2RGIA

Crystal structure of ca2+-free s100a2 at 1.6 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
b'MSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A2
publication title Crystal structure of Ca2+ -free S100A2 at 1.6-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2rgiA00
2P6BB 2KBIA 4GGNA 1Q80A 1SCVA 1TNXA 3DVEA 2KGRA 2F2OA 5ER4X 4AQJA 1RFJA 1BT6A 2FOTA 1XYDA 3EK4A 1KWOB 2K0JA 2MJWB 4MN0A 4PHMA 1J7RA 2LLSA 2NLNA 3FIAA 4GGFA 5K89A 1CKKA 1NPQA 3VRNA 1LA3A 3WNXB 4GGFC 1OZOA 2JQ6A 2Y5IA 1V1FA 1EG4A 1IG5A 2Q4UA 1CDMA 4PALA 2L5XB 3CZTX 2LAPA 3OHMB 5KU1A 4PHJA 2A4JA 1OQPA 1F4QA 1UURA 5KSZA 3SJSA 2KAXA 1KCYA 1XK4A 5PALA 1QV0A 4NQGA 1K90D 2G9BA 3NXAA 1XK4C 2LANA 4FQOA 4JWQA 2M49B 1ZUZA 2JXCA 2K2AA 2H61A 1F8HA 3GOFA 4F0ZB 1G8IA 4NDDA 5HLOA 2H61C 3OX6A 2KNEA 4WQ3A 2F3ZA 1NP8A 4OV2A 5D69A 3SIBA 1F71A 3PM8A 2BBMA 4TNCA 2HQ8A 1SCMB 2JULA 1BMOA 3EVRA 4YGDB 1IQ5A 1N2DA 5AEQA 2E30A 3BOWA 1CFDA 4MBEA 1K95A 2BE6A 1JWDA 4YI8A 1UHNA 2JU0A 1KK8C 1CB1A 1YTZC 1ZFSA 2KI6C 1IJ5A 1XFUO 1IRJA 4N5XA 4MLWA 1S6JA 2LHLA 1NX1A 1SY9A 3IQOA 1AJ4A 2GGMA 2Y1NA 4BY5A 1RJVA 1SMGA 2I2RE 1KQMC 4GAOA 1SL7A 1YUSA 2NCPA 1XFYO 3FS7A 2GGZA 4DIRA 1KFXL 5DKRA 3EVVA 3CR5X 4CFRA 3GK2A 1K93D 2KFFA 1C7WA 1Y6WA 2Y1MA 2KI6D 3JVTB 2KOTA 1NCXA 2JWWA 2JNXA 3CR4X 3NSKA 3PN7B 1QLKA 1BG1A 1DGUA 1IJ6A 5DKNA 2JOJA 1M39A 1GGZA 1M46A 3JTDC 5HKWA 2BCAA 2ZRSA 1YURA 2BL0C 1BR4B 1DF0A 4XYNA 1V1GA 1M45A 1KSOA 2V53A 4PE1A 3CTNA 1IH0A 2QPTA 2BCBA 3DD4A 4Q04A 4R1EA 2LUCA 2OPOA 3RLZA 1QVIZ 1CLBA 1SL9A 1CDNA 1QIWA 2L4IA 1J55A 2ZNEA 2ZFDA 2HQWA 3BUWB 1GGWA 5AERA 3TUYC 3HX4A 1SRAA 2MA2A 1F4OA 2MBXA 3SG7A 2LVJA 5JJGA 1M63B 1B4CA 2LLTA 2MHHA 2LP2A 1UP5A 1KK7Z 4GBAA 4YI9A 1FF1A 1DJGA 2L98A 4GNKB 5JOLA 1QTXA 2LLUA 2WOSA 5HYDA 5G08A 2CTNA 4QJ5B 1XFXO 4GFTA 3KHEA 1PRWA 1CFFA 3LL8B 