2MLFC

Nmr structure of the dilated cardiomyopathy mutation g159d in troponin c bound to the anchoring region of troponin i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
b'MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKDVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mlfC00
2OTGC 2KI6D 3A8RA 3CLNA 1XFZO 2LVIA 2M3WA 4GGFA 1CFDA 4C0JA 3D0YA 4QJ5B 1BLQA 5J3XA 1TNQA 1UHJA 3PLFB 1JF2A 3NSKA 1AK8A 2WCFA 2WCEA 1FBVA 3D0YB 2PSRA 1EH2A 3ICBA 3EK7A 3CR2A 4DS7A 4PE0A 2CTNA 1K8UA 2LVVA 3SIBA 1K9PA 2KAVA 5AERA 2KFHA 1IGVA 1IJ5A 1DT7B 4OCIA 2G2BA 4YGAA 4GFTA 1DJIA 2L0PA 1A75A 3BOWB 1JUOA 1WDCC 2BBMA 4NQGA 5HYDA 1S6CA 1GQMA 1TOPA 2JT8A 2QPTA 2LVJA 2CXJA 3FWCA 2KNEA 2E6WA 3I5HB 4BY4A 1C7VA 1ODBA 3FS7A 3GK1A 5PALA 3SG6A 1KFXS 2BCBA 1NCZA 2M49B 4R1EA 2IS9A 1F54A 1A4PA 4P5OE 2NXQA 3DVEA 5HKZA 1SNLA 1WRLA 1ZFSA 4GAOA 1IQ5A 3PN7C 4NDBA 1CFPA 1AJ4A 2JPTA 5CSNA 1BMOA 1PSRA 4USLA 1CLLA 1M31A 1UP5A 1KQVA 2CT9A 3VROA 3I5IC 3WXAA 1RJVA 2EC6C 1F55A 1SL7A 3HCMA 3M0WA 2G9BA 3SG4A 2ZFDA 1Y1AA 2MLEC 1OZSA 2LV7A 5BPJA 5FYXA 3E3RA 3DD4A 2NCPA 2KOTA 4YGCB 3SG2A 1PSBA 2GGMA 1TNPA 2I94A 2FJUB 2RGIA 2A4JA 3WHUB 1K2HA 1B8RA 1F4OA 1YVLA 2M97A 1TIZA 2I2RE 5CSIA 3IQOA 3BUOB 1R6PA 1SL9A 2WOSA 1B47A 4PE1A 4N5XA 1OMVA 4CLNA 2BBNA 3CZTX 1CM4A 1NCXA 2KYCA 1K9KA 1L2OC 3CR5X 1M46A 4MZLA 2JQ6A 1QX2A 2LMTA 3I5FC 2Y1NA 3TDUA 3ZWHA 1B7TZ 1ZUZA 4ORBB 1CM1A 1XFVO 1MXLC 1TNXA 1JF0A 1Y0VH 4I5LB 1ZMZA 3VRPA 3O6BA 1IQ3A 1XFUO 1JBAA 3EKJA 4OV2A 2Q91A 1A29A 3IF7A 4MRXA 2KI4C 4OKHA 4XJKA 3EVVA 1DJXA 4WQ2A 4DUQA 1KSOA 2MBXA 1UWOA 2HPSA 4IL1A 4HSZA 1SR6B 3KF9A 3BQ3A 4XJKB 2DOQA 2Y1MA 1FPWA 2JRFA 1IG5A 1B7TY 4WQ3A 1SPYA 2LUCA 3EK4A 3O4YA 2KHNA 2JXLA 2KSPA 2LHIA 1K96A 1XVJA 2ZNDA 2Q4UA 1GGZA 1PULA 1BR4B 1W7JB 4MRYA 4GNKB 1BJFA 1MQ1A 2LE9B 1PVBA 2JU0A 2WC8A 2JNFA 1CB1A 5DKNA 2GGZA 1KWOB 2LLTA 1RFJA 4NDDA 1G33A 1BF5A 2BECA 4GGFC 1JC2A 3TUYB 1S1EA 3AKAA 1ALVA 2KGRA 1WLZA 1NSHA 4E68A 2KI6C 2NLNA 1K95A 5B8IB 1MXEA 5KU1A 3JTDB 3KHEA 1YRTB 5CSJA 1KFUS 3NXAA 4HRGA 2JTZA 2OS8B 1KK8B 1DGUA 2KBMA 2MLFC 1XA5A 2M7NA 4I5JA 1L7ZA 5I2LA 4DRWA 1KK7Z 1KQMB 1A2XA 2AAOA 1DTLA 2M8UA 1YVHA 1CLMA 3BOWA 3I5HC 4M2QA 1UHHA 2M0RA 2WNDA 1NPQA 2MRDA 4HREE 2MAZA 1B8LA 2LUXA 3SIAA 3BUNB 2F3YA 1IRJA 3SG5A 2I18A 5D7FA 1BOCA 4YI9A 1UHNA 1YURA 2ISDA 1KK7Y 2JOJA 3LCPC 1QJTA 2K7DA 2K7CA 1NX2A 2JXCA 3PM8A 3SJSA 1Q80A 1FI6A 1CNPA 1TTXA 2LMUA 4YBHB 3WNXB 1XFWO 3VRRA 1CMGA 2HF5A 1H8BA 2KDHA 2K7BA 3I5GB 1B4CA 3F45A 2CNPA 2JULA 5K89A 2SASA 2JT0A 3EVRA 2BL0B 1G4YR 1NUBA 2CBLA 1HQVA 1BR1B 2LC5A 2PASA 1LXFC 1DJYA 5HKYA 4AOMA 4MVFA 1F70A 2ZRSA 1S3PA 3JVTC 3OX5A 1R2UA 1K9UA 1LKJA 2KQ6A 4MBEA 3TDIA 2JTTA 2L4IA 2D8NA 4P2YB 4MSPA 1NX1A 1DJWA 3DVMA 1NWDA 4YI8A 2LP3A 1DMOA 2HQWA 1JWDA 1TN4A 5HKWA 1IH0A 1QXPA 1CDLA 1ALWA 1SMGA 4OR9B 1TRFA 3OP0A 5AFPA 1GGWA 3CS1A 1KSMA 3RLZA 3SG7A 1M39A 1NCYA 2E30A 2SCPA 3FIAA 3PALA 4NDCA 3FWBA 4GGNA 5KTYA 4XYNA 1LVCD 1RK9A 2LP2A 2BKHB 1S5GZ 1IKUA 2H2KA 1UUSA 2L98A 1N65A 1SR6C 2ZN8A 5JJGA 1QATA 3H4SE 4ZCUA 2ZKMX 1SYMA 1DF0B 2JZIA 5ER5A 1CTRA 1MF8B 2JWWA 2JC2A 2LNKA 4QJ3B 3ZNIA 3TS5B 1AP4A 1N2DA 2O5GA 1TNWA 2ZRTA 1QLKA 4PHJA 2KGBC 1MR8A 4GPLB 2K0JA 5HLOA 1QVIZ 4QJ4B 1S5GY 1QTXA 1U5IB 4Q04A 1C07A 2K61A 1J55A 1S6IA 1WY9A 1V1GA 1KWOC 3LK0A 1EL4A 1QIWA 1YX7A 1EXRA 1BU3A 1CFFA 3BYAA 2Y5IA 4ORAB 3TUYC 2L50A 2F2OA 2K7OA 1CKKA 1OMDA 2NZ0A 1V1FA 1QVIY 1F71A 3WHTB 2L51A 2M9GA 1MWNA 5AANA 3JTDC 3SG3A 1J1EA 3KEVA 2PVBA 1XK4A 5ER4X 3VRNA 2LLSA 1KK8C 4L9MA 3AAJA 3LLEA 5IBWA 3OHMB 1YR5A 2WCBA 1BG1A 1PRWA 1DJHA 3EK8A 2MHHA 1XFYO 1KQMC 3CGAA 3TDZA 1AVSA 1SW8A 2M1KB 4MN0A 1ZOTB 1LA3A 4GUKA 1SCMB 4TNCA 3BUWB 3GK2A 1H4BA 5F6TA 2AMIA 4I5KA 1LA0A 4PHMA 2LM5A 2LLUA 1M63B 1QV0A 4CFQA 1BODA 1TCFA 5CPVA 2BKIB 1S26D 1OQPA 4PDZA 1LINA 1F8HA 3OB1B 1J1DA 2WORA 1CFCA 1C7WA 4PE4A 3EVUA 3PSRA 3AAKA 4M2OA 1B8CA 1YUTA 5D69A 1J7RA 4MZKA 2LHLA 2P6BB 1UURA 1SRAA 1NX3A 1K93D 3C1VA 3I5GC 2ZN9A 1Y1XA 2JNXA 4PALA 5G08A 1A03A 1JSAA 2V53A 2I7AA 2M29A 3DVKA 3QRXA 2BL0C 2OTGB 1CMFA 4JPZB 5I2QA 3BUMB 1EJ3A 2PMYA 4U8DA 1X02A 1J7QA 3BUXB 1A75B 1KFXL 4M2PA 3EKHA 2L5XB 1YUUA 2M1UA 4HRHA 3KPXA 2M7LA 1RECA 1N0YA 2KYFA 1Y1UA 1M45A 4WRIA 4MZJA 1YUSA 1OSAA 4D1EA 4YGBB 2KFGA 1B9AA 1WDCB 3NSIA 1RWYA 2MA2A 4C0LA 1EG3A 1YTZC 1RROA 2LANA 3KO0A 2F8PA 2H61C 3AKBA 4ICBA 3CR4X 2L2EA 2K2FA 1XO5A 2KAYA 1FI5A 1DGVA 1DVIA 1QLSA 1K90D 3D10A 4FQOA 1XYDA 2OPOA 2KFFA 4A4CA 1J7OA 1CDNA 2H61A 4FTGA 3IQQA 2FCEA 1PALA 2EGDA 4PHNA 1FW4A 2LAPA 3PN7B 1S36A 3TS5C 1ZACA 3VGOA 2BCAA 5I2OA 4YRUA 2PALA 2HQ8A 1Y6WA 1DF0A 1CDMA 2BE4A 3O78A 4CPVA 1UHKA 4YGEB 3VRQA 1S6JA 1E8AA 2CCMA 1QASA 3I5IB 3NSOA 2EC6B 1SK6D 2BE6A 4N1FA 4UPGA 2BCXA 2Y4QA 4C0KA 1F4QA 2K8MB 1CLBA 1SKTA 1MUXA 1VRKA 2B1UA 1QIVA 1WRZA 3NSLA 1W7IB 4ORCB 1YRUB 1CDPA 5KSZA 1AJ5A 3JVTB 2LCPA 1U5IA 2VRGA 5JOLA 2ZNEA 3PATA 1NX0A 2HETA 4OVNF 3RM1A 4AQJA 3TZ1A 5AEQA 2LVKA 5CSFA 2AUCA 4A4BA 1OZOA 1WLMA 2F2PA 3CWGA 4PHKA 5I8NA 1JFJA 4MLWA 4PCWA 2FCDA 5AXIA 4BY5A 3OB2B 1MHOA 5DKRA 3O2PA 4DIRA 1NP8A 1FF1A 5GQQC 3MSEB 1XK4C 4N1GA 2GV5A 1D1OA 2R2IA 1BT6A 1QV1A 1L2OB 2MJWB 1SCMC 3I5FB 2LMVA 4ZCVA 3A4UB 1NIWA 4I5NB 1HT9A 3PFVA 4JWQA 2OS8C 3CTNA 2COLB 2KBIA 2TN4A 1B1GA 1J7PA 4JQ0D 3LK1A 2JT3A 1IWQA 1AUIB 1QS7A 2KAXA 1KCYA 2F33A 1OMRA 2K2AA 2KI4B 1SBJA 5TNCA 2O60A 1JFKA 3LL8B 4AQIA 4CIDA 1IJ6A 2PRUA 5HLVA 1RTP1 4ETOA 2QACA 1G8IA 1YX8A 2KQYA 1QX5B 3GK4X 1DJGA 3DF0A 1DJZA 1SY9A 2L4HA 5DKQA 4F0ZB 4CFRA 4MEWA 1WRKA 1OOJA 1K94A 2EHBA 1EG4A 1PK0D 1PVAA 3K21A 1XFXO 2F3ZA 1GJYA 1SCVA 2FOTA 3DF0B 3GOFA 4PE7A 1QX7A 4DCKA 3BXKA 1OE9B 1TCOB 1UHIA 3DVJA 4YGDB 1NYAA 1AHRA 2NCOA 3HX4A 4GBAA 1KFUL 1SL8A 3OX6A
