2MLFC

Nmr structure of the dilated cardiomyopathy mutation g159d in troponin c bound to the anchoring region of troponin i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKDVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00036 EF-hand_1 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mlfC00
2KI6C 5CSFA 4JPZB 1N0YA 5D7FA 2R2IA 2PRUA 2KFFA 1K9KA 1QLSA 2A4JA 3PALA 1BF5A 4ORCB 1K8UA 2BL0B 1DJWA 2LP3A 1Y1XA 5HKYA 2K7BA 1KQMC 4BY4A 1SPYA 1B8CA 2RGIA 1SW8A 2CNPA 4P2YB 4CFQA 2JC2A 2KYFA 3CR5X 4YRUA 1C7VA 1CMFA 4UPGA 1B8RA 1YR5A 2SASA 2F3ZA 1K95A 2KFHA 3BUWB 5DKRA 1R2UA 5ER4X 4AQJA 1Y1AA 1C07A 5G08A 4PE7A 1MQ1A 1IGVA 1N65A 1RECA 2JZIA 3O6BA 2LLUA 4OV2A 1GQMA 2FOTA 1QATA 4CIDA 4ORBB 3D10A 3FS7A 2K7OA 1K96A 2OTGC 2K0JA 2PVBA 1CDNA 3M0WA 2K8MB 1SKTA 3WHUB 1NP8A 1G8IA 2LHIA 2DOQA 3OB1B 4PE4A 1IJ6A 1J55A 2CXJA 2M7NA 1AVSA 1EL4A 1PSBA 1A75A 1KFXL 1NUBA 1QX7A 3JTDC 1Y0VH 3E3RA 2JNXA 3D0YA 3RLZA 2LUXA 1E8AA 1K94A 3CR2A 2MA2A 2K2FA 3QRXA 3JVTC 3EK4A 2KAXA 2K7CA 1J7RA 4NQGA 1CFCA 1KK8B 2F8PA 4YGCB 3CS1A 1WLZA 3TDIA 1IRJA 3ICBA 1NX2A 3I5GB 2CCMA 1BMOA 2AMIA 2BE6A 3EKJA 3H4SE 3SG7A 1IG5A 1U5IB 1XK4C 1S6JA 3HX4A 4I5NB 2EC6B 1JF0A 2KDHA 1Y1UA 4OVNF 1ZFSA 1UUSA 2KNEA 3DVKA 1K90D 1K2HA 2H2KA 2LANA 4OR9B 1FPWA 3CTNA 3A8RA 4I5JA 3TZ1A 2JXCA 3BXKA 4PHMA 4PE1A 1CM4A 1LVCD 1B1GA 1JBAA 1M45A 2L51A 1LXFC 5HYDA 2WCEA 2K2AA 2KBMA 2LV7A 4I5KA 3CZTX 4JQ0D 1AK8A 2K7DA 1F4OA 1DGUA 1AP4A 1IJ5A 2L4HA 1IQ5A 1UHJA 2G2BA 1KK7Y 1OMDA 2WCBA 1YRTB 3VRRA 1EG4A 2Q4UA 1EJ3A 2MLEC 2KFGA 3DD4A 3TDUA 1G33A 2KBIA 3KPXA 3O78A 4I5LB 3SG4A 1K93D 1KQMB 1XFZO 3NSLA 1SY9A 2LVJA 1BU3A 4NDCA 4N1FA 1DJZA 1BOCA 2KI4C 1NCXA 2LAPA 1SR6C 5HKZA 2Q91A 3KO0A 1C7WA 1XO5A 2KAYA 2L2EA 3C1VA 5K89A 5I2OA 4YGEB 3MSEB 1M39A 1S6IA 2LVKA 2G9BA 5B8IB 1B47A 2BKIB 1M63B 1YRUB 2Y1MA 1TN4A 1KSOA 2L0PA 3CWGA 2OTGB 3OX5A 3GK1A 3SG5A 1OZOA 2WOSA 3WNXB 1TNXA 2F3YA 1AJ4A 1R6PA 1XYDA 2KAVA 2I7AA 2ZFDA 1MUXA 4A4CA 1QIVA 2LNKA 2M29A 1NSHA 5GQQC 1ZMZA 3JTDB 1DGVA 3WHTB 1DJYA 1YUTA 4YI8A 2EHBA 3BUXB 3I5FC 1IWQA 4WQ2A 2F2PA 2NXQA 4GAOA 4YGDB 4AOMA 1IQ3A 1A4PA 1LKJA 1FI6A 1DJGA 5CPVA 2OS8C 2M9GA 3DVMA 3JVTB 3A4UB 4OCIA 1HQVA 1F4QA 2GGZA 3NSOA 4C0LA 2I18A 3LLEA 2KSPA 1H4BA 5AERA 1AUIB 2HQ8A 2ZRSA 2M1UA 2FJUB 4MZJA 1VRKA 1N2DA 1SMGA 5HKWA 5DKNA 2NZ0A 2PASA 4DCKA 5KSZA 2MLFC 3EVUA 2M1KB 1X02A 4C0JA 4PCWA 5AXIA 2LLSA 1OZSA 2F33A 2M97A 1KCYA 4ORAB 1PALA 1MXEA 3TDZA 2D8NA 3KEVA 1H8BA 1TCFA 2JNFA 2JULA 2ZKMX 1FF1A 1YUSA 1U5IA 2IS9A 5I2LA 4MLWA 3SIBA 3ZNIA 3O4YA 1FW4A 1MF8B 2F2OA 2PSRA 1QIWA 4CLNA 1CTRA 1QX5B 2WNDA 1OE9B 1F55A 4PE0A 1GGWA 3CR4X 5HLVA 1DJXA 1QLKA 4QJ4B 2L4IA 4GBAA 3OB2B 1JC2A 1UHIA 3DVEA 2LVIA 2CBLA 1AHRA 2O60A 1J7QA 1W7JB 1YX8A 4MN0A 1WLMA 1CDPA 4MVFA 4TNCA 1A2XA 1TNPA 5CSJA 3RM1A 3I5IC 1OMVA 1QASA 1JUOA 1GJYA 2QACA 1J1DA 3VRNA 2ISDA 1F8HA 3NXAA 4MRYA 1WRKA 2KGBC 1NPQA 2KI4B 2TN4A 1PULA 3NSKA 1SR6B 2OPOA 1QXPA 1A03A 1SYMA 1L2OC 1YURA 4D1EA 1LA3A 1BG1A 2KQ6A 2COLB 2HETA 2ZRTA 4YI9A 4NDBA 1XFXO 2ZN8A 3VGOA 4HSZA 1ZACA 2WC8A 3AAJA 1KFUL 1EH2A 1KFXS 1QX2A 1XFUO 1EXRA 3KHEA 1YVLA 4GGNA 3EK7A 4WRIA 1RFJA 4AQIA 2MBXA 4XYNA 1S1EA 2L50A 1B7TY 1LINA 1AJ5A 1OOJA 2H61C 1DJHA 2LUCA 1F71A 1PSRA 3SG2A 3I5FB 1IH0A 4NDDA 4E68A 4Q04A 1XFYO 2I94A 2LM5A 4R1EA 4HRGA 1UP5A 2Y5IA 2OS8B 1FI5A 1MHOA 1XVJA 1Q80A 4FTGA 2BBNA 1ZUZA 3GK2A 1PK0D 2Y1NA 4ZCUA 5CSNA 1XFVO 1V1FA 3GOFA 4L9MA 1MXLC 2LP2A 3PN7C 4DIRA 5KU1A 1WY9A 2BCBA 3CGAA 1KWOC 1CB1A 2M49B 1DJIA 3SG3A 5BPJA 1UWOA 2QPTA 3PLFB 5JOLA 5ER5A 2JRFA 4F0ZB 2CT9A 3BOWB 1B7TZ 3OP0A 1XFWO 1JSAA 2AAOA 3IQQA 2M3WA 1QTXA 1NCZA 1TIZA 1QJTA 3PATA 2WORA 1M46A 1XK4A 2M7LA 1MR8A 4N5XA 3DF0B 1SL7A 3TS5C 1KK7Z 1JWDA 2KHNA 2SCPA 4WQ3A 3VROA 3VRPA 4P5OE 1WRLA 1UHKA 1BLQA 1NCYA 3EVVA 4YGAA 2BCAA 1ALVA 3LK1A 1PVBA 1TNQA 4XJKB 4GUKA 3I5IB 1V1GA 1CFDA 4GPLB 4GGFC 3GK4X 1SCMC 2KYCA 2MAZA 2PALA 1BT6A 2JWWA 1HT9A 4M2OA 1CMGA 1SRAA 1CLLA 3WXAA 1L2OB 2ZN9A 1RK9A 2LMUA 4PDZA 2MHHA 2GV5A 3KF9A 1M31A 2HF5A 4MBEA 3I5HC 1RTP1 2GGMA 1LA0A 1UURA 1WRZA 1S36A 2JTTA 4YBHB 3BUMB 4M2PA 1YTZC 2JTZA 4GNKB 5AEQA 1SBJA 3CLNA 2JXLA 3VRQA 4U8DA 3LK0A 1MWNA 1FBVA 1S5GY 3TUYC 1J7PA 4YGBB 3K21A 2E6WA 3EK8A 2P6BB 1L7ZA 2LLTA 3IQOA 4DS7A 2LHLA 2KQYA 4BY5A 2LCPA 2L5XB 3PFVA 5I2QA 2HPSA 4QJ3B 2NCPA 1SL8A 3EVRA 1YX7A 1EG3A 5DKQA 1KSMA 2JQ6A 4IL1A 1OQPA 1Y6WA 3BUNB 1TTXA 4ZCVA 1B9AA 1CNPA 1CLBA 3AKBA 3PN7B 1WDCC 3PM8A 1W7IB 1S6CA 4MZKA 1KWOB 3FWBA 1BODA 3FWCA 1UHHA 1BR1B 2JT8A 1CM1A 1TRFA 3O2PA 5AANA 2LMTA 1CDMA 1B8LA 1NYAA 2KOTA 4GGFA 1K9UA 1S5GZ 1A29A 2JOJA 3HCMA 1OSAA 2LVVA 4M2QA 2KGRA 5IBWA 4HRHA 4USLA 4DRWA 4A4BA 3ZWHA 3TS5B 3OHMB 2BCXA 2HQWA 2BL0C 1F70A 4HREE 1RROA 1QS7A 4PHJA 1PRWA 2M0RA 1B4CA 2Y4QA 1PVAA 2MJWB 3BOWA 4GFTA 4PHKA 1NX3A 5J3XA 1F54A 1SNLA 1BJFA 2I2RE 2JT3A 1OMRA 3SJSA 1SK6D 4PHNA 2ZNEA 2LC5A 3F45A 2V53A 2B1UA 4MEWA 3DF0A 1J7OA 2BECA 1SL9A 3SIAA 5PALA 3FIAA 1A75B 1SCMB 1TCOB 3AAKA 1JFJA 3D0YB 1D1OA 2LE9B 2BKHB 1RWYA 2WCFA 5KTYA 2K61A 3LL8B 2KI6D 1DF0A 4PALA 4XJKA 1QV1A 1S3PA 4FQOA 4MSPA 1KFUS 2MRDA 1CFFA 1JF2A 2VRGA 3I5HB 1QVIY 3OX6A 1CLMA 1NWDA 5F6TA 1IKUA 4CFRA 1J1EA 3BUOB 1ZOTB 1KQVA 2E30A 3TUYB 4N1GA 2O5GA 3AKAA 2FCEA 1K9PA 5AFPA 2AUCA 1ODBA 1KK8C 4JWQA 4QJ5B 4C0KA 1YUUA 2EGDA 2NLNA 5I8NA 1NIWA 1TNWA 3I5GC 2LMVA 1DVIA 1DT7B 3DVJA 1TOPA 1DMOA 4DUQA 3LCPC 5HLOA 2BE4A 2NCOA 2EC6C 1CKKA 1DF0B 1JFKA 1GGZA 1NX0A 2CTNA 3SG6A 2JT0A 5D69A 2BBMA 1RJVA 2H61A 3BQ3A 4MRXA 2M8UA 1NX1A 4MZLA 3EKHA 2JU0A 3PSRA 1QVIZ 1WDCB 5TNCA 5FYXA 2JPTA 1UHNA 1G4YR 3IF7A 5CSIA 4CPVA 1ALWA 1DTLA 5JJGA 1CFPA 1QV0A 1SCVA 4OKHA 1BR4B 4ICBA 1YVHA 1S26D 2FCDA 1CDLA 2L98A 2PMYA 2ZNDA 3NSIA 1XA5A 4ETOA 3BYAA