3NSIA 5FYXA 2LE9B 3HCMA 2BKHB 1TTXA 1W7IB 2NCOA 4ETOA 1H8BA 3VROA 3PALA 3OX5A 1A75A 1B47A 3VGOA 4DS7A 3VRPA 5IBWA 1SYMA 1CMFA 1OSAA 1TCOB 3EVUA 1Y1UA 1MF8B 1Y0VH 2LVKA 4C0JA 1CDLA 1RK9A 4PE0A 4I5NB 3SG5A 2JT8A 2WNDA 3CR2A 1Y1XA 4C0LA 1DJXA 1EJ3A 1A03A 3RM1A 1J7OA 3TS5C 1PSRA 2NXQA 1M31A 4YGBB 1KK8B 1RROA 1WRZA 2OTGC 3OP0A 1EL4A 1BR1B 1PULA 1FI6A 1E8AA 3PSRA 2MRDA 1KQMB 4NDBA 2E6WA 3AKAA 2L50A 1LXFC 2LUXA 3DVMA 1NX3A 3PLFB 2I18A 3SG2A 4QJ4B 1K96A 2WCBA 2ZN8A 3TDZA 4M2PA 2FCDA 3KF9A 1QVIY 1J7PA 2PASA 2I7AA 5J3XA 5GQQC 1CFPA 2AUCA 2GV5A 2MLEC 1YR5A 2VRGA 3BXKA 2L0PA 1OE9B 3SG4A 2JTZA 4HRGA 1KSMA 3E3RA 2SASA 1KK7Y 1XFZO 3H4SE 1DMOA 5DKQA 2RGIA 2LVVA 3NSLA 3VRRA 4CIDA 2WC8A 1DJHA 2CT9A 4N1GA 2TN4A 4QJ3B 1SBJA 1DF0B 2WORA 3I5HC 5CSFA 2PVBA 1UHIA 3K21A 1MXEA 1QXPA 3DF0B 1TNPA 2K7BA 1L2OC 1NX0A 1B1GA 1PSBA 1PVBA 1SL8A 2AMIA 1QATA 4MZKA 1A4PA 3KO0A 4IL1A 1WDCB 1QX7A 1R6PA 2ZN9A 3LLEA 1K2HA 1UHHA 2Q91A 1B9AA 1SR6B 3EK7A 1S1EA 1IWQA 5CSIA 1JSAA 1YX7A 3F45A 1J1DA 1BF5A 2KQYA 2KSPA 3O4YA 1DTLA 3BUNB 5BPJA 1JBAA 2K8MB 2MLFC 4HSZA 1G4YR 1TOPA 4U8DA 2HF5A 4DUQA 2ZNDA 5I8NA 2KDHA 3CLNA 4MEWA 3TDUA 2NZ0A 4XJKB 1PVAA 3LK0A 3OB2B 2M0RA 2PSRA 4MVFA 1G33A 1S6CA 1OZSA 2KFGA 2OS8C 1IKUA 3PFVA 1TN4A 2M1UA 2F8PA 1EH2A 1QIVA 3I5IC 1CLLA 4MZLA 1XA5A 3D0YA 2LV7A 4GUKA 4CLNA 2OTGB 1BJFA 4AOMA 2FJUB 4BY4A 2CXJA 1KFXS 2SCPA 3I5FC 4ZCVA 2KYFA 2M29A 3EKHA 1QLSA 4A4CA 1VRKA 4NDCA 1ALVA 3SG6A 1GJYA 1FW4A 1UUSA 4ICBA 4I5KA 1B7TZ 1SW8A 2BBNA 1UHKA 1JF2A 1NUBA 1HT9A 1WLMA 1NIWA 2LMUA 5CPVA 1LINA 3O6BA 1C07A 1LA0A 3WHUB 2LHIA 4OCIA 1A2XA 4OVNF 1TCFA 1WRLA 4PDZA 1NCYA 3C1VA 4JPZB 1ODBA 1YX8A 1S36A 1OOJA 1WLZA 2PMYA 3I5HB 2BKIB 1ALWA 1TNWA 2O60A 4P2YB 2ZRTA 4I5JA 3A8RA 1L2OB 1AP4A 2KQ6A 5HLVA 1DT7B 1JUOA 1KFUS 1OMVA 1GQMA 2DOQA 3ZNIA 1Y1AA 5AANA 4ZCUA 1LVCD 4UPGA 