chains in the Genus database with same CATH superfamily
2OTGC 2KI6D 5EL2A 3A8RA 3CLNA 1XFZO 2LVIA 2M3WA 4GGFA 1CFDA 4C0JA 3D0YA 4FQTA 4QJ5B 5J3XA 1TNQA 1BLQA 1UHJA 3PLFB 1JF2A 3NSKA 3S0GA 1AK8A 2WCFA 2WCEA 1FBVA 3D0YB 2PSRA 1EH2A 3ICBA 3EK7A 3CR2A 4DS7A 4PE0A 2CTNA 1K8UA 2LVVA 3SIBA 1K9PA 2KAVA 5AERA 2KFHA 1IGVA 1IJ5A 1DT7B 4OCIA 2G2BA 4YGAA 4GFTA 1DJIA 1XFRA 1A75A 2L0PA 1JUOA 1WDCC 2BBMA 3BOWB 3DZTA 4NQGA 3UO9A 5HYDA 1S6CA 1GQMA 1TOPA 2JT8A 1TUJA 2QPTA 2LVJA 2CXJA 3FWCA 2KNEA 2E6WA 3I5HB 2PQLA 4BY4A 1C7VA 1ODBA 3FS7A 3GK1A 3CDNA 5PALA 3SG6A 1DQEA 1KFXS 1OOGA 2BCBA 1NCZA 2M49B 4R1EA 2IS9A 1F54A 1A4PA 4P5OE 2NXQA 3DVEA 5HKZA 1SNLA 1WRLA 1ZFSA 1QWVA 1IQ5A 3K1EA 4GAOA 3PN7C 3S0BA 1LS8A 4NDBA 4INXA 1CFPA 1AJ4A 2JPTA 5CSNA 1BMOA 1PSRA 4USLA 1CLLA 1M31A 1UP5A 1KQVA 2CT9A 3VROA 3I5IC 3WXAA 1RJVA 2EC6C 1F55A 1SL7A 3HCMA 3M0WA 2G9BA 5DICA 2ZFDA 3SG4A 1Y1AA 3HX4A 4OZDA 2MLEC 1OZSA 2LV7A 5BPJA 5FYXA 3E3RA 3DD4A 2NCPA 2KOTA 4YGCB 3SG2A 1PSBA 2GGMA 1TNPA 2I94A 5I94A 2FJUB 2RGIA 2A4JA 3QMEA 3WHUB 1K2HA 1B8RA 1F4OA 2JPOA 1YVLA 2M97A 1TIZA 2I2RE 5CSIA 3IQOA 3BUOB 1R6PA 1OOHA 1SL9A 1T14A 1B47A 2WOSA 4PE1A 4N5XA 1OMVA 4CLNA 2BBNA 3CZTX 1CM4A 1NCXA 2KYCA 3VB1A 1K9KA 1L2OC 3CR5X 1M46A 4MZLA 2JQ6A 1QX2A 2LMTA 3I5FC 2Y1NA 3TDUA 3ZWHA 1B7TZ 1ZUZA 4ORBB 1CM1A 1XFVO 1MXLC 1TNXA 1JF0A 1Y0VH 1OOFA 4I5LB 1ZMZA 3VRPA 3O6BA 1IQ3A 1XFUO 1JBAA 3EKJA 4OV2A 2Q91A 3BJHA 2WCJA 3EG5B 1A29A 3IF7A 4MRXA 2KI4C 2WCLA 4OKHA 4XJKA 2P70A 3EVVA 1DJXA 4WQ2A 3UNWA 3PJIA 4DUQA 1KSOA 2L5YA 2MBXA 1UWOA 2HPSA 4IL1A 4HSZA 1SR6B 3KF9A 3BQ3A 4XJKB 3DYEA 2DOQA 2Y1MA 1FPWA 2JRFA 1IG5A 1B7TY 3D77A 4WQ3A 1SPYA 1TUZA 2LUCA 3EK4A 3O4YA 2KHNA 2JXLA 2KSPA 2LHIA 1K96A 1XVJA 2ZNDA 2Q4UA 1GGZA 1PULA 1BR4B 1W7JB 4MRYA 3DXLA 4GNKB 3RZSA 3L4LA 2P71A 3L4AA 1DC1A 1BJFA 5FI2A 5D3OA 1MQ1A 2LE9B 1PVBA 4F7FA 2JU0A 2WC8A 2JNFA 1CB1A 5DKNA 2GGZA 1KWOB 2LLTA 1RFJA 4NDDA 1G33A 3BFAA 1BF5A 2BECA 4GGFC 1JC2A 3TUYB 1S1EA 3AKAA 1ALVA 2KGRA 3B7AA 1WLZA 2FJYA 1NSHA 4E68A 3Q8IA 2KI6C 2NLNA 1K95A 5B8IB 1MXEA 2H8VA 5KU1A 3JTDB 3KHEA 1YRTB 5CSJA 1KFUS 3NXAA 3R1OA 4HRGA 2JTZA 2OS8B 1KK8B 2BAPA 1DGUA 2KBMA 2MLFC 1XA5A 2M7NA 3D73A 4I5JA 1L7ZA 5I2LA 4KYNA 4DRWA 1KK7Z 3D78A 1KQMB 1A2XA 2AAOA 1DTLA 2M8UA 1YVHA 1CLMA 3BOWA 3I5HC 4M2QA 1UHHA 2M0RA 2WNDA 1NPQA 2MRDA 4HREE 2MAZA 1B8LA 2LUXA 2L2CA 3SIAA 3BUNB 2F3YA 1OOIX 1IRJA 3SG5A 2I18A 5D7FA 1BOCA 4YI9A 1UHNA 1YURA 2ISDA 1KK7Y 2JOJA 3LCPC 1QJTA 2K7DA 1TWOA 2K7CA 1NX2A 2JXCA 3PM8A 3SJSA 1Q80A 1FI6A 1CNPA 3NGVA 1TTXA 2LMUA 4YBHB 3WNXB 1XFWO 3VRRA 1CMGA 2HF5A 1H8BA 2KDHA 2K7BA 3I5GB 1B4CA 3F45A 2CNPA 2JULA 5K89A 2SASA 2YGUA 2JT0A 3EVRA 2BL0B 1G4YR 1NUBA 2CBLA 1HQVA 1BR1B 2LC5A 2PASA 1LXFC 1DJYA 5HKYA 4AOMA 4MVFA 1F70A 2ZRSA 1S3PA 3JVTC 3OX5A 1R2UA 1K9UA 1LKJA 2KQ6A 4MBEA 3TDIA 2JTTA 2L4IA 2D8NA 4P2YB 4MSPA 1NX1A 1DJWA 3DVMA 1NWDA 4YI8A 1DELA 2LP3A 1DMOA 2HQWA 1JWDA 1TN4A 5HKWA 1IH0A 1QXPA 1CDLA 1ALWA 1SMGA 4OR9B 4PT1A 1TRFA 3BFBA 3NHTA 3OP0A 5AFPA 3CS1A 1KSMA 3RLZA 3SG7A 1M39A 1NCYA 1GGWA 2E30A 2SCPA 3FIAA 3PALA 3S0EA 2BNXA 3FWBA 4NDCA 4GGNA 5KTYA 1OW4A 3IVTA 1LVCD 1RK9A 2LP2A 2BKHB 1S5GZ 4XYNA 1IKUA 2H2KA 1UUSA 2L98A 1N65A 3FE9A 1SR6C 2ZN8A 5JJGA 1QATA 3CZ1A 3H4SE 4ZCUA 2ZKMX 1SYMA 1DF0B 2JZIA 5ER5A 1CTRA 3D76A 1MF8B 3L47A 2JWWA 2JC2A 4JKTA 2LNKA 4QJ3B 3ZNIA 4IJ7A 3TS5B 3B87A 1AP4A 2QEBA 1N2DA 2O5GA 1TNWA 2ZRTA 1QLKA 4PHJA 4JD9A 2KGBC 1MR8A 4GPLB 2K0JA 5HLOA 1QVIZ 4QJ4B 1S5GY 1QTXA 1U5IB 2KPHA 4Q04A 1C07A 2K61A 3D75A 1J55A 1S6IA 1WY9A 2QEHA 1V1GA 1KWOC 3LK0A 1EL4A 3R1VA 1QIWA 1YX7A 1EXRA 1BU3A 1CFFA 3BYAA 2Y5IA 4ORAB 3N7HA 2L50A 2F2OA 2K7OA 3TUYC 1CKKA 2QEVA 1OMDA 2NZ0A 1V1FA 1QVIY 1F71A 3WHTB 2L51A 2M9GA 2WCKA 1MWNA 5AANA 3JTDC 3SS3A 1J1EA 5FI6A 3SG3A 3KEVA 2PVBA 1XK4A 5ER4X 3VRNA 2LLSA 1KK8C 4L9MA 3AAJA 3LLEA 5IBWA 3OHMB 1YR5A 2WCBA 1BG1A 1PRWA 1DJHA 3OGNA 3EK8A 2MHHA 1XFYO 3FE8A 1KQMC 3CGAA 3TDZA 1AVSA 1SW8A 2M1KB 4MN0A 1ZOTB 1LA3A 4GUKA 1SCMB 2KLEA 4TNCA 3BUWB 3GK2A 1H4BA 3NHIA 5F6TA 2AMIA 4I5KA 1LA0A 3SS5A 3S0FA 1C3ZA 4PHMA 2LM5A 2LLUA 1M63B 1QV0A 4CFQA 1BODA 2WC6A 1TCFA 3CZ2A 2WCMA 2BKIB 1S26D 5CPVA 1OQPA 4PDZA 1LINA 1F8HA 3OB1B 1J1DA 2WORA 3B86A 1C7WA 4PE4A 5FI7A 3EVUA 3S0DA 3PSRA 1CFCA 3AAKA 4M2OA 1B8CA 1YUTA 5D69A 1J7RA 4MZKA 2LHLA 2P6BB 1UURA 3V2LA 1SRAA 1NX3A 1K93D 3C1VA 3I5GC 2ZN9A 1Y1XA 2JNXA 4PALA 5G08A 1A03A 1JSAA 2V53A 2I7AA 2M29A 3DVKA 3QRXA 2BL0C 2OTGB 1CMFA 4JPZB 5I2QA 3R72A 3BUMB 3BFHA 1EJ3A 2PMYA 4U8DA 1X02A 1J7QA 3BUXB 1A75B 2K60A 1KFXL 4M2PA 3EKHA 2L5XB 1YUUA 2M1UA 3CZ0A 3KPXA 4HRHA 2M7LA 1C3YA 1RECA 1N0YA 2KYFA 1Y1UA 1M45A 4WRIA 4MZJA 1YUSA 1OSAA 4D1EA 4YGBB 2KFGA 1B9AA 1WDCB 2GTEA 1RWYA 2MA2A 3NSIA 4C0LA 1EG3A 1YTZC 1RROA 2LANA 3KO0A 2F8PA 2H61C 2KLDA 2ERBA 3AKBA 4ICBA 3CR4X 2L2EA 2K2FA 1XO5A 2KAYA 1FI5A 1DGVA 1DVIA 1QLSA 3R1PA 1K90D 3D10A 4FQOA 1XYDA 2OPOA 2KFFA 4A4CA 1Z2CB 1J7OA 1CDNA 2H61A 4FTGA 1ORGA 3IQQA 2FCEA 1PALA 2EGDA 4PHNA 1FW4A 2LAPA 3CYZA 3PN7B 1S36A 3TS5C 1ZACA 2QEOA 2BCAA 3VGOA 5I2OA 3DY9A 2PALA 4YRUA 2HQ8A 1Y6WA 1DF0A 1CDMA 2BE4A 3O78A 4CPVA 