4MRXA 1XVJA 2NCPA 4YI8A 5I2QA 5F6TA 1RROA 5GQQC 1EG3A 1K8UA 4CLNA 3D0YA 1TCFA 1EH2A 2PASA 2EC6C 4XJKB 2RGIA 1H4BA 4JWQA 4Q04A 3PM8A 4WQ2A 3GK2A 2JTTA 1CDPA 5CSJA 1YX8A 3TUYC 4E68A 2O60A 5HLVA 2MAZA 4IL1A 3SG5A 1TRFA 1AP4A 1ALVA 2KFGA 3SJSA 5JJGA 1CM4A 2ZNDA 1L2OB 2BE6A 3OX6A 3VRQA 1FPWA 4GAOA 3BUNB 2KHNA 1N65A 4GGNA 2LE9B 1XO5A 1A2XA 1OMRA 4GNKB 1QATA 1BF5A 1BOCA 3KEVA 1CB1A 1JUOA 1TNWA 2F8PA 2L4IA 1CMGA 1DJHA 2CTNA 1TNPA 4PCWA 1JF2A 1UHIA 1YTZC 2L2EA 2L98A 3OB2B 4YBHB 1OZOA 1Y0VH 1NYAA 2CCMA 1WLZA 1MUXA 2B1UA 1DT7B 2KAVA 1F8HA 2GGMA 5AANA 1A03A 1WLMA 1A75A 2Q4UA 3NXAA 2SCPA 1K90D 4WQ3A 1KFXS 2G2BA 5I8NA 1F55A 2PMYA 2JC2A 2LMVA 2NZ0A 1J1DA 1LA3A 4PE4A 1KQMC 1QJTA 1YRTB 1CDNA 1E8AA 2K2AA 1IJ5A 1UWOA 4PE0A 2FCEA 2OTGB 2V53A 3M0WA 2KI6D 4P2YB 1KSMA 1XFXO 2ZNEA 1DF0B 1EXRA 5TNCA 3PN7C 4CIDA 3SIAA 3CR2A 3I5GC 1RK9A 2M29A 2JRFA 3GK4X 3JVTC 5D7FA 1XFWO 3SIBA 4DCKA 2R2IA 3WNXB 2M7NA 2M49B 1QV1A 1DJXA 3ZNIA 1TOPA 5FYXA 4UPGA 1KK7Z 3H4SE 1QLKA 2WOSA 1UHNA 1QVIZ 1K9KA 2NCOA 2LLTA 1S26D 3RLZA 2M1KB 1QX7A 5JOLA 4YGCB 1KFXL 2H61A 4NDCA 4MN0A 4OVNF 2K8MB 1CMFA 2L4HA 1LA0A 2OS8B 2LAPA 2PRUA
chains in the Genus database with same CATH superfamily
4XYNA 1YVHA 1KWOC 1QXPA 1SCMB 1F71A 1YUSA 3FWCA 3PALA 3SG3A 1PVBA 3GK1A 4NDDA 2QACA 1NX2A 1MQ1A 5IBWA 3FE8A 2WC6A 1LKJA 1U5IA 1S6JA 3WHUB 2MRDA 1CM1A 2JT0A 2KGRA 1PRWA 1W9ZA 1SNLA 3EVRA 1DJIA 3PLFB 1DVIA 1LVCD 4A4CA 4F7FA 2K61A 4PE7A 1SKTA 3O4YA 1B7TY 1SBJA 2KGBC 3S0FA 3CYZA 3O2PA 1NSHA 1OMDA 4GPLB 1XFYO 2JQ6A 1C07A 2ISDA 1C7WA 2KBMA 1XFZO 2WCMA 1SPYA 2PALA 1QX2A 2I94A 2LHLA 2A4JA 3I5IC 2LLUA 1PVAA 1RECA 2HF5A 2PVBA 1HT9A 2LUXA 2WCKA 1QIWA 3BUOB 1DJGA 1K93D 2JT8A 3KF9A 3N7HA 3JTDC 1MXLC 3PSRA 2BCAA 4C0JA 1NX1A 4FQOA 4OCIA 5AFPA 1IQ3A 4N1FA 3NHIA 1YRUB 1UP5A 2GTEA 2I18A 2OPOA 5HYDA 1QIVA 1W7JB 4USLA 1XFUO 1Z2CB 3D10A 2K0JA 1DQEA 2COLB 3BUXB 3CGAA 3F45A 4PT1A 1CLLA 1X02A 3R1VA 1CFPA 1GM0A 1QV0A 2ERBA 4XJKA 1ZMZA 1BG1A 1YR5A 3O6BA 3FS7A 5K89A 3D74A 1XYDA 2JT3A 5FI7A 1PSBA 1BR1B 3FE6A 2L2CA 2JXLA 2BCBA 3HCMA 5CPVA 4YRUA 2KI4C 5HKYA 2PSRA 1IIOA 2KOTA 2KYCA 2LNKA 3SG2A 3DVKA 1DC1A 2BKIB 1M45A 2BKHB 2WCJA 1LINA 3DF0B 4M2OA 3KPXA 1MF8B 1TUJA 2BL0C 1PSRA 1J1EA 1TN4A 1WDCC 1UUSA 2K7DA 1SW8A 2VRGA 3BQ3A 1KCYA 4PHKA 1AJ4A 4AQJA 1GJYA 1SMGA 2EGDA 1ZUZA 2Y1NA 1KK8B 3SG6A 2F33A 4I5NB 1B47A 4MSPA 5DICA 3IF7A 3K21A 3EK7A 1OOIX 2ZRTA 3BOWA 3CR5X 5BPJA 4P5OE 5I2LA 5J3XA 4C0KA 2K7OA 1TWOA 1LXFC 1B8RA 1Q80A 1V1FA 3D0YB 1FW4A 1K9UA 1L7ZA 2FCDA 1DGUA 2SASA 3DYEA 1ZOTB 4M2QA 5I2OA 1SR6C 2K7CA 5D3OA 1K95A 2KFHA 1Y1AA 4HRGA 1B4CA 1F70A 1M31A 2BCXA 3L4AA 4NDBA 2CXJA 2ZRSA 3C1VA 4PDZA 2LMTA 1CLMA 3LK0A 1OOHA 1SL7A 2QEVA 3AKAA 4TNCA 4YGAA 2JPTA 1TNQA 1DF0A 1QASA 1S6CA 5ER4X 3TDZA 2MJWB 3I5HB 2LVKA 1EG4A 2QEHA 4U8DA 1C7VA 1B8CA 1QX5B 1FI5A 2KFFA 2ZN8A 1HQVA 2FJUB 1KFUS 2JXCA 4WRIA 1PULA 3CZ1A 2H2KA 2WCHA 1JFJA 3I5FB 1DJYA 1WRKA 2QEOA 3DY9A 2MLEC 4JKTA 1CDMA 2LHIA 1M46A 4HREE 3FE9A 1NCXA 1NPQA 2ZKMX 3TS5B 2WC8A 1OW4A 3LK1A 1RJVA 4NQGA 1F4OA 2BECA 2KLEA 4ETOA 3S0AA 1B9AA 2MHHA 4ZCVA 2CBLA 2LUCA 2K7BA 5HLOA 1IG5A 1Y1XA 3NSOA 1A75B 1L2OC 4MVFA 3RM1A 1IKUA 2K2FA 2I2RE 3WHTB 2YGUA 1JWDA 1CDLA 1A4PA 1UHJA 2F2PA 4IJ7A 5CSIA 3BFHA 2HQWA 3KO0A 5FI6A 2F3ZA 2M97A 1IH0A 3CS1A 3KHEA 5AXIA 3L4LA 3CR4X 4ORCB 2LM5A 3VRPA 4BY4A 3DVEA 1GGWA 1KFUL 4AQIA 1CFDA 3ICBA 3LL8B 3ZWHA 4QJ5B 2WORA 1LS8A 1WRLA 2DOQA 3CTNA 1ALWA 2D8NA 3NSKA 2KAYA 1AHRA 1DGVA 3NSIA 4OKHA 4PHMA 3EKHA 4CPVA 4YGDB 2JULA 1DELA 1UURA 3DD4A 4N5XA 4I5JA 4M2PA 1EJ3A 1SL9A 1EL4A 2OTGC 4C0LA 2K60A 2LVVA 4JPZB 4MEWA 5HKWA 2P71A 3R1OA 3OB1B 1MXEA 2M0RA 2JOJA 4CFRA 1SRAA 1SL8A 1OZSA 1CFCA 2EC6B 2TN4A 1IJ6A 1RWYA 4YGBB 1MWNA 1C3YA 4R1EA 3BJHA 2LC5A 1B1GA 3QMEA 2CT9A 3NHTA 4GGFC 1U5IB 2JWWA 1YVLA 2AUCA 3A8RA 5EL2A 3OHMB 1S5GZ 3TUYB 2AAOA 2JZIA 3IVTA 1OMVA 2BBNA 2F2OA 2QEBA 2KAXA 2OS8C 1GQMA 1SCVA 1FF1A 2HETA 1M63B 3DZTA 3WXAA 1WY9A 1OOJA 1SCMC 2BE4A 3O78A 1DMOA 5G08A 1F4QA 2WNDA 3CZ0A 1S3PA 1MHOA 3BFAA 2L51A 1RFJA 2LCPA 3BXKA 2E30A 3CZ2A 4MBEA 2QPTA 5KSZA 1IRJA 2JNFA 4INXA 1IGVA 1AK8A 1IQ5A 1CNPA 5HKZA 5D69A 1PK0D 1ZACA 2MA2A 1BLQA 1NX3A 2MBXA 1XK4A 3BYAA 3D73A 1B8LA 1F54A 1OSAA 1QTXA 3D76A 3BUWB 3EK8A 1D1OA 1WRZA 1KQMB 5I94A 2L50A 3RZSA 3SG7A 2KPHA 2JU0A 2HQ8A 1B7TZ 1KK7Y 1R6PA 2BBMA 3FIAA 1VRKA 4L9MA 3EKJA 1QVIY 2WCLA 2KBIA 2HPSA 3UNWA 2M1UA 1K2HA 3I5GB 3DVJA 1SSEB 1T14A 3JVTB 3B6XA 3OX5A 1AJ5A 2M9GA 2LMUA 1IWQA 1TNXA 3GOFA 4PALA 2G9BA 2LVIA 3SG4A 2P70A 3E3RA 1QWVA 2E6WA 1Y1UA 1PALA 1W7IB 2JTZA 4PE1A 1DJZA 1JFKA 3AAJA 3AKBA 2L5XB 3EVUA 4YGEB 3SS4A 1BODA 1JBAA 1OQPA 3PM2A 1BMOA 1CKKA 2M8UA 1OOGA 4ORAB 1KSOA 1KQVA 5ER5A 3PN7B 1N0YA 5CSNA 3OBVA 4MRYA 2KI6C 3OP0A 4GUKA 2JNXA 1KWOB 1G8IA 5HL1A 3BOWB 3LLEA 3NSLA 3S0DA 4GBAA 3B88A 3PATA 2Y5IA 1YX7A 2ZN9A 4HRHA 