2RGIA

Crystal structure of ca2+-free s100a2 at 1.6 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
MSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A2
publication title Crystal structure of Ca2+ -free S100A2 at 1.6-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2rgiA00
5G08A 1RFJA 1S26D 1V1GA 4YI9A 3SG5A 1CDNA 1FPWA 3OX6A 1AP4A 4ORCB 3KO0A 5IBWA 1AUIB 1XFVO 4NQGA 2NLNA 1JWDA 1YRTB 1E8AA 1RROA 1M46A 2KFFA 2JT8A 2LC5A 4N1FA 4XJKA 2D8NA 2I18A 2K61A 4ZCVA 5CSNA 5KTYA 1F70A 1YVHA 2ZFDA 1YX7A 1CFDA 1OOJA 2BL0B 4OCIA 3SJSA 4GBAA 3OB2B 5B8IB 1F71A 1JSAA 1NX1A 2KI4C 1FI6A 2KAYA 2WCFA 2CT9A 2LUXA 3D0YB 5AEQA 1VRKA 2Y1MA 3PFVA 2FOTA 2I2RE 1GGZA 3CLNA 3D10A 1KCYA 2MRDA 1SMGA 2JOJA 4U8DA 3FWBA 3SIBA 3ZWHA 1J7QA 1QVIZ 1TN4A 3EK4A 2JRFA 5J3XA 4I5NB 5HKWA 4GGFA 1BR4B 1IWQA 1IJ6A 1CKKA 3PM8A 1CB1A 1KFUL 1PK0D 2BCAA 2K2FA 3HX4A 3ZNIA 2QACA 1B1GA 1K9UA 2CXJA 4DRWA 1G8IA 5D7FA 2F3YA 1NSHA 1XFUO 2JT0A 3GOFA 1TNXA 1JC2A 2GGMA 2ZRTA 2COLB 2G9BA 2SASA 2L4HA 4NDBA 1J7PA 2TN4A 3LLEA 1B8LA 2HF5A 1Y1UA 4DS7A 1TNPA 2P6BB 2KGBC 1CTRA 1KWOC 1L7ZA 3PN7C 2KBIA 2PVBA 1NPQA 5HYDA 4M2PA 1Y0VH 2EGDA 2JNXA 3GK2A 5AANA 1CFFA 2AMIA 4USLA 4YGAA 4MN0A 1KK7Z 2KAXA 4AQJA 1CLBA 4OV2A 1YUTA 1XVJA 1XO5A 1QX2A 5TNCA 4WQ2A 2KI6D 5F6TA 1F4OA 1K95A 4BY5A 2MHHA 2L98A 1EXRA 4CLNA 3VRQA 4YGBB 5CSFA 4CFQA 1M39A 1B7TY 4QJ3B 3RLZA 1KFUS 2BECA 4PE1A 2ZNEA 1UHNA 5DKNA 3EK7A 3TDIA 1XFXO 1FW4A 1QXPA 3JTDB 1UURA 4WRIA 4PE7A 2F8PA 1SCVA 2LVKA 2Y4QA 1OMVA 5KU1A 3IQOA 1YR5A 1F8HA 1MWNA 3EVRA 1Q80A 1NCYA 2HQWA 2RGIA 3BUNB 4PALA 1ODBA 2JT3A 3LL8B 2F2OA 1HT9A 1IKUA 1GJYA 2JTZA 2LP2A 4PHMA 1QLKA 3KEVA 3EK8A 1Y6WA 2NXQA 3MSEB 4HSZA 2NCOA 3BUMB 1AK8A 1A75B 2LM5A 3NSKA 3SG6A 1JBAA 1A2XA 3OX5A 4YI8A 1JFJA 1J55A 1UUSA 1NIWA 2M1KB 2CNPA 1TTXA 3KHEA 1JUOA 5CSIA 2KHNA 4FTGA 3SIAA 2A4JA 1SL9A 1BF5A 1DGVA 1XFWO 2ZNDA 2WCEA 1NCZA 2M1UA 1AJ4A 4MEWA 4I5KA 3ICBA 1K94A 2OPOA 1SBJA 3K21A 3TDZA 1DJGA 1ZFSA 1CDLA 3JVTB 4CPVA 1QTXA 5KSZA 1TRFA 1SL8A 2K2AA 2JC2A 3EVVA 4HREE 1RK9A 4DCKA 1XFZO 3OHMB 3WNXB 1NYAA 5D69A 5DKRA 2Y1NA 3DVKA 2IS9A 3HCMA 1C7VA 5AFPA 4TNCA 4PHKA 2BE6A 2M7LA 2PALA 2LAPA 2KSPA 1CDPA 2H61A 4I5JA 3SG3A 3TZ1A 5HLVA 1KQVA 4OVNF 3VGOA 2M3WA 1SCMB 2JTTA 1YVLA 1SY9A 1DJYA 1M31A 1S36A 2M9GA 3DVEA 3FWCA 1BU3A 1F55A 2BL0C 1YTZC 1B7TZ 2L0PA 5I2QA 1JF2A 2I94A 3M0WA 1NCXA 2L2EA 1AJ5A 4C0LA 2LHLA 4YGDB 1TNQA 2L5XB 2M8UA 1J7RA 1KSMA 1S6CA 1A75A 4ORBB 1BJFA 1LVCD 1GQMA 3RM1A 4MZKA 1TCOB 3TUYB 3TUYC 2R2IA 1QATA 2OTGB 2KYFA 2OTGC 1JFKA 4HRHA 4ICBA 2MJWB 1Y1AA 3F45A 1BOCA 1OQPA 2GV5A 2LMTA 1J7OA 4WQ3A 1LINA 3CS1A 4M2QA 4GFTA 3OP0A 1DVIA 1PALA 2JQ6A 2PASA 2WC8A 4XYNA 1MQ1A 2OS8B 4PHNA 5FYXA 1EG3A 1NX3A 2K7OA 4P2YB 1DTLA 1IJ5A 1BR1B 4UPGA 4I5LB 3TS5B 1DGUA 3TS5C 1EH2A 1N65A 1HQVA 1KK8B 2F2PA 1KK8C 1IQ5A 2JPTA 1YURA 1K90D 5GQQC 3AAJA 1BG1A 1WLMA 3WXAA 2H2KA 2SCPA 3C1VA 4GNKB 2JNFA 1FF1A 4OR9B 1W7IB 3EVUA 4CIDA 1SPYA 3BOWB 1CLMA 1JF0A 3H4SE 1IGVA 2KAVA 3CWGA 4IL1A 1EJ3A 1SK6D 1WDCB 2EC6B 3EKHA 1WDCC 2BKIB 4JWQA 1IQ3A 4PDZA 2KYCA 1NX2A 3BUXB 3CR4X 2KFGA 2KQ6A 2L50A 1WRLA 3NSIA 1WY9A 1DF0B 2LANA 1ALVA 2WNDA 1S6IA 2ZRSA 3E3RA 1FI5A 2Y5IA 4D1EA 1W7JB 1RJVA 4GAOA 2KNEA 1MUXA 4N1GA 1H4BA 1Y1XA 2V53A 1D1OA 3JTDC 2PSRA 5K89A 1L2OB 1MXEA 3VRRA 2FJUB 2KFHA 2MLEC 1U5IA 5I2OA 2BCBA 1OMDA 1CMFA 1WRZA 1ZACA 2KOTA 4ZCUA 4PE0A 2MA2A 5I8NA 4DIRA 1UHIA 1J1DA 2BE4A 3PALA 2HQ8A 2NZ0A 1QASA 3DVMA 3BUOB 2E30A 1OSAA 1EL4A 1A03A 3BUWB 1PULA 1QV0A 1PSRA 2G2BA 1BMOA 4MZJA 4C0KA 1FBVA 4A4CA 5ER4X 3I5FB 4JPZB 2MAZA 3BOWA 1B4CA 1H8BA 2MBXA 1WLZA 2PRUA 1QX5B 2WCBA 1M45A 2FCDA 1DJHA 2HETA 4YRUA 4GGFC 1SNLA 3AAKA 3CR2A 1M63B 1SL7A 2JXCA 1DF0A 4PHJA 3PSRA 1OZSA 1QIWA 2JXLA 2M49B 3KF9A 4P5OE 5DKQA 3JVTC 5BPJA 2K7DA 2LP3A 3DVJA 1BT6A 5PALA 2FCEA 1QIVA 3O6BA 3I5HB 3GK4X 2LUCA 3LK1A 1YUSA 1K9PA 1B8RA 2LNKA 2LLSA 1G4YR 5ER5A 3A8RA 4QJ4B 2ZN9A 1SCMC 3IF7A 1PSBA 1V1FA 3NSLA 3KPXA 2LE9B 4MBEA 4FQOA 3FIAA 1XYDA 4GPLB 3DF0B 3BYAA 5AXIA 1DJWA 1PRWA 2KI6C 3NSOA 1DT7B 1CMGA 5I2LA 2Q4UA 1KK7Y 1LKJA 1R2UA 3BQ3A 1S1EA 1SYMA 1LA0A 2QPTA 1SKTA 2F33A 2LVJA 2MLFC 4GUKA 1IH0A 1QLSA 4MLWA 1B9AA 4NDDA 3O78A 1MF8B 5AERA 2K8MB 2K7BA 4N5XA 2WOSA 1XA5A 1UHKA 4L9MA 2LV7A 1CLLA 1AHRA 3EKJA 4E68A 1N2DA 1YRUB 1QV1A 5JJGA 3OB1B 2CTNA 2M7NA 1ALWA 2E6WA 2M97A 2KI4B 2BBNA 4MSPA 1BODA 5HLOA 3SG7A 1S3PA 2VRGA 5CPVA 2JU0A 1DMOA 2OS8C 1U5IB 2F3ZA 2KDHA 2KQYA 1S5GY 1A29A 1IG5A 4DUQA 1KFXS 1CM1A 5JOLA 1C07A 1KSOA 3VRNA 1XK4A 2O5GA 2JULA 3LCPC 4YBHB 1TCFA 1LXFC 1K9KA 3CTNA 1PVAA 3DF0A 1RWYA 1KQMB 1KQMC 3IQQA 4M2OA 1K8UA 2NCPA 2ISDA 2LVVA 1LA3A 4QJ5B 3AKAA 1S6JA 2EC6C 1RTP1 1TNWA 1CM4A 1N0YA 2I7AA 1SR6B 1SR6C 3I5IB 1RECA 3I5IC 3SG4A 1MHOA 1UP5A 1BLQA 1A4PA 1B47A 4OKHA 1C7WA 1UHHA 3O4YA 2JWWA 2LLUA 2WORA 4AQIA 1EG4A 1KWOB 3PN7B 3WHTB 1SRAA 1NUBA 1NWDA 1NX0A 4MRXA 2KBMA 2GGZA 4PCWA 3CZTX 3VROA 4C0JA 4NDCA 2AUCA 2LCPA 2M0RA 3DD4A 4AOMA 2O60A 4R1EA 2BCXA 2LVIA 3D0YA 1L2OC 2H61C 1QX7A 4YGCB 3PATA 3I5GB 3I5GC 2B1UA 2PMYA 4ORAB 1GGWA 1DJZA 3CGAA 4MRYA 1SW8A 2JZIA 3WHUB 1OMRA 1X02A 1J1EA 4CFRA 1OE9B 3BXKA 3NXAA 1CFCA 3TDUA 1DJXA 1NP8A 5HKYA 1WRKA 1ZOTB 1AVSA 2BBMA 2K0JA 4JQ0D 2LLTA 3I5FC 4GGNA 2LMUA 2LMVA 3LK0A 1R6PA 4ETOA 1B8CA 2AAOA 1OZOA 1K96A 1TOPA 2CBLA 5CSJA 4XJKB 1QVIY 1QS7A 4PE4A 1S5GZ 4Q04A 4BY4A 4HRGA 2ZKMX 2DOQA 1CDMA 2BKHB 1TIZA 2K7CA 4MZLA 1F54A 3VRPA 5HKZA 3CR5X 1K2HA 1MR8A 2L51A 2L4IA 1XFYO 1F4QA 1YX8A 4A4BA 1CFPA 2CCMA 1MXLC 1UWOA 2KGRA 1ZMZA 3FS7A 3PLFB 2EHBA 1IRJA 3QRXA 3I5HC 2HPSA 3GK1A 3A4UB 1ZUZA 4MVFA 4YGEB 3SG2A 1K93D 1CNPA 1YUUA 1KFXL 3O2PA 2LHIA 3AKBA 2ZN8A 1G33A 1XK4C 2Q91A 1DJIA 1UHJA 1PVBA 4F0ZB 1QJTA 2M29A