1UHKA 4YGEB 3VRQA 1S6JA 1E8AA 2CCMA 1QASA 3I5IB 3NSOA 2EC6B 1SK6D 2BE6A 4N1FA 4UPGA 2BCXA 2Y4QA 4C0KA 3B6XA 3S0AA 1F4QA 2K8MB 1CLBA 1SKTA 1MUXA 1VRKA 2B1UA 1QIVA 1IIOA 1GM0A 1WRZA 3NSLA 1W7IB 3OBVA 1YRUB 1CDPA 4ORCB 5KSZA 1AJ5A 3PM2A 3JVTB 2LCPA 1U5IA 2VRGA 5JOLA 2ZNEA 3PATA 1NX0A 2HETA 4OVNF 3RM1A 4AQJA 3TZ1A 5AEQA 2LVKA 5CSFA 2AUCA 4A4BA 1OZOA 1WLMA 2F2PA 2WCHA 3CWGA 4PHKA 1Z4HA 5I8NA 1JFJA 4MLWA 4PCWA 2FCDA 3D74A 5AXIA 4BY5A 3OB2B 1MHOA 5DKRA 3O2PA 4DIRA 1NP8A 1FF1A 5GQQC 1SSEB 1XK4C 3MSEB 4N1GA 2GV5A 5HL1A 1D1OA 2R2IA 1BT6A 1QV1A 1L2OB 2MJWB 1SCMC 1W9ZA 3I5FB 2LMVA 4ZCVA 3A4UB 1NIWA 2QDIA 1HT9A 3PFVA 4I5NB 4JWQA 1DEKA 2OS8C 3CTNA 2COLB 2KBIA 2TN4A 1B1GA 2WC5A 1J7PA 4JQ0D 3LK1A 2JT3A 1IWQA 1AUIB 1QS7A 2KAXA 1KCYA 2F33A 1OMRA 2K2AA 2KI4B 2PYQA 1SBJA 5TNCA 2O60A 1JFKA 3LL8B 4AQIA 4CIDA 1IJ6A 2PRUA 5HLVA 1RTP1 4ETOA 2QACA 3SS4A 3CABA 1G8IA 1YX8A 2KQYA 1QX5B 3GK4X 1DJGA 3DF0A 1DJZA 1SY9A 2L4HA 3FE6A 4INWA 5DKQA 4CFRA 4MEWA 4F0ZB 3B88A 1WRKA 1OOJA 1K94A 2EHBA 1EG4A 1PK0D 1PVAA 3K21A 1XFXO 2F3ZA 1GJYA 1SCVA 2FOTA 3DF0B 3GOFA 4PE7A 1QX7A 4DCKA 3BXKA 1OE9B 1TCOB 1UHIA 3DVJA 4YGDB 1NYAA 1AHRA 1P28A 2NCOA 3O4XA 4GBAA 1KFUL 1SL8A 3OX6A
chains in the Genus database with same CATH topology
2OTGC 2KI6D 3A8RA 3CLNA 1XFZO 2LVIA 2M3WA 4GGFA 1CFDA 4C0JA 3D0YA 4QJ5B 1BLQA 5J3XA 1TNQA 1UHJA 3PLFB 1JF2A 3NSKA 1AK8A 2WCFA 2WCEA 1FBVA 3D0YB 2PSRA 1EH2A 3ICBA 3EK7A 3CR2A 4DS7A 4PE0A 2CTNA 1K8UA 2LVVA 3SIBA 1K9PA 2KAVA 5AERA 2KFHA 1IGVA 1IJ5A 1DT7B 4OCIA 2G2BA 4YGAA 4GFTA 1DJIA 2L0PA 1A75A 3BOWB 1JUOA 1WDCC 2BBMA 4NQGA 5HYDA 1S6CA 1GQMA 1TOPA 2JT8A 2QPTA 2LVJA 2CXJA 3FWCA 2KNEA 2E6WA 3I5HB 4BY4A 1C7VA 1ODBA 3FS7A 3GK1A 5PALA 3SG6A 1KFXS 2BCBA 1NCZA 2M49B 4R1EA 2IS9A 1F54A 1A4PA 4P5OE 2NXQA 3DVEA 5HKZA 1SNLA 1WRLA 1ZFSA 4GAOA 1IQ5A 3PN7C 4NDBA 1CFPA 1AJ4A 2JPTA 5CSNA 1BMOA 1PSRA 4USLA 1CLLA 1M31A 1UP5A 1KQVA 2CT9A 3VROA 3I5IC 3WXAA 1RJVA 2EC6C 1F55A 1SL7A 3HCMA 3M0WA 2G9BA 3SG4A 2ZFDA 1Y1AA 2MLEC 1OZSA 2LV7A 5BPJA 5FYXA 3E3RA 3DD4A 2NCPA 2KOTA 4YGCB 3SG2A 1PSBA 2GGMA 1TNPA 2I94A 2FJUB 2RGIA 2A4JA 3WHUB 1K2HA 1B8RA 1F4OA 1YVLA 2M97A 1TIZA 2I2RE 5CSIA 3IQOA 3BUOB 1R6PA 1SL9A 2WOSA 1B47A 4PE1A 4N5XA 1OMVA 4CLNA 2BBNA 3CZTX 1CM4A 1NCXA 2KYCA 1K9KA 1L2OC 3CR5X 1M46A 4MZLA 2JQ6A 1QX2A 2LMTA 3I5FC 2Y1NA 3TDUA 3ZWHA 1B7TZ 1ZUZA 4ORBB 1CM1A 1XFVO 1MXLC 1TNXA 1JF0A 1Y0VH 4I5LB 1ZMZA 3VRPA 3O6BA 1IQ3A 1XFUO 1JBAA 3EKJA 4OV2A 2Q91A 1A29A 3IF7A 4MRXA 2KI4C 4OKHA 4XJKA 3EVVA 1DJXA 4WQ2A 4DUQA 1KSOA 2MBXA 1UWOA 2HPSA 4IL1A 4HSZA 1SR6B 3KF9A 3BQ3A 4XJKB 2DOQA 2Y1MA 1FPWA 2JRFA 1IG5A 1B7TY 4WQ3A 1SPYA 2LUCA 3EK4A 3O4YA 2KHNA 2JXLA 2KSPA 2LHIA 1K96A 1XVJA 2ZNDA 2Q4UA 1GGZA 1PULA 1BR4B 1W7JB 4MRYA 4GNKB 1BJFA 1MQ1A 2LE9B 1PVBA 2JU0A 2WC8A 2JNFA 1CB1A 5DKNA 2GGZA 1KWOB 2LLTA 1RFJA 4NDDA 1G33A 1BF5A 2BECA 4GGFC 1JC2A 3TUYB 1S1EA 3AKAA 1ALVA 2KGRA 1WLZA 1NSHA 4E68A 2KI6C 2NLNA 1K95A 5B8IB 1MXEA 5KU1A 3JTDB 3KHEA 1YRTB 5CSJA 1KFUS 3NXAA 4HRGA 2JTZA 2OS8B 1KK8B 1DGUA 2KBMA 2MLFC 1XA5A 2M7NA 4I5JA 1L7ZA 5I2LA 4DRWA 1KK7Z 1KQMB 1A2XA 2AAOA 1DTLA 2M8UA 1YVHA 1CLMA 3BOWA 3I5HC 4M2QA 1UHHA 2M0RA 2WNDA 1NPQA 2MRDA 4HREE 2MAZA 1B8LA 2LUXA 3SIAA 3BUNB 2F3YA 1IRJA 3SG5A 2I18A 5D7FA 1BOCA 4YI9A 1UHNA 1YURA 2ISDA 1KK7Y 2JOJA 3LCPC 1QJTA 2K7DA 2K7CA 1NX2A 2JXCA 3PM8A 3SJSA 1Q80A 1FI6A 1CNPA 1TTXA 2LMUA 4YBHB 3WNXB 1XFWO 3VRRA 1CMGA 2HF5A 1H8BA 2KDHA 2K7BA 3I5GB 1B4CA 3F45A 2CNPA 2JULA 5K89A 2SASA 2JT0A 3EVRA 2BL0B 1G4YR 1NUBA 2CBLA 1HQVA 1BR1B 2LC5A 2PASA 1LXFC 1DJYA 5HKYA 4AOMA 4MVFA 1F70A 2ZRSA 1S3PA 3JVTC 3OX5A 1R2UA 1K9UA 1LKJA 2KQ6A 4MBEA 3TDIA 2JTTA 2L4IA 2D8NA 4P2YB 4MSPA 1NX1A 1DJWA 3DVMA 1NWDA 4YI8A 2LP3A 1DMOA 2HQWA 1JWDA 1TN4A 5HKWA 1IH0A 1QXPA 1CDLA 1ALWA 1SMGA 4OR9B 1TRFA 3OP0A 5AFPA 1GGWA 3CS1A 1KSMA 3RLZA 3SG7A 1M39A 1NCYA 2E30A 2SCPA 3FIAA 3PALA 4NDCA 3FWBA 4GGNA 5KTYA 4XYNA 1LVCD 1RK9A 2LP2A 2BKHB 1S5GZ 1IKUA 2H2KA 1UUSA 2L98A 1N65A 1SR6C 2ZN8A 5JJGA 1QATA 3H4SE 4ZCUA 2ZKMX 1SYMA 1DF0B 2JZIA 5ER5A 1CTRA 1MF8B 2JWWA 2JC2A 2LNKA 4QJ3B 3ZNIA 3TS5B 1AP4A 1N2DA 2O5GA 1TNWA 2ZRTA 1QLKA 4PHJA 2KGBC 1MR8A 4GPLB 2K0JA 5HLOA 1QVIZ 4QJ4B 1S5GY 1QTXA 1U5IB 4Q04A 1C07A 2K61A 1J55A 1S6IA 1WY9A 1V1GA 1KWOC 3LK0A 1EL4A 1QIWA 1YX7A 1EXRA 1BU3A 1CFFA 3BYAA 2Y5IA 4ORAB 3TUYC 2L50A 2F2OA 2K7OA 1CKKA 1OMDA 2NZ0A 1V1FA 1QVIY 1F71A 3WHTB 2L51A 2M9GA 1MWNA 5AANA 3JTDC 3SG3A 1J1EA 3KEVA 2PVBA 1XK4A 5ER4X 3VRNA 2LLSA 1KK8C 4L9MA 3AAJA 3LLEA 5IBWA 3OHMB 1YR5A 2WCBA 1BG1A 1PRWA 1DJHA 3EK8A 2MHHA 1XFYO 1KQMC 3CGAA 3TDZA 1AVSA 1SW8A 2M1KB 4MN0A 1ZOTB 1LA3A 4GUKA 1SCMB 4TNCA 3BUWB 3GK2A 1H4BA 5F6TA 2AMIA 4I5KA 1LA0A 4PHMA 2LM5A 2LLUA 1M63B 1QV0A 4CFQA 1BODA 1TCFA 5CPVA 2BKIB 1S26D 1OQPA 4PDZA 1LINA 1F8HA 3OB1B 1J1DA 2WORA 1CFCA 1C7WA 4PE4A 3EVUA 3PSRA 3AAKA 4M2OA 1B8CA 1YUTA 5D69A 1J7RA 4MZKA 2LHLA 2P6BB 1UURA 1SRAA 1NX3A 1K93D 3C1VA 3I5GC 2ZN9A 1Y1XA 2JNXA 4PALA 5G08A 1A03A 1JSAA 2V53A 2I7AA 2M29A 3DVKA 3QRXA 2BL0C 2OTGB 1CMFA 4JPZB 5I2QA 3BUMB 1EJ3A 2PMYA 4U8DA 1X02A 1J7QA 3BUXB 1A75B 1KFXL 4M2PA 3EKHA 2L5XB 1YUUA 2M1UA 4HRHA 3KPXA 2M7LA 1RECA 1N0YA 2KYFA 1Y1UA 1M45A 4WRIA 4MZJA 1YUSA 1OSAA 4D1EA 4YGBB 2KFGA 1B9AA 1WDCB 3NSIA 1RWYA 2MA2A 4C0LA 1EG3A 1YTZC 1RROA 2LANA 3KO0A 2F8PA 2H61C 3AKBA 4ICBA 3CR4X 2L2EA 2K2FA 1XO5A 2KAYA 1FI5A 1DGVA 1DVIA 1QLSA 1K90D 3D10A 4FQOA 1XYDA 2OPOA 2KFFA 