3Q8IA 4GGFA 4JD9A 2NLNA 4I5LB 2LV7A 1JC2A 3CABA 1YURA 1CFFA 2KSPA 3AAKA 3D77A 2KNEA 1KK8C 1K9PA 4ORBB 1J55A 3TDUA 1ZFSA 2WCFA 1XK4C 2WCBA 1XA5A 3VRRA 3BUMB 3CZTX 2F3YA 4QJ3B 1JSAA 1S5GY 1UHHA 3S0EA 2PQLA 4CFQA 1G4YR 1K94A 3I5IB 1J7RA 1S1EA 5DKNA 3VB1A 2LANA 1TIZA 1Y6WA 3DVMA 3PJIA 4D1EA 2M3WA 2L5YA 1BR4B 1SYMA 2NXQA 4DIRA 5AEQA 3JTDB 4MZKA 2LP3A 4HSZA 1J7OA 4GFTA 4MLWA 1AUIB 2Y1MA 2CNPA 2IS9A 3BFBA 1FI6A 1NUBA 2LVJA 2KYFA 1RTP1 4MZJA 2EHBA 2KQ6A 3IQOA 4I5KA 1BT6A 3I5HC 1UHKA 1BU3A 3HX4A 4ZCUA 4DS7A 1H8BA 1NWDA 1TCOB 2PYQA 3A4UB 4PHNA 1FBVA 1K96A 2BNXA 3V2LA 2P6BB 2ZFDA 4FQTA 1XFVO 4QJ4B 5KU1A 2L0PA 3PFVA 4A4BA 3EK4A 4N1GA 2O5GA 2I7AA 3I5FC 2Q91A 2LP2A 2QDIA 4MZLA 1TUZA 1N2DA 1TTXA 2KI4B 2WC5A 2Y4QA 1A29A 3TS5C 4OV2A 4F0ZB 3OGNA 3R1PA 2KQYA 4ICBA 3VRNA 5DKRA 3VGOA 1R2UA 3FWBA 3IQQA 2WCEA 2BL0B 5KTYA 1WDCB 1Z4HA 3NGVA 1V1GA 1YUTA 3QRXA 1JF0A 5CSFA 1GGZA 3CLNA 4DRWA 3TZ1A 5B8IB 4KYNA 1OOFA 1S36A 1QS7A 2KDHA 2MLFC 1XFRA 2H8VA 1M39A 3L47A 5PALA 2M7LA 1SK6D 4YI9A 3LCPC 1NP8A 3MSEB 1SY9A 3CWGA 2LLSA 5DKQA 4BY5A 5AERA 1J7PA 3DF0A 1MR8A 2GGZA 4FTGA 5FI2A 1CLBA 1AVSA 1DJWA 4OR9B 1YUUA 1CTRA 2JPOA 1NX0A 3TDIA 1NCZA 3EVVA 1SR6B 4JQ0D 1G33A 4DUQA 3VROA 1ODBA 1NCYA 2FOTA 1OE9B 1S6IA 1P28A 1QLSA 3D75A 4AOMA 1J7QA 1DTLA 2H61C 4PHJA 2AMIA 2GV5A 1NIWA 1BJFA 4MRXA 1XVJA 2NCPA 4YI8A 3SS3A 5I2QA 5F6TA 1RROA 5GQQC 1EG3A 3CDNA 1K8UA 4CLNA 3D0YA 1TCFA 3DXLA 2PASA 2EC6C 4XJKB 1EH2A 2RGIA 1H4BA 4JWQA 4Q04A 3PM8A 4WQ2A 3GK2A 2JTTA 1CDPA 5CSJA 1YX8A 3TUYC 3EG5B 4E68A 2O60A 5HLVA 2MAZA 3B87A 4IL1A 3SG5A 1TRFA 1AP4A 1ALVA 2KFGA 3S0BA 3SJSA 5JJGA 1CM4A 2ZNDA 1L2OB 2BE6A 1DEKA 3OX6A 3VRQA 1FPWA 4GAOA 1ORGA 2KHNA 1N65A 3BUNB 3K1EA 4GGNA 2LE9B 3UO9A 1XO5A 1A2XA 1OMRA 4GNKB 1QATA 1C3ZA 1BF5A 3KEVA 1BOCA 1CB1A 1JUOA 1TNWA 2F8PA 2L4IA 3B7AA 1DJHA 2CTNA 3B86A 1CMGA 1TNPA 4PCWA 1JF2A 1UHIA 1YTZC 2L2EA 2L98A 3OB2B 3R72A 4YBHB 1OZOA 1Y0VH 4OZDA 1NYAA 2CCMA 1WLZA 1MUXA 2B1UA 1DT7B 2KAVA 1F8HA 2GGMA 5AANA 1A03A 1WLMA 1A75A 2Q4UA 3NXAA 3O4XA 2SCPA 1K90D 2FJYA 4WQ3A 1KFXS 2G2BA 5I8NA 1F55A 3SS5A 2PMYA 3S0GA 2JC2A 2LMVA 2NZ0A 1J1DA 1LA3A 4PE4A 1KQMC 1QJTA 1YRTB 1CDNA 1E8AA 2K2AA 1IJ5A 1UWOA 4PE0A 2KLDA 2FCEA 2OTGB 2V53A 3M0WA 2KI6D 4P2YB 1KSMA 1XFXO 2ZNEA 1DF0B 1EXRA 5TNCA 3PN7C 4CIDA 3SIAA 3CR2A 3I5GC 1RK9A 2M29A 2JRFA 3GK4X 3JVTC 5D7FA 1XFWO 3SIBA 4DCKA 2R2IA 3WNXB 2M7NA 2M49B 1QV1A 1DJXA 3ZNIA 1TOPA 5FYXA 4UPGA 1KK7Z 3H4SE 1QLKA 2WOSA 1UHNA 1QVIZ 1K9KA 2NCOA 4INWA 2LLTA 1S26D 3D78A 3RLZA 2M1KB 1QX7A 5JOLA 4YGCB 1KFXL 2H61A 4NDCA 4MN0A 4OVNF 2K8MB 1CMFA 2BAPA 2L4HA 1LA0A 2OS8B 2LAPA 2PRUA
chains in the Genus database with same CATH topology
4XYNA 1YVHA 1KWOC 1QXPA 1SCMB 1F71A 1YUSA 3FWCA 3PALA 3SG3A 1PVBA 3GK1A 4NDDA 2QACA 1NX2A 1MQ1A 5IBWA 1LKJA 1U5IA 1S6JA 3WHUB 2MRDA 1CM1A 2JT0A 2KGRA 1PRWA 1SNLA 3EVRA 3PLFB 1DJIA 4A4CA 1DVIA 1LVCD 2K61A 4PE7A 1SKTA 3O4YA 1B7TY 1SBJA 2KGBC 3O2PA 1NSHA 1OMDA 4GPLB 1XFYO 2JQ6A 1C07A 2ISDA 1C7WA 2KBMA 1XFZO 1SPYA 2PALA 1QX2A 2I94A 2LHLA 2A4JA 3I5IC 2LLUA 1PVAA 1RECA 2HF5A 2PVBA 1HT9A 2LUXA 1QIWA 3BUOB 1DJGA 1K93D 2JT8A 3KF9A 3JTDC 1MXLC 3PSRA 2BCAA 4C0JA 1NX1A 4FQOA 4OCIA 5AFPA 1IQ3A 4N1FA 1YRUB 1UP5A 2I18A 2OPOA 5HYDA 1QIVA 1W7JB 4USLA 1XFUO 3D10A 2K0JA 3CGAA 2COLB 3BUXB 3F45A 1CLLA 1X02A 1CFPA 1QV0A 4XJKA 1ZMZA 1BG1A 1YR5A 3O6BA 3FS7A 5K89A 1XYDA 2JT3A 1PSBA 1BR1B 4YRUA 3HCMA 2JXLA 2BCBA 5CPVA 5HKYA 2KI4C 2PSRA 2KOTA 2KYCA 2LNKA 3SG2A 3DVKA 2BKIB 1M45A 2BKHB 1LINA 3DF0B 4M2OA 3KPXA 1MF8B 2BL0C 1PSRA 1J1EA 1TN4A 1WDCC 1UUSA 2K7DA 1SW8A 2VRGA 3BQ3A 1KCYA 4PHKA 1AJ4A 4AQJA 1GJYA 1SMGA 2EGDA 1ZUZA 2Y1NA 1KK8B 3SG6A 2F33A 4I5NB 1B47A 4MSPA 3IF7A 3K21A 3EK7A 2ZRTA 3BOWA 3CR5X 5BPJA 4P5OE 5I2LA 5J3XA 4C0KA 2K7OA 1LXFC 1B8RA 1Q80A 1V1FA 3D0YB 1FW4A 1K9UA 1L7ZA 2FCDA 1DGUA 2SASA 4M2QA 1ZOTB 5I2OA 1SR6C 2K7CA 1K95A 2KFHA 1Y1AA 4HRGA 1B4CA 1F70A 1M31A 2BCXA 4NDBA 2CXJA 2ZRSA 3C1VA 4PDZA 2LMTA 1CLMA 3LK0A 1SL7A 3AKAA 4TNCA 4YGAA 2JPTA 1TNQA 1DF0A 1QASA 1S6CA 5ER4X 3TDZA 2MJWB 3I5HB 2LVKA 1EG4A 4U8DA 1C7VA 1B8CA 1QX5B 1FI5A 2KFFA 2ZN8A 1HQVA 2FJUB 1KFUS 2JXCA 4WRIA 1PULA 1JFJA 2H2KA 3I5FB 1DJYA 1WRKA 2MLEC 1CDMA 2LHIA 1M46A 4HREE 1NCXA 1NPQA 2ZKMX 3TS5B 2WC8A 3LK1A 1RJVA 4NQGA 1F4OA 2BECA 4ETOA 1B9AA 2MHHA 4ZCVA 2CBLA 2LUCA 2K7BA 5HLOA 1IG5A 1Y1XA 3NSOA 1A75B 1L2OC 4MVFA 3RM1A 1IKUA 2K2FA 2I2RE 3WHTB 1JWDA 1CDLA 1A4PA 1UHJA 2F2PA 5CSIA 2HQWA 3KO0A 2F3ZA 2M97A 1IH0A 3CS1A 3KHEA 5AXIA 3CR4X 4ORCB 2LM5A 3VRPA 4BY4A 3DVEA 1GGWA 1KFUL 4AQIA 1CFDA 3ICBA 3LL8B 3ZWHA 4QJ5B 2WORA 1WRLA 2DOQA 3CTNA 1ALWA 2D8NA 3NSKA 2KAYA 1AHRA 1DGVA 3NSIA 4OKHA 4PHMA 3EKHA 4CPVA 4YGDB 2JULA 1UURA 3DD4A 4N5XA 4I5JA 4M2PA 1EJ3A 1SL9A 1EL4A 2OTGC 4C0LA 2LVVA 4JPZB 4MEWA 5HKWA 3OB1B 1MXEA 2M0RA 2JOJA 4CFRA 1SRAA 1SL8A 1OZSA 1CFCA 2EC6B 