chains in the Genus database with same CATH superfamily
5G08A 1RFJA 1S26D 1V1GA 4YI9A 3SG5A 1CDNA 2WC6A 1FPWA 3OX6A 1AP4A 4ORCB 3KO0A 5IBWA 1AUIB 1XFVO 3OBVA 4NQGA 2NLNA 1JWDA 1YRTB 1E8AA 1RROA 1M46A 2KFFA 2JT8A 2LC5A 4N1FA 4XJKA 2D8NA 3O4XA 5FI6A 2I18A 2K61A 5FI2A 5CSNA 4ZCVA 5KTYA 1F70A 1YVHA 2ZFDA 1YX7A 1CFDA 1OOJA 2BL0B 4OCIA 3SJSA 2PQLA 4GBAA 3OB2B 5B8IB 1F71A 1JSAA 1NX1A 2KI4C 5D3OA 1FI6A 2KAYA 2WCFA 2CT9A 2LUXA 3D0YB 5AEQA 3CZ1A 1VRKA 1TWOA 2WCHA 2Y1MA 3PFVA 3L47A 2FOTA 2I2RE 1GGZA 3CLNA 3D10A 1KCYA 2MRDA 1SMGA 2JOJA 4U8DA 3FWBA 3SIBA 3ZWHA 1J7QA 1QVIZ 1TN4A 3EK4A 2JRFA 5J3XA 4JKTA 4I5NB 5HKWA 4GGFA 1BR4B 1IWQA 1IJ6A 1CKKA 3PM8A 1CB1A 1KFUL 3DY9A 1OOHA 1PK0D 2BCAA 2K2FA 3HX4A 3ZNIA 2QACA 1B1GA 1K9UA 2CXJA 4DRWA 1G8IA 5D7FA 2F3YA 1NSHA 1XFUO 3FE8A 2JT0A 3Q8IA 3GOFA 3NHTA 1TNXA 1JC2A 2GGMA 3S0AA 2ZRTA 2COLB 2G9BA 2SASA 2L4HA 4NDBA 1J7PA 2TN4A 3LLEA 1B8LA 4INWA 3B86A 2HF5A 1Y1UA 4DS7A 1TNPA 2P6BB 2KGBC 1CTRA 1KWOC 1L7ZA 3PN7C 2KBIA 2PVBA 1NPQA 5HYDA 4M2PA 1Y0VH 1XFRA 2EGDA 2JNXA 3GK2A 3L4AA 5AANA 1CFFA 3IVTA 3N7HA 2AMIA 4USLA 4YGAA 4MN0A 2QEVA 1KK7Z 2KAXA 4AQJA 4PT1A 1CLBA 4OV2A 1YUTA 1XVJA 1XO5A 1QX2A 5TNCA 4WQ2A 2KI6D 5F6TA 1F4OA 1K95A 4BY5A 2MHHA 2L98A 1EXRA 4CLNA 3VRQA 4YGBB 5CSFA 4CFQA 1M39A 1B7TY 4QJ3B 3RLZA 1KFUS 3S0DA 1Z4HA 2BECA 4PE1A 2ZNEA 1UHNA 2YGUA 5DKNA 3EK7A 3TDIA 1XFXO 2BAPA 1FW4A 1QXPA 3JTDB 1UURA 4WRIA 4PE7A 2F8PA 1SCVA 2LVKA 2Y4QA 1OMVA 5KU1A 3IQOA 1YR5A 1F8HA 1MWNA 3EVRA 1Q80A 1NCYA 2HQWA 2RGIA 3BUNB 4PALA 1ODBA 2JT3A 3LL8B 2F2OA 2QDIA 1HT9A 1IKUA 1GJYA 2JTZA 2LP2A 4PHMA 1QLKA 3KEVA 3FE6A 3EK8A 1Y6WA 1Z2CB 2NXQA 3MSEB 4HSZA 2NCOA 3BUMB 2L5YA 3DZTA 1AK8A 1A75B 3CZ2A 3BFBA 3S0GA 2LM5A 3NSKA 3SG6A 1JBAA 1A2XA 3OX5A 3EG5B 2GTEA 4YI8A 1JFJA 1J55A 1UUSA 1NIWA 2M1KB 2CNPA 1TTXA 3KHEA 1JUOA 5CSIA 2KHNA 4FTGA 3CYZA 3SIAA 2A4JA 1SL9A 2FJYA 1BF5A 1DGVA 1XFWO 2ZNDA 2WCEA 1NCZA 2M1UA 1AJ4A 4MEWA 4I5KA 3ICBA 1K94A 2OPOA 1SBJA 3K21A 3TDZA 1DJGA 1ZFSA 1CDLA 3JVTB 4CPVA 1QTXA 5KSZA 1TRFA 1SL8A 2K2AA 2JC2A 3EVVA 4HREE 1RK9A 4DCKA 3S0FA 1XFZO 3NGVA 3OHMB 3WNXB 1NYAA 5D69A 5DKRA 2Y1NA 3DVKA 2IS9A 3HCMA 1C7VA 5AFPA 4TNCA 4PHKA 2BE6A 2WCMA 2M7LA 2PALA 2LAPA 2KSPA 1CDPA 2H61A 4I5JA 3SG3A 3TZ1A 5HLVA 1KQVA 4OVNF 3VGOA 2M3WA 1SCMB 2JTTA 1YVLA 1SY9A 1DJYA 3QMEA 1M31A 1S36A 2M9GA 3DVEA 3FE9A 3FWCA 1BU3A 1F55A 2BL0C 1YTZC 1B7TZ 2KPHA 2L0PA 5I2QA 1JF2A 2I94A 2PYQA 3M0WA 1NCXA 2L2EA 1AJ5A 4C0LA 2LHLA 4YGDB 1TNQA 2L5XB 2M8UA 1J7RA 1KSMA 1S6CA 1A75A 4ORBB 1BJFA 1LVCD 1GQMA 3S0BA 3RM1A 4MZKA 1TCOB 5EL2A 3TUYB 3TUYC 2R2IA 1QATA 2OTGB 2KYFA 2OTGC 1JFKA 4HRHA 4ICBA 2WCKA 2MJWB 1Y1AA 3F45A 1BOCA 1OQPA 3B7AA 2GV5A 2LMTA 1J7OA 4WQ3A 1LINA 3CS1A 4M2QA 4GFTA 1DEKA 3NHIA 3OP0A 1DVIA 1PALA 1SSEB 2JQ6A 2PASA 2WC8A 4XYNA 1QWVA 1MQ1A 2OS8B 3R1PA 4PHNA 5FYXA 1EG3A 1NX3A 2K7OA 4P2YB 1DTLA 1IJ5A 1BR1B 4UPGA 4I5LB 3TS5B 1DGUA 3TS5C 1EH2A 1N65A 1HQVA 1KK8B 2F2PA 4FQTA 1KK8C 1IQ5A 2JPTA 1YURA 1K90D 5GQQC 3AAJA 1BG1A 1WLMA 3WXAA 2H2KA 2SCPA 3C1VA 4GNKB 2JNFA 4KYNA 1FF1A 4OR9B 1W7IB 3EVUA 4CIDA 1SPYA 3BOWB 1CLMA 1JF0A 2L2CA 3H4SE 1IGVA 2KAVA 3D77A 3CWGA 4IL1A 1EJ3A 1SK6D 1WDCB 2EC6B 3EKHA 1WDCC 2BKIB 4JWQA 1IQ3A 4PDZA 2KYCA 1NX2A 3BUXB 3CR4X 2KFGA 2KQ6A 2L50A 1WRLA 3NSIA 1OOFA 1WY9A 1DF0B 2LANA 1ALVA 2WNDA 1S6IA 2ZRSA 3E3RA 2KLDA 1FI5A 4JD9A 2Y5IA 4D1EA 1W7JB 1RJVA 4GAOA 2KNEA 1MUXA 4N1GA 1H4BA 1Y1XA 2V53A 1D1OA 1TUZA 3JTDC 2PSRA 5K89A 1L2OB 1MXEA 3VRRA 3R72A 2FJUB 2KFHA 2MLEC 1U5IA 5I2OA 2BCBA 1OMDA 1CMFA 1WRZA 1ZACA 2KOTA 4ZCUA 4PE0A 2MA2A 3SS5A 5I8NA 4DIRA 1UHIA 1J1DA 2BE4A 3PALA 2HQ8A 2NZ0A 1QASA 3DVMA 3BUOB 2E30A 1OSAA 1EL4A 1A03A 3BUWB 2K60A 3D73A 1PULA 1QV0A 1PSRA 2G2BA 1BMOA 4MZJA 4C0KA 1FBVA 1ORGA 3UO9A 4A4CA 5ER4X 3I5FB 4JPZB 2MAZA 3BOWA 1B4CA 1H8BA 3DXLA 2MBXA 1DELA 1WLZA 2PRUA 2P71A 3D78A 1QX5B 2WCBA 1M45A 2FCDA 1DJHA 1LS8A 2HETA 2JPOA 4YRUA 4GGFC 1SNLA 3AAKA 3CR2A 1M63B 1SL7A 2JXCA 1DF0A 4PHJA 3PSRA 1OZSA 1QIWA 2JXLA 2M49B 3KF9A 4P5OE 5DKQA 3JVTC 5BPJA 2K7DA 2LP3A 3DVJA 1BT6A 5PALA 2FCEA 1QIVA 3O6BA 3I5HB 3GK4X 3PM2A 2LUCA 3LK1A 1YUSA 3VB1A 1K9PA 1B8RA 2LNKA 2LLSA 1G4YR 3CABA 5ER5A 3A8RA 4QJ4B 2ZN9A 1SCMC 3IF7A 1PSBA 1V1FA 3NSLA 3KPXA 2LE9B 4MBEA 4FQOA 3FIAA 1XYDA 4GPLB 3DF0B 3BYAA 5AXIA 1DJWA 1PRWA 2KI6C 3NSOA 1DT7B 1CMGA 5I2LA 3CZ0A 2Q4UA 1KK7Y 1LKJA 1R2UA 3BQ3A 3DYEA 1S1EA 1SYMA 1LA0A 2QPTA 1SKTA 2F33A 2LVJA 5I94A 2MLFC 4GUKA 4F7FA 1IH0A 1QLSA 4MLWA 1OOIX 1B9AA 4NDDA 2QEOA 3O78A 1MF8B 5AERA 2K8MB 3SS4A 2K7BA 4N5XA 2WOSA 1XA5A 1UHKA 4L9MA 1W9ZA 2LV7A 5FI7A 3RZSA 1CLLA 1AHRA 3EKJA 4E68A 1N2DA 5HL1A 1YRUB 1QV1A 5JJGA 3OB1B 2CTNA 2M7NA 2KLEA 1ALWA 2E6WA 2M97A 2KI4B 2BBNA 4MSPA 1BODA 5HLOA 3SG7A 1S3PA 3OGNA 2WCJA 2VRGA 5CPVA 2JU0A 1DMOA 2OS8C 1U5IB 2F3ZA 2KDHA 2KQYA 2QEBA 1S5GY 1A29A 1IG5A 1GM0A 3V2LA 1KFXS 4DUQA 1CM1A 2WC5A 5JOLA 1C07A 1KSOA 3VRNA 1XK4A 2O5GA 2JULA 3LCPC 4YBHB 1TUJA 1TCFA 1LXFC 1C3YA 1K9KA 2ERBA 3CTNA 1PVAA 3DF0A 4OZDA 1RWYA 1KQMB 1KQMC 3L4LA 3IQQA 4M2OA 5DICA 3B87A 1K8UA 2NCPA 2ISDA 2LVVA 1LA3A 4QJ5B 3AKAA 1DC1A 1S6JA 1OW4A 1RTP1 2EC6C 1TNWA 