4A4CA 1J7OA 1CDNA 2H61A 4FTGA 3IQQA 2FCEA 1PALA 2EGDA 4PHNA 1FW4A 2LAPA 3PN7B 1S36A 3TS5C 1ZACA 3VGOA 2BCAA 5I2OA 4YRUA 2PALA 2HQ8A 1Y6WA 1DF0A 1CDMA 2BE4A 3O78A 4CPVA 1UHKA 4YGEB 3VRQA 1S6JA 1E8AA 2CCMA 1QASA 3I5IB 3NSOA 2EC6B 1SK6D 2BE6A 4N1FA 4UPGA 2BCXA 2Y4QA 4C0KA 1F4QA 2K8MB 1CLBA 1SKTA 1MUXA 1VRKA 2B1UA 1QIVA 1WRZA 3NSLA 1W7IB 4ORCB 1YRUB 1CDPA 5KSZA 1AJ5A 3JVTB 2LCPA 1U5IA 2VRGA 5JOLA 2ZNEA 3PATA 1NX0A 2HETA 4OVNF 3RM1A 4AQJA 3TZ1A 5AEQA 2LVKA 5CSFA 2AUCA 4A4BA 1OZOA 1WLMA 2F2PA 3CWGA 4PHKA 5I8NA 1JFJA 4MLWA 4PCWA 2FCDA 5AXIA 4BY5A 3OB2B 1MHOA 5DKRA 3O2PA 4DIRA 1NP8A 1FF1A 5GQQC 3MSEB 1XK4C 4N1GA 2GV5A 1D1OA 2R2IA 1BT6A 1QV1A 1L2OB 2MJWB 1SCMC 3I5FB 2LMVA 4ZCVA 3A4UB 1NIWA 4I5NB 1HT9A 3PFVA 4JWQA 2OS8C 3CTNA 2COLB 2KBIA 2TN4A 1B1GA 1J7PA 4JQ0D 3LK1A 2JT3A 1IWQA 1AUIB 1QS7A 2KAXA 1KCYA 2F33A 1OMRA 2K2AA 2KI4B 1SBJA 5TNCA 2O60A 1JFKA 3LL8B 4AQIA 4CIDA 1IJ6A 2PRUA 5HLVA 1RTP1 4ETOA 2QACA 1G8IA 1YX8A 2KQYA 1QX5B 3GK4X 1DJGA 3DF0A 1DJZA 1SY9A 2L4HA 5DKQA 4F0ZB 4CFRA 4MEWA 1WRKA 1OOJA 1K94A 2EHBA 1EG4A 1PK0D 1PVAA 3K21A 1XFXO 2F3ZA 1GJYA 1SCVA 2FOTA 3DF0B 3GOFA 4PE7A 1QX7A 4DCKA 3BXKA 1OE9B 1TCOB 1UHIA 3DVJA 4YGDB 1NYAA 1AHRA 2NCOA 3HX4A 4GBAA 1KFUL 1SL8A 3OX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTG C;  2KI6 D;  3A8R A;  3CLN A;  1XFZ O;  2LVI A;  2M3W A;  4GGF A;  1CFD A;  4C0J A;  3D0Y A;  4QJ5 B;  1BLQ A;  5J3X A;  1TNQ A;  1UHJ A;  3PLF B;  1JF2 A;  3NSK A;  1AK8 A;  2WCF A;  2WCE A;  1FBV A;  3D0Y B;  2PSR A;  1EH2 A;  3ICB A;  3EK7 A;  3CR2 A;  4DS7 A;  4PE0 A;  2CTN A;  1K8U A;  2LVV A;  3SIB A;  1K9P A;  2KAV A;  5AER A;  2KFH A;  1IGV A;  1IJ5 A;  1DT7 B;  4OCI A;  2G2B A;  4YGA A;  4GFT A;  1DJI A;  2L0P A;  1A75 A;  3BOW B;  1JUO A;  1WDC C;  2BBM A;  4NQG A;  5HYD A;  1S6C A;  1GQM A;  1TOP A;  2JT8 A;  2QPT A;  2LVJ A;  2CXJ A;  3FWC A;  2KNE A;  2E6W A;  3I5H B;  4BY4 A;  1C7V A;  1ODB A;  3FS7 A;  3GK1 A;  5PAL A;  3SG6 A;  1KFX S;  2BCB A;  1NCZ A;  2M49 B;  4R1E A;  2IS9 A;  1F54 A;  1A4P A;  4P5O E;  2NXQ A;  3DVE A;  5HKZ A;  1SNL A;  1WRL A;  1ZFS A;  4GAO A;  1IQ5 A;  3PN7 C;  4NDB A;  1CFP A;  1AJ4 A;  2JPT A;  5CSN A;  1BMO A;  1PSR A;  4USL A;  1CLL A;  1M31 A;  1UP5 A;  1KQV A;  2CT9 A;  3VRO A;  3I5I C;  3WXA A;  1RJV A;  2EC6 C;  1F55 A;  1SL7 A;  3HCM A;  3M0W A;  2G9B A;  3SG4 A;  2ZFD A;  1Y1A A;  2MLE C;  1OZS A;  2LV7 A;  5BPJ A;  5FYX A;  3E3R A;  3DD4 A;  2NCP A;  2KOT A;  4YGC B;  3SG2 A;  1PSB A;  2GGM A;  1TNP A;  2I94 A;  2FJU B;  2RGI A;  2A4J A;  3WHU B;  1K2H A;  1B8R A;  1F4O A;  1YVL A;  2M97 A;  1TIZ A;  2I2R E;  5CSI A;  3IQO A;  3BUO B;  1R6P A;  1SL9 A;  2WOS A;  1B47 A;  4PE1 A;  4N5X A;  1OMV A;  4CLN A;  2BBN A;  3CZT X;  1CM4 A;  1NCX A;  2KYC A;  1K9K A;  1L2O C;  3CR5 X;  1M46 A;  4MZL A;  2JQ6 A;  1QX2 A;  2LMT A;  3I5F C;  2Y1N A;  3TDU A;  3ZWH A;  1B7T Z;  1ZUZ A;  4ORB B;  1CM1 A;  1XFV O;  1MXL C;  1TNX A;  1JF0 A;  1Y0V H;  4I5L B;  1ZMZ A;  3VRP A;  3O6B A;  1IQ3 A;  1XFU O;  1JBA A;  3EKJ A;  4OV2 A;  2Q91 A;  1A29 A;  3IF7 A;  4MRX A;  2KI4 C;  4OKH A;  4XJK A;  3EVV A;  1DJX A;  4WQ2 A;  4DUQ A;  1KSO A;  2MBX A;  1UWO A;  2HPS A;  4IL1 A;  4HSZ A;  1SR6 B;  3KF9 A;  3BQ3 A;  4XJK B;  2DOQ A;  2Y1M A;  1FPW A;  2JRF A;  1IG5 A;  1B7T Y;  4WQ3 A;  1SPY A;  2LUC A;  3EK4 A;  3O4Y A;  2KHN A;  2JXL A;  2KSP A;  2LHI A;  1K96 A;  1XVJ A;  2ZND A;  2Q4U A;  1GGZ A;  1PUL A;  1BR4 B;  1W7J B;  4MRY A;  4GNK B;  1BJF A;  1MQ1 A;  2LE9 B;  1PVB A;  2JU0 A;  2WC8 A;  2JNF A;  1CB1 A;  5DKN A;  2GGZ A;  1KWO B;  2LLT A;  1RFJ A;  4NDD A;  1G33 A;  1BF5 A;  2BEC A;  4GGF C;  1JC2 A;  3TUY B;  1S1E A;  3AKA A;  1ALV A;  2KGR A;  1WLZ A;  1NSH A;  4E68 A;  2KI6 C;  2NLN A;  1K95 A;  5B8I B;  1MXE A;  5KU1 A;  3JTD B;  3KHE A;  1YRT B;  5CSJ A;  1KFU S;  3NXA A;  4HRG A;  2JTZ A;  2OS8 B;  1KK8 B;  1DGU A;  2KBM A;  2MLF C;  1XA5 A;  2M7N A;  4I5J A;  1L7Z A;  5I2L A;  4DRW A;  1KK7 Z;  1KQM B;  1A2X A;  2AAO A;  1DTL A;  2M8U A;  1YVH A;  1CLM A;  3BOW A;  3I5H C;  4M2Q A;  1UHH A;  2M0R A;  2WND A;  1NPQ A;  2MRD A;  4HRE E;  2MAZ A;  1B8L A;  2LUX A;  3SIA A;  3BUN B;  2F3Y A;  1IRJ A;  3SG5 A;  2I18 A;  5D7F A;  1BOC A;  4YI9 A;  1UHN A;  1YUR A;  2ISD A;  1KK7 Y;  2JOJ A;  3LCP C;  1QJT A;  2K7D A;  2K7C A;  1NX2 A;  2JXC A;  3PM8 A;  3SJS A;  1Q80 A;  1FI6 A;  1CNP A;  1TTX A;  2LMU A;  4YBH B;  3WNX B;  1XFW O;  3VRR A;  1CMG A;  2HF5 A;  1H8B A;  2KDH A;  2K7B A;  3I5G B;  1B4C A;  3F45 A;  2CNP A;  2JUL A;  5K89 A;  2SAS A;  2JT0 A;  3EVR A;  2BL0 B;  1G4Y R;  1NUB A;  2CBL A;  1HQV A;  1BR1 B;  2LC5 A;  2PAS A;  1LXF C;  1DJY A;  5HKY A;  4AOM A;  4MVF A;  1F70 A;  2ZRS A;  1S3P A;  3JVT C;  3OX5 A;  1R2U A;  1K9U A;  1LKJ A;  2KQ6 A;  4MBE A;  3TDI A;  2JTT A;  2L4I A;  2D8N A;  4P2Y B;  4MSP A;  1NX1 A;  1DJW A;  3DVM A;  1NWD A;  4YI8 A;  2LP3 A;  1DMO A;  2HQW A;  1JWD A;  1TN4 A;  5HKW A;  1IH0 A;  1QXP A;  1CDL A;  1ALW A;  1SMG A;  4OR9 B;  1TRF A;  3OP0 A;  5AFP A;  1GGW A;  3CS1 A;  1KSM A;  3RLZ A;  3SG7 A;  1M39 A;  1NCY A;  2E30 A;  2SCP A;  3FIA A;  3PAL A;  4NDC A;  3FWB A;  4GGN A;  5KTY A;  4XYN A;  1LVC D;  1RK9 A;  2LP2 A;  2BKH B;  1S5G Z;  1IKU A;  2H2K A;  1UUS A;  2L98 A;  1N65 A;  1SR6 C;  2ZN8 A;  5JJG A;  1QAT A;  