chains in the Genus database with same CATH superfamily
2KI6C 5CSFA 4JPZB 3S0GA 1N0YA 5D7FA 2R2IA 2PRUA 2KFFA 1K9KA 1QLSA 2A4JA 3PALA 1BF5A 4ORCB 1K8UA 2BL0B 1DJWA 2LP3A 1Y1XA 5HKYA 2K7BA 1KQMC 3L4AA 4BY4A 1SPYA 1B8CA 2RGIA 1SW8A 2CNPA 4P2YB 4CFQA 2JC2A 2KYFA 3CR5X 4YRUA 1C7VA 1CMFA 4UPGA 1B8RA 1YR5A 2SASA 2F3ZA 1K95A 2KFHA 3BUWB 5DKRA 1R2UA 5ER4X 4AQJA 1Y1AA 1T14A 5G08A 1C07A 4PE7A 1MQ1A 1IGVA 1N65A 1DC1A 1RECA 2JZIA 3O6BA 5HL1A 2LLUA 1GM0A 4OV2A 1GQMA 2FOTA 1QATA 4CIDA 4ORBB 3D10A 3FS7A 2K7OA 1K96A 2OTGC 2K0JA 2PVBA 1CDNA 3M0WA 2K8MB 1SKTA 3WHUB 1NP8A 1G8IA 2LHIA 2DOQA 3OB1B 4PE4A 1IJ6A 1J55A 2CXJA 2M7NA 1AVSA 1EL4A 1PSBA 1A75A 1KFXL 1NUBA 1QX7A 3JTDC 1Y0VH 3E3RA 2JNXA 3D0YA 3RLZA 2LUXA 1E8AA 1K94A 2PQLA 3V2LA 3CR2A 2MA2A 3UNWA 2K2FA 3S0FA 2FJYA 3QRXA 5FI7A 3JVTC 3EK4A 2KAXA 2K7CA 1J7RA 3FE6A 4NQGA 1CFCA 3DYEA 1KK8B 2F8PA 2BNXA 4YGCB 3CS1A 1WLZA 3TDIA 1IRJA 3ICBA 1NX2A 3I5GB 2CCMA 2P71A 3DZTA 3EG5B 2H8VA 1BMOA 2AMIA 2BE6A 3EKJA 3H4SE 3SG7A 1IG5A 1U5IB 1XK4C 1S6JA 3B86A 3HX4A 4I5NB 2EC6B 5FI6A 3L47A 1JF0A 2KDHA 1Y1UA 4OVNF 1ZFSA 1UUSA 2KNEA 3DVKA 1K90D 1K2HA 2H2KA 2LANA 3N7HA 4OR9B 1FPWA 3CTNA 1TWOA 3A8RA 4I5JA 1C3ZA 3TZ1A 2JXCA 3BXKA 4PHMA 4PE1A 1CM4A 1LVCD 1B1GA 2WCKA 1JBAA 1M45A 2L51A 1LXFC 5HYDA 2WCEA 2K2AA 2KBMA 2LV7A 4I5KA 3CZTX 4JQ0D 1AK8A 2K7DA 2L2CA 1F4OA 1DGUA 1AP4A 1IJ5A 2L4HA 1IQ5A 1UHJA 1OW4A 3L4LA 2G2BA 1KK7Y 1OMDA 2WCBA 1YRTB 3VRRA 1EG4A 2Q4UA 1EJ3A 2MLEC 2KFGA 3DD4A 5D3OA 3TDUA 1G33A 2KBIA 3KPXA 3O78A 2GTEA 3R1PA 4I5LB 3SG4A 1K93D 1KQMB 1XFZO 2WCLA 3NSLA 1SY9A 2LVJA 1BU3A 3PM2A 4NDCA 4N1FA 1DJZA 1BOCA 3BJHA 1QWVA 2KI4C 1NCXA 2LAPA 1SR6C 5HKZA 3RZSA 1DQEA 2Q91A 3KO0A 1OOHA 1C7WA 1XO5A 2KAYA 2L2EA 3B7AA 3C1VA 4PT1A 5I2OA 5K89A 4YGEB 3MSEB 1M39A 1S6IA 2LVKA 2G9BA 5B8IB 1B47A 2BKIB 1M63B 1YRUB 1W9ZA 1TN4A 1KSOA 2L0PA 2Y1MA 2OTGB 3CWGA 3OX5A 3GK1A 3R1VA 3SG5A 1OZOA 2WOSA 3WNXB 1TNXA 2F3YA 1AJ4A 1R6PA 1XYDA 2KAVA 2I7AA 2ZFDA 1MUXA 4A4CA 1QIVA 2QEHA 2LNKA 3S0EA 3SJSA 2M29A 1NSHA 5GQQC 1ZMZA 3JTDB 1DGVA 3WHTB 1DJYA 2PYQA 1YUTA 4YI8A 4FQTA 2EHBA 3BUXB 3I5FC 1IWQA 4WQ2A 2F2PA 2NXQA 4GAOA 4YGDB 4AOMA 1IQ3A 1A4PA 1LKJA 1FI6A 1DJGA 3NHIA 5CPVA 2OS8C 2M9GA 3DVMA 3JVTB 3A4UB 4OCIA 1HQVA 3QMEA 1F4QA 2GGZA 3NSOA 4OZDA 4C0LA 2I18A 3LLEA 2KSPA 1H4BA 5AERA 1AUIB 2HQ8A 2ZRSA 2M1UA 2FJUB 4MZJA 1VRKA 1N2DA 1SMGA 5HKWA 5DKNA 3UO9A 2NZ0A 2PASA 4DCKA 5KSZA 2MLFC 3EVUA 2M1KB 1X02A 4C0JA 4PCWA 5AXIA 2WCMA 2LLSA 1OZSA 2F33A 2M97A 1KCYA 4ORAB 1PALA 1MXEA 3TDZA 2D8NA 3KEVA 1H8BA 1TCFA 2BAPA 2JNFA 2JULA 2ZKMX 1FF1A 1YUSA 1U5IA 2IS9A 5I2LA 4MLWA 3SIBA 1C3YA 2QDIA 3ZNIA 3O4YA 1FW4A 1MF8B 2F2OA 2PSRA 1QIWA 3FE9A 3R72A 4CLNA 1CTRA 1QX5B 2WNDA 1OE9B 1F55A 4PE0A 1GGWA 3CR4X 5HLVA 1DJXA 1QLKA 4QJ4B 2L4IA 4GBAA 3OB2B 1JC2A 1UHIA 3DVEA 2LVIA 2CBLA 1AHRA 2O60A 1J7QA 1W7JB 1YX8A 4MN0A 1WLMA 1CDPA 4MVFA 4TNCA 1A2XA 1TNPA 5CSJA 3RM1A 3CABA 3I5IC 1OMVA 1QASA 1JUOA 1GJYA 2QACA 1J1DA 3VRNA 2ISDA 1F8HA 3NXAA 4MRYA 1WRKA 2KGBC 4F7FA 1NPQA 2KI4B 2TN4A 1PULA 3NSKA 1SR6B 2JPOA 2OPOA 1QXPA 1A03A 1SYMA 3DXLA 1IIOA 1L2OC 1YURA 4D1EA 1LA3A 1BG1A 2KQ6A 3CZ2A 3D75A 2COLB 2HETA 2ZRTA 4YI9A 4NDBA 1XFXO 2ZN8A 3VGOA 4HSZA 1ZACA 2L5YA 2WC8A 3AAJA 1KFUL 1EH2A 1KFXS 1QX2A 1XFUO 1EXRA 3KHEA 1YVLA 4GGNA 3EK7A 4WRIA 1RFJA 4AQIA 2MBXA 4XYNA 1S1EA 2L50A 1B7TY 1LINA 1AJ5A 1OOJA 2H61C 3BFHA 1DJHA 2LUCA 1F71A 1PSRA 3SG2A 3I5FB 1IH0A 4NDDA 4E68A 4Q04A 1XFYO 2I94A 2LM5A 4R1EA 4HRGA 1UP5A 2Y5IA 2OS8B 1FI5A 1MHOA 1XVJA 1Q80A 4FTGA 3O4XA 2BBNA 1ZUZA 3GK2A 4JKTA 1SSEB 1PK0D 2Y1NA 4ZCUA 5CSNA 1XFVO 2WCHA 2KPHA 2KLDA 1V1FA 3FE8A 3GOFA 4L9MA 3S0AA 1MXLC 2KLEA 2LP2A 3PN7C 4DIRA 5KU1A 1WY9A 2BCBA 3CGAA 5I94A 1KWOC 1CB1A 2M49B 1XFRA 1DJIA 3SG3A 5BPJA 1UWOA 2QPTA 3PLFB 5JOLA 5ER5A 2JRFA 4F0ZB 2CT9A 3BOWB 1B7TZ 3OP0A 1XFWO 1JSAA 2AAOA 3IQQA 2M3WA 1QTXA 1NCZA 1TIZA 1QJTA 3PATA 2WORA 1M46A 1XK4A 2M7LA 1MR8A 4N5XA 3DF0B 1SL7A 3TS5C 1KK7Z 1JWDA 2K60A 2KHNA 2SCPA 4WQ3A 3VROA 3VRPA 4P5OE 1WRLA 1UHKA 1P28A 1Z4HA 1ORGA 1BLQA 5DICA 1NCYA 3EVVA 3DY9A 4YGAA 2BCAA 3BFBA 3VB1A 1ALVA 3LK1A 2YGUA 3B88A 1PVBA 1TNQA 4XJKB 3S0DA 3D76A 4GUKA 3I5IB 1V1GA 1CFDA 4GPLB 4GGFC 3GK4X 1SCMC 2KYCA 2MAZA 2PALA 1BT6A 3OGNA 3SS4A 2JWWA 1HT9A 4M2OA 1CMGA 1SRAA 1CLLA 3CYZA 3WXAA 1TUJA 1L2OB 2ZN9A 1RK9A 2LMUA 3R1OA 4PDZA 2MHHA 2ERBA 2GV5A 3KF9A 1M31A 2HF5A 4MBEA 3Q8IA 3I5HC 1RTP1 2GGMA 1LA0A 1UURA 1WRZA 1S36A 2JTTA 4YBHB 3BUMB 4M2PA 1YTZC 2JTZA 4GNKB 5AEQA 1SBJA 3CLNA 2JXLA 3VRQA 4U8DA 3LK0A 1MWNA 1FBVA 4INXA 1S5GY 3TUYC 1J7PA 4YGBB 3K21A 2E6WA 3EK8A 3D73A 2P6BB 1L7ZA 2LLTA 3IQOA 3OBVA 4DS7A 2LHLA 2KQYA 4BY5A 5FI2A 2LCPA 2L5XB 3PFVA 5I2QA 2HPSA 4QJ3B 2NCPA 1SL8A 3EVRA 1YX7A 1EG3A 5DKQA 3K1EA 1KSMA 2JQ6A 4IL1A 1OQPA 1Y6WA 3BUNB 1TTXA 4ZCVA 1B9AA 1CNPA 1CLBA 3AKBA 3PN7B 1WDCC 3PM8A 1W7IB 1S6CA 4MZKA 1KWOB 3FWBA 1BODA 3FWCA 1UHHA 1BR1B 2JT8A 1CM1A 1TRFA 2P70A 3O2PA 5AANA 2LMTA 3D78A 1CDMA 1B8LA 1NYAA 2KOTA 4GGFA 1K9UA 1S5GZ 3D77A 1A29A 2JOJA 3HCMA 1OSAA 2LVVA 2WCJA 1OOGA 2KGRA 4M2QA 5IBWA 4HRHA 4INWA 4USLA 4DRWA 4A4BA 3SS3A 3SS5A 4IJ7A 