2TN4A 1IJ6A 1RWYA 4YGBB 1MWNA 4R1EA 1B1GA 2LC5A 2CT9A 4GGFC 1U5IB 2JWWA 1YVLA 2AUCA 3A8RA 3OHMB 1S5GZ 3TUYB 2AAOA 2JZIA 1OMVA 2BBNA 2F2OA 1FF1A 2KAXA 2OS8C 1GQMA 1SCVA 2HETA 1M63B 3WXAA 1WY9A 1OOJA 1SCMC 2BE4A 3O78A 1DMOA 5G08A 1F4QA 2WNDA 1S3PA 1MHOA 2L51A 1RFJA 2LCPA 3BXKA 2E30A 4MBEA 2QPTA 5KSZA 1IRJA 2JNFA 1IGVA 1AK8A 1IQ5A 1CNPA 5HKZA 5D69A 1PK0D 1ZACA 2MA2A 1BLQA 1NX3A 2MBXA 1XK4A 3BYAA 1B8LA 1F54A 1OSAA 1QTXA 3EK8A 3BUWB 1D1OA 1WRZA 1KQMB 2L50A 3SG7A 2JU0A 2HQ8A 1B7TZ 1KK7Y 1R6PA 2BBMA 3FIAA 1VRKA 4L9MA 3EKJA 1QVIY 2KBIA 2HPSA 2M1UA 1K2HA 3I5GB 3DVJA 3JVTB 3OX5A 4PALA 1AJ5A 2M9GA 2LMUA 1IWQA 1TNXA 3GOFA 2G9BA 2LVIA 3SG4A 3E3RA 2E6WA 1Y1UA 1PALA 1W7IB 2JTZA 4PE1A 1DJZA 1JFKA 3AAJA 3AKBA 2L5XB 3EVUA 4YGEB 1BODA 1JBAA 1OQPA 1BMOA 1CKKA 2M8UA 4ORAB 1KSOA 1KQVA 5ER5A 3PN7B 1N0YA 5CSNA 4MRYA 2KI6C 3OP0A 4GUKA 2JNXA 1KWOB 1G8IA 3BOWB 3LLEA 3NSLA 4GBAA 3PATA 2Y5IA 1YX7A 2ZN9A 4HRHA 4GGFA 2NLNA 4I5LB 2LV7A 1JC2A 1YURA 1CFFA 2KSPA 3AAKA 2KNEA 1KK8C 1K9PA 4ORBB 1J55A 3TDUA 1ZFSA 2WCFA 1XK4C 2WCBA 1XA5A 3VRRA 3BUMB 3CZTX 2F3YA 4QJ3B 1JSAA 1S5GY 1UHHA 4CFQA 1G4YR 1K94A 3I5IB 1J7RA 1S1EA 5DKNA 2LANA 1TIZA 1Y6WA 3DVMA 4D1EA 2M3WA 1BR4B 1SYMA 2NXQA 4DIRA 5AEQA 3JTDB 4MZKA 2LP3A 4HSZA 1J7OA 4GFTA 4MLWA 1AUIB 2Y1MA 2CNPA 2IS9A 1FI6A 1NUBA 2LVJA 2KYFA 1RTP1 4MZJA 2EHBA 2KQ6A 3IQOA 4I5KA 1BT6A 3I5HC 1UHKA 1BU3A 3HX4A 4ZCUA 4DS7A 1H8BA 1NWDA 1TCOB 3A4UB 4PHNA 1FBVA 1K96A 2P6BB 2ZFDA 1XFVO 4QJ4B 5KU1A 2L0PA 3PFVA 4A4BA 3EK4A 4N1GA 2O5GA 2I7AA 3I5FC 2Q91A 2LP2A 4MZLA 1N2DA 1TTXA 2KI4B 2Y4QA 1A29A 3TS5C 4OV2A 4F0ZB 2KQYA 4ICBA 3VRNA 5DKRA 3VGOA 1R2UA 3FWBA 3IQQA 2WCEA 2BL0B 5KTYA 1WDCB 1V1GA 1YUTA 3QRXA 1JF0A 5CSFA 1GGZA 3CLNA 4DRWA 3TZ1A 5B8IB 1S36A 1QS7A 2KDHA 2MLFC 1M39A 5PALA 2M7LA 1SK6D 4YI9A 3LCPC 1NP8A 3MSEB 1SY9A 3CWGA 2LLSA 5DKQA 4BY5A 5AERA 1J7PA 3DF0A 1MR8A 2GGZA 4FTGA 1CLBA 1AVSA 1DJWA 4OR9B 1YUUA 1CTRA 3TDIA 1NX0A 1NCZA 3EVVA 1SR6B 4JQ0D 1G33A 4DUQA 3VROA 1ODBA 1NCYA 2FOTA 1OE9B 1S6IA 1QLSA 4AOMA 1J7QA 1DTLA 2H61C 4PHJA 2AMIA 2GV5A 1NIWA 1BJFA 4MRXA 1XVJA 2NCPA 4YI8A 5I2QA 5F6TA 1RROA 5GQQC 1EG3A 1K8UA 4CLNA 3D0YA 1TCFA 1EH2A 2PASA 2EC6C 4XJKB 2RGIA 1H4BA 4JWQA 4Q04A 3PM8A 4WQ2A 3GK2A 2JTTA 1CDPA 5CSJA 1YX8A 3TUYC 4E68A 2O60A 5HLVA 2MAZA 4IL1A 3SG5A 1TRFA 1AP4A 1ALVA 2KFGA 3SJSA 5JJGA 1CM4A 2ZNDA 1L2OB 2BE6A 3OX6A 3VRQA 1FPWA 4GAOA 3BUNB 2KHNA 1N65A 4GGNA 2LE9B 1XO5A 1A2XA 1OMRA 4GNKB 1QATA 1BF5A 1BOCA 3KEVA 1CB1A 1JUOA 1TNWA 2F8PA 2L4IA 1CMGA 1DJHA 2CTNA 1TNPA 4PCWA 1JF2A 1UHIA 1YTZC 2L2EA 2L98A 3OB2B 4YBHB 1OZOA 1Y0VH 1NYAA 2CCMA 1WLZA 1MUXA 2B1UA 1DT7B 2KAVA 1F8HA 2GGMA 5AANA 1A03A 1WLMA 1A75A 2Q4UA 3NXAA 2SCPA 1K90D 4WQ3A 1KFXS 2G2BA 5I8NA 1F55A 2PMYA 2JC2A 2LMVA 2NZ0A 1J1DA 1LA3A 4PE4A 1KQMC 1QJTA 1YRTB 1CDNA 1E8AA 2K2AA 1IJ5A 1UWOA 4PE0A 2FCEA 2OTGB 2V53A 3M0WA 2KI6D 4P2YB 1KSMA 1XFXO 2ZNEA 1DF0B 1EXRA 5TNCA 3PN7C 4CIDA 3SIAA 3CR2A 3I5GC 1RK9A 2M29A 2JRFA 3GK4X 3JVTC 5D7FA 1XFWO 3SIBA 4DCKA 2R2IA 3WNXB 2M7NA 2M49B 1QV1A 1DJXA 3ZNIA 1TOPA 5FYXA 4UPGA 1KK7Z 3H4SE 1QLKA 2WOSA 1UHNA 1QVIZ 1K9KA 2NCOA 2LLTA 1S26D 3RLZA 2M1KB 1QX7A 5JOLA 4YGCB 1KFXL 2H61A 4NDCA 4MN0A 4OVNF 2K8MB 1CMFA 2L4HA 1LA0A 2OS8B 2LAPA 2PRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYN A;  1YVH A;  1KWO C;  1QXP A;  1SCM B;  1F71 A;  1YUS A;  3FWC A;  3PAL A;  3SG3 A;  1PVB A;  3GK1 A;  4NDD A;  2QAC A;  1NX2 A;  1MQ1 A;  5IBW A;  1LKJ A;  1U5I A;  1S6J A;  3WHU B;  2MRD A;  1CM1 A;  2JT0 A;  2KGR A;  1PRW A;  1SNL A;  3EVR A;  3PLF B;  1DJI A;  4A4C A;  1DVI A;  1LVC D;  2K61 A;  4PE7 A;  1SKT A;  3O4Y A;  1B7T Y;  1SBJ A;  2KGB C;  3O2P A;  1NSH A;  1OMD A;  4GPL B;  1XFY O;  2JQ6 A;  1C07 A;  2ISD A;  1C7W A;  2KBM A;  1XFZ O;  1SPY A;  2PAL A;  1QX2 A;  2I94 A;  2LHL A;  2A4J A;  3I5I C;  2LLU A;  1PVA A;  1REC A;  2HF5 A;  2PVB A;  1HT9 A;  2LUX A;  1QIW A;  3BUO B;  1DJG A;  1K93 D;  2JT8 A;  3KF9 A;  3JTD C;  1MXL C;  3PSR A;  2BCA A;  4C0J A;  1NX1 A;  4FQO A;  4OCI A;  5AFP A;  1IQ3 A;  4N1F A;  1YRU B;  1UP5 A;  2I18 A;  2OPO A;  5HYD A;  1QIV A;  1W7J B;  4USL A;  1XFU O;  3D10 A;  2K0J A;  3CGA A;  2COL B;  3BUX B;  3F45 A;  1CLL A;  1X02 A;  1CFP A;  1QV0 A;  4XJK A;  1ZMZ A;  1BG1 A;  1YR5 A;  3O6B A;  3FS7 A;  5K89 A;  1XYD A;  2JT3 A;  1PSB A;  1BR1 B;  4YRU A;  3HCM A;  2JXL A;  2BCB A;  5CPV A;  5HKY A;  2KI4 C;  2PSR A;  2KOT A;  2KYC A;  2LNK A;  3SG2 A;  3DVK A;  2BKI B;  1M45 A;  2BKH B;  1LIN A;  3DF0 B;  4M2O A;  3KPX A;  1MF8 B;  2BL0 C;  1PSR A;  1J1E A;  1TN4 A;  1WDC C;  1UUS A;  2K7D A;  1SW8 A;  2VRG A;  3BQ3 A;  1KCY A;  4PHK A;  1AJ4 A;  4AQJ A;  1GJY A;  1SMG A;  2EGD A;  1ZUZ A;  2Y1N A;  1KK8 B;  3SG6 A;  2F33 A;  4I5N B;  1B47 A;  4MSP A;  3IF7 A;  3K21 A;  3EK7 A;  2ZRT A;  