1ZOTB 4I5LB 5I2OA 3KEVA 2WCFA 2PALA 4YGEB 3WXAA 3BOWB 2CCMA 1JF0A 4CFQA 3M0WA 3FWCA 2ISDA 4PE4A 1DJYA 2M8UA 1YVHA 1BODA 2IS9A 4PHNA 2M97A 1IGVA 2I94A 1X02A 1F54A 2HPSA 3JVTC 1MHOA 3BQ3A 1PALA 3PN7C 2K61A 1U5IA 1NCZA 5CSJA 1B8RA 1N0YA 2COLB 5HKYA 1SPYA 2KI4C 4FTGA 4OR9B 4CPVA 2LVIA 4JQ0D 1K94A 1WY9A 1AHRA 2HETA 2M3WA 4MRYA 2LC5A 1N65A 2OS8B 4M2QA 3JTDB 3IF7A 1BU3A 1CLMA 1XO5A 2R2IA 4YBHB 1S5GZ 2BL0B 3EKJA 3BUOB 1B7TY 3I5IB 2BE4A 2BCXA 2F2PA 4USLA 3D0YB 4WRIA 3WHTB 1J7QA 3I5FB 5I2LA 2LM5A 4YRUA 1RWYA 3TUYB 1QASA 1AUIB 2KYCA 1DVIA 2K7DA 1F55A 1JFKA 5B8IB 1NYAA 3I5GC 2QACA 2EC6C 1FBVA 2G2BA 2D8NA 3EK8A 4MZJA 1BOCA 5KTYA 1CMGA 3DVKA 3CS1A 4MSPA 1XVJA 2F3YA 3AKBA 1OMRA 2CNPA 2K7OA 2L2EA 1LKJA 1YUTA 1MUXA 2M7NA 2EHBA 2H2KA 4ORCB 2M7LA 1IQ3A 4MRXA 1DJWA 3A4UB 2JTTA 5I2QA 1L7ZA 2KAVA 3D10A 1B8CA 1K9PA 1YRUB 3O2PA 4DCKA 3PATA 1A75B 1QJTA 4AQIA 1R2UA 3MSEB 1FPWA 4ORAB 2FCEA 2BECA 1QX5B 2F33A 4P5OE 2LP3A 3SIAA 1XFWO 1S26D 1AVSA 1ZACA 1EXRA 1QV1A 2EGDA 1KWOC 2JZIA 1EG3A 3OB1B 5HKZA 2LCPA 4M2OA 1W7JB 1PK0D 3TS5B 3VRQA 2KAYA 4DRWA 1K9UA 1UHJA 1MQ1A 1TNQA 2CBLA 1AK8A 2WCEA 3SG3A 5ER5A 1CTRA 2MAZA 4L9MA 2JC2A 4A4BA 3NSOA 1S5GY 3BUXB 1WRKA 3TDIA 1MXLC 2AAOA 2K7CA 1J1EA 1OMDA 1H4BA 1U5IB 1MR8A 2JPTA 2JT0A 2L51A 3KPXA 5F6TA 5TNCA 1CFCA 2KI4B 1JFJA 4C0KA 2KFHA 3GK4X 1C7VA 1BLQA 1D1OA 3CWGA 1K8UA 1XFVO 1ZMZA 2PRUA 4YGCB 3DF0A 3BYAA 4WQ2A 2L4HA 3ICBA 4PCWA 1YVLA 1KQVA 2M9GA 2LNKA 2ZKMX 2O5GA 3IQQA 1SCMC 2JNFA 4N1FA 5AFPA 3TZ1A 1F70A 3DVJA 3QRXA 1CM4A 1TIZA 1SKTA 3CGAA 1B8LA 3GK1A 5CSNA 1WDCC 2LMTA 1DGVA 1QS7A 4PE7A 1UWOA 1CM1A 3AAKA 1AJ5A 1KFUL 3LK1A 4D1EA 2B1UA 4GPLB 4ORBB 2JRFA 1RTP1 1S3PA 2LMVA 1SK6D 3BUMB 2JT3A 1SR6C 1YRTB 3AAJA 2K2FA 3LCPC 1RECA 3I5GB 3O78A 1JC2A 2EC6B 1HQVA 1YUUA 1DJZA 5D7FA 1SNLA 4HRHA 1DJIA 1MWNA 1K9KA 1FI5A 4HREE 1CNPA 1S6IA 2KBMA 2KHNA 2Y4QA 1TRFA 2KGBC 4XJKA 4E68A 1A29A 3FWBA 4PHKA 1NX2A 3ZWHA 1NWDA 1QX2A 4YGAA 2JXLA 1CDPA 2M1KB 5AXIA 4OKHA 1NSHA