1CM4A 1N0YA 2I7AA 1SR6B 1SR6C 3I5IB 1RECA 3I5IC 3SG4A 1MHOA 1UP5A 1BLQA 1A4PA 1B47A 3BFHA 1C7WA 1UHHA 3O4YA 2JWWA 2LLUA 2WORA 4OKHA 4AQIA 1EG4A 1KWOB 3PN7B 1DQEA 4IJ7A 3UNWA 1SRAA 3WHTB 1OOGA 1NUBA 1NWDA 1NX0A 1IIOA 4MRXA 2KBMA 2GGZA 4PCWA 3CZTX 3VROA 4C0JA 4NDCA 2AUCA 2LCPA 2M0RA 3DD4A 4AOMA 2O60A 4R1EA 2BCXA 2LVIA 3D0YA 1L2OC 2H61C 1QX7A 4YGCB 3PATA 3R1OA 3I5GB 3I5GC 2B1UA 2PMYA 4ORAB 1GGWA 1DJZA 3CGAA 4MRYA 2BNXA 1SW8A 2JZIA 3WHUB 1OMRA 1X02A 1J1EA 4CFRA 1OE9B 3BXKA 3R1VA 3NXAA 1CFCA 3TDUA 1DJXA 1NP8A 4INXA 5HKYA 1WRKA 1ZOTB 1AVSA 2BBMA 3D75A 2K0JA 4JQ0D 1P28A 2LLTA 3I5FC 4GGNA 2LMUA 2LMVA 3LK0A 1R6PA 4ETOA 1B8CA 2AAOA 1OZOA 1K96A 1TOPA 2CBLA 5CSJA 4XJKB 1QVIY 2P70A 1QS7A 4PE4A 3D76A 1S5GZ 4Q04A 4BY4A 4HRGA 2ZKMX 2DOQA 3B6XA 3S0EA 1CDMA 2BKHB 1TIZA 2K7CA 2WCLA 3D74A 4MZLA 1F54A 3B88A 3VRPA 5HKZA 2QEHA 3CR5X 1K2HA 1MR8A 2L51A 2L4IA 1XFYO 1F4QA 1YX8A 4A4BA 1CFPA 2CCMA 1MXLC 3K1EA 1UWOA 2KGRA 1ZMZA 3FS7A 3PLFB 2H8VA 1C3ZA 2EHBA 1IRJA 3QRXA 3I5HC 2HPSA 3GK1A 3A4UB 1ZUZA 4MVFA 4YGEB 3SG2A 1K93D 1CNPA 1YUUA 1KFXL 3O2PA 2LHIA 3AKBA 2ZN8A 3CDNA 1G33A 3BJHA 1XK4C 3BFAA 3PJIA 2Q91A 1DJIA 1UHJA 1T14A 3SS3A 1PVBA 4F0ZB 1QJTA 2M29A
chains in the Genus database with same CATH topology
5G08A 1RFJA 1S26D 1V1GA 4YI9A 3SG5A 1CDNA 1FPWA 3OX6A 1AP4A 4ORCB 3KO0A 5IBWA 1AUIB 1XFVO 4NQGA 2NLNA 1JWDA 1YRTB 1E8AA 1RROA 1M46A 2KFFA 2JT8A 2LC5A 4N1FA 4XJKA 2D8NA 2I18A 2K61A 4ZCVA 5CSNA 5KTYA 1F70A 1YVHA 2ZFDA 1YX7A 1CFDA 1OOJA 2BL0B 4OCIA 3SJSA 4GBAA 3OB2B 5B8IB 1F71A 1JSAA 1NX1A 2KI4C 1FI6A 2KAYA 2WCFA 2CT9A 2LUXA 3D0YB 5AEQA 1VRKA 2Y1MA 3PFVA 2FOTA 2I2RE 1GGZA 3CLNA 3D10A 1KCYA 2MRDA 1SMGA 2JOJA 4U8DA 3FWBA 3SIBA 3ZWHA 1J7QA 1QVIZ 1TN4A 3EK4A 2JRFA 5J3XA 4I5NB 5HKWA 4GGFA 1BR4B 1IWQA 1IJ6A 1CKKA 3PM8A 1CB1A 1KFUL 1PK0D 2BCAA 2K2FA 3HX4A 3ZNIA 2QACA 1B1GA 1K9UA 2CXJA 4DRWA 1G8IA 5D7FA 2F3YA 1NSHA 1XFUO 2JT0A 3GOFA 1TNXA 1JC2A 2GGMA 2ZRTA 2COLB 2G9BA 2SASA 2L4HA 4NDBA 1J7PA 2TN4A 3LLEA 1B8LA 2HF5A 1Y1UA 4DS7A 1TNPA 2P6BB 2KGBC 1CTRA 1KWOC 1L7ZA 3PN7C 2KBIA 2PVBA 1NPQA 5HYDA 4M2PA 1Y0VH 2EGDA 2JNXA 3GK2A 5AANA 1CFFA 2AMIA 4USLA 4YGAA 4MN0A 1KK7Z 2KAXA 4AQJA 1CLBA 4OV2A 1YUTA 1XVJA 1XO5A 1QX2A 5TNCA 4WQ2A 2KI6D 5F6TA 1F4OA 1K95A 4BY5A 2MHHA 2L98A 1EXRA 4CLNA 3VRQA 4YGBB 5CSFA 4CFQA 1M39A 1B7TY 4QJ3B 3RLZA 1KFUS 2BECA 4PE1A 2ZNEA 1UHNA 5DKNA 3EK7A 3TDIA 1XFXO 1FW4A 1QXPA 3JTDB 1UURA 4WRIA 4PE7A 2F8PA 1SCVA 2LVKA 2Y4QA 1OMVA 5KU1A 3IQOA 1YR5A 1F8HA 1MWNA 3EVRA 1Q80A 1NCYA 2HQWA 2RGIA 3BUNB 4PALA 1ODBA 2JT3A 3LL8B 2F2OA 1HT9A 1IKUA 1GJYA 2JTZA 2LP2A 4PHMA 1QLKA 3KEVA 3EK8A 1Y6WA 2NXQA 3MSEB 4HSZA 2NCOA 3BUMB 1AK8A 1A75B 2LM5A 3NSKA 3SG6A 1JBAA 1A2XA 3OX5A 4YI8A 1JFJA 1J55A 1UUSA 1NIWA 2M1KB 2CNPA 1TTXA 3KHEA 1JUOA 5CSIA 2KHNA 4FTGA 3SIAA 2A4JA 1SL9A 1BF5A 1DGVA 1XFWO 2ZNDA 2WCEA 1NCZA 2M1UA 1AJ4A 4MEWA 4I5KA 3ICBA 1K94A 2OPOA 1SBJA 3K21A 3TDZA 1DJGA 1ZFSA 1CDLA 3JVTB 4CPVA 1QTXA 5KSZA 1TRFA 1SL8A 2K2AA 2JC2A 3EVVA 4HREE 1RK9A 4DCKA 1XFZO 3OHMB 3WNXB 1NYAA 5D69A 5DKRA 2Y1NA 3DVKA 2IS9A 3HCMA 1C7VA 5AFPA 4TNCA 4PHKA 2BE6A 2M7LA 2PALA 2LAPA 2KSPA 1CDPA 2H61A 4I5JA 3SG3A 3TZ1A 5HLVA 1KQVA 4OVNF 3VGOA 2M3WA 1SCMB 2JTTA 1YVLA 1SY9A 1DJYA 1M31A 1S36A 2M9GA 3DVEA 3FWCA 1BU3A 1F55A 2BL0C 1YTZC 1B7TZ 2L0PA 5I2QA 1JF2A 2I94A 3M0WA 1NCXA 2L2EA 1AJ5A 4C0LA 2LHLA 4YGDB 1TNQA 2L5XB 2M8UA 1J7RA 1KSMA 1S6CA 1A75A 4ORBB 1BJFA 1LVCD 1GQMA 3RM1A 4MZKA 1TCOB 3TUYB 3TUYC 2R2IA 1QATA 2OTGB 2KYFA 2OTGC 1JFKA 4HRHA 4ICBA 2MJWB 1Y1AA 3F45A 1BOCA 1OQPA 2GV5A 2LMTA 1J7OA 4WQ3A 1LINA 3CS1A 4M2QA 4GFTA 3OP0A 1DVIA 1PALA 2JQ6A 2PASA 2WC8A 4XYNA 1MQ1A 2OS8B 4PHNA 5FYXA 1EG3A 1NX3A 2K7OA 4P2YB 1DTLA 1IJ5A 1BR1B 4UPGA 4I5LB 3TS5B 1DGUA 3TS5C 1EH2A 1N65A 1HQVA 1KK8B 2F2PA 1KK8C 1IQ5A 2JPTA 1YURA 1K90D 5GQQC 3AAJA 1BG1A 1WLMA 3WXAA 2H2KA 2SCPA 3C1VA 4GNKB 2JNFA 1FF1A 4OR9B 1W7IB 3EVUA 4CIDA 1SPYA 3BOWB 1CLMA 1JF0A 3H4SE 1IGVA 2KAVA 3CWGA 4IL1A 1EJ3A 1SK6D 1WDCB 2EC6B 3EKHA 1WDCC 2BKIB 4JWQA 1IQ3A 4PDZA 2KYCA 1NX2A 3BUXB 3CR4X 2KFGA 2KQ6A 2L50A 1WRLA 3NSIA 1WY9A 1DF0B 2LANA 1ALVA 2WNDA 1S6IA 2ZRSA 3E3RA 1FI5A 2Y5IA 4D1EA 1W7JB 1RJVA 4GAOA 2KNEA 1MUXA 4N1GA 1H4BA 1Y1XA 2V53A 1D1OA 3JTDC 2PSRA 5K89A 1L2OB 1MXEA 3VRRA 2FJUB 2KFHA 2MLEC 1U5IA 5I2OA 2BCBA 1OMDA 1CMFA 1WRZA 1ZACA 2KOTA 4ZCUA 4PE0A 2MA2A 5I8NA 4DIRA 1UHIA 1J1DA 2BE4A 3PALA 2HQ8A 2NZ0A 1QASA 3DVMA 3BUOB 2E30A 1OSAA 1EL4A 1A03A 3BUWB 1PULA 1QV0A 1PSRA 2G2BA 1BMOA 4MZJA 4C0KA 1FBVA 4A4CA 5ER4X 3I5FB 4JPZB 2MAZA 3BOWA 1B4CA 1H8BA 2MBXA 1WLZA 2PRUA 1QX5B 2WCBA 1M45A 2FCDA 1DJHA 2HETA 4YRUA 4GGFC 1SNLA 3AAKA 3CR2A 1M63B 1SL7A 2JXCA 1DF0A 4PHJA 3PSRA 1OZSA 1QIWA 2JXLA 2M49B 3KF9A 4P5OE 5DKQA 3JVTC 5BPJA 2K7DA 2LP3A 3DVJA 1BT6A 5PALA 2FCEA 1QIVA 3O6BA 3I5HB 3GK4X 2LUCA 3LK1A 1YUSA 1K9PA 1B8RA 2LNKA 2LLSA 1G4YR 5ER5A 3A8RA 4QJ4B 2ZN9A 1SCMC 3IF7A 1PSBA 1V1FA 3NSLA 3KPXA 2LE9B 4MBEA 4FQOA 3FIAA 1XYDA 4GPLB 3DF0B 3BYAA 5AXIA 1DJWA 1PRWA 2KI6C 3NSOA 1DT7B 1CMGA 5I2LA 2Q4UA 1KK7Y 1LKJA 1R2UA 3BQ3A 1S1EA 1SYMA 1LA0A 2QPTA 1SKTA 2F33A 2LVJA 2MLFC 4GUKA 1IH0A 1QLSA 4MLWA 1B9AA 4NDDA 3O78A 1MF8B 5AERA 2K8MB 2K7BA 4N5XA 2WOSA 1XA5A 1UHKA 4L9MA 2LV7A 1CLLA 1AHRA 3EKJA 4E68A 1N2DA 1YRUB 1QV1A 5JJGA 3OB1B 2CTNA 2M7NA 1ALWA 2E6WA 2M97A 2KI4B 2BBNA 4MSPA 1BODA 5HLOA 3SG7A 1S3PA 2VRGA 5CPVA 2JU0A 1DMOA 2OS8C 1U5IB 2F3ZA 2KDHA 2KQYA 1S5GY 1A29A 