3BOW A;  3CR5 X;  5BPJ A;  4P5O E;  5I2L A;  5J3X A;  4C0K A;  2K7O A;  1LXF C;  1B8R A;  1Q80 A;  1V1F A;  3D0Y B;  1FW4 A;  1K9U A;  1L7Z A;  2FCD A;  1DGU A;  2SAS A;  4M2Q A;  1ZOT B;  5I2O A;  1SR6 C;  2K7C A;  1K95 A;  2KFH A;  1Y1A A;  4HRG A;  1B4C A;  1F70 A;  1M31 A;  2BCX A;  4NDB A;  2CXJ A;  2ZRS A;  3C1V A;  4PDZ A;  2LMT A;  1CLM A;  3LK0 A;  1SL7 A;  3AKA A;  4TNC A;  4YGA A;  2JPT A;  1TNQ A;  1DF0 A;  1QAS A;  1S6C A;  5ER4 X;  3TDZ A;  2MJW B;  3I5H B;  2LVK A;  1EG4 A;  4U8D A;  1C7V A;  1B8C A;  1QX5 B;  1FI5 A;  2KFF A;  2ZN8 A;  1HQV A;  2FJU B;  1KFU S;  2JXC A;  4WRI A;  1PUL A;  1JFJ A;  2H2K A;  3I5F B;  1DJY A;  1WRK A;  2MLE C;  1CDM A;  2LHI A;  1M46 A;  4HRE E;  1NCX A;  1NPQ A;  2ZKM X;  3TS5 B;  2WC8 A;  3LK1 A;  1RJV A;  4NQG A;  1F4O A;  2BEC A;  4ETO A;  1B9A A;  2MHH A;  4ZCV A;  2CBL A;  2LUC A;  2K7B A;  5HLO A;  1IG5 A;  1Y1X A;  3NSO A;  1A75 B;  1L2O C;  4MVF A;  3RM1 A;  1IKU A;  2K2F A;  2I2R E;  3WHT B;  1JWD A;  1CDL A;  1A4P A;  1UHJ A;  2F2P A;  5CSI A;  2HQW A;  3KO0 A;  2F3Z A;  2M97 A;  1IH0 A;  3CS1 A;  3KHE A;  5AXI A;  3CR4 X;  4ORC B;  2LM5 A;  3VRP A;  4BY4 A;  3DVE A;  1GGW A;  1KFU L;  4AQI A;  1CFD A;  3ICB A;  3LL8 B;  3ZWH A;  4QJ5 B;  2WOR A;  1WRL A;  2DOQ A;  3CTN A;  1ALW A;  2D8N A;  3NSK A;  2KAY A;  1AHR A;  1DGV A;  3NSI A;  4OKH A;  4PHM A;  3EKH A;  4CPV A;  4YGD B;  2JUL A;  1UUR A;  3DD4 A;  4N5X A;  4I5J A;  4M2P A;  1EJ3 A;  1SL9 A;  1EL4 A;  2OTG C;  4C0L A;  2LVV A;  4JPZ B;  4MEW A;  5HKW A;  3OB1 B;  1MXE A;  2M0R A;  2JOJ A;  4CFR A;  1SRA A;  1SL8 A;  1OZS A;  1CFC A;  2EC6 B;  2TN4 A;  1IJ6 A;  1RWY A;  4YGB B;  1MWN A;  4R1E A;  1B1G A;  2LC5 A;  2CT9 A;  4GGF C;  1U5I B;  2JWW A;  1YVL A;  2AUC A;  3A8R A;  3OHM B;  1S5G Z;  3TUY B;  2AAO A;  2JZI A;  1OMV A;  2BBN A;  2F2O A;  1FF1 A;  2KAX A;  2OS8 C;  1GQM A;  1SCV A;  2HET A;  1M63 B;  3WXA A;  1WY9 A;  1OOJ A;  1SCM C;  2BE4 A;  3O78 A;  1DMO A;  5G08 A;  1F4Q A;  2WND A;  1S3P A;  1MHO A;  2L51 A;  1RFJ A;  2LCP A;  3BXK A;  2E30 A;  4MBE A;  2QPT A;  5KSZ A;  1IRJ A;  2JNF A;  1IGV A;  1AK8 A;  1IQ5 A;  1CNP A;  5HKZ A;  5D69 A;  1PK0 D;  1ZAC A;  2MA2 A;  1BLQ A;  1NX3 A;  2MBX A;  1XK4 A;  3BYA A;  1B8L A;  1F54 A;  1OSA A;  1QTX A;  3EK8 A;  3BUW B;  1D1O A;  1WRZ A;  1KQM B;  2L50 A;  3SG7 A;  2JU0 A;  2HQ8 A;  1B7T Z;  1KK7 Y;  1R6P A;  2BBM A;  3FIA A;  1VRK A;  4L9M A;  3EKJ A;  1QVI Y;  2KBI A;  2HPS A;  2M1U A;  1K2H A;  3I5G B;  3DVJ A;  3JVT B;  3OX5 A;  4PAL A;  1AJ5 A;  2M9G A;  2LMU A;  1IWQ A;  1TNX A;  3GOF A;  2G9B A;  2LVI A;  3SG4 A;  3E3R A;  2E6W A;  1Y1U A;  1PAL A;  1W7I B;  2JTZ A;  4PE1 A;  1DJZ A;  1JFK A;  3AAJ A;  3AKB A;  2L5X B;  3EVU A;  4YGE B;  1BOD A;  1JBA A;  1OQP A;  1BMO A;  1CKK A;  2M8U A;  4ORA B;  1KSO A;  1KQV A;  5ER5 A;  3PN7 B;  1N0Y A;  5CSN A;  4MRY A;  2KI6 C;  3OP0 A;  4GUK A;  2JNX A;  1KWO B;  1G8I A;  3BOW B;  3LLE A;  3NSL A;  4GBA A;  3PAT A;  2Y5I A;  1YX7 A;  2ZN9 A;  4HRH A;  4GGF A;  2NLN A;  4I5L B;  2LV7 A;  1JC2 A;  1YUR A;  1CFF A;  2KSP A;  3AAK A;  2KNE A;  1KK8 C;  1K9P A;  4ORB B;  1J55 A;  3TDU A;  1ZFS A;  2WCF A;  1XK4 C;  2WCB A;  1XA5 A;  3VRR A;  3BUM B;  3CZT X;  2F3Y A;  4QJ3 B;  1JSA A;  1S5G Y;  1UHH A;  4CFQ A;  1G4Y R;  1K94 A;  3I5I B;  1J7R A;  1S1E A;  5DKN A;  2LAN A;  1TIZ A;  1Y6W A;  3DVM A;  4D1E A;  2M3W A;  1BR4 B;  1SYM A;  2NXQ A;  4DIR A;  5AEQ A;  3JTD B;  4MZK A;  2LP3 A;  4HSZ A;  1J7O A;  4GFT A;  4MLW A;  1AUI B;  2Y1M A;  2CNP A;  2IS9 A;  1FI6 A;  1NUB A;  2LVJ A;  2KYF A;  1RTP 1;  4MZJ A;  2EHB A;  2KQ6 A;  3IQO A;  4I5K A;  1BT6 A;  3I5H C;  1UHK A;  1BU3 A;  3HX4 A;  4ZCU A;  4DS7 A;  1H8B A;  1NWD A;  1TCO B;  3A4U B;  4PHN A;  1FBV A;  1K96 A;  2P6B B;  2ZFD A;  1XFV O;  4QJ4 B;  5KU1 A;  2L0P A;  3PFV A;  4A4B A;  3EK4 A;  4N1G A;  2O5G A;  2I7A A;  3I5F C;  2Q91 A;  2LP2 A;  4MZL A;  1N2D A;  1TTX A;  2KI4 B;  2Y4Q A;  1A29 A;  3TS5 C;  4OV2 A;  4F0Z B;  2KQY A;  4ICB A;  3VRN A;  5DKR A;  3VGO A;  1R2U A;  3FWB A;  3IQQ A;  2WCE A;  2BL0 B;  5KTY A;  1WDC B;  1V1G A;  1YUT A;  3QRX A;  1JF0 A;  5CSF A;  1GGZ A;  3CLN A;  4DRW A;  3TZ1 A;  5B8I B;  1S36 A;  1QS7 A;  2KDH A;  2MLF C;  1M39 A;  5PAL A;  2M7L A;  1SK6 D;  4YI9 A;  3LCP C;  1NP8 A;  3MSE B;  1SY9 A;  3CWG A;  2LLS A;  5DKQ A;  4BY5 A;  5AER A;  1J7P A;  3DF0 A;  1MR8 A;  2GGZ A;  4FTG A;  1CLB A;  1AVS A;  1DJW A;  4OR9 B;  1YUU A;  1CTR A;  3TDI A;  1NX0 A;  1NCZ A;  3EVV A;  1SR6 B;  4JQ0 D;  1G33 A;  4DUQ A;  3VRO A;  1ODB A;  1NCY A;  2FOT A;  1OE9 B;  1S6I A;  1QLS A;  4AOM A;  1J7Q A;  1DTL A;  2H61 C;  4PHJ A;  2AMI A;  2GV5 A;  1NIW A;  1BJF A;  4MRX A;  1XVJ A;  2NCP A;  