chains in the Genus database with same CATH superfamily
2P6BB 2KBIA 4GGNA 3IVTA 1Q80A 1SCVA 1TNXA 3DVEA 2KGRA 2F2OA 3SS4A 5ER4X 4AQJA 1RFJA 1BT6A 2FOTA 1XYDA 3EK4A 3NHTA 1KWOB 2K0JA 2MJWB 4MN0A 4PHMA 1J7RA 2LLSA 2NLNA 3FIAA 4GGFA 5K89A 1CKKA 1NPQA 3VRNA 1LA3A 3WNXB 4GGFC 1OZOA 2JQ6A 2Y5IA 1V1FA 1EG4A 1IG5A 2Q4UA 1CDMA 3SS3A 4PALA 2L5XB 3CZTX 2LAPA 3OHMB 5KU1A 1C3ZA 4PHJA 2A4JA 5FI7A 1OQPA 1F4QA 1UURA 5KSZA 3SJSA 2KAXA 1OOHA 1KCYA 1XK4A 5PALA 3CZ0A 1QV0A 4NQGA 1K90D 2G9BA 3NXAA 1XK4C 3PM2A 2LANA 4FQOA 4JWQA 2M49B 1ZUZA 2JXCA 2K2AA 3CABA 2H61A 1F8HA 3GOFA 4F0ZB 1G8IA 1TUZA 4NDDA 5HLOA 2H61C 3OX6A 2KNEA 4WQ3A 2F3ZA 1NP8A 4OV2A 5D69A 3SIBA 1F71A 1LS8A 3PM8A 2BBMA 4TNCA 1Z4HA 2HQ8A 1SCMB 2JULA 1BMOA 3EVRA 4YGDB 1IQ5A 1N2DA 5AEQA 2E30A 1XFRA 1CFDA 3BOWA 4MBEA 1K95A 2BE6A 1JWDA 4YI8A 1UHNA 2JU0A 1KK8C 1CB1A 1YTZC 1ZFSA 2KI6C 1IJ5A 1XFUO 1IRJA 4N5XA 4MLWA 1S6JA 2LHLA 1NX1A 1SY9A 3IQOA 1AJ4A 2GGMA 2Y1NA 4BY5A 1RJVA 1SMGA 3D75A 2I2RE 1KQMC 1DELA 3BFAA 4GAOA 1SL7A 1YUSA 2NCPA 1XFYO 3FS7A 3SS5A 2FJYA 2GGZA 4DIRA 1KFXL 5DKRA 3CZ1A 3CR5X 3EVVA 4CFRA 3GK2A 1K93D 2KFFA 1C7WA 1Y6WA 2Y1MA 2KI6D 3JVTB 2KOTA 1NCXA 2JWWA 2JNXA 3CR4X 2GTEA 3NSKA 1QLKA 2H8VA 3PN7B 1BG1A 1DGUA 1IJ6A 5DKNA 2JOJA 1M39A 1GGZA 1M46A 3JTDC 5HKWA 2BCAA 2ZRSA 3EG5B 1YURA 2BL0C 1BR4B 1DF0A 4KYNA 1V1GA 1M45A 1KSOA 2V53A 4PE1A 3CTNA 4XYNA 1IH0A 2QPTA 2BCBA 3DD4A 4Q04A 4R1EA 3FE8A 2LUCA 2OPOA 3RLZA 1QVIZ 1CLBA 1SL9A 1CDNA 1QIWA 2L4IA 1J55A 2ZNEA 2KLDA 2ZFDA 2HQWA 3BUWB 1GGWA 5AERA 2QDIA 3TUYC 3HX4A 1SRAA 2MA2A 3L4AA 1F4OA 2MBXA 3SG7A 2LVJA 5JJGA 1M63B 1B4CA 2LLTA 2MHHA 2LP2A 1UP5A 1KK7Z 4GBAA 4YI9A 1FF1A 1DJGA 2L98A 4GNKB 5JOLA 1QTXA 2LLUA 