3H4S E;  4ZCU A;  2ZKM X;  1SYM A;  1DF0 B;  2JZI A;  5ER5 A;  1CTR A;  1MF8 B;  2JWW A;  2JC2 A;  2LNK A;  4QJ3 B;  3ZNI A;  3TS5 B;  1AP4 A;  1N2D A;  2O5G A;  1TNW A;  2ZRT A;  1QLK A;  4PHJ A;  2KGB C;  1MR8 A;  4GPL B;  2K0J A;  5HLO A;  1QVI Z;  4QJ4 B;  1S5G Y;  1QTX A;  1U5I B;  4Q04 A;  1C07 A;  2K61 A;  1J55 A;  1S6I A;  1WY9 A;  1V1G A;  1KWO C;  3LK0 A;  1EL4 A;  1QIW A;  1YX7 A;  1EXR A;  1BU3 A;  1CFF A;  3BYA A;  2Y5I A;  4ORA B;  3TUY C;  2L50 A;  2F2O A;  2K7O A;  1CKK A;  1OMD A;  2NZ0 A;  1V1F A;  1QVI Y;  1F71 A;  3WHT B;  2L51 A;  2M9G A;  1MWN A;  5AAN A;  3JTD C;  3SG3 A;  1J1E A;  3KEV A;  2PVB A;  1XK4 A;  5ER4 X;  3VRN A;  2LLS A;  1KK8 C;  4L9M A;  3AAJ A;  3LLE A;  5IBW A;  3OHM B;  1YR5 A;  2WCB A;  1BG1 A;  1PRW A;  1DJH A;  3EK8 A;  2MHH A;  1XFY O;  1KQM C;  3CGA A;  3TDZ A;  1AVS A;  1SW8 A;  2M1K B;  4MN0 A;  1ZOT B;  1LA3 A;  4GUK A;  1SCM B;  4TNC A;  3BUW B;  3GK2 A;  1H4B A;  5F6T A;  2AMI A;  4I5K A;  1LA0 A;  4PHM A;  2LM5 A;  2LLU A;  1M63 B;  1QV0 A;  4CFQ A;  1BOD A;  1TCF A;  5CPV A;  2BKI B;  1S26 D;  1OQP A;  4PDZ A;  1LIN A;  1F8H A;  3OB1 B;  1J1D A;  2WOR A;  1CFC A;  1C7W A;  4PE4 A;  3EVU A;  3PSR A;  3AAK A;  4M2O A;  1B8C A;  1YUT A;  5D69 A;  1J7R A;  4MZK A;  2LHL A;  2P6B B;  1UUR A;  1SRA A;  1NX3 A;  1K93 D;  3C1V A;  3I5G C;  2ZN9 A;  1Y1X A;  2JNX A;  4PAL A;  5G08 A;  1A03 A;  1JSA A;  2V53 A;  2I7A A;  2M29 A;  3DVK A;  3QRX A;  2BL0 C;  2OTG B;  1CMF A;  4JPZ B;  5I2Q A;  3BUM B;  1EJ3 A;  2PMY A;  4U8D A;  1X02 A;  1J7Q A;  3BUX B;  1A75 B;  1KFX L;  4M2P A;  3EKH A;  2L5X B;  1YUU A;  2M1U A;  4HRH A;  3KPX A;  2M7L A;  1REC A;  1N0Y A;  2KYF A;  1Y1U A;  1M45 A;  4WRI A;  4MZJ A;  1YUS A;  1OSA A;  4D1E A;  4YGB B;  2KFG A;  1B9A A;  1WDC B;  3NSI A;  1RWY A;  2MA2 A;  4C0L A;  1EG3 A;  1YTZ C;  1RRO A;  2LAN A;  3KO0 A;  2F8P A;  2H61 C;  3AKB A;  4ICB A;  3CR4 X;  2L2E A;  2K2F A;  1XO5 A;  2KAY A;  1FI5 A;  1DGV A;  1DVI A;  1QLS A;  1K90 D;  3D10 A;  4FQO A;  1XYD A;  2OPO A;  2KFF A;  4A4C A;  1J7O A;  1CDN A;  2H61 A;  4FTG A;  3IQQ A;  2FCE A;  1PAL A;  2EGD A;  4PHN A;  1FW4 A;  2LAP A;  3PN7 B;  1S36 A;  3TS5 C;  1ZAC A;  3VGO A;  2BCA A;  5I2O A;  4YRU A;  2PAL A;  2HQ8 A;  1Y6W A;  1DF0 A;  1CDM A;  2BE4 A;  3O78 A;  4CPV A;  1UHK A;  4YGE B;  3VRQ A;  1S6J A;  1E8A A;  2CCM A;  1QAS A;  3I5I B;  3NSO A;  2EC6 B;  1SK6 D;  2BE6 A;  4N1F A;  4UPG A;  2BCX A;  2Y4Q A;  4C0K A;  1F4Q A;  2K8M B;  1CLB A;  1SKT A;  1MUX A;  1VRK A;  2B1U A;  1QIV A;  1WRZ A;  3NSL A;  1W7I B;  4ORC B;  1YRU B;  1CDP A;  5KSZ A;  1AJ5 A;  3JVT B;  2LCP A;  1U5I A;  2VRG A;  5JOL A;  2ZNE A;  3PAT A;  1NX0 A;  2HET A;  4OVN F;  3RM1 A;  4AQJ A;  3TZ1 A;  5AEQ A;  2LVK A;  5CSF A;  2AUC A;  4A4B A;  1OZO A;  1WLM A;  2F2P A;  3CWG A;  4PHK A;  5I8N A;  1JFJ A;  4MLW A;  4PCW A;  2FCD A;  5AXI A;  4BY5 A;  3OB2 B;  1MHO A;  5DKR A;  3O2P A;  4DIR A;  1NP8 A;  1FF1 A;  5GQQ C;  3MSE B;  1XK4 C;  4N1G A;  2GV5 A;  1D1O A;  2R2I A;  1BT6 A;  1QV1 A;  1L2O B;  2MJW B;  1SCM C;  3I5F B;  2LMV A;  4ZCV A;  3A4U B;  1NIW A;  4I5N B;  1HT9 A;  3PFV A;  4JWQ A;  2OS8 C;  3CTN A;  2COL B;  2KBI A;  2TN4 A;  1B1G A;  1J7P A;  4JQ0 D;  3LK1 A;  2JT3 A;  1IWQ A;  1AUI B;  1QS7 A;  2KAX A;  1KCY A;  2F33 A;  1OMR A;  2K2A A;  2KI4 B;  1SBJ A;  5TNC A;  2O60 A;  1JFK A;  3LL8 B;  4AQI A;  4CID A;  1IJ6 A;  2PRU A;  5HLV A;  1RTP 1;  4ETO A;  2QAC A;  1G8I A;  1YX8 A;  2KQY A;  1QX5 B;  3GK4 X;  1DJG A;  3DF0 A;  1DJZ A;  1SY9 A;  2L4H A;  5DKQ A;  4F0Z B;  4CFR A;  4MEW A;  1WRK A;  1OOJ A;  1K94 A;  2EHB A;  1EG4 A;  1PK0 D;  1PVA A;  3K21 A;  1XFX O;  2F3Z A;  1GJY A;  1SCV A;  2FOT A;  3DF0 B;  3GOF A;  4PE7 A;  1QX7 A;  4DCK A;  3BXK A;  1OE9 B;  1TCO B;  1UHI A;  3DVJ A;  4YGD B;  1NYA A;  1AHR A;  2NCO A;  3HX4 A;  4GBA A;  1KFU L;  1SL8 A;  3OX6 A; 
#chains in the Genus database with same CATH topology
 2OTG C;  2KI6 D;  5EL2 A;  3A8R A;  3CLN A;  1XFZ O;  2LVI A;  2M3W A;  4GGF A;  1CFD A;  4C0J A;  3D0Y A;  4FQT A;  4QJ5 B;  5J3X A;  1TNQ A;  1BLQ A;  1UHJ A;  3PLF B;  1JF2 A;  3NSK A;  3S0G A;  1AK8 A;  2WCF A;  2WCE A;  1FBV A;  3D0Y B;  2PSR A;  1EH2 A;  3ICB A;  3EK7 A;  3CR2 A;  4DS7 A;  4PE0 A;  2CTN A;  1K8U A;  2LVV A;  3SIB A;  1K9P A;  2KAV A;  5AER A;  2KFH A;  1IGV A;  1IJ5 A;  1DT7 B;  4OCI A;  2G2B A;  4YGA A;  4GFT A;  1DJI A;  1XFR A;  1A75 A;  2L0P A;  1JUO A;  1WDC C;  2BBM A;  3BOW B;  3DZT A;  4NQG A;  3UO9 A;  5HYD A;  1S6C A;  1GQM A;  1TOP A;  2JT8 A;  1TUJ A;  2QPT A;  2LVJ A;  2CXJ A;  3FWC A;  2KNE A;  2E6W A;  3I5H B;  2PQL A;  4BY4 A;  1C7V A;  1ODB A;  3FS7 A;  3GK1 A;  3CDN A;  5PAL A;  3SG6 A;  1DQE A;  1KFX S;  1OOG A;  2BCB A;  1NCZ A;  2M49 B;  4R1E A;  2IS9 A;  1F54 A;  1A4P A;  4P5O E;  2NXQ A;  3DVE A;  5HKZ A;  1SNL A;  1WRL A;  1ZFS A;  1QWV A;  1IQ5 A;  3K1E A;  4GAO A;  3PN7 C;  3S0B A;  1LS8 A;  4NDB A;  4INX A;  1CFP A;  1AJ4 A;  2JPT A;  5CSN A;  1BMO A;  1PSR A;  4USL A;  1CLL A;  1M31 A;  1UP5 A;  1KQV A;  2CT9 A;  3VRO A;  3I5I C;  3WXA A;  1RJV A;  2EC6 C;  1F55 A;  1SL7 A;  3HCM A;  3M0W A;  2G9B A;  5DIC A;  2ZFD A;  3SG4 A;  1Y1A A;  3HX4 A;  4OZD A;  2MLE C;  1OZS A;  2LV7 A;  5BPJ A;  5FYX A;  3E3R A;  3DD4 A;  2NCP