4YI8 A;  5I2Q A;  5F6T A;  1RRO A;  5GQQ C;  1EG3 A;  1K8U A;  4CLN A;  3D0Y A;  1TCF A;  1EH2 A;  2PAS A;  2EC6 C;  4XJK B;  2RGI A;  1H4B A;  4JWQ A;  4Q04 A;  3PM8 A;  4WQ2 A;  3GK2 A;  2JTT A;  1CDP A;  5CSJ A;  1YX8 A;  3TUY C;  4E68 A;  2O60 A;  5HLV A;  2MAZ A;  4IL1 A;  3SG5 A;  1TRF A;  1AP4 A;  1ALV A;  2KFG A;  3SJS A;  5JJG A;  1CM4 A;  2ZND A;  1L2O B;  2BE6 A;  3OX6 A;  3VRQ A;  1FPW A;  4GAO A;  3BUN B;  2KHN A;  1N65 A;  4GGN A;  2LE9 B;  1XO5 A;  1A2X A;  1OMR A;  4GNK B;  1QAT A;  1BF5 A;  1BOC A;  3KEV A;  1CB1 A;  1JUO A;  1TNW A;  2F8P A;  2L4I A;  1CMG A;  1DJH A;  2CTN A;  1TNP A;  4PCW A;  1JF2 A;  1UHI A;  1YTZ C;  2L2E A;  2L98 A;  3OB2 B;  4YBH B;  1OZO A;  1Y0V H;  1NYA A;  2CCM A;  1WLZ A;  1MUX A;  2B1U A;  1DT7 B;  2KAV A;  1F8H A;  2GGM A;  5AAN A;  1A03 A;  1WLM A;  1A75 A;  2Q4U A;  3NXA A;  2SCP A;  1K90 D;  4WQ3 A;  1KFX S;  2G2B A;  5I8N A;  1F55 A;  2PMY A;  2JC2 A;  2LMV A;  2NZ0 A;  1J1D A;  1LA3 A;  4PE4 A;  1KQM C;  1QJT A;  1YRT B;  1CDN A;  1E8A A;  2K2A A;  1IJ5 A;  1UWO A;  4PE0 A;  2FCE A;  2OTG B;  2V53 A;  3M0W A;  2KI6 D;  4P2Y B;  1KSM A;  1XFX O;  2ZNE A;  1DF0 B;  1EXR A;  5TNC A;  3PN7 C;  4CID A;  3SIA A;  3CR2 A;  3I5G C;  1RK9 A;  2M29 A;  2JRF A;  3GK4 X;  3JVT C;  5D7F A;  1XFW O;  3SIB A;  4DCK A;  2R2I A;  3WNX B;  2M7N A;  2M49 B;  1QV1 A;  1DJX A;  3ZNI A;  1TOP A;  5FYX A;  4UPG A;  1KK7 Z;  3H4S E;  1QLK A;  2WOS A;  1UHN A;  1QVI Z;  1K9K A;  2NCO A;  2LLT A;  1S26 D;  3RLZ A;  2M1K B;  1QX7 A;  5JOL A;  4YGC B;  1KFX L;  2H61 A;  4NDC A;  4MN0 A;  4OVN F;  2K8M B;  1CMF A;  2L4H A;  1LA0 A;  2OS8 B;  2LAP A;  2PRU A; 
#chains in the Genus database with same CATH topology
 4XYN A;  1YVH A;  1KWO C;  1QXP A;  1SCM B;  1F71 A;  1YUS A;  3FWC A;  3PAL A;  3SG3 A;  1PVB A;  3GK1 A;  4NDD A;  2QAC A;  1NX2 A;  1MQ1 A;  5IBW A;  3FE8 A;  2WC6 A;  1LKJ A;  1U5I A;  1S6J A;  3WHU B;  2MRD A;  1CM1 A;  2JT0 A;  2KGR A;  1PRW A;  1W9Z A;  1SNL A;  3EVR A;  1DJI A;  3PLF B;  1DVI A;  1LVC D;  4A4C A;  4F7F A;  2K61 A;  4PE7 A;  1SKT A;  3O4Y A;  1B7T Y;  1SBJ A;  2KGB C;  3S0F A;  3CYZ A;  3O2P A;  1NSH A;  1OMD A;  4GPL B;  1XFY O;  2JQ6 A;  1C07 A;  2ISD A;  1C7W A;  2KBM A;  1XFZ O;  2WCM A;  1SPY A;  2PAL A;  1QX2 A;  2I94 A;  2LHL A;  2A4J A;  3I5I C;  2LLU A;  1PVA A;  1REC A;  2HF5 A;  2PVB A;  1HT9 A;  2LUX A;  2WCK A;  1QIW A;  3BUO B;  1DJG A;  1K93 D;  2JT8 A;  3KF9 A;  3N7H A;  3JTD C;  1MXL C;  3PSR A;  2BCA A;  4C0J A;  1NX1 A;  4FQO A;  4OCI A;  5AFP A;  1IQ3 A;  4N1F A;  3NHI A;  1YRU B;  1UP5 A;  2GTE A;  2I18 A;  2OPO A;  5HYD A;  1QIV A;  1W7J B;  4USL A;  1XFU O;  1Z2C B;  3D10 A;  2K0J A;  1DQE A;  2COL B;  3BUX B;  3CGA A;  3F45 A;  4PT1 A;  1CLL A;  1X02 A;  3R1V A;  1CFP A;  1GM0 A;  1QV0 A;  2ERB A;  4XJK A;  1ZMZ A;  1BG1 A;  1YR5 A;  3O6B A;  3FS7 A;  5K89 A;  3D74 A;  1XYD A;  2JT3 A;  5FI7 A;  1PSB A;  1BR1 B;  3FE6 A;  2L2C A;  2JXL A;  2BCB A;  3HCM A;  5CPV A;  4YRU A;  2KI4 C;  5HKY A;  2PSR A;  1IIO A;  2KOT A;  2KYC A;  2LNK A;  3SG2 A;  3DVK A;  1DC1 A;  2BKI B;  1M45 A;  2BKH B;  2WCJ A;  1LIN A;  3DF0 B;  4M2O A;  3KPX A;  1MF8 B;  1TUJ A;  2BL0 C;  1PSR A;  1J1E A;  1TN4 A;  1WDC C;  1UUS A;  2K7D A;  1SW8 A;  2VRG A;  3BQ3 A;  1KCY A;  4PHK A;  1AJ4 A;  4AQJ A;  1GJY A;  1SMG A;  2EGD A;  1ZUZ A;  2Y1N A;  1KK8 B;  3SG6 A;  2F33 A;  4I5N B;  1B47 A;  4MSP A;  5DIC A;  3IF7 A;  3K21 A;  3EK7 A;  1OOI X;  2ZRT A;  3BOW A;  3CR5 X;  5BPJ A;  4P5O E;  5I2L A;  5J3X A;  4C0K A;  2K7O A;  1TWO A;  1LXF C;  1B8R A;  1Q80 A;  1V1F A;  3D0Y B;  1FW4 A;  1K9U A;  1L7Z A;  2FCD A;  1DGU A;  2SAS A;  3DYE A;  1ZOT B;  4M2Q A;  5I2O A;  1SR6 C;  2K7C A;  5D3O A;  1K95 A;  2KFH A;  1Y1A A;  4HRG A;  1B4C A;  1F70 A;  1M31 A;  2BCX A;  3L4A A;  4NDB A;  2CXJ A;  2ZRS A;  3C1V A;  4PDZ A;  2LMT A;  1CLM A;  3LK0 A;  1OOH A;  1SL7 A;  2QEV A;  3AKA A;  4TNC A;  4YGA A;  2JPT A;  1TNQ A;  1DF0 A;  1QAS A;  1S6C A;  5ER4 X;  3TDZ A;  2MJW B;  3I5H B;  2LVK A;  1EG4 A;  2QEH A;  4U8D A;  1C7V A;  1B8C A;  1QX5 B;  1FI5 A;  2KFF A;  2ZN8 A;  1HQV A;  2FJU B;  1KFU S;  2JXC A;  4WRI A;  1PUL A;  3CZ1 A;  2H2K A;  2WCH A;  1JFJ A;  3I5F B;  1DJY A;  1WRK A;  2QEO A;  3DY9 A;  2MLE C;  4JKT A;  1CDM A;  2LHI A;  1M46 A;  4HRE E;  3FE9 A;  1NCX A;  1NPQ A;  2ZKM X;  3TS5 B;  2WC8 A;  1OW4 A;  3LK1 A;  1RJV A;  4NQG A;  1F4O A;  2BEC A;  2KLE A;  4ETO A;  3S0A A;  1B9A A;  2MHH A;  4ZCV A;  2CBL A;  2LUC A;  2K7B A;  5HLO A;  1IG5 A;  1Y1X A;  3NSO A;  1A75 B;  1L2O C;  4MVF A;  3RM1 A;  1IKU A;  2K2F A;  2I2R E;  3WHT B;  2YGU A;  1JWD A;  1CDL A;  1A4P A;  1UHJ A;  2F2P A;  4IJ7 A;  5CSI A;  3BFH A;  2HQW A;  3KO0 A;  5FI6 A;  2F3Z A;  2M97 A;  1IH0 A;  3CS1 A;  3KHE A;  5AXI A;  3L4L A;  3CR4 X;  4ORC B;  2LM5 A;  3VRP A;  4BY4 A;  3DVE A;  1GGW A;  1KFU L;  4AQI A;  1CFD A;  3ICB A;  3LL8 B;  3ZWH A;  4QJ5 B;  2WOR A;  1LS8 A;  1WRL A;  2DOQ A;  3CTN A;  1ALW A;  2D8N A;  3NSK A;  2KAY A;  1AHR A;  1DGV A;  3NSI A;  4OKH A;  4PHM A;  3EKH A;  4CPV A;  4YGD B;  2JUL A;  1DEL A;  1UUR A;  3DD4 A;  4N5X A;  4I5J A;  4M2P A;  1EJ3 A;  1SL9 A;  1EL4 A;  2OTG C;  4C0L A;  2K60 A;  2LVV A;  4JPZ B;  4MEW A;  5HKW A;  2P71 A;  3R1O A;  3OB1 B;  1MXE A;  2M0R A;  2JOJ A;  4CFR A;  1SRA A;  1SL8 A;  1OZS A;  1CFC A;  2EC6 B;  2TN4 A;  1IJ6 A;  1RWY A;  4YGB B;  1MWN A;  1C3Y A;  4R1E A;  3BJH A;  2LC5 A;  1B1G A;  3QME A;  2CT9 A;  3NHT A;  4GGF C;  1U5I B;  2JWW A;  1YVL A;  2AUC A;  3A8R A;  5EL2 A;  3OHM B;  1S5G Z;  3TUY B;  2AAO A;  2JZI A;  3IVT A;  1OMV A;  2BBN A;  2F2O A;  2QEB A;  2KAX A;  2OS8 C;  1GQM A;  1SCV A;  1FF1 A;  2HET A;  1M63 B;  3DZT A;  3WXA A;  1WY9 A;  1OOJ A;  1SCM C;  2BE4 A;  3O78 A;  1DMO A;  5G08 A;  1F4Q A;  2WND A;  3CZ0 A;  1S3P A;  1MHO A;  3BFA A;  2L51 A;  1RFJ A;  2LCP A;  3BXK A;  2E30 A;  3CZ2 A;  4MBE A;  2QPT A;  5KSZ A;  1IRJ A;  2JNF A;  4INX A;  1IGV A;  1AK8 A;  1IQ5 A;  1CNP A;  5HKZ A;  5D69 A;  1PK0 D;  1ZAC A;  2MA2 A;  1BLQ A;  1NX3 A;  2MBX A;  1XK4 A;  3BYA A;  3D73 A;  1B8L A;  1F54 A;  1OSA A;  1QTX A;  3D76 A;  3BUW B;  3EK8 A;  1D1O A;  1WRZ A;  1KQM B;  5I94 A;  2L50 A;  3RZS A;  3SG7 A;  2KPH A;  2JU0 A;  2HQ8 A;  1B7T Z;  1KK7 Y;  1R6P A;  2BBM A;  3FIA A;  1VRK A;  4L9M A;  3EKJ A;  1QVI Y;  2WCL A;  2KBI A;  2HPS A;  3UNW A;  2M1U A;  1K2H A;  3I5G B;  3DVJ A;  1SSE B;  1T14 A;  3JVT B;  3B6X A;  3OX5 A;  1AJ5 A;  2M9G A;  2LMU A;  1IWQ A;  1TNX A;  3GOF A;  4PAL A;  2G9B A;  2LVI A;  3SG4 A;  2P70 A;  3E3R A;  1QWV A;  2E6W A;  1Y1U A;  1PAL A;  1W7I B;  2JTZ A;  4PE1 A;  1DJZ A;  1JFK A;  3AAJ A;  3AKB A;  2L5X B;  3EVU A;  4YGE B;  3SS4 A;  1BOD A;  1JBA A;  1OQP A;  3PM2 A;  1BMO A;  1CKK A;  2M8U A;  1OOG A;  4ORA B;  1KSO A;  1KQV A;  5ER5 A;  3PN7 B;  1N0Y A;  5CSN A;  3OBV A;  4MRY A;  2KI6 C;  3OP0 A;  4GUK A;  2JNX A;  1KWO B;  1G8I A;  5HL1 A;  3BOW B;  3LLE A;  3NSL A;  3S0D A;  4GBA A;  3B88 A;  3PAT A;  2Y5I A;  1YX7 A;  2ZN9 A;  4HRH A;  3Q8I A;  4GGF A;  4JD9 A;  2NLN A;  4I5L B;  2LV7 A;  1JC2 A;  3CAB A;  1YUR A;  1CFF A;  2KSP A;  3AAK A;  3D77 A;  2KNE A;  1KK8 C;  1K9P A;  4ORB B;  1J55 A;  3TDU A;  1ZFS A;  2WCF A;  1XK4 C;  2WCB A;  1XA5 A;  3VRR A;  3BUM B;  3CZT X;  2F3Y A;  4QJ3 B;  1JSA A;  1S5G Y;  1UHH A;  3S0E A;  2PQL A;  4CFQ A;  1G4Y R;  1K94 A;  3I5I B;  1J7R A;  1S1E A;  5DKN A;  3VB1 A;  2LAN A;  1TIZ A;  1Y6W A;  3DVM A;  3PJI A;  4D1E A;  2M3W A;  2L5Y A;  1BR4 B;  1SYM A;  2NXQ A;  4DIR A;  5AEQ A;  3JTD B;  4MZK A;  2LP3 A;  4HSZ A;  1J7O A;  4GFT A;  4MLW A;  1AUI B;  2Y1M A;  2CNP A;  2IS9 A;  3BFB A;  1FI6 A;  1NUB A;  2LVJ A;  2KYF A;  1RTP 1;  4MZJ A;  2EHB A;  2KQ6 A;  3IQO A;  4I5K A;  1BT6 A;  3I5H C;  1UHK A;  1BU3 A;  3HX4 A;  4ZCU A;  4DS7 A;  1H8B A;  1NWD A;  1TCO B;  2PYQ A;  3A4U B;  4PHN A;  1FBV A;  1K96 A;  2BNX A;  3V2L A;  2P6B B;  2ZFD A;  4FQT A;  1XFV O;  4QJ4 B;  5KU1 A;  2L0P A;  3PFV A;  4A4B A;  3EK4 A;  4N1G A;  2O5G A;  2I7A A;  3I5F C;  2Q91 A;  2LP2 A;  2QDI A;  4MZL A;  1TUZ A;  1N2D A;  1TTX A;  2KI4 B;  2WC5 A;  2Y4Q A;  1A29 A;  3TS5 C;  4OV2 A;  4F0Z B;  3OGN A;  3R1P A;  2KQY A;  4ICB A;  3VRN A;  5DKR A;  3VGO A;  1R2U A;  3FWB A;  3IQQ A;  2WCE A;  2BL0 B;  5KTY A;  1WDC B;  1Z4H A;  3NGV A;  1V1G A;  1YUT A;  3QRX A;  1JF0 A;  5CSF A;  1GGZ A;  3CLN A;  4DRW A;  3TZ1 A;  5B8I B;  4KYN A;  1OOF A;  1S36 A;  1QS7 A;  2KDH A;  2MLF C;  1XFR A;  2H8V A;  1M39 A;  3L47 A;  5PAL A;  2M7L A;  1SK6 D;  4YI9 A;  3LCP C;  1NP8 A;  3MSE B;  1SY9 A;  3CWG A;  2LLS A;  5DKQ A;  4BY5 A;  5AER A;  1J7P A;  3DF0 A;  1MR8 A;  2GGZ A;  4FTG A;  5FI2 A;  1CLB A;  1AVS A;  1DJW A;  4OR9 B;  1YUU A;  1CTR A;  2JPO A;  1NX0 A;  3TDI A;  1NCZ A;  3EVV A;  1SR6 B;  4JQ0 D;  1G33 A;  4DUQ A;  3VRO A;  1ODB A;  1NCY A;  2FOT A;  1OE9 B;  1S6I A;  1P28 A;  1QLS A;  3D75 A;  4AOM A;  1J7Q A;  1DTL A;  2H61 C;  4PHJ A;  2AMI A;  2GV5 A;  1NIW A;  1BJF A;  4MRX A;  1XVJ A;  2NCP A;  4YI8 A;  3SS3 A;  5I2Q A;  5F6T A;  1RRO A;  5GQQ C;  1EG3 A;  3CDN A;  1K8U A;  4CLN A;  3D0Y A;  1TCF A;  3DXL A;  2PAS A;  2EC6 C;  4XJK B;  1EH2 A;  2RGI A;  1H4B A;  4JWQ A;  4Q04 A;  3PM8 A;  4WQ2 A;  3GK2 A;  2JTT A;  1CDP A;  5CSJ A;  1YX8 A;  3TUY C;  3EG5 B;  4E68 A;  2O60 A;  5HLV A;  2MAZ A;  3B87 A;  4IL1 A;  3SG5 A;  1TRF A;  1AP4 A;  1ALV A;  2KFG A;  3S0B A;  3SJS A;  5JJG A;  1CM4 A;  2ZND A;  1L2O