2WOSA 5HYDA 5G08A 2CTNA 4QJ5B 1XFXO 4GFTA 3KHEA 1PRWA 1CFFA 3LL8B 1Z2CB 1TUJA 3O4XA 3NSIA 5FYXA 2LE9B 2QEOA 3HCMA 2BKHB 3N7HA 1TTXA 1W7IB 2NCOA 4ETOA 1H8BA 3VROA 3PALA 3OX5A 1A75A 1B47A 3VGOA 4DS7A 1OOGA 3VRPA 3DY9A 1SYMA 5IBWA 1CMFA 1OSAA 1TCOB 3EVUA 1Y1UA 1MF8B 1Y0VH 2LVKA 4C0JA 1CDLA 1RK9A 3OBVA 4I5NB 4PE0A 2JT8A 3SG5A 1TWOA 2WNDA 3CR2A 2QEBA 1DEKA 1Y1XA 1DJXA 1EJ3A 4C0LA 3RM1A 1A03A 1J7OA 3TS5C 1PSRA 2NXQA 1M31A 4YGBB 1KK8B 1RROA 2BNXA 1WRZA 2OTGC 3CZ2A 3OP0A 1EL4A 1BR1B 1PULA 3DXLA 1E8AA 1FI6A 3PSRA 2MRDA 1KQMB 4NDBA 2E6WA 3AKAA 2L50A 1LXFC 2LUXA 3DVMA 1NX3A 3PLFB 2I18A 3SG2A 3VB1A 4QJ4B 1K96A 1QWVA 2WCBA 2ZN8A 3TDZA 4M2PA 2FCDA 3KF9A 1QVIY 1J7PA 2PASA 2I7AA 5J3XA 5GQQC 1CFPA 2AUCA 2GV5A 2MLEC 3B87A 1YR5A 2VRGA 3BXKA 2L0PA 1DQEA 1OE9B 2JTZA 4HRGA 1SSEB 1KSMA 4INXA 3E3RA 3SG4A 2SASA 1KK7Y 3Q8IA 1XFZO 3H4SE 1DMOA 5DKQA 2RGIA 2LVVA 3NSLA 3VRRA 4CIDA 2WC8A 1DJHA 2CT9A 4N1GA 2TN4A 4QJ3B 1SBJA 1DF0B 2WORA 3I5HC 5CSFA 2PVBA 1UHIA 3K21A 1MXEA 1QXPA 3DF0B 1TNPA 2K7BA 1L2OC 1NX0A 1B1GA 1PSBA 1PVBA 1SL8A 2AMIA 1QATA 3RZSA 4MZKA 1A4PA 3KO0A 4IL1A 1WDCB 1QX7A 1R6PA 2L5YA 2ZN9A 3LLEA 1K2HA 1UHHA 2Q91A 1B9AA 1OOIX 3D77A 3CDNA 1SR6B 3EK7A 1S1EA 1IWQA 5CSIA 1JSAA 1YX7A 3F45A 2JPOA 1J1DA 1BF5A 2KLEA 2KQYA 2KSPA 3O4YA 1DTLA 3BUNB 5BPJA 1JBAA 2K8MB 2MLFC 4HSZA 1G4YR 1TOPA 2WCJA 2HF5A 4U8DA 2WCKA 4DUQA 2ZNDA 3DZTA 2KDHA 3CLNA 5I8NA 4MEWA 3TDUA 2NZ0A 4XJKB 1PVAA 3LK0A 3OB2B 2M0RA 2PSRA 3CYZA 4MVFA 1G33A 1S6CA 1OZSA 2KFGA 2OS8C 1IKUA 3PFVA 1OOFA 1TN4A 2M1UA 2F8PA 1EH2A 3OGNA 1QIVA 3I5IC 1CLLA 4MZLA 1XA5A 3D0YA 2LV7A 3FE6A 4GUKA 4CLNA 2OTGB 1BJFA 4AOMA 2FJUB 4BY4A 2CXJA 1KFXS 2SCPA 3I5FC 4ZCVA 3BFHA 2KYFA 2M29A 3EKHA 1QLSA 3S0GA 1VRKA 4A4CA 2QEVA 4NDCA 3DYEA 3D76A 1ALVA 3SG6A 1GJYA 3R1PA 1FW4A 1P28A 1UUSA 4ICBA 4I5KA 1B7TZ 1SW8A 2BAPA 