1IG5A 4DUQA 1KFXS 1CM1A 5JOLA 1C07A 1KSOA 3VRNA 1XK4A 2O5GA 2JULA 3LCPC 4YBHB 1TCFA 1LXFC 1K9KA 3CTNA 1PVAA 3DF0A 1RWYA 1KQMB 1KQMC 3IQQA 4M2OA 1K8UA 2NCPA 2ISDA 2LVVA 1LA3A 4QJ5B 3AKAA 1S6JA 2EC6C 1RTP1 1TNWA 1CM4A 1N0YA 2I7AA 1SR6B 1SR6C 3I5IB 1RECA 3I5IC 3SG4A 1MHOA 1UP5A 1BLQA 1A4PA 1B47A 4OKHA 1C7WA 1UHHA 3O4YA 2JWWA 2LLUA 2WORA 4AQIA 1EG4A 1KWOB 3PN7B 3WHTB 1SRAA 1NUBA 1NWDA 1NX0A 4MRXA 2KBMA 2GGZA 4PCWA 3CZTX 3VROA 4C0JA 4NDCA 2AUCA 2LCPA 2M0RA 3DD4A 4AOMA 2O60A 4R1EA 2BCXA 2LVIA 3D0YA 1L2OC 2H61C 1QX7A 4YGCB 3PATA 3I5GB 3I5GC 2B1UA 2PMYA 4ORAB 1GGWA 1DJZA 3CGAA 4MRYA 1SW8A 2JZIA 3WHUB 1OMRA 1X02A 1J1EA 4CFRA 1OE9B 3BXKA 3NXAA 1CFCA 3TDUA 1DJXA 1NP8A 5HKYA 1WRKA 1ZOTB 1AVSA 2BBMA 2K0JA 4JQ0D 2LLTA 3I5FC 4GGNA 2LMUA 2LMVA 3LK0A 1R6PA 4ETOA 1B8CA 2AAOA 1OZOA 1K96A 1TOPA 2CBLA 5CSJA 4XJKB 1QVIY 1QS7A 4PE4A 1S5GZ 4Q04A 4BY4A 4HRGA 2ZKMX 2DOQA 1CDMA 2BKHB 1TIZA 2K7CA 4MZLA 1F54A 3VRPA 5HKZA 3CR5X 1K2HA 1MR8A 2L51A 2L4IA 1XFYO 1F4QA 1YX8A 4A4BA 1CFPA 2CCMA 1MXLC 1UWOA 2KGRA 1ZMZA 3FS7A 3PLFB 2EHBA 1IRJA 3QRXA 3I5HC 2HPSA 3GK1A 3A4UB 1ZUZA 4MVFA 4YGEB 3SG2A 1K93D 1CNPA 1YUUA 1KFXL 3O2PA 2LHIA 3AKBA 2ZN8A 1G33A 1XK4C 2Q91A 1DJIA 1UHJA 1PVBA 4F0ZB 1QJTA 2M29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G08 A;  1RFJ A;  1S26 D;  1V1G A;  4YI9 A;  3SG5 A;  1CDN A;  1FPW A;  3OX6 A;  1AP4 A;  4ORC B;  3KO0 A;  5IBW A;  1AUI B;  1XFV O;  4NQG A;  2NLN A;  1JWD A;  1YRT B;  1E8A A;  1RRO A;  1M46 A;  2KFF A;  2JT8 A;  2LC5 A;  4N1F A;  4XJK A;  2D8N A;  2I18 A;  2K61 A;  4ZCV A;  5CSN A;  5KTY A;  1F70 A;  1YVH A;  2ZFD A;  1YX7 A;  1CFD A;  1OOJ A;  2BL0 B;  4OCI A;  3SJS A;  4GBA A;  3OB2 B;  5B8I B;  1F71 A;  1JSA A;  1NX1 A;  2KI4 C;  1FI6 A;  2KAY A;  2WCF A;  2CT9 A;  2LUX A;  3D0Y B;  5AEQ A;  1VRK A;  2Y1M A;  3PFV A;  2FOT A;  2I2R E;  1GGZ A;  3CLN A;  3D10 A;  1KCY A;  2MRD A;  1SMG A;  2JOJ A;  4U8D A;  3FWB A;  3SIB A;  3ZWH A;  1J7Q A;  1QVI Z;  1TN4 A;  3EK4 A;  2JRF A;  5J3X A;  4I5N B;  5HKW A;  4GGF A;  1BR4 B;  1IWQ A;  1IJ6 A;  1CKK A;  3PM8 A;  1CB1 A;  1KFU L;  1PK0 D;  2BCA A;  2K2F A;  3HX4 A;  3ZNI A;  2QAC A;  1B1G A;  1K9U A;  2CXJ A;  4DRW A;  1G8I A;  5D7F A;  2F3Y A;  1NSH A;  1XFU O;  2JT0 A;  3GOF A;  1TNX A;  1JC2 A;  2GGM A;  2ZRT A;  2COL B;  2G9B A;  2SAS A;  2L4H A;  4NDB A;  1J7P A;  2TN4 A;  3LLE A;  1B8L A;  2HF5 A;  1Y1U A;  4DS7 A;  1TNP A;  2P6B B;  2KGB C;  1CTR A;  1KWO C;  1L7Z A;  3PN7 C;  2KBI A;  2PVB A;  1NPQ A;  5HYD A;  4M2P A;  1Y0V H;  2EGD A;  2JNX A;  3GK2 A;  5AAN A;  1CFF A;  2AMI A;  4USL A;  4YGA A;  4MN0 A;  1KK7 Z;  2KAX A;  4AQJ A;  1CLB A;  4OV2 A;  1YUT A;  1XVJ A;  1XO5 A;  1QX2 A;  5TNC A;  4WQ2 A;  2KI6 D;  5F6T A;  1F4O A;  1K95 A;  4BY5 A;  2MHH A;  2L98 A;  1EXR A;  4CLN A;  3VRQ A;  4YGB B;  5CSF A;  4CFQ A;  1M39 A;  1B7T Y;  4QJ3 B;  3RLZ A;  1KFU S;  2BEC A;  4PE1 A;  2ZNE A;  1UHN A;  5DKN A;  3EK7 A;  3TDI A;  1XFX O;  1FW4 A;  1QXP A;  3JTD B;  1UUR A;  4WRI A;  4PE7 A;  2F8P A;  1SCV A;  2LVK A;  2Y4Q A;  1OMV A;  5KU1 A;  3IQO A;  1YR5 A;  1F8H A;  1MWN A;  3EVR A;  1Q80 A;  1NCY A;  2HQW A;  2RGI A;  3BUN B;  4PAL A;  1ODB A;  2JT3 A;  3LL8 B;  2F2O A;  1HT9 A;  1IKU A;  1GJY A;  2JTZ A;  2LP2 A;  4PHM A;  1QLK A;  3KEV A;  3EK8 A;  1Y6W A;  2NXQ A;  3MSE B;  4HSZ A;  2NCO A;  3BUM B;  1AK8 A;  1A75 B;  2LM5 A;  3NSK A;  3SG6 A;  1JBA A;  1A2X A;  3OX5 A;  4YI8 A;  1JFJ A;  1J55 A;  1UUS A;  1NIW A;  2M1K B;  2CNP A;  1TTX A;  3KHE A;  1JUO A;  5CSI A;  2KHN A;  4FTG A;  3SIA A;  2A4J A;  1SL9 A;  1BF5 A;  1DGV A;  1XFW O;  2ZND A;  2WCE A;  1NCZ A;  2M1U A;  1AJ4 A;  4MEW A;  4I5K A;  3ICB A;  1K94 A;  2OPO A;  1SBJ A;  3K21 A;  3TDZ A;  1DJG A;  1ZFS A;  1CDL A;  3JVT B;  4CPV A;  1QTX A;  5KSZ A;  1TRF A;  1SL8 A;  2K2A A;  2JC2 A;  3EVV A;  4HRE E;  1RK9 A;  4DCK A;  1XFZ O;  3OHM B;  3WNX B;  1NYA A;  5D69 A;  5DKR A;  2Y1N A;  3DVK A;  2IS9 A;  3HCM A;  1C7V A;  5AFP A;  4TNC A;  4PHK A;  2BE6 A;  2M7L A;  2PAL A;  2LAP A;  2KSP A;  1CDP A;  2H61 A;  4I5J A;  3SG3 A;  3TZ1 A;  5HLV A;  1KQV A;  4OVN F;  3VGO A;  2M3W A;  1SCM B;  2JTT A;  1YVL A;  1SY9 A;  1DJY A;  1M31 A;  1S36 A;  2M9G A;  3DVE A;  3FWC A;  1BU3 A;  1F55 A;  2BL0 C;  1YTZ C;  1B7T Z;  2L0P A;  5I2Q A;  1JF2 A;  2I94 A;  3M0W A;  1NCX A;  2L2E A;  1AJ5 A;  4C0L A;  2LHL A;  4YGD B;  1TNQ A;  2L5X B;  2M8U A;  1J7R A;  1KSM A;  1S6C A;  1A75 A;  4ORB B;  1BJF A;  1LVC D;  1GQM A;  3RM1 A;  4MZK A;  1TCO B;  3TUY B;  3TUY C;  2R2I A;  1QAT A;  2OTG B;  2KYF A;  2OTG C;  1JFK A;  4HRH A;  4ICB A;  2MJW B;  1Y1A A;  3F45 A;  1BOC A;  1OQP A;  2GV5 A;  2LMT A;  1J7O A;  4WQ3 A;  1LIN A;  3CS1 A;  4M2Q A;  4GFT A;  3OP0 A;  1DVI A;  1PAL A;  2JQ6 A;  2PAS A;  2WC8 A;  4XYN A;  1MQ1 A;  2OS8 B;  4PHN A;  5FYX A;  1EG3 A;  1NX3 A;  2K7O A;  4P2Y B;  1DTL A;  1IJ5 A;  1BR1 B;  4UPG A;  4I5L B;  3TS5 B;  1DGU A;  3TS5 C;  1EH2 A;  1N65 A;  1HQV A;  1KK8 B;  2F2P A;  1KK8 C;  1IQ5 A;  2JPT A;  1YUR A;  1K90 D;  5GQQ C;  3AAJ A;  1BG1 A;  1WLM A;  3WXA A;  2H2K A;  2SCP A;  3C1V A;  4GNK B;  2JNF A;  1FF1 A;  4OR9 B;  1W7I B;  3EVU A;  4CID A;  1SPY A;  3BOW B;  1CLM A;  1JF0 A;  3H4S E;  1IGV A;  2KAV A;  3CWG A;  4IL1 A;  1EJ3 A;  1SK6 D;  1WDC B;  2EC6 B;  3EKH A;  1WDC