B;  2BE6 A;  1DEK A;  3OX6 A;  3VRQ A;  1FPW A;  4GAO A;  1ORG A;  2KHN A;  1N65 A;  3BUN B;  3K1E A;  4GGN A;  2LE9 B;  3UO9 A;  1XO5 A;  1A2X A;  1OMR A;  4GNK B;  1QAT A;  1C3Z A;  1BF5 A;  3KEV A;  1BOC A;  1CB1 A;  1JUO A;  1TNW A;  2F8P A;  2L4I A;  3B7A A;  1DJH A;  2CTN A;  3B86 A;  1CMG A;  1TNP A;  4PCW A;  1JF2 A;  1UHI A;  1YTZ C;  2L2E A;  2L98 A;  3OB2 B;  3R72 A;  4YBH B;  1OZO A;  1Y0V H;  4OZD A;  1NYA A;  2CCM A;  1WLZ A;  1MUX A;  2B1U A;  1DT7 B;  2KAV A;  1F8H A;  2GGM A;  5AAN A;  1A03 A;  1WLM A;  1A75 A;  2Q4U A;  3NXA A;  3O4X A;  2SCP A;  1K90 D;  2FJY A;  4WQ3 A;  1KFX S;  2G2B A;  5I8N A;  1F55 A;  3SS5 A;  2PMY A;  3S0G A;  2JC2 A;  2LMV A;  2NZ0 A;  1J1D A;  1LA3 A;  4PE4 A;  1KQM C;  1QJT A;  1YRT B;  1CDN A;  1E8A A;  2K2A A;  1IJ5 A;  1UWO A;  4PE0 A;  2KLD A;  2FCE A;  2OTG B;  2V53 A;  3M0W A;  2KI6 D;  4P2Y B;  1KSM A;  1XFX O;  2ZNE A;  1DF0 B;  1EXR A;  5TNC A;  3PN7 C;  4CID A;  3SIA A;  3CR2 A;  3I5G C;  1RK9 A;  2M29 A;  2JRF A;  3GK4 X;  3JVT C;  5D7F A;  1XFW O;  3SIB A;  4DCK A;  2R2I A;  3WNX B;  2M7N A;  2M49 B;  1QV1 A;  1DJX A;  3ZNI A;  1TOP A;  5FYX A;  4UPG A;  1KK7 Z;  3H4S E;  1QLK A;  2WOS A;  1UHN A;  1QVI Z;  1K9K A;  2NCO A;  4INW A;  2LLT A;  1S26 D;  3D78 A;  3RLZ A;  2M1K B;  1QX7 A;  5JOL A;  4YGC B;  1KFX L;  2H61 A;  4NDC A;  4MN0 A;  4OVN F;  2K8M B;  1CMF A;  2BAP A;  2L4H A;  1LA0 A;  2OS8 B;  2LAP A;  2PRU A; 
#chains in the Genus database with same CATH homology
 4XYN A;  1YVH A;  1KWO C;  1QXP A;  1SCM B;  1F71 A;  1YUS A;  3FWC A;  3PAL A;  3SG3 A;  1PVB A;  3GK1 A;  4NDD A;  2QAC A;  1NX2 A;  1MQ1 A;  5IBW A;  1LKJ A;  1U5I A;  1S6J A;  3WHU B;  2MRD A;  1CM1 A;  2JT0 A;  2KGR A;  1PRW A;  1SNL A;  3EVR A;  3PLF B;  1DJI A;  4A4C A;  1DVI A;  1LVC D;  2K61 A;  4PE7 A;  1SKT A;  3O4Y A;  1B7T Y;  1SBJ A;  2KGB C;  3O2P A;  1NSH A;  1OMD A;  4GPL B;  1XFY O;  2JQ6 A;  1C07 A;  2ISD A;  1C7W A;  2KBM A;  1XFZ O;  1SPY A;  2PAL A;  1QX2 A;  2I94 A;  2LHL A;  2A4J A;  3I5I C;  2LLU A;  1PVA A;  1REC A;  2HF5 A;  2PVB A;  1HT9 A;  2LUX A;  1QIW A;  3BUO B;  1DJG A;  1K93 D;  2JT8 A;  3KF9 A;  3JTD C;  1MXL C;  3PSR A;  2BCA A;  4C0J A;  1NX1 A;  4FQO A;  4OCI A;  5AFP A;  1IQ3 A;  4N1F A;  1YRU B;  1UP5 A;  2I18 A;  2OPO A;  5HYD A;  1QIV A;  1W7J B;  4USL A;  1XFU O;  3D10 A;  2K0J A;  3CGA A;  2COL B;  3BUX B;  3F45 A;  1CLL A;  1X02 A;  1CFP A;  1QV0 A;  4XJK A;  1ZMZ A;  1BG1 A;  1YR5 A;  3O6B A;  3FS7 A;  5K89 A;  1XYD A;  2JT3 A;  1PSB A;  1BR1 B;  4YRU A;  3HCM A;  2JXL A;  2BCB A;  5CPV A;  5HKY A;  2KI4 C;  2PSR A;  2KOT A;  2KYC A;  2LNK A;  3SG2 A;  3DVK A;  2BKI B;  1M45 A;  2BKH B;  1LIN A;  3DF0 B;  4M2O A;  3KPX A;  1MF8 B;  2BL0 C;  1PSR A;  1J1E A;  1TN4 A;  1WDC C;  1UUS A;  2K7D A;  1SW8 A;  2VRG A;  3BQ3 A;  1KCY A;  4PHK A;  1AJ4 A;  4AQJ A;  1GJY A;  1SMG A;  2EGD A;  1ZUZ A;  2Y1N A;  1KK8 B;  3SG6 A;  2F33 A;  4I5N B;  1B47 A;  4MSP A;  3IF7 A;  3K21 A;  3EK7 A;  2ZRT A;  3BOW A;  3CR5 X;  5BPJ A;  4P5O E;  5I2L A;  5J3X A;  4C0K A;  2K7O A;  1LXF C;  1B8R A;  1Q80 A;  1V1F A;  3D0Y B;  1FW4 A;  1K9U A;  1L7Z A;  2FCD A;  1DGU A;  2SAS A;  4M2Q A;  1ZOT B;  5I2O A;  1SR6 C;  2K7C A;  1K95 A;  2KFH A;  1Y1A A;  4HRG A;  1B4C A;  1F70 A;  1M31 A;  2BCX A;  4NDB A;  2CXJ A;  2ZRS A;  3C1V A;  4PDZ A;  2LMT A;  1CLM A;  3LK0 A;  1SL7 A;  3AKA A;  4TNC A;  4YGA A;  2JPT A;  1TNQ A;  1DF0 A;  1QAS A;  1S6C A;  5ER4 X;  3TDZ A;  2MJW B;  3I5H B;  2LVK A;  1EG4 A;  4U8D A;  1C7V A;  1B8C A;  1QX5 B;  1FI5 A;  2KFF A;  2ZN8 A;  1HQV A;  2FJU B;  1KFU S;  2JXC A;  4WRI A;  1PUL A;  1JFJ A;  2H2K A;  3I5F B;  1DJY A;  1WRK A;  2MLE C;  1CDM A;  2LHI A;  1M46 A;  4HRE E;  1NCX A;  1NPQ A;  2ZKM X;  3TS5 B;  2WC8 A;  3LK1 A;  1RJV A;  4NQG A;  1F4O A;  2BEC A;  4ETO A;  1B9A A;  2MHH A;  4ZCV A;  2CBL A;  2LUC A;  2K7B A;  5HLO A;  1IG5 A;  1Y1X A;  3NSO A;  1A75 B;  1L2O C;  4MVF A;  3RM1 A;  1IKU A;  2K2F A;  2I2R E;  3WHT B;  1JWD A;  1CDL A;  1A4P A;  1UHJ A;  2F2P A;  5CSI A;  2HQW A;  3KO0 A;  2F3Z A;  2M97 A;  1IH0 A;  3CS1 A;  3KHE A;  5AXI A;  3CR4 X;  4ORC B;  2LM5 A;  3VRP A;  4BY4 A;  3DVE A;  1GGW A;  1KFU L;  4AQI A;  1CFD A;  3ICB A;  3LL8 B;  3ZWH A;  4QJ5 B;  2WOR A;  1WRL A;  2DOQ A;  3CTN A;  1ALW A;  2D8N A;  3NSK A;  2KAY A;  1AHR A;  1DGV A;  3NSI A;  4OKH A;  4PHM A;  3EKH A;  4CPV A;  4YGD B;  2JUL A;  1UUR A;  3DD4 A;  4N5X A;  4I5J A;  4M2P A;  1EJ3 A;  1SL9 A;  1EL4 A;  2OTG C;  4C0L A;  2LVV A;  4JPZ B;  4MEW A;  5HKW A;  3OB1 B;  1MXE A;  2M0R A;  2JOJ A;  4CFR A;  1SRA A;  1SL8 A;  1OZS A;  1CFC A;  2EC6 B;  2TN4 A;  1IJ6 A;  1RWY A;  4YGB B;  1MWN A;  4R1E A;  1B1G A;  2LC5 A;  2CT9 