3ZWHA 3BFAA 3TS5B 1OOIX 3B87A 3OHMB 2BCXA 2HQWA 2BL0C 1F70A 4HREE 1RROA 1QS7A 4PHJA 1PRWA 2M0RA 1B4CA 2Y4QA 1PVAA 2MJWB 3BOWA 4GFTA 4PHKA 1NX3A 5J3XA 1F54A 1SNLA 1BJFA 2I2RE 2JT3A 1OMRA 2WC6A 1SK6D 5EL2A 4PHNA 2ZNEA 2QEOA 3NGVA 2LC5A 3F45A 2V53A 2B1UA 4KYNA 4MEWA 3DF0A 1TUZA 1J7OA 1SL9A 2BECA 3SIAA 5PALA 3B6XA 3FIAA 1A75B 1SCMB 1TCOB 3AAKA 1JFJA 3D0YB 2QEBA 1D1OA 2LE9B 1Z2CB 2BKHB 1RWYA 2WCFA 1DELA 5KTYA 1DEKA 2K61A 3LL8B 3S0BA 2KI6D 1DF0A 4PALA 4XJKA 1QV1A 1S3PA 4FQOA 4MSPA 1KFUS 2MRDA 1CFFA 1JF2A 2VRGA 3I5HB 1QVIY 3OX6A 1CLMA 1NWDA 2QEVA 5F6TA 1IKUA 4CFRA 1J1EA 3BUOB 1ZOTB 1LS8A 2E30A 1KQVA 2WC5A 3TUYB 4N1GA 2O5GA 3AKAA 2FCEA 1K9PA 5AFPA 2AUCA 1ODBA 1KK8C 1OOFA 4JD9A 4JWQA 4QJ5B 4C0KA 1YUUA 2EGDA 2NLNA 5I8NA 1NIWA 1TNWA 3I5GC 3NHTA 2LMVA 1DVIA 1DT7B 3PJIA 3DVJA 1TOPA 1DMOA 4DUQA 3LCPC 3D74A 2BE4A 2NCOA 5HLOA 2EC6C 1CKKA 1DF0B 1JFKA 1GGZA 1NX0A 2CTNA 3IVTA 3SG6A 2JT0A 5D69A 2BBMA 1RJVA 3CZ1A 2H61A 3BQ3A 4MRXA 2M8UA 3CDNA 1NX1A 4MZLA 3EKHA 2JU0A 3PSRA 1QVIZ 1WDCB 5TNCA 5FYXA 2JPTA 1UHNA 1G4YR 3IF7A 5CSIA 4CPVA 1ALWA 1DTLA 5JJGA 1CFPA 1QV0A 1SCVA 4OKHA 3CZ0A 1BR4B 4ICBA 1YVHA 1S26D 2FCDA 1CDLA 2L98A 2PMYA 2ZNDA 3NSIA 1XA5A 4ETOA 3BYAA
chains in the Genus database with same CATH topology
2KI6C 5CSFA 4JPZB 1N0YA 5D7FA 2R2IA 2PRUA 2KFFA 1K9KA 1QLSA 2A4JA 3PALA 1BF5A 4ORCB 1K8UA 2BL0B 1DJWA 2LP3A 1Y1XA 5HKYA 2K7BA 1KQMC 4BY4A 1SPYA 1B8CA 2RGIA 1SW8A 2CNPA 4P2YB 4CFQA 2JC2A 2KYFA 3CR5X 4YRUA 1C7VA 1CMFA 4UPGA 1B8RA 1YR5A 2SASA 2F3ZA 1K95A 2KFHA 3BUWB 5DKRA 1R2UA 5ER4X 4AQJA 1Y1AA 1C07A 5G08A 4PE7A 1MQ1A 1IGVA 1N65A 1RECA 2JZIA 3O6BA 2LLUA 4OV2A 1GQMA 2FOTA 1QATA 4CIDA 4ORBB 3D10A 3FS7A 2K7OA 1K96A 2OTGC 2K0JA 2PVBA 1CDNA 3M0WA 2K8MB 1SKTA 3WHUB 1NP8A 1G8IA 2LHIA 2DOQA 3OB1B 4PE4A 1IJ6A 1J55A 2CXJA 2M7NA 1AVSA 1EL4A 1PSBA 1A75A 1KFXL 1NUBA 1QX7A 3JTDC 1Y0VH 3E3RA 2JNXA 3D0YA 3RLZA 2LUXA 1E8AA 1K94A 3CR2A 2MA2A 2K2FA 3QRXA 3JVTC 3EK4A 2KAXA 2K7CA 1J7RA 4NQGA 1CFCA 1KK8B 2F8PA 4YGCB 3CS1A 1WLZA 3TDIA 1IRJA 3ICBA 1NX2A 3I5GB 2CCMA 1BMOA 2AMIA 2BE6A 3EKJA 3H4SE 3SG7A 1IG5A 1U5IB 1XK4C 1S6JA 3HX4A 4I5NB 2EC6B 1JF0A 2KDHA 1Y1UA 4OVNF 1ZFSA 1UUSA 2KNEA 3DVKA 1K90D 1K2HA 2H2KA 2LANA 4OR9B 1FPWA 3CTNA 3A8RA 4I5JA 3TZ1A 2JXCA 3BXKA 4PHMA 4PE1A 1CM4A 1LVCD 1B1GA 1JBAA 1M45A 2L51A 1LXFC 5HYDA 2WCEA 2K2AA 2KBMA 2LV7A 4I5KA 3CZTX 4JQ0D 1AK8A 2K7DA 1F4OA 1DGUA 1AP4A 1IJ5A 2L4HA 1IQ5A 1UHJA 2G2BA 1KK7Y 1OMDA 2WCBA 1YRTB 3VRRA 1EG4A 2Q4UA 1EJ3A 2MLEC 2KFGA 3DD4A 3TDUA 1G33A 2KBIA 3KPXA 3O78A 4I5LB 3SG4A 1K93D 1KQMB 1XFZO 3NSLA 1SY9A 2LVJA 1BU3A 4NDCA 4N1FA 1DJZA 1BOCA 2KI4C 1NCXA 2LAPA 1SR6C 5HKZA 2Q91A 3KO0A 1C7WA 1XO5A 2KAYA 2L2EA 3C1VA 5K89A 5I2OA 4YGEB 3MSEB 1M39A 1S6IA 2LVKA 2G9BA 5B8IB 1B47A 2BKIB 1M63B 1YRUB 2Y1MA 1TN4A 1KSOA 2L0PA 3CWGA 2OTGB 3OX5A 3GK1A 3SG5A 1OZOA 2WOSA 3WNXB 1TNXA 2F3YA 1AJ4A 1R6PA 1XYDA 2KAVA 2I7AA 2ZFDA 1MUXA 4A4CA 1QIVA 2LNKA 2M29A 1NSHA 5GQQC 1ZMZA 3JTDB 1DGVA 3WHTB 1DJYA 1YUTA 4YI8A 2EHBA 3BUXB 3I5FC 1IWQA 4WQ2A 2F2PA 2NXQA 4GAOA 4YGDB 4AOMA 1IQ3A 1A4PA 1LKJA 1FI6A 1DJGA 5CPVA 2OS8C 2M9GA 3DVMA 3JVTB 3A4UB 4OCIA 1HQVA 1F4QA 2GGZA 3NSOA 4C0LA 2I18A 3LLEA 2KSPA 1H4BA 5AERA 1AUIB 2HQ8A 2ZRSA 2M1UA 2FJUB 4MZJA 1VRKA 1N2DA 1SMGA 5HKWA 5DKNA 2NZ0A 2PASA 4DCKA 5KSZA 2MLFC 3EVUA 2M1KB 1X02A 4C0JA 4PCWA 5AXIA 2LLSA 1OZSA 2F33A 2M97A 1KCYA 4ORAB 1PALA 1MXEA 3TDZA 2D8NA 3KEVA 1H8BA 1TCFA 2JNFA 2JULA 2ZKMX 1FF1A 1YUSA 1U5IA 2IS9A 5I2LA 4MLWA 3SIBA 3ZNIA 3O4YA 1FW4A 1MF8B 2F2OA 2PSRA 1QIWA 4CLNA 1CTRA 1QX5B 2WNDA 1OE9B 1F55A 4PE0A 1GGWA 3CR4X 5HLVA 1DJXA 1QLKA 4QJ4B 2L4IA 4GBAA 3OB2B 1JC2A 1UHIA 3DVEA 2LVIA 2CBLA 1AHRA 2O60A 1J7QA 1W7JB 1YX8A 4MN0A 1WLMA 1CDPA 4MVFA 4TNCA 1A2XA 1TNPA 5CSJA 3RM1A 3I5IC 1OMVA 1QASA 1JUOA 1GJYA 2QACA 1J1DA 3VRNA 2ISDA 1F8HA 3NXAA 4MRYA 1WRKA 2KGBC 1NPQA 2KI4B 2TN4A 1PULA 3NSKA 1SR6B 2OPOA 1QXPA 1A03A 1SYMA 1L2OC 1YURA 4D1EA 1LA3A 1BG1A 2KQ6A 2COLB 2HETA 2ZRTA 4YI9A 4NDBA 1XFXO 2ZN8A 3VGOA 4HSZA 1ZACA 2WC8A 3AAJA 1KFUL 1EH2A 1KFXS 1QX2A 1XFUO 1EXRA 3KHEA 1YVLA 4GGNA 3EK7A 4WRIA 1RFJA 4AQIA 2MBXA 4XYNA 1S1EA 2L50A 1B7TY 1LINA 1AJ5A 1OOJA 2H61C 1DJHA 2LUCA 1F71A 1PSRA 3SG2A 3I5FB 1IH0A 4NDDA 4E68A 4Q04A 1XFYO 2I94A 2LM5A 4R1EA 4HRGA 1UP5A 2Y5IA 2OS8B 1FI5A 1MHOA 1XVJA 1Q80A 4FTGA 2BBNA 1ZUZA 3GK2A 1PK0D 2Y1NA 4ZCUA 5CSNA 1XFVO 1V1FA 3GOFA 4L9MA 1MXLC 2LP2A 3PN7C 4DIRA 5KU1A 1WY9A 2BCBA 3CGAA 1KWOC 1CB1A 2M49B 1DJIA 3SG3A 5BPJA 1UWOA 2QPTA 3PLFB 5JOLA 5ER5A 2JRFA 4F0ZB 2CT9A 3BOWB 1B7TZ 3OP0A 1XFWO 1JSAA 2AAOA 3IQQA 2M3WA 1QTXA 1NCZA 1TIZA 1QJTA 3PATA 2WORA 1M46A 1XK4A 2M7LA 1MR8A 4N5XA 3DF0B 1SL7A 3TS5C 1KK7Z 1JWDA 2KHNA 2SCPA 4WQ3A 3VROA 3VRPA 4P5OE 1WRLA 1UHKA 1BLQA 1NCYA 3EVVA 4YGAA 2BCAA 1ALVA 3LK1A 1PVBA 1TNQA 4XJKB 4GUKA 3I5IB 1V1GA 1CFDA 4GPLB 4GGFC 3GK4X 1SCMC 2KYCA 2MAZA 2PALA 1BT6A 2JWWA 1HT9A 4M2OA 1CMGA 1SRAA 1CLLA 3WXAA 1L2OB 2ZN9A 1RK9A 2LMUA 4PDZA 2MHHA 2GV5A 3KF9A 1M31A 2HF5A 4MBEA 3I5HC 1RTP1 2GGMA 1LA0A 1UURA 1WRZA 1S36A 2JTTA 4YBHB 3BUMB 4M2PA 1YTZC 2JTZA 4GNKB 5AEQA 1SBJA 3CLNA 2JXLA 3VRQA 4U8DA 3LK0A 1MWNA 1FBVA 1S5GY 3TUYC 1J7PA 4YGBB 3K21A 2E6WA 3EK8A 2P6BB 1L7ZA 2LLTA 3IQOA 4DS7A 2LHLA 2KQYA 4BY5A 2LCPA 2L5XB 3PFVA 5I2QA 2HPSA 4QJ3B 2NCPA 1SL8A 3EVRA 1YX7A 1EG3A 5DKQA 1KSMA 2JQ6A 4IL1A 1OQPA 1Y6WA 3BUNB 1TTXA 4ZCVA 1B9AA 1CNPA 1CLBA 3AKBA 3PN7B 1WDCC 3PM8A 1W7IB 1S6CA 