C;  2BKI B;  4JWQ A;  1IQ3 A;  4PDZ A;  2KYC A;  1NX2 A;  3BUX B;  3CR4 X;  2KFG A;  2KQ6 A;  2L50 A;  1WRL A;  3NSI A;  1WY9 A;  1DF0 B;  2LAN A;  1ALV A;  2WND A;  1S6I A;  2ZRS A;  3E3R A;  1FI5 A;  2Y5I A;  4D1E A;  1W7J B;  1RJV A;  4GAO A;  2KNE A;  1MUX A;  4N1G A;  1H4B A;  1Y1X A;  2V53 A;  1D1O A;  3JTD C;  2PSR A;  5K89 A;  1L2O B;  1MXE A;  3VRR A;  2FJU B;  2KFH A;  2MLE C;  1U5I A;  5I2O A;  2BCB A;  1OMD A;  1CMF A;  1WRZ A;  1ZAC A;  2KOT A;  4ZCU A;  4PE0 A;  2MA2 A;  5I8N A;  4DIR A;  1UHI A;  1J1D A;  2BE4 A;  3PAL A;  2HQ8 A;  2NZ0 A;  1QAS A;  3DVM A;  3BUO B;  2E30 A;  1OSA A;  1EL4 A;  1A03 A;  3BUW B;  1PUL A;  1QV0 A;  1PSR A;  2G2B A;  1BMO A;  4MZJ A;  4C0K A;  1FBV A;  4A4C A;  5ER4 X;  3I5F B;  4JPZ B;  2MAZ A;  3BOW A;  1B4C A;  1H8B A;  2MBX A;  1WLZ A;  2PRU A;  1QX5 B;  2WCB A;  1M45 A;  2FCD A;  1DJH A;  2HET A;  4YRU A;  4GGF C;  1SNL A;  3AAK A;  3CR2 A;  1M63 B;  1SL7 A;  2JXC A;  1DF0 A;  4PHJ A;  3PSR A;  1OZS A;  1QIW A;  2JXL A;  2M49 B;  3KF9 A;  4P5O E;  5DKQ A;  3JVT C;  5BPJ A;  2K7D A;  2LP3 A;  3DVJ A;  1BT6 A;  5PAL A;  2FCE A;  1QIV A;  3O6B A;  3I5H B;  3GK4 X;  2LUC A;  3LK1 A;  1YUS A;  1K9P A;  1B8R A;  2LNK A;  2LLS A;  1G4Y R;  5ER5 A;  3A8R A;  4QJ4 B;  2ZN9 A;  1SCM C;  3IF7 A;  1PSB A;  1V1F A;  3NSL A;  3KPX A;  2LE9 B;  4MBE A;  4FQO A;  3FIA A;  1XYD A;  4GPL B;  3DF0 B;  3BYA A;  5AXI A;  1DJW A;  1PRW A;  2KI6 C;  3NSO A;  1DT7 B;  1CMG A;  5I2L A;  2Q4U A;  1KK7 Y;  1LKJ A;  1R2U A;  3BQ3 A;  1S1E A;  1SYM A;  1LA0 A;  2QPT A;  1SKT A;  2F33 A;  2LVJ A;  2MLF C;  4GUK A;  1IH0 A;  1QLS A;  4MLW A;  1B9A A;  4NDD A;  3O78 A;  1MF8 B;  5AER A;  2K8M B;  2K7B A;  4N5X A;  2WOS A;  1XA5 A;  1UHK A;  4L9M A;  2LV7 A;  1CLL A;  1AHR A;  3EKJ A;  4E68 A;  1N2D A;  1YRU B;  1QV1 A;  5JJG A;  3OB1 B;  2CTN A;  2M7N A;  1ALW A;  2E6W A;  2M97 A;  2KI4 B;  2BBN A;  4MSP A;  1BOD A;  5HLO A;  3SG7 A;  1S3P A;  2VRG A;  5CPV A;  2JU0 A;  1DMO A;  2OS8 C;  1U5I B;  2F3Z A;  2KDH A;  2KQY A;  1S5G Y;  1A29 A;  1IG5 A;  4DUQ A;  1KFX S;  1CM1 A;  5JOL A;  1C07 A;  1KSO A;  3VRN A;  1XK4 A;  2O5G A;  2JUL A;  3LCP C;  4YBH B;  1TCF A;  1LXF C;  1K9K A;  3CTN A;  1PVA A;  3DF0 A;  1RWY A;  1KQM B;  1KQM C;  3IQQ A;  4M2O A;  1K8U A;  2NCP A;  2ISD A;  2LVV A;  1LA3 A;  4QJ5 B;  3AKA A;  1S6J A;  2EC6 C;  1RTP 1;  1TNW A;  1CM4 A;  1N0Y A;  2I7A A;  1SR6 B;  1SR6 C;  3I5I B;  1REC A;  3I5I C;  3SG4 A;  1MHO A;  1UP5 A;  1BLQ A;  1A4P A;  1B47 A;  4OKH A;  1C7W A;  1UHH A;  3O4Y A;  2JWW A;  2LLU A;  2WOR A;  4AQI A;  1EG4 A;  1KWO B;  3PN7 B;  3WHT B;  1SRA A;  1NUB A;  1NWD A;  1NX0 A;  4MRX A;  2KBM A;  2GGZ A;  4PCW A;  3CZT X;  3VRO A;  4C0J A;  4NDC A;  2AUC A;  2LCP A;  2M0R A;  3DD4 A;  4AOM A;  2O60 A;  4R1E A;  2BCX A;  2LVI A;  3D0Y A;  1L2O C;  2H61 C;  1QX7 A;  4YGC B;  3PAT A;  3I5G B;  3I5G C;  2B1U A;  2PMY A;  4ORA B;  1GGW A;  1DJZ A;  3CGA A;  4MRY A;  1SW8 A;  2JZI A;  3WHU B;  1OMR A;  1X02 A;  1J1E A;  4CFR A;  1OE9 B;  3BXK A;  3NXA A;  1CFC A;  3TDU A;  1DJX A;  1NP8 A;  5HKY A;  1WRK A;  1ZOT B;  1AVS A;  2BBM A;  2K0J A;  4JQ0 D;  2LLT A;  3I5F C;  4GGN A;  2LMU A;  2LMV A;  3LK0 A;  1R6P A;  4ETO A;  1B8C A;  2AAO A;  1OZO A;  1K96 A;  1TOP A;  2CBL A;  5CSJ A;  4XJK B;  1QVI Y;  1QS7 A;  4PE4 A;  1S5G Z;  4Q04 A;  4BY4 A;  4HRG A;  2ZKM X;  2DOQ A;  1CDM A;  2BKH B;  1TIZ A;  2K7C A;  4MZL A;  1F54 A;  3VRP A;  5HKZ A;  3CR5 X;  1K2H A;  1MR8 A;  2L51 A;  2L4I A;  1XFY O;  1F4Q A;  1YX8 A;  4A4B A;  1CFP A;  2CCM A;  1MXL C;  1UWO A;  2KGR A;  1ZMZ A;  3FS7 A;  3PLF B;  2EHB A;  1IRJ A;  3QRX A;  3I5H C;  2HPS A;  3GK1 A;  3A4U B;  1ZUZ A;  4MVF A;  4YGE B;  3SG2 A;  1K93 D;  1CNP A;  1YUU A;  1KFX L;  3O2P A;  2LHI A;  3AKB A;  2ZN8 A;  1G33 A;  1XK4 C;  2Q91 A;  1DJI A;  1UHJ A;  1PVB A;  4F0Z B;  1QJT A;  2M29 A; 
#chains in the Genus database with same CATH topology
 5G08 A;  1RFJ A;  1S26 D;  1V1G A;  4YI9 A;  3SG5 A;  1CDN A;  2WC6 A;  1FPW A;  3OX6 A;  1AP4 A;  4ORC B;  3KO0 A;  5IBW A;  1AUI B;  1XFV O;  3OBV A;  4NQG A;  2NLN A;  1JWD A;  1YRT B;  1E8A A;  1RRO A;  1M46 A;  2KFF A;  2JT8 A;  2LC5 A;  4N1F A;  4XJK A;  2D8N A;  3O4X A;  5FI6 A;  2I18 A;  2K61 A;  5FI2 A;  5CSN A;  4ZCV A;  5KTY A;  1F70 A;  1YVH A;  2ZFD A;  1YX7 A;  1CFD A;  1OOJ A;  2BL0 B;  4OCI A;  3SJS A;  2PQL A;  4GBA A;  3OB2 B;  5B8I B;  1F71 A;  1JSA A;  1NX1 A;  2KI4 C;  5D3O A;  1FI6 A;  2KAY A;  2WCF A;  2CT9 A;  2LUX A;  3D0Y B;  5AEQ A;  3CZ1 A;  1VRK A;  1TWO A;  2WCH A;  2Y1M A;  3PFV A;  3L47 A;  2FOT A;  2I2R E;  1GGZ A;  3CLN A;  3D10 A;  1KCY A;  2MRD A;  1SMG A;  2JOJ A;  4U8D A;  3FWB A;  3SIB A;  3ZWH A;  1J7Q A;  1QVI Z;  1TN4 A;  3EK4 A;  2JRF A;  5J3X A;  4JKT A;  4I5N B;  5HKW A;  4GGF A;  1BR4 B;  1IWQ A;  1IJ6 A;  1CKK A;  3PM8 A;  1CB1 A;  1KFU L;  3DY9 A;  1OOH A;  1PK0 D;  2BCA A;  2K2F A;  3HX4 A;  3ZNI A;  2QAC A;  1B1G A;  1K9U A;  2CXJ A;  4DRW A;  1G8I A;  5D7F A;  2F3Y A;  1NSH A;  1XFU O;  3FE8 A;  2JT0 A;  3Q8I A;  3GOF A;  3NHT A;  1TNX A;  1JC2 A;  2GGM A;  3S0A A;  2ZRT A;  2COL B;  2G9B A;  2SAS A;  2L4H A;  4NDB A;  1J7P A;  2TN4 A;  3LLE A;  1B8L A;  4INW A;  3B86 A;  2HF5 A;  1Y1U A;  4DS7 A;  1TNP A;  2P6B B;  2KGB C;  