A;  4GGF C;  1U5I B;  2JWW A;  1YVL A;  2AUC A;  3A8R A;  3OHM B;  1S5G Z;  3TUY B;  2AAO A;  2JZI A;  1OMV A;  2BBN A;  2F2O A;  1FF1 A;  2KAX A;  2OS8 C;  1GQM A;  1SCV A;  2HET A;  1M63 B;  3WXA A;  1WY9 A;  1OOJ A;  1SCM C;  2BE4 A;  3O78 A;  1DMO A;  5G08 A;  1F4Q A;  2WND A;  1S3P A;  1MHO A;  2L51 A;  1RFJ A;  2LCP A;  3BXK A;  2E30 A;  4MBE A;  2QPT A;  5KSZ A;  1IRJ A;  2JNF A;  1IGV A;  1AK8 A;  1IQ5 A;  1CNP A;  5HKZ A;  5D69 A;  1PK0 D;  1ZAC A;  2MA2 A;  1BLQ A;  1NX3 A;  2MBX A;  1XK4 A;  3BYA A;  1B8L A;  1F54 A;  1OSA A;  1QTX A;  3EK8 A;  3BUW B;  1D1O A;  1WRZ A;  1KQM B;  2L50 A;  3SG7 A;  2JU0 A;  2HQ8 A;  1B7T Z;  1KK7 Y;  1R6P A;  2BBM A;  3FIA A;  1VRK A;  4L9M A;  3EKJ A;  1QVI Y;  2KBI A;  2HPS A;  2M1U A;  1K2H A;  3I5G B;  3DVJ A;  3JVT B;  3OX5 A;  4PAL A;  1AJ5 A;  2M9G A;  2LMU A;  1IWQ A;  1TNX A;  3GOF A;  2G9B A;  2LVI A;  3SG4 A;  3E3R A;  2E6W A;  1Y1U A;  1PAL A;  1W7I B;  2JTZ A;  4PE1 A;  1DJZ A;  1JFK A;  3AAJ A;  3AKB A;  2L5X B;  3EVU A;  4YGE B;  1BOD A;  1JBA A;  1OQP A;  1BMO A;  1CKK A;  2M8U A;  4ORA B;  1KSO A;  1KQV A;  5ER5 A;  3PN7 B;  1N0Y A;  5CSN A;  4MRY A;  2KI6 C;  3OP0 A;  4GUK A;  2JNX A;  1KWO B;  1G8I A;  3BOW B;  3LLE A;  3NSL A;  4GBA A;  3PAT A;  2Y5I A;  1YX7 A;  2ZN9 A;  4HRH A;  4GGF A;  2NLN A;  4I5L B;  2LV7 A;  1JC2 A;  1YUR A;  1CFF A;  2KSP A;  3AAK A;  2KNE A;  1KK8 C;  1K9P A;  4ORB B;  1J55 A;  3TDU A;  1ZFS A;  2WCF A;  1XK4 C;  2WCB A;  1XA5 A;  3VRR A;  3BUM B;  3CZT X;  2F3Y A;  4QJ3 B;  1JSA A;  1S5G Y;  1UHH A;  4CFQ A;  1G4Y R;  1K94 A;  3I5I B;  1J7R A;  1S1E A;  5DKN A;  2LAN A;  1TIZ A;  1Y6W A;  3DVM A;  4D1E A;  2M3W A;  1BR4 B;  1SYM A;  2NXQ A;  4DIR A;  5AEQ A;  3JTD B;  4MZK A;  2LP3 A;  4HSZ A;  1J7O A;  4GFT A;  4MLW A;  1AUI B;  2Y1M A;  2CNP A;  2IS9 A;  1FI6 A;  1NUB A;  2LVJ A;  2KYF A;  1RTP 1;  4MZJ A;  2EHB A;  2KQ6 A;  3IQO A;  4I5K A;  1BT6 A;  3I5H C;  1UHK A;  1BU3 A;  3HX4 A;  4ZCU A;  4DS7 A;  1H8B A;  1NWD A;  1TCO B;  3A4U B;  4PHN A;  1FBV A;  1K96 A;  2P6B B;  2ZFD A;  1XFV O;  4QJ4 B;  5KU1 A;  2L0P A;  3PFV A;  4A4B A;  3EK4 A;  4N1G A;  2O5G A;  2I7A A;  3I5F C;  2Q91 A;  2LP2 A;  4MZL A;  1N2D A;  1TTX A;  2KI4 B;  2Y4Q A;  1A29 A;  3TS5 C;  4OV2 A;  4F0Z B;  2KQY A;  4ICB A;  3VRN A;  5DKR A;  3VGO A;  1R2U A;  3FWB A;  3IQQ A;  2WCE A;  2BL0 B;  5KTY A;  1WDC B;  1V1G A;  1YUT A;  3QRX A;  1JF0 A;  5CSF A;  1GGZ A;  3CLN A;  4DRW A;  3TZ1 A;  5B8I B;  1S36 A;  1QS7 A;  2KDH A;  2MLF C;  1M39 A;  5PAL A;  2M7L A;  1SK6 D;  4YI9 A;  3LCP C;  1NP8 A;  3MSE B;  1SY9 A;  3CWG A;  2LLS A;  5DKQ A;  4BY5 A;  5AER A;  1J7P A;  3DF0 A;  1MR8 A;  2GGZ A;  4FTG A;  1CLB A;  1AVS A;  1DJW A;  4OR9 B;  1YUU A;  1CTR A;  3TDI A;  1NX0 A;  1NCZ A;  3EVV A;  1SR6 B;  4JQ0 D;  1G33 A;  4DUQ A;  3VRO A;  1ODB A;  1NCY A;  2FOT A;  1OE9 B;  1S6I A;  1QLS A;  4AOM A;  1J7Q A;  1DTL A;  2H61 C;  4PHJ A;  2AMI A;  2GV5 A;  1NIW A;  1BJF A;  4MRX A;  1XVJ A;  2NCP A;  4YI8 A;  5I2Q A;  5F6T A;  1RRO A;  5GQQ C;  1EG3 A;  1K8U A;  4CLN A;  3D0Y A;  1TCF A;  1EH2 A;  2PAS A;  2EC6 C;  4XJK B;  2RGI A;  1H4B A;  4JWQ A;  4Q04 A;  3PM8 A;  4WQ2 A;  3GK2 A;  2JTT A;  1CDP A;  5CSJ A;  1YX8 A;  3TUY C;  4E68 A;  2O60 A;  5HLV A;  2MAZ A;  4IL1 A;  3SG5 A;  1TRF A;  1AP4 A;  1ALV A;  2KFG A;  3SJS A;  5JJG A;  1CM4 A;  2ZND A;  1L2O B;  2BE6 A;  3OX6 A;  3VRQ A;  1FPW A;  4GAO A;  3BUN B;  2KHN A;  1N65 A;  4GGN A;  2LE9 B;  1XO5 A;  1A2X A;  1OMR A;  4GNK B;  1QAT A;  1BF5 A;  1BOC A;  3KEV A;  1CB1 A;  1JUO A;  1TNW A;  2F8P A;  2L4I A;  1CMG A;  1DJH A;  2CTN A;  1TNP A;  4PCW A;  1JF2 A;  1UHI A;  1YTZ C;  2L2E A;  2L98 A;  3OB2 B;  4YBH B;  1OZO A;  1Y0V H;  1NYA A;  2CCM A;  1WLZ A;  1MUX A;  2B1U A;  1DT7 B;  2KAV A;  1F8H A;  2GGM A;  5AAN A;  1A03 A;  1WLM A;  1A75 A;  2Q4U A;  3NXA A;  2SCP A;  1K90 D;  4WQ3 A;  1KFX S;  2G2B A;  5I8N A;  1F55 A;  2PMY A;  2JC2 A;  2LMV A;  2NZ0 A;  1J1D A;  1LA3 A;  4PE4 A;  1KQM C;  1QJT A;  1YRT B;  1CDN A;  1E8A A;  2K2A A;  1IJ5 A;  1UWO A;  4PE0 A;  2FCE A;  2OTG B;  2V53 A;  3M0W A;  2KI6 D;  4P2Y B;  1KSM A;  1XFX O;  2ZNE A;  1DF0 B;  1EXR A;  5TNC A;  3PN7 C;  4CID A;  3SIA A;  3CR2 A;  3I5G C;  1RK9 A;  2M29 A;  2JRF A;  3GK4 X;  3JVT C;  5D7F A;  1XFW O;  3SIB A;  4DCK A;  2R2I A;  3WNX B;  2M7N A;  2M49 B;  1QV1 A;  1DJX A;  3ZNI A;  1TOP A;  5FYX A;  4UPG A;  1KK7 Z;  3H4S E;  1QLK A;  2WOS A;  1UHN A;  1QVI Z;  1K9K A;  2NCO A;  2LLT A;  1S26 D;  3RLZ A;  2M1K B;  1QX7 A;  5JOL A;  4YGC B;  1KFX L;  2H61 A;  4NDC A;  4MN0 A;  4OVN F;  2K8M B;  1CMF A;  2L4H A;  1LA0 A;  2OS8 B;  2LAP A;  2PRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...