4MZKA 1KWOB 3FWBA 1BODA 3FWCA 1UHHA 1BR1B 2JT8A 1CM1A 1TRFA 3O2PA 5AANA 2LMTA 1CDMA 1B8LA 1NYAA 2KOTA 4GGFA 1K9UA 1S5GZ 1A29A 2JOJA 3HCMA 1OSAA 2LVVA 4M2QA 2KGRA 5IBWA 4HRHA 4USLA 4DRWA 4A4BA 3ZWHA 3TS5B 3OHMB 2BCXA 2HQWA 2BL0C 1F70A 4HREE 1RROA 1QS7A 4PHJA 1PRWA 2M0RA 1B4CA 2Y4QA 1PVAA 2MJWB 3BOWA 4GFTA 4PHKA 1NX3A 5J3XA 1F54A 1SNLA 1BJFA 2I2RE 2JT3A 1OMRA 3SJSA 1SK6D 4PHNA 2ZNEA 2LC5A 3F45A 2V53A 2B1UA 4MEWA 3DF0A 1J7OA 2BECA 1SL9A 3SIAA 5PALA 3FIAA 1A75B 1SCMB 1TCOB 3AAKA 1JFJA 3D0YB 1D1OA 2LE9B 2BKHB 1RWYA 2WCFA 5KTYA 2K61A 3LL8B 2KI6D 1DF0A 4PALA 4XJKA 1QV1A 1S3PA 4FQOA 4MSPA 1KFUS 2MRDA 1CFFA 1JF2A 2VRGA 3I5HB 1QVIY 3OX6A 1CLMA 1NWDA 5F6TA 1IKUA 4CFRA 1J1EA 3BUOB 1ZOTB 1KQVA 2E30A 3TUYB 4N1GA 2O5GA 3AKAA 2FCEA 1K9PA 5AFPA 2AUCA 1ODBA 1KK8C 4JWQA 4QJ5B 4C0KA 1YUUA 2EGDA 2NLNA 5I8NA 1NIWA 1TNWA 3I5GC 2LMVA 1DVIA 1DT7B 3DVJA 1TOPA 1DMOA 4DUQA 3LCPC 5HLOA 2BE4A 2NCOA 2EC6C 1CKKA 1DF0B 1JFKA 1GGZA 1NX0A 2CTNA 3SG6A 2JT0A 5D69A 2BBMA 1RJVA 2H61A 3BQ3A 4MRXA 2M8UA 1NX1A 4MZLA 3EKHA 2JU0A 3PSRA 1QVIZ 1WDCB 5TNCA 5FYXA 2JPTA 1UHNA 1G4YR 3IF7A 5CSIA 4CPVA 1ALWA 1DTLA 5JJGA 1CFPA 1QV0A 1SCVA 4OKHA 1BR4B 4ICBA 1YVHA 1S26D 2FCDA 1CDLA 2L98A 2PMYA 2ZNDA 3NSIA 1XA5A 4ETOA 3BYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 C;  5CSF A;  4JPZ B;  1N0Y A;  5D7F A;  2R2I A;  2PRU A;  2KFF A;  1K9K A;  1QLS A;  2A4J A;  3PAL A;  1BF5 A;  4ORC B;  1K8U A;  2BL0 B;  1DJW A;  2LP3 A;  1Y1X A;  5HKY A;  2K7B A;  1KQM C;  4BY4 A;  1SPY A;  1B8C A;  2RGI A;  1SW8 A;  2CNP A;  4P2Y B;  4CFQ A;  2JC2 A;  2KYF A;  3CR5 X;  4YRU A;  1C7V A;  1CMF A;  4UPG A;  1B8R A;  1YR5 A;  2SAS A;  2F3Z A;  1K95 A;  2KFH A;  3BUW B;  5DKR A;  1R2U A;  5ER4 X;  4AQJ A;  1Y1A A;  1C07 A;  5G08 A;  4PE7 A;  1MQ1 A;  1IGV A;  1N65 A;  1REC A;  2JZI A;  3O6B A;  2LLU A;  4OV2 A;  1GQM A;  2FOT A;  1QAT A;  4CID A;  4ORB B;  3D10 A;  3FS7 A;  2K7O A;  1K96 A;  2OTG C;  2K0J A;  2PVB A;  1CDN A;  3M0W A;  2K8M B;  1SKT A;  3WHU B;  1NP8 A;  1G8I A;  2LHI A;  2DOQ A;  3OB1 B;  4PE4 A;  1IJ6 A;  1J55 A;  2CXJ A;  2M7N A;  1AVS A;  1EL4 A;  1PSB A;  1A75 A;  1KFX L;  1NUB A;  1QX7 A;  3JTD C;  1Y0V H;  3E3R A;  2JNX A;  3D0Y A;  3RLZ A;  2LUX A;  1E8A A;  1K94 A;  3CR2 A;  2MA2 A;  2K2F A;  3QRX A;  3JVT C;  3EK4 A;  2KAX A;  2K7C A;  1J7R A;  4NQG A;  1CFC A;  1KK8 B;  2F8P A;  4YGC B;  3CS1 A;  1WLZ A;  3TDI A;  1IRJ A;  3ICB A;  1NX2 A;  3I5G B;  2CCM A;  1BMO A;  2AMI A;  2BE6 A;  3EKJ A;  3H4S E;  3SG7 A;  1IG5 A;  1U5I B;  1XK4 C;  1S6J A;  3HX4 A;  4I5N B;  2EC6 B;  1JF0 A;  2KDH A;  1Y1U A;  4OVN F;  1ZFS A;  1UUS A;  2KNE A;  3DVK A;  1K90 D;  1K2H A;  2H2K A;  2LAN A;  4OR9 B;  1FPW A;  3CTN A;  3A8R A;  4I5J A;  3TZ1 A;  2JXC A;  3BXK A;  4PHM A;  4PE1 A;  1CM4 A;  1LVC D;  1B1G A;  1JBA A;  1M45 A;  2L51 A;  1LXF C;  5HYD A;  2WCE A;  2K2A A;  2KBM A;  2LV7 A;  4I5K A;  3CZT X;  4JQ0 D;  1AK8 A;  2K7D A;  1F4O A;  1DGU A;  1AP4 A;  1IJ5 A;  2L4H A;  1IQ5 A;  1UHJ A;  2G2B A;  1KK7 Y;  1OMD A;  2WCB A;  1YRT B;  3VRR A;  1EG4 A;  2Q4U A;  1EJ3 A;  2MLE C;  2KFG A;  3DD4 A;  3TDU A;  1G33 A;  2KBI A;  3KPX A;  3O78 A;  4I5L B;  3SG4 A;  1K93 D;  1KQM B;  1XFZ O;  3NSL A;  1SY9 A;  2LVJ A;  1BU3 A;  4NDC A;  4N1F A;  1DJZ A;  1BOC A;  2KI4 C;  1NCX A;  2LAP A;  1SR6 C;  5HKZ A;  2Q91 A;  3KO0 A;  1C7W A;  1XO5 A;  2KAY A;  2L2E A;  3C1V A;  5K89 A;  5I2O A;  4YGE B;  3MSE B;  1M39 A;  1S6I A;  2LVK A;  2G9B A;  5B8I B;  1B47 A;  2BKI B;  1M63 B;  1YRU B;  2Y1M A;  1TN4 A;  1KSO A;  2L0P A;  3CWG A;  2OTG B;  3OX5 A;  3GK1 A;  3SG5 A;  1OZO A;  2WOS A;  3WNX B;  1TNX A;  2F3Y A;  1AJ4 A;  1R6P A;  1XYD A;  2KAV A;  2I7A A;  2ZFD A;  1MUX A;  4A4C A;  1QIV A;  2LNK A;  2M29 A;  1NSH A;  5GQQ C;  1ZMZ A;  3JTD B;  1DGV A;  3WHT B;  1DJY A;  1YUT A;  4YI8 A;  2EHB A;  3BUX B;  3I5F C;  1IWQ A;  4WQ2 A;  2F2P A;  2NXQ A;  4GAO A;  4YGD B;  4AOM A;  1IQ3 A;  1A4P A;  1LKJ A;  1FI6 A;  1DJG A;  5CPV A;  2OS8 C;  2M9G A;  3DVM A;  3JVT B;  3A4U B;  4OCI A;  1HQV A;  1F4Q A;  2GGZ A;  3NSO A;  4C0L A;  2I18 A;  3LLE A;  2KSP A;  1H4B A;  5AER A;  1AUI B;  2HQ8 A;  2ZRS A;  2M1U A;  2FJU B;  4MZJ A;  1VRK A;  1N2D A;  1SMG A;  5HKW A;  5DKN A;  2NZ0 A;  2PAS A;  4DCK A;  5KSZ A;  2MLF C;  3EVU A;  2M1K B;  1X02 A;  4C0J A;  4PCW A;  5AXI A;  2LLS A;  1OZS A;  2F33 A;  2M97 A;  1KCY A;  4ORA B;  1PAL A;  1MXE A;  3TDZ A;  2D8N A;  3KEV A;  1H8B A;  1TCF A;  2JNF A;  2JUL A;  2ZKM X;  1FF1 A;  1YUS A;  1U5I A;  2IS9 A;  5I2L A;  4MLW A;  3SIB A;  3ZNI A;  3O4Y A;  1FW4 A;  1MF8 B;  2F2O A;  2PSR A;  1QIW A;  4CLN A;  1CTR A;  1QX5 B;  2WND A;  1OE9 B;  1F55 A;  4PE0 A;  1GGW A;  3CR4 X;  5HLV A;  1DJX A;  1QLK A;  4QJ4 B;  2L4I A;  4GBA A;  3OB2 B;  1JC2 A;  1UHI A;  3DVE A;  2LVI A;  2CBL A;  1AHR A;  2O60 A;  1J7Q A;  1W7J B;  1YX8 A;  4MN0 A;  1WLM A;  1CDP A;  4MVF A;  4TNC A;  1A2X A;  1TNP A;  5CSJ A;  3RM1 A;  3I5I C;  1OMV A;  1QAS A;  1JUO A;  1GJY A;  2QAC A;  1J1D A;  3VRN A;  2ISD A;  1F8H A;  3NXA A;  4MRY A;  1WRK A;  2KGB C;  1NPQ A;  2KI4 B;  2TN4 A;  1PUL A;  3NSK A;  1SR6 B;  2OPO A;  1QXP A;  1A03 A;  1SYM A;  1L2O C;  1YUR A;  4D1E A;  1LA3 A;  1BG1 A;  2KQ6 A;  2COL B;  2HET A;  2ZRT A;  4YI9 A;  4NDB A;  1XFX O;  2ZN8 A;  3VGO A;  4HSZ A;  1ZAC A;  2WC8 A;  3AAJ A;  1KFU L;  1EH2 A;  1KFX S;  1QX2 A;  1XFU O;  1EXR A;  3KHE A;  1YVL A;  4GGN A;  3EK7 A;  4WRI A;  1RFJ A;  4AQI A;  2MBX A;  4XYN A;  1S1E A;  2L50 A;  1B7T Y;  1LIN A;  1AJ5 A;  1OOJ A;  2H61 C;  1DJH A;  2LUC A;  1F71 A;  1PSR A;  3SG2 A;  3I5F B;  1IH0 A;  4NDD A;  4E68 A;  4Q04 A;  1XFY O;  2I94 A;  2LM5 A;  4R1E A;  4HRG A;  1UP5 A;  2Y5I A;  2OS8 B;  1FI5 A;  1MHO A;  1XVJ A;  1Q80 A;  4FTG A;  2BBN A;  1ZUZ A;  3GK2 A;  1PK0 D;  2Y1N A;  4ZCU A;  5CSN A;  1XFV O;  1V1F A;  3GOF A;  4L9M A;  1MXL C;  2LP2 A;  3PN7 C;  4DIR A;  5KU1 A;  1WY9 A;  2BCB A;  3CGA A;  1KWO C;  1CB1 A;  2M49 B;  1DJI A;  3SG3 A;  5BPJ A;  1UWO A;  2QPT A;  3PLF B;  5JOL A;  5ER5 A;  2JRF A;  4F0Z B;  2CT9 A;  3BOW B;  1B7T Z;  3OP0 A;  1XFW O;  1JSA A;  2AAO A;  3IQQ A;  2M3W A;  1QTX A;  1NCZ A;  1TIZ A;  1QJT A;  3PAT A;  2WOR A;  1M46 A;  1XK4 A;  2M7L A;  1MR8 A;  4N5X A;  3DF0 B;  1SL7 A;  3TS5 C;  1KK7 Z;  1JWD A;  2KHN A;  2SCP A;  4WQ3 A;  3VRO A;  3VRP A;  4P5O E;  1WRL A;  1UHK A;  1BLQ A;  1NCY A;  3EVV A;  4YGA A;  2BCA A;  1ALV A;  3LK1 A;  1PVB A;  1TNQ A;  4XJK B;  4GUK A;  3I5I B;  1V1G A;  1CFD A;  4GPL B;  4GGF C;  3GK4 X;  1SCM C;  2KYC A;  2MAZ A;  2PAL A;  1BT6 A;  2JWW A;  1HT9 A;  4M2O A;  1CMG A;  1SRA A;  1CLL A;  3WXA A;  1L2O B;  2ZN9 A;  1RK9 A;  2LMU A;  4PDZ A;  2MHH A;  2GV5 A;  3KF9 A;  1M31 A;  2HF5 A;  4MBE A;  3I5H C;  1RTP 1;  2GGM A;  1LA0 A;  1UUR A;  1WRZ A;  1S36 A;  2JTT A;  4YBH B;  3BUM B;  4M2P A;  1YTZ C;  2JTZ A;  4GNK B;  5AEQ A;  1SBJ A;  3CLN A;  2JXL A;  3VRQ A;  4U8D A;  3LK0 A;  1MWN A;  1FBV A;  1S5G Y;  3TUY C;  1J7P A;  4YGB B;  3K21 A;  2E6W A;  3EK8 A;  2P6B B;  1L7Z A;  2LLT A;  3IQO A;  4DS7 A;  2LHL A;  2KQY A;  4BY5 A;  2LCP A;  2L5X B;  3PFV A;  5I2Q A;  2HPS A;  4QJ3 B;  2NCP A;  1SL8 A;  3EVR A;  1YX7 A;  1EG3 A;  5DKQ A;  1KSM A;  2JQ6 A;  4IL1 A;  1OQP A;  1Y6W A;  3BUN B;  1TTX A;  4ZCV A;  1B9A A;  1CNP A;  1CLB A;  3AKB A;  3PN7 B;  1WDC C;  3PM8 A;  1W7I B;  1S6C A;  4MZK A;  1KWO B;  3FWB A;  1BOD A;  3FWC A;  1UHH A;  1BR1 B;  2JT8 A;  1CM1 A;  1TRF A;  3O2P A;  5AAN A;  2LMT A;  1CDM A;  1B8L A;  1NYA A;  2KOT A;  4GGF A;  1K9U A;  1S5G Z;  1A29 A;  2JOJ A;  3HCM A;  1OSA A;  2LVV A;  4M2Q A;  2KGR A;  5IBW A;  4HRH A;  4USL A;  4DRW A;  4A4B A;  3ZWH A;  3TS5 B;  3OHM B;  2BCX A;  2HQW A;  2BL0 C;  1F70 A;  4HRE E;  1RRO A;  1QS7 A;  4PHJ A;  1PRW A;  2M0R A;  1B4C A;  2Y4Q A;  1PVA A;  2MJW B;  3BOW A;  4GFT A;  4PHK A;  1NX3 A;  5J3X A;  1F54 A;  1SNL A;  1BJF A;  2I2R E;  2JT3 A;  1OMR A;  3SJS A;  1SK6 D;  4PHN A;  2ZNE A;  2LC5 A;  3F45 A;  2V53 A;  2B1U A;  4MEW A;  3DF0 A;  1J7O A;  2BEC A;  1SL9 A;  3SIA A;  5PAL A;  3FIA A;  1A75 B;  1SCM B;  1TCO B;  3AAK A;  1JFJ A;  3D0Y B;  1D1O A;  2LE9 B;  2BKH B;  1RWY A;  2WCF A;  5KTY A;  2K61 A;  3LL8 B;  2KI6 D;  1DF0 A;  4PAL A;  4XJK A;  1QV1 A;  1S3P A;  4FQO A;  4MSP A;  1KFU S;  2MRD A;  1CFF A;  1JF2 A;  2VRG A;  3I5H B;  1QVI Y;  3OX6 A;  1CLM A;  1NWD A;  5F6T A;  1IKU A;  4CFR A;  1J1E A;  3BUO B;  1ZOT B;  1KQV A;  2E30 A;  3TUY B;  4N1G A;  2O5G A;  3AKA A;  2FCE A;  1K9P A;  5AFP A;  2AUC A;  1ODB A;  1KK8 C;  4JWQ A;  4QJ5 B;  4C0K A;  1YUU A;  2EGD A;  2NLN A;  5I8N A;  1NIW A;  1TNW A;  3I5G C;  2LMV A;  1DVI A;  1DT7 B;  3DVJ A;  1TOP A;  1DMO A;  4DUQ A;  3LCP C;  5HLO A;  2BE4 A;  2NCO A;  2EC6 C;  1CKK A;  1DF0 B;  1JFK A;  1GGZ A;  1NX0 A;  2CTN A;  3SG6 A;  2JT0 A;  5D69 A;  2BBM A;  1RJV A;  2H61 A;  3BQ3 A;  4MRX A;  2M8U A;  1NX1 A;  4MZL A;  3EKH A;  2JU0 A;  3PSR A;  1QVI Z;  1WDC B;  5TNC A;  5FYX A;  2JPT A;  1UHN A;  1G4Y R;  3IF7 A;  5CSI A;  4CPV A;  1ALW A;  1DTL A;  5JJG A;  1CFP A;  1QV0 A;  1SCV A;  4OKH A;  1BR4 B;  4ICB A;  1YVH A;  1S26 D;  2FCD A;  1CDL A;  2L98 A;  2PMY A;  2ZND A;  3NSI A;  1XA5 A;  4ETO A;  3BYA A; 
#chains in the Genus database with same CATH topology
 2KI6 C;  5CSF A;  4JPZ B;  3S0G A;  1N0Y A;  5D7F A;  2R2I A;  2PRU A;  2KFF A;  1K9K A;  1QLS A;  2A4J A;  3PAL A;  1BF5 A;  4ORC B;  1K8U A;  2BL0 B;  1DJW A;  2LP3 A;  1Y1X A;  5HKY A;  2K7B A;  1KQM C;  3L4A A;  4BY4 A;  1SPY A;  1B8C A;  2RGI A;  1SW8 A;  2CNP A;  4P2Y B;  4CFQ A;  2JC2 A;  2KYF A;  3CR5 X;  4YRU A;  1C7V A;  1CMF A;  4UPG A;  1B8R A;  1YR5 A;  2SAS A;  2F3Z A;  1K95 A;  2KFH A;  3BUW B;  5DKR A;  1R2U A;  5ER4 X;  4AQJ A;  1Y1A A;  1T14 A;  5G08 A;  1C07 A;  4PE7 A;  1MQ1 A;  1IGV A;  1N65 A;  1DC1 A;  1REC A;  2JZI A;  3O6B A;  5HL1 A;  2LLU A;  1GM0 A;  4OV2 A;  1GQM A;  2FOT A;  1QAT A;  4CID A;  4ORB B;  3D10 A;  3FS7 A;  2K7O A;  1K96 A;  2OTG C;  2K0J A;  2PVB A;  1CDN A;  3M0W A;  2K8M B;  1SKT A;  3WHU B;  1NP8 A;  1G8I A;  2LHI A;  2DOQ A;  3OB1 B;  4PE4 A;  1IJ6 A;  1J55 A;  2CXJ A;  2M7N A;  1AVS A;  1EL4 A;  1PSB A;  1A75 A;  1KFX L;  1NUB A;  1QX7 A;  3JTD C;  1Y0V H;  3E3R A;  2JNX A;  3D0Y A;  3RLZ A;  2LUX A;  1E8A A;  1K94 A;  2PQL A;  3V2L A;  3CR2 A;  2MA2 A;  3UNW A;  2K2F A;  3S0F A;  2FJY A;  3QRX A;  5FI7 A;  3JVT C;  3EK4 A;  2KAX A;  2K7C A;  1J7R A;  3FE6 A;  4NQG A;  1CFC A;  3DYE A;  1KK8 B;  2F8P A;  2BNX A;  4YGC B;  3CS1 A;  1WLZ A;  3TDI A;  1IRJ A;  3ICB A;  1NX2 A;  3I5G B;  2CCM A;  2P71 A;  3DZT A;  3EG5 B;  