1CTR A;  1KWO C;  1L7Z A;  3PN7 C;  2KBI A;  2PVB A;  1NPQ A;  5HYD A;  4M2P A;  1Y0V H;  1XFR A;  2EGD A;  2JNX A;  3GK2 A;  3L4A A;  5AAN A;  1CFF A;  3IVT A;  3N7H A;  2AMI A;  4USL A;  4YGA A;  4MN0 A;  2QEV A;  1KK7 Z;  2KAX A;  4AQJ A;  4PT1 A;  1CLB A;  4OV2 A;  1YUT A;  1XVJ A;  1XO5 A;  1QX2 A;  5TNC A;  4WQ2 A;  2KI6 D;  5F6T A;  1F4O A;  1K95 A;  4BY5 A;  2MHH A;  2L98 A;  1EXR A;  4CLN A;  3VRQ A;  4YGB B;  5CSF A;  4CFQ A;  1M39 A;  1B7T Y;  4QJ3 B;  3RLZ A;  1KFU S;  3S0D A;  1Z4H A;  2BEC A;  4PE1 A;  2ZNE A;  1UHN A;  2YGU A;  5DKN A;  3EK7 A;  3TDI A;  1XFX O;  2BAP A;  1FW4 A;  1QXP A;  3JTD B;  1UUR A;  4WRI A;  4PE7 A;  2F8P A;  1SCV A;  2LVK A;  2Y4Q A;  1OMV A;  5KU1 A;  3IQO A;  1YR5 A;  1F8H A;  1MWN A;  3EVR A;  1Q80 A;  1NCY A;  2HQW A;  2RGI A;  3BUN B;  4PAL A;  1ODB A;  2JT3 A;  3LL8 B;  2F2O A;  2QDI A;  1HT9 A;  1IKU A;  1GJY A;  2JTZ A;  2LP2 A;  4PHM A;  1QLK A;  3KEV A;  3FE6 A;  3EK8 A;  1Y6W A;  1Z2C B;  2NXQ A;  3MSE B;  4HSZ A;  2NCO A;  3BUM B;  2L5Y A;  3DZT A;  1AK8 A;  1A75 B;  3CZ2 A;  3BFB A;  3S0G A;  2LM5 A;  3NSK A;  3SG6 A;  1JBA A;  1A2X A;  3OX5 A;  3EG5 B;  2GTE A;  4YI8 A;  1JFJ A;  1J55 A;  1UUS A;  1NIW A;  2M1K B;  2CNP A;  1TTX A;  3KHE A;  1JUO A;  5CSI A;  2KHN A;  4FTG A;  3CYZ A;  3SIA A;  2A4J A;  1SL9 A;  2FJY A;  1BF5 A;  1DGV A;  1XFW O;  2ZND A;  2WCE A;  1NCZ A;  2M1U A;  1AJ4 A;  4MEW A;  4I5K A;  3ICB A;  1K94 A;  2OPO A;  1SBJ A;  3K21 A;  3TDZ A;  1DJG A;  1ZFS A;  1CDL A;  3JVT B;  4CPV A;  1QTX A;  5KSZ A;  1TRF A;  1SL8 A;  2K2A A;  2JC2 A;  3EVV A;  4HRE E;  1RK9 A;  4DCK A;  3S0F A;  1XFZ O;  3NGV A;  3OHM B;  3WNX B;  1NYA A;  5D69 A;  5DKR A;  2Y1N A;  3DVK A;  2IS9 A;  3HCM A;  1C7V A;  5AFP A;  4TNC A;  4PHK A;  2BE6 A;  2WCM A;  2M7L A;  2PAL A;  2LAP A;  2KSP A;  1CDP A;  2H61 A;  4I5J A;  3SG3 A;  3TZ1 A;  5HLV A;  1KQV A;  4OVN F;  3VGO A;  2M3W A;  1SCM B;  2JTT A;  1YVL A;  1SY9 A;  1DJY A;  3QME A;  1M31 A;  1S36 A;  2M9G A;  3DVE A;  3FE9 A;  3FWC A;  1BU3 A;  1F55 A;  2BL0 C;  1YTZ C;  1B7T Z;  2KPH A;  2L0P A;  5I2Q A;  1JF2 A;  2I94 A;  2PYQ A;  3M0W A;  1NCX A;  2L2E A;  1AJ5 A;  4C0L A;  2LHL A;  4YGD B;  1TNQ A;  2L5X B;  2M8U A;  1J7R A;  1KSM A;  1S6C A;  1A75 A;  4ORB B;  1BJF A;  1LVC D;  1GQM A;  3S0B A;  3RM1 A;  4MZK A;  1TCO B;  5EL2 A;  3TUY B;  3TUY C;  2R2I A;  1QAT A;  2OTG B;  2KYF A;  2OTG C;  1JFK A;  4HRH A;  4ICB A;  2WCK A;  2MJW B;  1Y1A A;  3F45 A;  1BOC A;  1OQP A;  3B7A A;  2GV5 A;  2LMT A;  1J7O A;  4WQ3 A;  1LIN A;  3CS1 A;  4M2Q A;  4GFT A;  1DEK A;  3NHI A;  3OP0 A;  1DVI A;  1PAL A;  1SSE B;  2JQ6 A;  2PAS A;  2WC8 A;  4XYN A;  1QWV A;  1MQ1 A;  2OS8 B;  3R1P A;  4PHN A;  5FYX A;  1EG3 A;  1NX3 A;  2K7O A;  4P2Y B;  1DTL A;  1IJ5 A;  1BR1 B;  4UPG A;  4I5L B;  3TS5 B;  1DGU A;  3TS5 C;  1EH2 A;  1N65 A;  1HQV A;  1KK8 B;  2F2P A;  4FQT A;  1KK8 C;  1IQ5 A;  2JPT A;  1YUR A;  1K90 D;  5GQQ C;  3AAJ A;  1BG1 A;  1WLM A;  3WXA A;  2H2K A;  2SCP A;  3C1V A;  4GNK B;  2JNF A;  4KYN A;  1FF1 A;  4OR9 B;  1W7I B;  3EVU A;  4CID A;  1SPY A;  3BOW B;  1CLM A;  1JF0 A;  2L2C A;  3H4S E;  1IGV A;  2KAV A;  3D77 A;  3CWG A;  4IL1 A;  1EJ3 A;  1SK6 D;  1WDC B;  2EC6 B;  3EKH A;  1WDC C;  2BKI B;  4JWQ A;  1IQ3 A;  4PDZ A;  2KYC A;  1NX2 A;  3BUX B;  3CR4 X;  2KFG A;  2KQ6 A;  2L50 A;  1WRL A;  3NSI A;  1OOF A;  1WY9 A;  1DF0 B;  2LAN A;  1ALV A;  2WND A;  1S6I A;  2ZRS A;  3E3R A;  2KLD A;  1FI5 A;  4JD9 A;  2Y5I A;  4D1E A;  1W7J B;  1RJV A;  4GAO A;  2KNE A;  1MUX A;  4N1G A;  1H4B A;  1Y1X A;  2V53 A;  1D1O A;  1TUZ A;  3JTD C;  2PSR A;  5K89 A;  1L2O B;  1MXE A;  3VRR A;  3R72 A;  2FJU B;  2KFH A;  2MLE C;  1U5I A;  5I2O A;  2BCB A;  1OMD A;  1CMF A;  1WRZ A;  1ZAC A;  2KOT A;  4ZCU A;  4PE0 A;  2MA2 A;  3SS5 A;  5I8N A;  4DIR A;  1UHI A;  1J1D A;  2BE4 A;  3PAL A;  2HQ8 A;  2NZ0 A;  1QAS A;  3DVM A;  3BUO B;  2E30 A;  1OSA A;  1EL4 A;  1A03 A;  3BUW B;  2K60 A;  3D73 A;  1PUL A;  1QV0 A;  1PSR A;  2G2B A;  1BMO A;  4MZJ A;  4C0K A;  1FBV A;  1ORG A;  3UO9 A;  4A4C A;  5ER4 X;  3I5F B;  4JPZ B;  2MAZ A;  3BOW A;  1B4C A;  1H8B A;  3DXL A;  2MBX A;  1DEL A;  1WLZ A;  2PRU A;  2P71 A;  3D78 A;  1QX5 B;  2WCB A;  1M45 A;  2FCD A;  1DJH A;  1LS8 A;  2HET A;  2JPO A;  4YRU A;  4GGF C;  1SNL A;  3AAK A;  3CR2 A;  1M63 B;  1SL7 A;  2JXC A;  1DF0 A;  4PHJ A;  3PSR A;  1OZS A;  1QIW A;  2JXL A;  2M49 B;  3KF9 A;  4P5O E;  5DKQ A;  3JVT C;  5BPJ A;  2K7D A;  2LP3 A;  3DVJ A;  1BT6 A;  5PAL A;  2FCE A;  1QIV A;  3O6B A;  3I5H B;  3GK4 X;  3PM2 A;  2LUC A;  3LK1 A;  1YUS A;  3VB1 A;  1K9P A;  1B8R A;  2LNK A;  2LLS A;  1G4Y R;  3CAB A;  5ER5 A;  3A8R A;  4QJ4 B;  2ZN9 A;  1SCM C;  3IF7 A;  1PSB A;  1V1F A;  3NSL A;  3KPX A;  2LE9 B;  4MBE A;  4FQO A;  3FIA A;  1XYD A;  4GPL B;  3DF0 B;  3BYA A;  5AXI A;  1DJW A;  1PRW A;  2KI6 C;  3NSO A;  1DT7 B;  1CMG A;  5I2L A;  3CZ0 A;  2Q4U A;  1KK7 Y;  1LKJ A;  1R2U A;  3BQ3 A;  3DYE A;  1S1E A;  1SYM A;  1LA0 A;  2QPT A;  1SKT A;  2F33 A;  2LVJ A;  5I94 A;  2MLF C;  4GUK A;  4F7F A;  1IH0 A;  1QLS A;  4MLW A;  1OOI X;  1B9A A;  4NDD A;  2QEO A;  3O78 A;  1MF8 B;  5AER A;  2K8M B;  3SS4 A;  2K7B A;  4N5X A;  2WOS A;  1XA5 A;  1UHK A;  4L9M A;  1W9Z A;  2LV7 A;  5FI7 A;  3RZS