A;  2KOT A;  4YGC B;  3SG2 A;  1PSB A;  2GGM A;  1TNP A;  2I94 A;  5I94 A;  2FJU B;  2RGI A;  2A4J A;  3QME A;  3WHU B;  1K2H A;  1B8R A;  1F4O A;  2JPO A;  1YVL A;  2M97 A;  1TIZ A;  2I2R E;  5CSI A;  3IQO A;  3BUO B;  1R6P A;  1OOH A;  1SL9 A;  1T14 A;  1B47 A;  2WOS A;  4PE1 A;  4N5X A;  1OMV A;  4CLN A;  2BBN A;  3CZT X;  1CM4 A;  1NCX A;  2KYC A;  3VB1 A;  1K9K A;  1L2O C;  3CR5 X;  1M46 A;  4MZL A;  2JQ6 A;  1QX2 A;  2LMT A;  3I5F C;  2Y1N A;  3TDU A;  3ZWH A;  1B7T Z;  1ZUZ A;  4ORB B;  1CM1 A;  1XFV O;  1MXL C;  1TNX A;  1JF0 A;  1Y0V H;  1OOF A;  4I5L B;  1ZMZ A;  3VRP A;  3O6B A;  1IQ3 A;  1XFU O;  1JBA A;  3EKJ A;  4OV2 A;  2Q91 A;  3BJH A;  2WCJ A;  3EG5 B;  1A29 A;  3IF7 A;  4MRX A;  2KI4 C;  2WCL A;  4OKH A;  4XJK A;  2P70 A;  3EVV A;  1DJX A;  4WQ2 A;  3UNW A;  3PJI A;  4DUQ A;  1KSO A;  2L5Y A;  2MBX A;  1UWO A;  2HPS A;  4IL1 A;  4HSZ A;  1SR6 B;  3KF9 A;  3BQ3 A;  4XJK B;  3DYE A;  2DOQ A;  2Y1M A;  1FPW A;  2JRF A;  1IG5 A;  1B7T Y;  3D77 A;  4WQ3 A;  1SPY A;  1TUZ A;  2LUC A;  3EK4 A;  3O4Y A;  2KHN A;  2JXL A;  2KSP A;  2LHI A;  1K96 A;  1XVJ A;  2ZND A;  2Q4U A;  1GGZ A;  1PUL A;  1BR4 B;  1W7J B;  4MRY A;  3DXL A;  4GNK B;  3RZS A;  3L4L A;  2P71 A;  3L4A A;  1DC1 A;  1BJF A;  5FI2 A;  5D3O A;  1MQ1 A;  2LE9 B;  1PVB A;  4F7F A;  2JU0 A;  2WC8 A;  2JNF A;  1CB1 A;  5DKN A;  2GGZ A;  1KWO B;  2LLT A;  1RFJ A;  4NDD A;  1G33 A;  3BFA A;  1BF5 A;  2BEC A;  4GGF C;  1JC2 A;  3TUY B;  1S1E A;  3AKA A;  1ALV A;  2KGR A;  3B7A A;  1WLZ A;  2FJY A;  1NSH A;  4E68 A;  3Q8I A;  2KI6 C;  2NLN A;  1K95 A;  5B8I B;  1MXE A;  2H8V A;  5KU1 A;  3JTD B;  3KHE A;  1YRT B;  5CSJ A;  1KFU S;  3NXA A;  3R1O A;  4HRG A;  2JTZ A;  2OS8 B;  1KK8 B;  2BAP A;  1DGU A;  2KBM A;  2MLF C;  1XA5 A;  2M7N A;  3D73 A;  4I5J A;  1L7Z A;  5I2L A;  4KYN A;  4DRW A;  1KK7 Z;  3D78 A;  1KQM B;  1A2X A;  2AAO A;  1DTL A;  2M8U A;  1YVH A;  1CLM A;  3BOW A;  3I5H C;  4M2Q A;  1UHH A;  2M0R A;  2WND A;  1NPQ A;  2MRD A;  4HRE E;  2MAZ A;  1B8L A;  2LUX A;  2L2C A;  3SIA A;  3BUN B;  2F3Y A;  1OOI X;  1IRJ A;  3SG5 A;  2I18 A;  5D7F A;  1BOC A;  4YI9 A;  1UHN A;  1YUR A;  2ISD A;  1KK7 Y;  2JOJ A;  3LCP C;  1QJT A;  2K7D A;  1TWO A;  2K7C A;  1NX2 A;  2JXC A;  3PM8 A;  3SJS A;  1Q80 A;  1FI6 A;  1CNP A;  3NGV A;  1TTX A;  2LMU A;  4YBH B;  3WNX B;  1XFW O;  3VRR A;  1CMG A;  2HF5 A;  1H8B A;  2KDH A;  2K7B A;  3I5G B;  1B4C A;  3F45 A;  2CNP A;  2JUL A;  5K89 A;  2SAS A;  2YGU A;  2JT0 A;  3EVR A;  2BL0 B;  1G4Y R;  1NUB A;  2CBL A;  1HQV A;  1BR1 B;  2LC5 A;  2PAS A;  1LXF C;  1DJY A;  5HKY A;  4AOM A;  4MVF A;  1F70 A;  2ZRS A;  1S3P A;  3JVT C;  3OX5 A;  1R2U A;  1K9U A;  1LKJ A;  2KQ6 A;  4MBE A;  3TDI A;  2JTT A;  2L4I A;  2D8N A;  4P2Y B;  4MSP A;  1NX1 A;  1DJW A;  3DVM A;  1NWD A;  4YI8 A;  1DEL A;  2LP3 A;  1DMO A;  2HQW A;  1JWD A;  1TN4 A;  5HKW A;  1IH0 A;  1QXP A;  1CDL A;  1ALW A;  1SMG A;  4OR9 B;  4PT1 A;  1TRF A;  3BFB A;  3NHT A;  3OP0 A;  5AFP A;  3CS1 A;  1KSM A;  3RLZ A;  3SG7 A;  1M39 A;  1NCY A;  1GGW A;  2E30 A;  2SCP A;  3FIA A;  3PAL A;  3S0E A;  2BNX A;  3FWB A;  4NDC A;  4GGN A;  5KTY A;  1OW4 A;  3IVT A;  1LVC D;  1RK9 A;  2LP2 A;  2BKH B;  1S5G Z;  4XYN A;  1IKU A;  2H2K A;  1UUS A;  2L98 A;  1N65 A;  3FE9 A;  1SR6 C;  2ZN8 A;  5JJG A;  1QAT A;  3CZ1 A;  3H4S E;  4ZCU A;  2ZKM X;  1SYM A;  1DF0 B;  2JZI A;  5ER5 A;  1CTR A;  3D76 A;  1MF8 B;  3L47 A;  2JWW A;  2JC2 A;  4JKT A;  2LNK A;  4QJ3 B;  3ZNI A;  4IJ7 A;  3TS5 B;  3B87 A;  1AP4 A;  2QEB A;  1N2D A;  2O5G A;  1TNW A;  2ZRT A;  1QLK A;  4PHJ A;  4JD9 A;  2KGB C;  1MR8 A;  4GPL B;  2K0J A;  5HLO A;  1QVI Z;  4QJ4 B;  1S5G Y;  1QTX A;  1U5I B;  2KPH A;  4Q04 A;  1C07 A;  2K61 A;  3D75 A;  1J55 A;  1S6I A;  1WY9 A;  2QEH A;  1V1G A;  1KWO C;  3LK0 A;  1EL4 A;  3R1V A;  1QIW A;  1YX7 A;  1EXR A;  1BU3 A;  1CFF A;  3BYA A;  2Y5I A;  4ORA B;  3N7H A;  2L50 A;  2F2O A;  2K7O A;  3TUY C;  1CKK A;  2QEV A;  1OMD A;  2NZ0 A;  1V1F A;  1QVI Y;  1F71 A;  3WHT B;  2L51 A;  2M9G A;  2WCK A;  1MWN A;  5AAN A;  3JTD C;  3SS3 A;  1J1E A;  5FI6 A;  3SG3 A;  3KEV A;  2PVB A;  1XK4 A;  5ER4 X;  3VRN A;  2LLS A;  1KK8 C;  4L9M A;  3AAJ A;  3LLE A;  5IBW A;  3OHM B;  1YR5 A;  2WCB A;  1BG1 A;  1PRW A;  1DJH A;  3OGN A;  3EK8 A;  2MHH A;  1XFY O;  3FE8 A;  1KQM C;  3CGA A;  3TDZ A;  1AVS A;  1SW8 A;  2M1K B;  4MN0 A;  1ZOT B;  1LA3 A;  4GUK A;  1SCM B;  2KLE A;  4TNC A;  3BUW B;  3GK2 A;  1H4B A;  3NHI A;  5F6T A;  2AMI A;  4I5K A;  1LA0 A;  3SS5 A;  3S0F A;  1C3Z A;  4PHM A;  2LM5 A;  2LLU A;  1M63 B;  1QV0 A;  4CFQ A;  1BOD A;  2WC6 A;  1TCF A;  3CZ2 A;  2WCM A;  2BKI B;  1S26 D;  5CPV A;  1OQP A;  4PDZ A;  1LIN A;  1F8H A;  3OB1 B;  1J1D A;  2WOR A;  3B86 A;  1C7W A;  4PE4 A;  5FI7 A;  3EVU A;  3S0D A;  3PSR A;  1CFC A;  3AAK A;  4M2O A;  1B8C A;  1YUT A;  5D69 A;  1J7R A;  4MZK A;  2LHL A;  2P6B B;  1UUR A;  3V2L A;  1SRA A;  1NX3 A;  1K93 D;  3C1V A;  3I5G C;  2ZN9 A;  1Y1X A;  2JNX A;  4PAL A;  5G08 A;  1A03 A;  1JSA A;  2V53 A;  2I7A A;  2M29 A;  3DVK A;  3QRX A;  2BL0 C;  2OTG B;  1CMF A;  4JPZ B;  5I2Q A;  3R72 A;  3BUM B;  3BFH A;  1EJ3 A;  2PMY A;  4U8D A;  1X02 A;  1J7Q A;  3BUX B;  1A75 B;  2K60 A;  1KFX L;  4M2P A;  3EKH A;  2L5X B;  1YUU A;  2M1U A;  3CZ0 