2H8V A;  1BMO A;  2AMI A;  2BE6 A;  3EKJ A;  3H4S E;  3SG7 A;  1IG5 A;  1U5I B;  1XK4 C;  1S6J A;  3B86 A;  3HX4 A;  4I5N B;  2EC6 B;  5FI6 A;  3L47 A;  1JF0 A;  2KDH A;  1Y1U A;  4OVN F;  1ZFS A;  1UUS A;  2KNE A;  3DVK A;  1K90 D;  1K2H A;  2H2K A;  2LAN A;  3N7H A;  4OR9 B;  1FPW A;  3CTN A;  1TWO A;  3A8R A;  4I5J A;  1C3Z A;  3TZ1 A;  2JXC A;  3BXK A;  4PHM A;  4PE1 A;  1CM4 A;  1LVC D;  1B1G A;  2WCK A;  1JBA A;  1M45 A;  2L51 A;  1LXF C;  5HYD A;  2WCE A;  2K2A A;  2KBM A;  2LV7 A;  4I5K A;  3CZT X;  4JQ0 D;  1AK8 A;  2K7D A;  2L2C A;  1F4O A;  1DGU A;  1AP4 A;  1IJ5 A;  2L4H A;  1IQ5 A;  1UHJ A;  1OW4 A;  3L4L A;  2G2B A;  1KK7 Y;  1OMD A;  2WCB A;  1YRT B;  3VRR A;  1EG4 A;  2Q4U A;  1EJ3 A;  2MLE C;  2KFG A;  3DD4 A;  5D3O A;  3TDU A;  1G33 A;  2KBI A;  3KPX A;  3O78 A;  2GTE A;  3R1P A;  4I5L B;  3SG4 A;  1K93 D;  1KQM B;  1XFZ O;  2WCL A;  3NSL A;  1SY9 A;  2LVJ A;  1BU3 A;  3PM2 A;  4NDC A;  4N1F A;  1DJZ A;  1BOC A;  3BJH A;  1QWV A;  2KI4 C;  1NCX A;  2LAP A;  1SR6 C;  5HKZ A;  3RZS A;  1DQE A;  2Q91 A;  3KO0 A;  1OOH A;  1C7W A;  1XO5 A;  2KAY A;  2L2E A;  3B7A A;  3C1V A;  4PT1 A;  5I2O A;  5K89 A;  4YGE B;  3MSE B;  1M39 A;  1S6I A;  2LVK A;  2G9B A;  5B8I B;  1B47 A;  2BKI B;  1M63 B;  1YRU B;  1W9Z A;  1TN4 A;  1KSO A;  2L0P A;  2Y1M A;  2OTG B;  3CWG A;  3OX5 A;  3GK1 A;  3R1V A;  3SG5 A;  1OZO A;  2WOS A;  3WNX B;  1TNX A;  2F3Y A;  1AJ4 A;  1R6P A;  1XYD A;  2KAV A;  2I7A A;  2ZFD A;  1MUX A;  4A4C A;  1QIV A;  2QEH A;  2LNK A;  3S0E A;  3SJS A;  2M29 A;  1NSH A;  5GQQ C;  1ZMZ A;  3JTD B;  1DGV A;  3WHT B;  1DJY A;  2PYQ A;  1YUT A;  4YI8 A;  4FQT A;  2EHB A;  3BUX B;  3I5F C;  1IWQ A;  4WQ2 A;  2F2P A;  2NXQ A;  4GAO A;  4YGD B;  4AOM A;  1IQ3 A;  1A4P A;  1LKJ A;  1FI6 A;  1DJG A;  3NHI A;  5CPV A;  2OS8 C;  2M9G A;  3DVM A;  3JVT B;  3A4U B;  4OCI A;  1HQV A;  3QME A;  1F4Q A;  2GGZ A;  3NSO A;  4OZD A;  4C0L A;  2I18 A;  3LLE A;  2KSP A;  1H4B A;  5AER A;  1AUI B;  2HQ8 A;  2ZRS A;  2M1U A;  2FJU B;  4MZJ A;  1VRK A;  1N2D A;  1SMG A;  5HKW A;  5DKN A;  3UO9 A;  2NZ0 A;  2PAS A;  4DCK A;  5KSZ A;  2MLF C;  3EVU A;  2M1K B;  1X02 A;  4C0J A;  4PCW A;  5AXI A;  2WCM A;  2LLS A;  1OZS A;  2F33 A;  2M97 A;  1KCY A;  4ORA B;  1PAL A;  1MXE A;  3TDZ A;  2D8N A;  3KEV A;  1H8B A;  1TCF A;  2BAP A;  2JNF A;  2JUL A;  2ZKM X;  1FF1 A;  1YUS A;  1U5I A;  2IS9 A;  5I2L A;  4MLW A;  3SIB A;  1C3Y A;  2QDI A;  3ZNI A;  3O4Y A;  1FW4 A;  1MF8 B;  2F2O A;  2PSR A;  1QIW A;  3FE9 A;  3R72 A;  4CLN A;  1CTR A;  1QX5 B;  2WND A;  1OE9 B;  1F55 A;  4PE0 A;  1GGW A;  3CR4 X;  5HLV A;  1DJX A;  1QLK A;  4QJ4 B;  2L4I A;  4GBA A;  3OB2 B;  1JC2 A;  1UHI A;  3DVE A;  2LVI A;  2CBL A;  1AHR A;  2O60 A;  1J7Q A;  1W7J B;  1YX8 A;  4MN0 A;  1WLM A;  1CDP A;  4MVF A;  4TNC A;  1A2X A;  1TNP A;  5CSJ A;  3RM1 A;  3CAB A;  3I5I C;  1OMV A;  1QAS A;  1JUO A;  1GJY A;  2QAC A;  1J1D A;  3VRN A;  2ISD A;  1F8H A;  3NXA A;  4MRY A;  1WRK A;  2KGB C;  4F7F A;  1NPQ A;  2KI4 B;  2TN4 A;  1PUL A;  3NSK A;  1SR6 B;  2JPO A;  2OPO A;  1QXP A;  1A03 A;  1SYM A;  3DXL A;  1IIO A;  1L2O C;  1YUR A;  4D1E A;  1LA3 A;  1BG1 A;  2KQ6 A;  3CZ2 A;  3D75 A;  2COL B;  2HET A;  2ZRT A;  4YI9 A;  4NDB A;  1XFX O;  2ZN8 A;  3VGO A;  4HSZ A;  1ZAC A;  2L5Y A;  2WC8 A;  3AAJ A;  1KFU L;  1EH2 A;  1KFX S;  1QX2 A;  1XFU O;  1EXR A;  3KHE A;  1YVL A;  4GGN A;  3EK7 A;  4WRI A;  1RFJ A;  4AQI A;  2MBX A;  4XYN A;  1S1E A;  2L50 A;  1B7T Y;  1LIN A;  1AJ5 A;  1OOJ A;  2H61 C;  3BFH A;  1DJH A;  2LUC A;  1F71 A;  1PSR A;  3SG2 A;  3I5F B;  1IH0 A;  4NDD A;  4E68 A;  4Q04 A;  1XFY O;  2I94 A;  2LM5 A;  4R1E A;  4HRG A;  1UP5 A;  2Y5I A;  2OS8 B;  1FI5 A;  1MHO A;  1XVJ A;  1Q80 A;  4FTG A;  3O4X A;  2BBN A;  1ZUZ A;  3GK2 A;  4JKT A;  1SSE B;  1PK0 D;  2Y1N A;  4ZCU A;  5CSN A;  1XFV O;  2WCH A;  2KPH A;  2KLD A;  1V1F A;  3FE8 A;  3GOF A;  4L9M A;  3S0A A;  1MXL C;  2KLE A;  2LP2 A;  3PN7 C;  4DIR A;  5KU1 A;  1WY9 A;  2BCB A;  3CGA A;  5I94 A;  1KWO C;  1CB1 A;  2M49 B;  1XFR A;  1DJI A;  3SG3 A;  5BPJ A;  1UWO A;  2QPT A;  3PLF B;  5JOL A;  5ER5 A;  2JRF A;  4F0Z B;  2CT9 A;  3BOW B;  1B7T Z;  3OP0 A;  1XFW O;  1JSA A;  2AAO A;  3IQQ A;  2M3W A;  1QTX A;  1NCZ A;  1TIZ A;  1QJT A;  3PAT A;  2WOR A;  1M46 A;  1XK4 A;  2M7L A;  1MR8 A;  4N5X A;  3DF0 B;  1SL7 A;  3TS5 C;  1KK7 Z;  1JWD A;  2K60 A;  2KHN A;  2SCP A;  4WQ3 A;  3VRO A;  3VRP A;  4P5O E;  1WRL A;  1UHK A;  1P28 A;  1Z4H A;  1ORG A;  1BLQ A;  5DIC A;  1NCY A;  3EVV A;  3DY9 A;  4YGA A;  2BCA A;  3BFB A;  3VB1 A;  1ALV A;  3LK1 A;  2YGU A;  3B88 A;  1PVB A;  1TNQ A;  4XJK B;  3S0D A;  3D76 A;  4GUK A;  3I5I B;  1V1G A;  1CFD A;  4GPL B;  4GGF C;  3GK4 X;  1SCM C;  2KYC A;  2MAZ A;  2PAL A;  1BT6 A;  3OGN A;  3SS4 A;  2JWW A;  1HT9 A;  4M2O A;  1CMG A;  1SRA A;  1CLL A;  3CYZ A;  3WXA A;  1TUJ A;  1L2O B;  2ZN9 A;  1RK9 A;  2LMU A;  3R1O A;  4PDZ A;  2MHH A;  2ERB A;  2GV5 A;  3KF9 A;  1M31 A;  2HF5 A;  4MBE A;  3Q8I A;  3I5H C;  1RTP 1;  2GGM A;  1LA0 A;  1UUR A;  1WRZ A;  1S36 A;  2JTT A;  4YBH B;  3BUM B;  4M2P A;  1YTZ C;  2JTZ A;  4GNK B;  5AEQ A;  1SBJ A;  3CLN A;  2JXL A;  3VRQ A;  4U8D A;  3LK0 A;  1MWN A;  1FBV A;  4INX A;  1S5G Y;  3TUY C;  1J7P A;  4YGB B;  3K21 A;  2E6W A;  