A;  1CLL A;  1AHR A;  3EKJ A;  4E68 A;  1N2D A;  5HL1 A;  1YRU B;  1QV1 A;  5JJG A;  3OB1 B;  2CTN A;  2M7N A;  2KLE A;  1ALW A;  2E6W A;  2M97 A;  2KI4 B;  2BBN A;  4MSP A;  1BOD A;  5HLO A;  3SG7 A;  1S3P A;  3OGN A;  2WCJ A;  2VRG A;  5CPV A;  2JU0 A;  1DMO A;  2OS8 C;  1U5I B;  2F3Z A;  2KDH A;  2KQY A;  2QEB A;  1S5G Y;  1A29 A;  1IG5 A;  1GM0 A;  3V2L A;  1KFX S;  4DUQ A;  1CM1 A;  2WC5 A;  5JOL A;  1C07 A;  1KSO A;  3VRN A;  1XK4 A;  2O5G A;  2JUL A;  3LCP C;  4YBH B;  1TUJ A;  1TCF A;  1LXF C;  1C3Y A;  1K9K A;  2ERB A;  3CTN A;  1PVA A;  3DF0 A;  4OZD A;  1RWY A;  1KQM B;  1KQM C;  3L4L A;  3IQQ A;  4M2O A;  5DIC A;  3B87 A;  1K8U A;  2NCP A;  2ISD A;  2LVV A;  1LA3 A;  4QJ5 B;  3AKA A;  1DC1 A;  1S6J A;  1OW4 A;  1RTP 1;  2EC6 C;  1TNW A;  1CM4 A;  1N0Y A;  2I7A A;  1SR6 B;  1SR6 C;  3I5I B;  1REC A;  3I5I C;  3SG4 A;  1MHO A;  1UP5 A;  1BLQ A;  1A4P A;  1B47 A;  3BFH A;  1C7W A;  1UHH A;  3O4Y A;  2JWW A;  2LLU A;  2WOR A;  4OKH A;  4AQI A;  1EG4 A;  1KWO B;  3PN7 B;  1DQE A;  4IJ7 A;  3UNW A;  1SRA A;  3WHT B;  1OOG A;  1NUB A;  1NWD A;  1NX0 A;  1IIO A;  4MRX A;  2KBM A;  2GGZ A;  4PCW A;  3CZT X;  3VRO A;  4C0J A;  4NDC A;  2AUC A;  2LCP A;  2M0R A;  3DD4 A;  4AOM A;  2O60 A;  4R1E A;  2BCX A;  2LVI A;  3D0Y A;  1L2O C;  2H61 C;  1QX7 A;  4YGC B;  3PAT A;  3R1O A;  3I5G B;  3I5G C;  2B1U A;  2PMY A;  4ORA B;  1GGW A;  1DJZ A;  3CGA A;  4MRY A;  2BNX A;  1SW8 A;  2JZI A;  3WHU B;  1OMR A;  1X02 A;  1J1E A;  4CFR A;  1OE9 B;  3BXK A;  3R1V A;  3NXA A;  1CFC A;  3TDU A;  1DJX A;  1NP8 A;  4INX A;  5HKY A;  1WRK A;  1ZOT B;  1AVS A;  2BBM A;  3D75 A;  2K0J A;  4JQ0 D;  1P28 A;  2LLT A;  3I5F C;  4GGN A;  2LMU A;  2LMV A;  3LK0 A;  1R6P A;  4ETO A;  1B8C A;  2AAO A;  1OZO A;  1K96 A;  1TOP A;  2CBL A;  5CSJ A;  4XJK B;  1QVI Y;  2P70 A;  1QS7 A;  4PE4 A;  3D76 A;  1S5G Z;  4Q04 A;  4BY4 A;  4HRG A;  2ZKM X;  2DOQ A;  3B6X A;  3S0E A;  1CDM A;  2BKH B;  1TIZ A;  2K7C A;  2WCL A;  3D74 A;  4MZL A;  1F54 A;  3B88 A;  3VRP A;  5HKZ A;  2QEH A;  3CR5 X;  1K2H A;  1MR8 A;  2L51 A;  2L4I A;  1XFY O;  1F4Q A;  1YX8 A;  4A4B A;  1CFP A;  2CCM A;  1MXL C;  3K1E A;  1UWO A;  2KGR A;  1ZMZ A;  3FS7 A;  3PLF B;  2H8V A;  1C3Z A;  2EHB A;  1IRJ A;  3QRX A;  3I5H C;  2HPS A;  3GK1 A;  3A4U B;  1ZUZ A;  4MVF A;  4YGE B;  3SG2 A;  1K93 D;  1CNP A;  1YUU A;  1KFX L;  3O2P A;  2LHI A;  3AKB A;  2ZN8 A;  3CDN A;  1G33 A;  3BJH A;  1XK4 C;  3BFA A;  3PJI A;  2Q91 A;  1DJI A;  1UHJ A;  1T14 A;  3SS3 A;  1PVB A;  4F0Z B;  1QJT A;  2M29 A; 
#chains in the Genus database with same CATH homology
 5G08 A;  1RFJ A;  1S26 D;  1V1G A;  4YI9 A;  3SG5 A;  1CDN A;  1FPW A;  3OX6 A;  1AP4 A;  4ORC B;  3KO0 A;  5IBW A;  1AUI B;  1XFV O;  4NQG A;  2NLN A;  1JWD A;  1YRT B;  1E8A A;  1RRO A;  1M46 A;  2KFF A;  2JT8 A;  2LC5 A;  4N1F A;  4XJK A;  2D8N A;  2I18 A;  2K61 A;  4ZCV A;  5CSN A;  5KTY A;  1F70 A;  1YVH A;  2ZFD A;  1YX7 A;  1CFD A;  1OOJ A;  2BL0 B;  4OCI A;  3SJS A;  4GBA A;  3OB2 B;  5B8I B;  1F71 A;  1JSA A;  1NX1 A;  2KI4 C;  1FI6 A;  2KAY A;  2WCF A;  2CT9 A;  2LUX A;  3D0Y B;  5AEQ A;  1VRK A;  2Y1M A;  3PFV A;  2FOT A;  2I2R E;  1GGZ A;  3CLN A;  3D10 A;  1KCY A;  2MRD A;  1SMG A;  2JOJ A;  4U8D A;  3FWB A;  3SIB A;  3ZWH A;  1J7Q A;  1QVI Z;  1TN4 A;  3EK4 A;  2JRF A;  5J3X A;  4I5N B;  5HKW A;  4GGF A;  1BR4 B;  1IWQ A;  1IJ6 A;  1CKK A;  3PM8 A;  1CB1 A;  1KFU L;  1PK0 D;  2BCA A;  2K2F A;  3HX4 A;  3ZNI A;  2QAC A;  1B1G A;  1K9U A;  2CXJ A;  4DRW A;  1G8I A;  5D7F A;  2F3Y A;  1NSH A;  1XFU O;  2JT0 A;  3GOF A;  1TNX A;  1JC2 A;  2GGM A;  2ZRT A;  2COL B;  2G9B A;  2SAS A;  2L4H A;  4NDB A;  1J7P A;  2TN4 A;  3LLE A;  1B8L A;  2HF5 A;  1Y1U A;  4DS7 A;  1TNP A;  2P6B B;  2KGB C;  1CTR A;  1KWO C;  1L7Z A;  3PN7 C;  2KBI A;  2PVB A;  1NPQ A;  5HYD A;  4M2P A;  1Y0V H;  2EGD A;  2JNX A;  3GK2 A;  5AAN A;  1CFF A;  2AMI A;  4USL A;  4YGA A;  4MN0 A;  1KK7 Z;  2KAX A;  4AQJ A;  1CLB A;  4OV2 A;  1YUT A;  1XVJ A;  1XO5 A;  1QX2 A;  5TNC A;  4WQ2 A;  2KI6 D;  5F6T A;  1F4O A;  1K95 A;  4BY5 A;  2MHH A;  2L98 A;  1EXR A;  4CLN A;  3VRQ A;  4YGB B;  5CSF A;  4CFQ A;  1M39 A;  1B7T Y;  4QJ3 B;  3RLZ A;  1KFU S;  2BEC A;  4PE1 A;  2ZNE A;  1UHN A;  5DKN A;  3EK7 A;  3TDI A;  1XFX O;  1FW4 A;  1QXP A;  3JTD B;  1UUR A;  4WRI A;  4PE7 A;  2F8P A;  1SCV A;  2LVK A;  2Y4Q A;  1OMV A;  5KU1 A;  3IQO A;  1YR5 A;  1F8H A;  1MWN A;  3EVR A;  1Q80 A;  1NCY A;  2HQW A;  2RGI A;  3BUN B;  4PAL A;  1ODB A;  2JT3 A;  3LL8 B;  2F2O A;  1HT9 A;  1IKU A;  1GJY A;  2JTZ A;  2LP2 A;  4PHM A;  1QLK A;  3KEV A;  3EK8 A;  1Y6W A;  2NXQ A;  3MSE B;  4HSZ A;  2NCO A;  3BUM B;  1AK8 A;  1A75 B;  2LM5 A;  3NSK A;  3SG6 A;  1JBA A;  1A2X A;  3OX5 A;  4YI8 A;  1JFJ A;  1J55 A;  1UUS A;  1NIW A;  2M1K B;  2CNP A;  1TTX A;  3KHE A;  1JUO A;  5CSI A;  2KHN A;  4FTG A;  3SIA A;  2A4J A;  1SL9 A;  1BF5 A;  1DGV A;  1XFW O;  2ZND A;  2WCE A;  1NCZ A;  2M1U A;  1AJ4 A;  4MEW A;  4I5K A;  3ICB A;  1K94 A;  2OPO A;  1SBJ A;  3K21 A;  3TDZ A;  1DJG A;  1ZFS A;  1CDL A;  3JVT B;  4CPV A;  1QTX A;  5KSZ A;  1TRF A;  1SL8 A;  2K2A A;  2JC2 A;  3EVV A;  4HRE E;  1RK9 A;  4DCK A;  1XFZ O;  3OHM B;  3WNX B;  1NYA A;  5D69 A;  5DKR A;  2Y1N A;  3DVK A;  2IS9 A;  3HCM A;  