A;  3KPX A;  4HRH A;  2M7L A;  1C3Y A;  1REC A;  1N0Y A;  2KYF A;  1Y1U A;  1M45 A;  4WRI A;  4MZJ A;  1YUS A;  1OSA A;  4D1E A;  4YGB B;  2KFG A;  1B9A A;  1WDC B;  2GTE A;  1RWY A;  2MA2 A;  3NSI A;  4C0L A;  1EG3 A;  1YTZ C;  1RRO A;  2LAN A;  3KO0 A;  2F8P A;  2H61 C;  2KLD A;  2ERB A;  3AKB A;  4ICB A;  3CR4 X;  2L2E A;  2K2F A;  1XO5 A;  2KAY A;  1FI5 A;  1DGV A;  1DVI A;  1QLS A;  3R1P A;  1K90 D;  3D10 A;  4FQO A;  1XYD A;  2OPO A;  2KFF A;  4A4C A;  1Z2C B;  1J7O A;  1CDN A;  2H61 A;  4FTG A;  1ORG A;  3IQQ A;  2FCE A;  1PAL A;  2EGD A;  4PHN A;  1FW4 A;  2LAP A;  3CYZ A;  3PN7 B;  1S36 A;  3TS5 C;  1ZAC A;  2QEO A;  2BCA A;  3VGO A;  5I2O A;  3DY9 A;  2PAL A;  4YRU A;  2HQ8 A;  1Y6W A;  1DF0 A;  1CDM A;  2BE4 A;  3O78 A;  4CPV A;  1UHK A;  4YGE B;  3VRQ A;  1S6J A;  1E8A A;  2CCM A;  1QAS A;  3I5I B;  3NSO A;  2EC6 B;  1SK6 D;  2BE6 A;  4N1F A;  4UPG A;  2BCX A;  2Y4Q A;  4C0K A;  3B6X A;  3S0A A;  1F4Q A;  2K8M B;  1CLB A;  1SKT A;  1MUX A;  1VRK A;  2B1U A;  1QIV A;  1IIO A;  1GM0 A;  1WRZ A;  3NSL A;  1W7I B;  3OBV A;  1YRU B;  1CDP A;  4ORC B;  5KSZ A;  1AJ5 A;  3PM2 A;  3JVT B;  2LCP A;  1U5I A;  2VRG A;  5JOL A;  2ZNE A;  3PAT A;  1NX0 A;  2HET A;  4OVN F;  3RM1 A;  4AQJ A;  3TZ1 A;  5AEQ A;  2LVK A;  5CSF A;  2AUC A;  4A4B A;  1OZO A;  1WLM A;  2F2P A;  2WCH A;  3CWG A;  4PHK A;  1Z4H A;  5I8N A;  1JFJ A;  4MLW A;  4PCW A;  2FCD A;  3D74 A;  5AXI A;  4BY5 A;  3OB2 B;  1MHO A;  5DKR A;  3O2P A;  4DIR A;  1NP8 A;  1FF1 A;  5GQQ C;  1SSE B;  1XK4 C;  3MSE B;  4N1G A;  2GV5 A;  5HL1 A;  1D1O A;  2R2I A;  1BT6 A;  1QV1 A;  1L2O B;  2MJW B;  1SCM C;  1W9Z A;  3I5F B;  2LMV A;  4ZCV A;  3A4U B;  1NIW A;  2QDI A;  1HT9 A;  3PFV A;  4I5N B;  4JWQ A;  1DEK A;  2OS8 C;  3CTN A;  2COL B;  2KBI A;  2TN4 A;  1B1G A;  2WC5 A;  1J7P A;  4JQ0 D;  3LK1 A;  2JT3 A;  1IWQ A;  1AUI B;  1QS7 A;  2KAX A;  1KCY A;  2F33 A;  1OMR A;  2K2A A;  2KI4 B;  2PYQ A;  1SBJ A;  5TNC A;  2O60 A;  1JFK A;  3LL8 B;  4AQI A;  4CID A;  1IJ6 A;  2PRU A;  5HLV A;  1RTP 1;  4ETO A;  2QAC A;  3SS4 A;  3CAB A;  1G8I A;  1YX8 A;  2KQY A;  1QX5 B;  3GK4 X;  1DJG A;  3DF0 A;  1DJZ A;  1SY9 A;  2L4H A;  3FE6 A;  4INW A;  5DKQ A;  4CFR A;  4MEW A;  4F0Z B;  3B88 A;  1WRK A;  1OOJ A;  1K94 A;  2EHB A;  1EG4 A;  1PK0 D;  1PVA A;  3K21 A;  1XFX O;  2F3Z A;  1GJY A;  1SCV A;  2FOT A;  3DF0 B;  3GOF A;  4PE7 A;  1QX7 A;  4DCK A;  3BXK A;  1OE9 B;  1TCO B;  1UHI A;  3DVJ A;  4YGD B;  1NYA A;  1AHR A;  1P28 A;  2NCO A;  3O4X A;  4GBA A;  1KFU L;  1SL8 A;  3OX6 A; 
#chains in the Genus database with same CATH homology
 2OTG C;  2KI6 D;  3A8R A;  3CLN A;  1XFZ O;  2LVI A;  2M3W A;  4GGF A;  1CFD A;  4C0J A;  3D0Y A;  4QJ5 B;  1BLQ A;  5J3X A;  1TNQ A;  1UHJ A;  3PLF B;  1JF2 A;  3NSK A;  1AK8 A;  2WCF A;  2WCE A;  1FBV A;  3D0Y B;  2PSR A;  1EH2 A;  3ICB A;  3EK7 A;  3CR2 A;  4DS7 A;  4PE0 A;  2CTN A;  1K8U A;  2LVV A;  3SIB A;  1K9P A;  2KAV A;  5AER A;  2KFH A;  1IGV A;  1IJ5 A;  1DT7 B;  4OCI A;  2G2B A;  4YGA A;  4GFT A;  1DJI A;  2L0P A;  1A75 A;  3BOW B;  1JUO A;  1WDC C;  2BBM A;  4NQG A;  5HYD A;  1S6C A;  1GQM A;  1TOP A;  2JT8 A;  2QPT A;  2LVJ A;  2CXJ A;  3FWC A;  2KNE A;  2E6W A;  3I5H B;  4BY4 A;  1C7V A;  1ODB A;  3FS7 A;  3GK1 A;  5PAL A;  3SG6 A;  1KFX S;  2BCB A;  1NCZ A;  2M49 B;  4R1E A;  2IS9 A;  1F54 A;  1A4P A;  4P5O E;  2NXQ A;  3DVE A;  5HKZ A;  1SNL A;  1WRL A;  1ZFS A;  4GAO A;  1IQ5 A;  3PN7 C;  4NDB A;  1CFP A;  1AJ4 A;  2JPT A;  5CSN A;  1BMO A;  1PSR A;  4USL A;  1CLL A;  1M31 A;  1UP5 A;  1KQV A;  2CT9 A;  3VRO A;  3I5I C;  3WXA A;  1RJV A;  2EC6 C;  1F55 A;  1SL7 A;  3HCM A;  3M0W A;  2G9B A;  3SG4 A;  2ZFD A;  1Y1A A;  2MLE C;  1OZS A;  2LV7 A;  5BPJ A;  5FYX A;  3E3R A;  3DD4 A;  2NCP A;  2KOT A;  4YGC B;  3SG2 A;  1PSB A;  2GGM A;  1TNP A;  2I94 A;  2FJU B;  2RGI A;  2A4J A;  3WHU B;  1K2H A;  1B8R A;  1F4O A;  1YVL A;  2M97 A;  1TIZ A;  2I2R E;  5CSI A;  3IQO A;  3BUO B;  1R6P A;  1SL9 A;  2WOS A;  1B47 A;  4PE1 A;  4N5X A;  1OMV A;  4CLN A;  2BBN A;  3CZT X;  1CM4 A;  1NCX A;  2KYC A;  1K9K A;  1L2O C;  3CR5 X;  1M46 A;  4MZL A;  2JQ6 A;  1QX2 A;  2LMT A;  3I5F C;  2Y1N A;  3TDU A;  3ZWH A;  1B7T Z;  1ZUZ A;  4ORB B;  1CM1 A;  1XFV O;  1MXL C;  1TNX A;  1JF0 A;  1Y0V H;  4I5L B;  1ZMZ A;  3VRP A;  3O6B A;  1IQ3 A;  1XFU O;  1JBA A;  3EKJ A;  4OV2 A;  2Q91 A;  1A29 A;  3IF7 A;  4MRX A;  2KI4 C;  4OKH A;  4XJK A;  3EVV A;  1DJX A;  4WQ2 A;  4DUQ A;  1KSO A;  2MBX A;  1UWO A;  2HPS A;  4IL1 A;  4HSZ A;  1SR6 B;  3KF9 A;  3BQ3 A;  4XJK B;  2DOQ A;  2Y1M A;  1FPW A;  2JRF A;  1IG5 A;  1B7T Y;  4WQ3 A;  1SPY A;  2LUC A;  3EK4 A;  3O4Y A;  2KHN A;  2JXL A;  2KSP A;  2LHI A;  1K96 A;  1XVJ A;  2ZND A;  2Q4U A;  1GGZ A;  1PUL A;  1BR4 B;  1W7J B;  4MRY A;  4GNK B;  1BJF A;  1MQ1 A;  2LE9 B;  1PVB A;  2JU0 A;  2WC8 A;  2JNF A;  1CB1 A;  5DKN A;  2GGZ A;  1KWO B;  2LLT A;  1RFJ A;  4NDD A;  1G33 A;  1BF5 A;  2BEC A;  4GGF C;  1JC2 A;  3TUY B;  1S1E A;  3AKA A;  1ALV A;  2KGR A;  1WLZ A;  1NSH A;  4E68 A;  2KI6 C;  2NLN A;  1K95 A;  5B8I B;  1MXE A;  5KU1 A;  3JTD B;  3KHE A;  1YRT B;  5CSJ A;  1KFU S;  3NXA A;  4HRG A;  2JTZ A;  2OS8 B;  1KK8 B;  1DGU A;  2KBM A;  2MLF C;  1XA5 A;  2M7N A;  4I5J A;  1L7Z A;  5I2L A;  4DRW A;  