3EK8 A;  3D73 A;  2P6B B;  1L7Z A;  2LLT A;  3IQO A;  3OBV A;  4DS7 A;  2LHL A;  2KQY A;  4BY5 A;  5FI2 A;  2LCP A;  2L5X B;  3PFV A;  5I2Q A;  2HPS A;  4QJ3 B;  2NCP A;  1SL8 A;  3EVR A;  1YX7 A;  1EG3 A;  5DKQ A;  3K1E A;  1KSM A;  2JQ6 A;  4IL1 A;  1OQP A;  1Y6W A;  3BUN B;  1TTX A;  4ZCV A;  1B9A A;  1CNP A;  1CLB A;  3AKB A;  3PN7 B;  1WDC C;  3PM8 A;  1W7I B;  1S6C A;  4MZK A;  1KWO B;  3FWB A;  1BOD A;  3FWC A;  1UHH A;  1BR1 B;  2JT8 A;  1CM1 A;  1TRF A;  2P70 A;  3O2P A;  5AAN A;  2LMT A;  3D78 A;  1CDM A;  1B8L A;  1NYA A;  2KOT A;  4GGF A;  1K9U A;  1S5G Z;  3D77 A;  1A29 A;  2JOJ A;  3HCM A;  1OSA A;  2LVV A;  2WCJ A;  1OOG A;  2KGR A;  4M2Q A;  5IBW A;  4HRH A;  4INW A;  4USL A;  4DRW A;  4A4B A;  3SS3 A;  3SS5 A;  4IJ7 A;  3ZWH A;  3BFA A;  3TS5 B;  1OOI X;  3B87 A;  3OHM B;  2BCX A;  2HQW A;  2BL0 C;  1F70 A;  4HRE E;  1RRO A;  1QS7 A;  4PHJ A;  1PRW A;  2M0R A;  1B4C A;  2Y4Q A;  1PVA A;  2MJW B;  3BOW A;  4GFT A;  4PHK A;  1NX3 A;  5J3X A;  1F54 A;  1SNL A;  1BJF A;  2I2R E;  2JT3 A;  1OMR A;  2WC6 A;  1SK6 D;  5EL2 A;  4PHN A;  2ZNE A;  2QEO A;  3NGV A;  2LC5 A;  3F45 A;  2V53 A;  2B1U A;  4KYN A;  4MEW A;  3DF0 A;  1TUZ A;  1J7O A;  1SL9 A;  2BEC A;  3SIA A;  5PAL A;  3B6X A;  3FIA A;  1A75 B;  1SCM B;  1TCO B;  3AAK A;  1JFJ A;  3D0Y B;  2QEB A;  1D1O A;  2LE9 B;  1Z2C B;  2BKH B;  1RWY A;  2WCF A;  1DEL A;  5KTY A;  1DEK A;  2K61 A;  3LL8 B;  3S0B A;  2KI6 D;  1DF0 A;  4PAL A;  4XJK A;  1QV1 A;  1S3P A;  4FQO A;  4MSP A;  1KFU S;  2MRD A;  1CFF A;  1JF2 A;  2VRG A;  3I5H B;  1QVI Y;  3OX6 A;  1CLM A;  1NWD A;  2QEV A;  5F6T A;  1IKU A;  4CFR A;  1J1E A;  3BUO B;  1ZOT B;  1LS8 A;  2E30 A;  1KQV A;  2WC5 A;  3TUY B;  4N1G A;  2O5G A;  3AKA A;  2FCE A;  1K9P A;  5AFP A;  2AUC A;  1ODB A;  1KK8 C;  1OOF A;  4JD9 A;  4JWQ A;  4QJ5 B;  4C0K A;  1YUU A;  2EGD A;  2NLN A;  5I8N A;  1NIW A;  1TNW A;  3I5G C;  3NHT A;  2LMV A;  1DVI A;  1DT7 B;  3PJI A;  3DVJ A;  1TOP A;  1DMO A;  4DUQ A;  3LCP C;  3D74 A;  2BE4 A;  2NCO A;  5HLO A;  2EC6 C;  1CKK A;  1DF0 B;  1JFK A;  1GGZ A;  1NX0 A;  2CTN A;  3IVT A;  3SG6 A;  2JT0 A;  5D69 A;  2BBM A;  1RJV A;  3CZ1 A;  2H61 A;  3BQ3 A;  4MRX A;  2M8U A;  3CDN A;  1NX1 A;  4MZL A;  3EKH A;  2JU0 A;  3PSR A;  1QVI Z;  1WDC B;  5TNC A;  5FYX A;  2JPT A;  1UHN A;  1G4Y R;  3IF7 A;  5CSI A;  4CPV A;  1ALW A;  1DTL A;  5JJG A;  1CFP A;  1QV0 A;  1SCV A;  4OKH A;  3CZ0 A;  1BR4 B;  4ICB A;  1YVH A;  1S26 D;  2FCD A;  1CDL A;  2L98 A;  2PMY A;  2ZND A;  3NSI A;  1XA5 A;  4ETO A;  3BYA A; 
#chains in the Genus database with same CATH homology
 2KI6 C;  5CSF A;  4JPZ B;  1N0Y A;  5D7F A;  2R2I A;  2PRU A;  2KFF A;  1K9K A;  1QLS A;  2A4J A;  3PAL A;  1BF5 A;  4ORC B;  1K8U A;  2BL0 B;  1DJW A;  2LP3 A;  1Y1X A;  5HKY A;  2K7B A;  1KQM C;  4BY4 A;  1SPY A;  1B8C A;  2RGI A;  1SW8 A;  2CNP A;  4P2Y B;  4CFQ A;  2JC2 A;  2KYF A;  3CR5 X;  4YRU A;  1C7V A;  1CMF A;  4UPG A;  1B8R A;  1YR5 A;  2SAS A;  2F3Z A;  1K95 A;  2KFH A;  3BUW B;  5DKR A;  1R2U A;  5ER4 X;  4AQJ A;  1Y1A A;  1C07 A;  5G08 A;  4PE7 A;  1MQ1 A;  1IGV A;  1N65 A;  1REC A;  2JZI A;  3O6B A;  2LLU A;  4OV2 A;  1GQM A;  2FOT A;  1QAT A;  4CID A;  4ORB B;  3D10 A;  3FS7 A;  2K7O A;  1K96 A;  2OTG C;  2K0J A;  2PVB A;  1CDN A;  3M0W A;  2K8M B;  1SKT A;  3WHU B;  1NP8 A;  1G8I A;  2LHI A;  2DOQ A;  3OB1 B;  4PE4 A;  1IJ6 A;  1J55 A;  2CXJ A;  2M7N A;  1AVS A;  1EL4 A;  1PSB A;  1A75 A;  1KFX L;  1NUB A;  1QX7 A;  3JTD C;  1Y0V H;  3E3R A;  2JNX A;  3D0Y A;  3RLZ A;  2LUX A;  1E8A A;  1K94 A;  3CR2 A;  2MA2 A;  2K2F A;  3QRX A;  3JVT C;  3EK4 A;  2KAX A;  2K7C A;  1J7R A;  4NQG A;  1CFC A;  1KK8 B;  2F8P A;  4YGC B;  3CS1 A;  1WLZ A;  3TDI A;  1IRJ A;  3ICB A;  1NX2 A;  3I5G B;  2CCM A;  1BMO A;  2AMI A;  2BE6 A;  3EKJ A;  3H4S E;  3SG7 A;  1IG5 A;  1U5I B;  1XK4 C;  1S6J A;  3HX4 A;  4I5N B;  2EC6 B;  1JF0 A;  2KDH A;  1Y1U A;  4OVN F;  1ZFS A;  1UUS A;  2KNE A;  3DVK A;  1K90 D;  1K2H A;  2H2K A;  2LAN A;  4OR9 B;  1FPW A;  3CTN A;  3A8R A;  4I5J A;  3TZ1 A;  2JXC A;  3BXK A;  4PHM A;  4PE1 A;  1CM4 A;  1LVC D;  1B1G A;  1JBA A;  1M45 A;  2L51 A;  1LXF C;  5HYD A;  2WCE A;  2K2A A;  2KBM A;  2LV7 A;  4I5K A;  3CZT X;  4JQ0 D;  1AK8 A;  2K7D A;  1F4O A;  1DGU A;  1AP4 A;  1IJ5 A;  2L4H A;  1IQ5 A;  1UHJ A;  2G2B A;  1KK7 Y;  1OMD A;  2WCB A;  1YRT B;  3VRR A;  1EG4 A;  2Q4U A;  1EJ3 A;  2MLE C;  2KFG A;  3DD4 A;  3TDU A;  1G33 A;  2KBI A;  3KPX A;  3O78 A;  4I5L B;  3SG4 A;  1K93 D;  1KQM B;  1XFZ O;  3NSL A;  1SY9 A;  2LVJ A;  1BU3 A;  4NDC A;  4N1F A;  1DJZ A;  1BOC A;  2KI4 C;  1NCX A;  2LAP A;  1SR6 C;  5HKZ A;  2Q91 A;  3KO0 A;  1C7W A;  1XO5 A;  2KAY A;  2L2E A;  3C1V A;  5K89 A;  5I2O A;  4YGE B;  3MSE B;  1M39 A;  1S6I A;  2LVK A;  2G9B A;  5B8I B;  1B47 A;  2BKI B;  1M63 B;  1YRU B;  2Y1M A;  1TN4 A;  1KSO A;  2L0P A;  3CWG A;  2OTG B;  3OX5 A;  3GK1 A;  3SG5 A;  1OZO A;  2WOS A;  3WNX B;  1TNX A;  2F3Y A;  1AJ4 A;  1R6P A;  1XYD A;  2KAV A;  2I7A A;  2ZFD A;  1MUX A;  4A4C A;  1QIV A;  2LNK A;  2M29 A;  1NSH A;  5GQQ C;  1ZMZ A;  3JTD B;  1DGV A;  3WHT B;  1DJY A;  1YUT A;  4YI8 A;  2EHB A;  3BUX B;  3I5F C;  1IWQ A;  4WQ2 A;  2F2P A;  2NXQ A;  4GAO A;  4YGD B;  4AOM A;  1IQ3 A;  1A4P A;  1LKJ A;  1FI6 