1C7V A;  5AFP A;  4TNC A;  4PHK A;  2BE6 A;  2M7L A;  2PAL A;  2LAP A;  2KSP A;  1CDP A;  2H61 A;  4I5J A;  3SG3 A;  3TZ1 A;  5HLV A;  1KQV A;  4OVN F;  3VGO A;  2M3W A;  1SCM B;  2JTT A;  1YVL A;  1SY9 A;  1DJY A;  1M31 A;  1S36 A;  2M9G A;  3DVE A;  3FWC A;  1BU3 A;  1F55 A;  2BL0 C;  1YTZ C;  1B7T Z;  2L0P A;  5I2Q A;  1JF2 A;  2I94 A;  3M0W A;  1NCX A;  2L2E A;  1AJ5 A;  4C0L A;  2LHL A;  4YGD B;  1TNQ A;  2L5X B;  2M8U A;  1J7R A;  1KSM A;  1S6C A;  1A75 A;  4ORB B;  1BJF A;  1LVC D;  1GQM A;  3RM1 A;  4MZK A;  1TCO B;  3TUY B;  3TUY C;  2R2I A;  1QAT A;  2OTG B;  2KYF A;  2OTG C;  1JFK A;  4HRH A;  4ICB A;  2MJW B;  1Y1A A;  3F45 A;  1BOC A;  1OQP A;  2GV5 A;  2LMT A;  1J7O A;  4WQ3 A;  1LIN A;  3CS1 A;  4M2Q A;  4GFT A;  3OP0 A;  1DVI A;  1PAL A;  2JQ6 A;  2PAS A;  2WC8 A;  4XYN A;  1MQ1 A;  2OS8 B;  4PHN A;  5FYX A;  1EG3 A;  1NX3 A;  2K7O A;  4P2Y B;  1DTL A;  1IJ5 A;  1BR1 B;  4UPG A;  4I5L B;  3TS5 B;  1DGU A;  3TS5 C;  1EH2 A;  1N65 A;  1HQV A;  1KK8 B;  2F2P A;  1KK8 C;  1IQ5 A;  2JPT A;  1YUR A;  1K90 D;  5GQQ C;  3AAJ A;  1BG1 A;  1WLM A;  3WXA A;  2H2K A;  2SCP A;  3C1V A;  4GNK B;  2JNF A;  1FF1 A;  4OR9 B;  1W7I B;  3EVU A;  4CID A;  1SPY A;  3BOW B;  1CLM A;  1JF0 A;  3H4S E;  1IGV A;  2KAV A;  3CWG A;  4IL1 A;  1EJ3 A;  1SK6 D;  1WDC B;  2EC6 B;  3EKH A;  1WDC C;  2BKI B;  4JWQ A;  1IQ3 A;  4PDZ A;  2KYC A;  1NX2 A;  3BUX B;  3CR4 X;  2KFG A;  2KQ6 A;  2L50 A;  1WRL A;  3NSI A;  1WY9 A;  1DF0 B;  2LAN A;  1ALV A;  2WND A;  1S6I A;  2ZRS A;  3E3R A;  1FI5 A;  2Y5I A;  4D1E A;  1W7J B;  1RJV A;  4GAO A;  2KNE A;  1MUX A;  4N1G A;  1H4B A;  1Y1X A;  2V53 A;  1D1O A;  3JTD C;  2PSR A;  5K89 A;  1L2O B;  1MXE A;  3VRR A;  2FJU B;  2KFH A;  2MLE C;  1U5I A;  5I2O A;  2BCB A;  1OMD A;  1CMF A;  1WRZ A;  1ZAC A;  2KOT A;  4ZCU A;  4PE0 A;  2MA2 A;  5I8N A;  4DIR A;  1UHI A;  1J1D A;  2BE4 A;  3PAL A;  2HQ8 A;  2NZ0 A;  1QAS A;  3DVM A;  3BUO B;  2E30 A;  1OSA A;  1EL4 A;  1A03 A;  3BUW B;  1PUL A;  1QV0 A;  1PSR A;  2G2B A;  1BMO A;  4MZJ A;  4C0K A;  1FBV A;  4A4C A;  5ER4 X;  3I5F B;  4JPZ B;  2MAZ A;  3BOW A;  1B4C A;  1H8B A;  2MBX A;  1WLZ A;  2PRU A;  1QX5 B;  2WCB A;  1M45 A;  2FCD A;  1DJH A;  2HET A;  4YRU A;  4GGF C;  1SNL A;  3AAK A;  3CR2 A;  1M63 B;  1SL7 A;  2JXC A;  1DF0 A;  4PHJ A;  3PSR A;  1OZS A;  1QIW A;  2JXL A;  2M49 B;  3KF9 A;  4P5O E;  5DKQ A;  3JVT C;  5BPJ A;  2K7D A;  2LP3 A;  3DVJ A;  1BT6 A;  5PAL A;  2FCE A;  1QIV A;  3O6B A;  3I5H B;  3GK4 X;  2LUC A;  3LK1 A;  1YUS A;  1K9P A;  1B8R A;  2LNK A;  2LLS A;  1G4Y R;  5ER5 A;  3A8R A;  4QJ4 B;  2ZN9 A;  1SCM C;  3IF7 A;  1PSB A;  1V1F A;  3NSL A;  3KPX A;  2LE9 B;  4MBE A;  4FQO A;  3FIA A;  1XYD A;  4GPL B;  3DF0 B;  3BYA A;  5AXI A;  1DJW A;  1PRW A;  2KI6 C;  3NSO A;  1DT7 B;  1CMG A;  5I2L A;  2Q4U A;  1KK7 Y;  1LKJ A;  1R2U A;  3BQ3 A;  1S1E A;  1SYM A;  1LA0 A;  2QPT A;  1SKT A;  2F33 A;  2LVJ A;  2MLF C;  4GUK A;  1IH0 A;  1QLS A;  4MLW A;  1B9A A;  4NDD A;  3O78 A;  1MF8 B;  5AER A;  2K8M B;  2K7B A;  4N5X A;  2WOS A;  1XA5 A;  1UHK A;  4L9M A;  2LV7 A;  1CLL A;  1AHR A;  3EKJ A;  4E68 A;  1N2D A;  1YRU B;  1QV1 A;  5JJG A;  3OB1 B;  2CTN A;  2M7N A;  1ALW A;  2E6W A;  2M97 A;  2KI4 B;  2BBN A;  4MSP A;  1BOD A;  5HLO A;  3SG7 A;  1S3P A;  2VRG A;  5CPV A;  2JU0 A;  1DMO A;  2OS8 C;  1U5I B;  2F3Z A;  2KDH A;  2KQY A;  1S5G Y;  1A29 A;  1IG5 A;  4DUQ A;  1KFX S;  1CM1 A;  5JOL A;  1C07 A;  1KSO A;  3VRN A;  1XK4 A;  2O5G A;  2JUL A;  3LCP C;  4YBH B;  1TCF A;  1LXF C;  1K9K A;  3CTN A;  1PVA A;  3DF0 A;  1RWY A;  1KQM B;  1KQM C;  3IQQ A;  4M2O A;  1K8U A;  2NCP A;  2ISD A;  2LVV A;  1LA3 A;  4QJ5 B;  3AKA A;  1S6J A;  2EC6 C;  1RTP 1;  1TNW A;  1CM4 A;  1N0Y A;  2I7A A;  1SR6 B;  1SR6 C;  3I5I B;  1REC A;  3I5I C;  3SG4 A;  1MHO A;  1UP5 A;  1BLQ A;  1A4P A;  1B47 A;  4OKH A;  1C7W A;  1UHH A;  3O4Y A;  2JWW A;  2LLU A;  2WOR A;  4AQI A;  1EG4 A;  1KWO B;  3PN7 B;  3WHT B;  1SRA A;  1NUB A;  1NWD A;  1NX0 A;  4MRX A;  2KBM A;  2GGZ A;  4PCW A;  3CZT X;  3VRO A;  4C0J A;  4NDC A;  2AUC A;  2LCP A;  2M0R A;  3DD4 A;  4AOM A;  2O60 A;  4R1E A;  2BCX A;  2LVI A;  3D0Y A;  1L2O C;  2H61 C;  1QX7 A;  4YGC B;  3PAT A;  3I5G B;  3I5G C;  2B1U A;  2PMY A;  4ORA B;  1GGW A;  1DJZ A;  3CGA A;  4MRY A;  1SW8 A;  2JZI A;  3WHU B;  1OMR A;  1X02 A;  1J1E A;  4CFR A;  1OE9 B;  3BXK A;  3NXA A;  1CFC A;  3TDU A;  1DJX A;  1NP8 A;  5HKY A;  1WRK A;  1ZOT B;  1AVS A;  2BBM A;  2K0J A;  4JQ0 D;  2LLT A;  3I5F C;  4GGN A;  2LMU A;  2LMV A;  3LK0 A;  1R6P A;  4ETO A;  1B8C A;  2AAO A;  1OZO A;  1K96 A;  1TOP A;  2CBL A;  5CSJ A;  4XJK B;  1QVI Y;  1QS7 A;  4PE4 A;  1S5G Z;  4Q04 A;  4BY4 A;  4HRG A;  2ZKM X;  2DOQ A;  1CDM A;  2BKH B;  1TIZ A;  2K7C A;  4MZL A;  1F54 A;  3VRP A;  5HKZ A;  3CR5 X;  1K2H A;  1MR8 A;  2L51 A;  2L4I A;  1XFY O;  1F4Q A;  1YX8 A;  4A4B A;  1CFP A;  2CCM A;  1MXL C;  1UWO A;  2KGR A;  1ZMZ A;  3FS7 A;  3PLF B;  2EHB A;  1IRJ A;  3QRX A;  3I5H C;  2HPS A;  3GK1 A;  3A4U B;  1ZUZ A;  4MVF A;  4YGE B;  3SG2 A;  1K93 D;  1CNP A;  1YUU A;  1KFX L;  3O2P A;  2LHI A;  3AKB A;  2ZN8 A;  1G33 A;  1XK4 C;  2Q91 A;  1DJI A;  1UHJ A;  1PVB A;  4F0Z B;  1QJT A;  2M29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...