1KK7 Z;  1KQM B;  1A2X A;  2AAO A;  1DTL A;  2M8U A;  1YVH A;  1CLM A;  3BOW A;  3I5H C;  4M2Q A;  1UHH A;  2M0R A;  2WND A;  1NPQ A;  2MRD A;  4HRE E;  2MAZ A;  1B8L A;  2LUX A;  3SIA A;  3BUN B;  2F3Y A;  1IRJ A;  3SG5 A;  2I18 A;  5D7F A;  1BOC A;  4YI9 A;  1UHN A;  1YUR A;  2ISD A;  1KK7 Y;  2JOJ A;  3LCP C;  1QJT A;  2K7D A;  2K7C A;  1NX2 A;  2JXC A;  3PM8 A;  3SJS A;  1Q80 A;  1FI6 A;  1CNP A;  1TTX A;  2LMU A;  4YBH B;  3WNX B;  1XFW O;  3VRR A;  1CMG A;  2HF5 A;  1H8B A;  2KDH A;  2K7B A;  3I5G B;  1B4C A;  3F45 A;  2CNP A;  2JUL A;  5K89 A;  2SAS A;  2JT0 A;  3EVR A;  2BL0 B;  1G4Y R;  1NUB A;  2CBL A;  1HQV A;  1BR1 B;  2LC5 A;  2PAS A;  1LXF C;  1DJY A;  5HKY A;  4AOM A;  4MVF A;  1F70 A;  2ZRS A;  1S3P A;  3JVT C;  3OX5 A;  1R2U A;  1K9U A;  1LKJ A;  2KQ6 A;  4MBE A;  3TDI A;  2JTT A;  2L4I A;  2D8N A;  4P2Y B;  4MSP A;  1NX1 A;  1DJW A;  3DVM A;  1NWD A;  4YI8 A;  2LP3 A;  1DMO A;  2HQW A;  1JWD A;  1TN4 A;  5HKW A;  1IH0 A;  1QXP A;  1CDL A;  1ALW A;  1SMG A;  4OR9 B;  1TRF A;  3OP0 A;  5AFP A;  1GGW A;  3CS1 A;  1KSM A;  3RLZ A;  3SG7 A;  1M39 A;  1NCY A;  2E30 A;  2SCP A;  3FIA A;  3PAL A;  4NDC A;  3FWB A;  4GGN A;  5KTY A;  4XYN A;  1LVC D;  1RK9 A;  2LP2 A;  2BKH B;  1S5G Z;  1IKU A;  2H2K A;  1UUS A;  2L98 A;  1N65 A;  1SR6 C;  2ZN8 A;  5JJG A;  1QAT A;  3H4S E;  4ZCU A;  2ZKM X;  1SYM A;  1DF0 B;  2JZI A;  5ER5 A;  1CTR A;  1MF8 B;  2JWW A;  2JC2 A;  2LNK A;  4QJ3 B;  3ZNI A;  3TS5 B;  1AP4 A;  1N2D A;  2O5G A;  1TNW A;  2ZRT A;  1QLK A;  4PHJ A;  2KGB C;  1MR8 A;  4GPL B;  2K0J A;  5HLO A;  1QVI Z;  4QJ4 B;  1S5G Y;  1QTX A;  1U5I B;  4Q04 A;  1C07 A;  2K61 A;  1J55 A;  1S6I A;  1WY9 A;  1V1G A;  1KWO C;  3LK0 A;  1EL4 A;  1QIW A;  1YX7 A;  1EXR A;  1BU3 A;  1CFF A;  3BYA A;  2Y5I A;  4ORA B;  3TUY C;  2L50 A;  2F2O A;  2K7O A;  1CKK A;  1OMD A;  2NZ0 A;  1V1F A;  1QVI Y;  1F71 A;  3WHT B;  2L51 A;  2M9G A;  1MWN A;  5AAN A;  3JTD C;  3SG3 A;  1J1E A;  3KEV A;  2PVB A;  1XK4 A;  5ER4 X;  3VRN A;  2LLS A;  1KK8 C;  4L9M A;  3AAJ A;  3LLE A;  5IBW A;  3OHM B;  1YR5 A;  2WCB A;  1BG1 A;  1PRW A;  1DJH A;  3EK8 A;  2MHH A;  1XFY O;  1KQM C;  3CGA A;  3TDZ A;  1AVS A;  1SW8 A;  2M1K B;  4MN0 A;  1ZOT B;  1LA3 A;  4GUK A;  1SCM B;  4TNC A;  3BUW B;  3GK2 A;  1H4B A;  5F6T A;  2AMI A;  4I5K A;  1LA0 A;  4PHM A;  2LM5 A;  2LLU A;  1M63 B;  1QV0 A;  4CFQ A;  1BOD A;  1TCF A;  5CPV A;  2BKI B;  1S26 D;  1OQP A;  4PDZ A;  1LIN A;  1F8H A;  3OB1 B;  1J1D A;  2WOR A;  1CFC A;  1C7W A;  4PE4 A;  3EVU A;  3PSR A;  3AAK A;  4M2O A;  1B8C A;  1YUT A;  5D69 A;  1J7R A;  4MZK A;  2LHL A;  2P6B B;  1UUR A;  1SRA A;  1NX3 A;  1K93 D;  3C1V A;  3I5G C;  2ZN9 A;  1Y1X A;  2JNX A;  4PAL A;  5G08 A;  1A03 A;  1JSA A;  2V53 A;  2I7A A;  2M29 A;  3DVK A;  3QRX A;  2BL0 C;  2OTG B;  1CMF A;  4JPZ B;  5I2Q A;  3BUM B;  1EJ3 A;  2PMY A;  4U8D A;  1X02 A;  1J7Q A;  3BUX B;  1A75 B;  1KFX L;  4M2P A;  3EKH A;  2L5X B;  1YUU A;  2M1U A;  4HRH A;  3KPX A;  2M7L A;  1REC A;  1N0Y A;  2KYF A;  1Y1U A;  1M45 A;  4WRI A;  4MZJ A;  1YUS A;  1OSA A;  4D1E A;  4YGB B;  2KFG A;  1B9A A;  1WDC B;  3NSI A;  1RWY A;  2MA2 A;  4C0L A;  1EG3 A;  1YTZ C;  1RRO A;  2LAN A;  3KO0 A;  2F8P A;  2H61 C;  3AKB A;  4ICB A;  3CR4 X;  2L2E A;  2K2F A;  1XO5 A;  2KAY A;  1FI5 A;  1DGV A;  1DVI A;  1QLS A;  1K90 D;  3D10 A;  4FQO A;  1XYD A;  2OPO A;  2KFF A;  4A4C A;  1J7O A;  1CDN A;  2H61 A;  4FTG A;  3IQQ A;  2FCE A;  1PAL A;  2EGD A;  4PHN A;  1FW4 A;  2LAP A;  3PN7 B;  1S36 A;  3TS5 C;  1ZAC A;  3VGO A;  2BCA A;  5I2O A;  4YRU A;  2PAL A;  2HQ8 A;  1Y6W A;  1DF0 A;  1CDM A;  2BE4 A;  3O78 A;  4CPV A;  1UHK A;  4YGE B;  3VRQ A;  1S6J A;  1E8A A;  2CCM A;  1QAS A;  3I5I B;  3NSO A;  2EC6 B;  1SK6 D;  2BE6 A;  4N1F A;  4UPG A;  2BCX A;  2Y4Q A;  4C0K A;  1F4Q A;  2K8M B;  1CLB A;  1SKT A;  1MUX A;  1VRK A;  2B1U A;  1QIV A;  1WRZ A;  3NSL A;  1W7I B;  4ORC B;  1YRU B;  1CDP A;  5KSZ A;  1AJ5 A;  3JVT B;  2LCP A;  1U5I A;  2VRG A;  5JOL A;  2ZNE A;  3PAT A;  1NX0 A;  2HET A;  4OVN F;  3RM1 A;  4AQJ A;  3TZ1 A;  5AEQ A;  2LVK A;  5CSF A;  2AUC A;  4A4B A;  1OZO A;  1WLM A;  2F2P A;  3CWG A;  4PHK A;  5I8N A;  1JFJ A;  4MLW A;  4PCW A;  2FCD A;  5AXI A;  4BY5 A;  3OB2 B;  1MHO A;  5DKR A;  3O2P A;  4DIR A;  1NP8 A;  1FF1 A;  5GQQ C;  3MSE B;  1XK4 C;  4N1G A;  2GV5 A;  1D1O A;  2R2I A;  1BT6 A;  1QV1 A;  1L2O B;  2MJW B;  1SCM C;  3I5F B;  2LMV A;  4ZCV A;  3A4U B;  1NIW A;  4I5N B;  1HT9 A;  3PFV A;  4JWQ A;  2OS8 C;  3CTN A;  2COL B;  2KBI A;  2TN4 A;  1B1G A;  1J7P A;  4JQ0 D;  3LK1 A;  2JT3 A;  1IWQ A;  1AUI B;  1QS7 A;  2KAX A;  1KCY A;  2F33 A;  1OMR A;  2K2A A;  2KI4 B;  1SBJ A;  5TNC A;  2O60 A;  1JFK A;  3LL8 B;  4AQI A;  4CID A;  1IJ6 A;  2PRU A;  5HLV A;  1RTP 1;  4ETO A;  2QAC A;  1G8I A;  1YX8 A;  2KQY A;  1QX5 B;  3GK4 X;  1DJG A;  3DF0 A;  1DJZ A;  1SY9 A;  2L4H A;  5DKQ A;  4F0Z B;  4CFR A;  4MEW A;  1WRK A;  1OOJ A;  1K94 A;  2EHB A;  1EG4 A;  1PK0 D;  1PVA A;  3K21 A;  1XFX O;  2F3Z A;  1GJY A;  1SCV A;  2FOT A;  3DF0 B;  3GOF A;  4PE7 A;  1QX7 A;  4DCK A;  3BXK A;  1OE9 B;  1TCO B;  1UHI A;  3DVJ A;  4YGD B;  1NYA A;  1AHR A;  2NCO A;  3HX4 A;  4GBA A;  1KFU L;  1SL8 A;  3OX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...