A;  1DJG A;  5CPV A;  2OS8 C;  2M9G A;  3DVM A;  3JVT B;  3A4U B;  4OCI A;  1HQV A;  1F4Q A;  2GGZ A;  3NSO A;  4C0L A;  2I18 A;  3LLE A;  2KSP A;  1H4B A;  5AER A;  1AUI B;  2HQ8 A;  2ZRS A;  2M1U A;  2FJU B;  4MZJ A;  1VRK A;  1N2D A;  1SMG A;  5HKW A;  5DKN A;  2NZ0 A;  2PAS A;  4DCK A;  5KSZ A;  2MLF C;  3EVU A;  2M1K B;  1X02 A;  4C0J A;  4PCW A;  5AXI A;  2LLS A;  1OZS A;  2F33 A;  2M97 A;  1KCY A;  4ORA B;  1PAL A;  1MXE A;  3TDZ A;  2D8N A;  3KEV A;  1H8B A;  1TCF A;  2JNF A;  2JUL A;  2ZKM X;  1FF1 A;  1YUS A;  1U5I A;  2IS9 A;  5I2L A;  4MLW A;  3SIB A;  3ZNI A;  3O4Y A;  1FW4 A;  1MF8 B;  2F2O A;  2PSR A;  1QIW A;  4CLN A;  1CTR A;  1QX5 B;  2WND A;  1OE9 B;  1F55 A;  4PE0 A;  1GGW A;  3CR4 X;  5HLV A;  1DJX A;  1QLK A;  4QJ4 B;  2L4I A;  4GBA A;  3OB2 B;  1JC2 A;  1UHI A;  3DVE A;  2LVI A;  2CBL A;  1AHR A;  2O60 A;  1J7Q A;  1W7J B;  1YX8 A;  4MN0 A;  1WLM A;  1CDP A;  4MVF A;  4TNC A;  1A2X A;  1TNP A;  5CSJ A;  3RM1 A;  3I5I C;  1OMV A;  1QAS A;  1JUO A;  1GJY A;  2QAC A;  1J1D A;  3VRN A;  2ISD A;  1F8H A;  3NXA A;  4MRY A;  1WRK A;  2KGB C;  1NPQ A;  2KI4 B;  2TN4 A;  1PUL A;  3NSK A;  1SR6 B;  2OPO A;  1QXP A;  1A03 A;  1SYM A;  1L2O C;  1YUR A;  4D1E A;  1LA3 A;  1BG1 A;  2KQ6 A;  2COL B;  2HET A;  2ZRT A;  4YI9 A;  4NDB A;  1XFX O;  2ZN8 A;  3VGO A;  4HSZ A;  1ZAC A;  2WC8 A;  3AAJ A;  1KFU L;  1EH2 A;  1KFX S;  1QX2 A;  1XFU O;  1EXR A;  3KHE A;  1YVL A;  4GGN A;  3EK7 A;  4WRI A;  1RFJ A;  4AQI A;  2MBX A;  4XYN A;  1S1E A;  2L50 A;  1B7T Y;  1LIN A;  1AJ5 A;  1OOJ A;  2H61 C;  1DJH A;  2LUC A;  1F71 A;  1PSR A;  3SG2 A;  3I5F B;  1IH0 A;  4NDD A;  4E68 A;  4Q04 A;  1XFY O;  2I94 A;  2LM5 A;  4R1E A;  4HRG A;  1UP5 A;  2Y5I A;  2OS8 B;  1FI5 A;  1MHO A;  1XVJ A;  1Q80 A;  4FTG A;  2BBN A;  1ZUZ A;  3GK2 A;  1PK0 D;  2Y1N A;  4ZCU A;  5CSN A;  1XFV O;  1V1F A;  3GOF A;  4L9M A;  1MXL C;  2LP2 A;  3PN7 C;  4DIR A;  5KU1 A;  1WY9 A;  2BCB A;  3CGA A;  1KWO C;  1CB1 A;  2M49 B;  1DJI A;  3SG3 A;  5BPJ A;  1UWO A;  2QPT A;  3PLF B;  5JOL A;  5ER5 A;  2JRF A;  4F0Z B;  2CT9 A;  3BOW B;  1B7T Z;  3OP0 A;  1XFW O;  1JSA A;  2AAO A;  3IQQ A;  2M3W A;  1QTX A;  1NCZ A;  1TIZ A;  1QJT A;  3PAT A;  2WOR A;  1M46 A;  1XK4 A;  2M7L A;  1MR8 A;  4N5X A;  3DF0 B;  1SL7 A;  3TS5 C;  1KK7 Z;  1JWD A;  2KHN A;  2SCP A;  4WQ3 A;  3VRO A;  3VRP A;  4P5O E;  1WRL A;  1UHK A;  1BLQ A;  1NCY A;  3EVV A;  4YGA A;  2BCA A;  1ALV A;  3LK1 A;  1PVB A;  1TNQ A;  4XJK B;  4GUK A;  3I5I B;  1V1G A;  1CFD A;  4GPL B;  4GGF C;  3GK4 X;  1SCM C;  2KYC A;  2MAZ A;  2PAL A;  1BT6 A;  2JWW A;  1HT9 A;  4M2O A;  1CMG A;  1SRA A;  1CLL A;  3WXA A;  1L2O B;  2ZN9 A;  1RK9 A;  2LMU A;  4PDZ A;  2MHH A;  2GV5 A;  3KF9 A;  1M31 A;  2HF5 A;  4MBE A;  3I5H C;  1RTP 1;  2GGM A;  1LA0 A;  1UUR A;  1WRZ A;  1S36 A;  2JTT A;  4YBH B;  3BUM B;  4M2P A;  1YTZ C;  2JTZ A;  4GNK B;  5AEQ A;  1SBJ A;  3CLN A;  2JXL A;  3VRQ A;  4U8D A;  3LK0 A;  1MWN A;  1FBV A;  1S5G Y;  3TUY C;  1J7P A;  4YGB B;  3K21 A;  2E6W A;  3EK8 A;  2P6B B;  1L7Z A;  2LLT A;  3IQO A;  4DS7 A;  2LHL A;  2KQY A;  4BY5 A;  2LCP A;  2L5X B;  3PFV A;  5I2Q A;  2HPS A;  4QJ3 B;  2NCP A;  1SL8 A;  3EVR A;  1YX7 A;  1EG3 A;  5DKQ A;  1KSM A;  2JQ6 A;  4IL1 A;  1OQP A;  1Y6W A;  3BUN B;  1TTX A;  4ZCV A;  1B9A A;  1CNP A;  1CLB A;  3AKB A;  3PN7 B;  1WDC C;  3PM8 A;  1W7I B;  1S6C A;  4MZK A;  1KWO B;  3FWB A;  1BOD A;  3FWC A;  1UHH A;  1BR1 B;  2JT8 A;  1CM1 A;  1TRF A;  3O2P A;  5AAN A;  2LMT A;  1CDM A;  1B8L A;  1NYA A;  2KOT A;  4GGF A;  1K9U A;  1S5G Z;  1A29 A;  2JOJ A;  3HCM A;  1OSA A;  2LVV A;  4M2Q A;  2KGR A;  5IBW A;  4HRH A;  4USL A;  4DRW A;  4A4B A;  3ZWH A;  3TS5 B;  3OHM B;  2BCX A;  2HQW A;  2BL0 C;  1F70 A;  4HRE E;  1RRO A;  1QS7 A;  4PHJ A;  1PRW A;  2M0R A;  1B4C A;  2Y4Q A;  1PVA A;  2MJW B;  3BOW A;  4GFT A;  4PHK A;  1NX3 A;  5J3X A;  1F54 A;  1SNL A;  1BJF A;  2I2R E;  2JT3 A;  1OMR A;  3SJS A;  1SK6 D;  4PHN A;  2ZNE A;  2LC5 A;  3F45 A;  2V53 A;  2B1U A;  4MEW A;  3DF0 A;  1J7O A;  2BEC A;  1SL9 A;  3SIA A;  5PAL A;  3FIA A;  1A75 B;  1SCM B;  1TCO B;  3AAK A;  1JFJ A;  3D0Y B;  1D1O A;  2LE9 B;  2BKH B;  1RWY A;  2WCF A;  5KTY A;  2K61 A;  3LL8 B;  2KI6 D;  1DF0 A;  4PAL A;  4XJK A;  1QV1 A;  1S3P A;  4FQO A;  4MSP A;  1KFU S;  2MRD A;  1CFF A;  1JF2 A;  2VRG A;  3I5H B;  1QVI Y;  3OX6 A;  1CLM A;  1NWD A;  5F6T A;  1IKU A;  4CFR A;  1J1E A;  3BUO B;  1ZOT B;  1KQV A;  2E30 A;  3TUY B;  4N1G A;  2O5G A;  3AKA A;  2FCE A;  1K9P A;  5AFP A;  2AUC A;  1ODB A;  1KK8 C;  4JWQ A;  4QJ5 B;  4C0K A;  1YUU A;  2EGD A;  2NLN A;  5I8N A;  1NIW A;  1TNW A;  3I5G C;  2LMV A;  1DVI A;  1DT7 B;  3DVJ A;  1TOP A;  1DMO A;  4DUQ A;  3LCP C;  5HLO A;  2BE4 A;  2NCO A;  2EC6 C;  1CKK A;  1DF0 B;  1JFK A;  1GGZ A;  1NX0 A;  2CTN A;  3SG6 A;  2JT0 A;  5D69 A;  2BBM A;  1RJV A;  2H61 A;  3BQ3 A;  4MRX A;  2M8U A;  1NX1 A;  4MZL A;  3EKH A;  2JU0 A;  3PSR A;  1QVI Z;  1WDC B;  5TNC A;  5FYX A;  2JPT A;  1UHN A;  1G4Y R;  3IF7 A;  5CSI A;  4CPV A;  1ALW A;  1DTL A;  5JJG A;  1CFP A;  1QV0 A;  1SCV A;  4OKH A;  1BR4 B;  4ICB A;  1YVH A;  1S26 D;  2FCD A;  1CDL A;  2L98 A;  2PMY A;  2ZND A;  3NSI A;  1XA5 A;  4ETO A;  3BYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...