2BBNA 1UHKA 1JF2A 1NUBA 1HT9A 1WLMA 3B7AA 1NIWA 2LMUA 3D74A 2WCMA 1LINA 3O6BA 5CPVA 1C07A 1LA0A 3WHUB 2LHIA 4OCIA 1A2XA 3S0EA 4OVNF 1TCFA 1WRLA 4PDZA 1NCYA 3C1VA 4JPZB 1ODBA 1YX8A 1S36A 1OOJA 1WLZA 2PMYA 3I5HB 2BKIB 1ALWA 1TNWA 2O60A 4P2YB 2ZRTA 4I5JA 3A8RA 1L2OB 3L47A 1AP4A 2KQ6A 5HLVA 4IJ7A 2ERBA 3S0FA 1DT7B 1JUOA 1KFUS 1OMVA 1GQMA 2DOQA 5DICA 3ZNIA 1Y1AA 5AANA 4ZCUA 1LVCD 1C3YA 4UPGA 1ZOTB 4I5LB 3D73A 5I2OA 3KEVA 2WC5A 5D3OA 4OZDA 2WCFA 2PYQA 2PALA 4YGEB 3WXAA 3BOWB 2CCMA 2L2CA 1JF0A 3S0AA 4CFQA 3M0WA 3FWCA 2ISDA 4PE4A 1DJYA 2M8UA 3PJIA 1YVHA 5FI2A 3S0DA 2IS9A 1BODA 4PHNA 2M97A 1IGVA 2QEHA 2I94A 1X02A 1F54A 2HPSA 3JVTC 1MHOA 3BQ3A 1PALA 3PN7C 2K61A 1U5IA 1NCZA 5CSJA 1B8RA 1N0YA 2COLB 5HKYA 3FE9A 1SPYA 2KI4C 4FTGA 4OR9B 5EL2A 2LVIA 4JQ0D 1K94A 1WY9A 4CPVA 3R72A 1AHRA 2HETA 2M3WA 4MRYA 2LC5A 1N65A 2OS8B 2P70A 4M2QA 3JTDB 3IF7A 1BU3A 1CLMA 1XO5A 2R2IA 4YBHB 1S5GZ 2BL0B 3EKJA 3BUOB 1B7TY 3I5IB 4INWA 2BE4A 2BCXA 2K60A 2F2PA 4USLA 3BFBA 3D0YB 4WRIA 3WHTB 1J7QA 3I5FB 1W9ZA 2LM5A 5I2LA 4YRUA 1RWYA 3TUYB 2P71A 1QASA 1AUIB 2KYCA 3K1EA 1DVIA 2K7DA 1F55A 1JFKA 5B8IB 1NYAA 3I5GC 2QACA 2EC6C 1FBVA 2G2BA 2WCHA 2D8NA 3EK8A 4MZJA 1BOCA 4F7FA 5KTYA 1CMGA 2WCLA 3DVKA 3CS1A 3BJHA 4MSPA 1XVJA 2F3YA 3AKBA 1OMRA 2CNPA 2K7OA 2L2EA 1T14A 1LKJA 1YUTA 1MUXA 4JKTA 2M7NA 2EHBA 1ORGA 2H2KA 4ORCB 2M7LA 1IQ3A 4MRXA 1DJWA 3A4UB 2JTTA 3D78A 5I2QA 1L7ZA 2KAVA 3D10A 1B8CA 1K9PA 1YRUB 3O2PA 4DCKA 3S0BA 3PATA 1A75B 1QJTA 4AQIA 3B6XA 1R2UA 3MSEB 1FPWA 4ORAB 2FCEA 2WC6A 2BECA 1QX5B 2F33A 4P5OE 2LP3A 3SIAA 1XFWO 1S26D 1AVSA 1ZACA 1EXRA 1QV1A 2EGDA 1KWOC 2JZIA 1EG3A 3B86A 3OB1B 5HKZA 2LCPA 4M2OA 1W7JB 1PK0D 3TS5B 3VRQA 2KAYA 4DRWA 1K9UA 1UHJA 1MQ1A 1GM0A 1TNQA 3R1OA 1IIOA 2CBLA 1AK8A 2WCEA 3SG3A 5ER5A 1CTRA 2MAZA 4L9MA 2JC2A 3V2LA 3NSOA 1S5GY 3BUXB 4A4BA 4PT1A 1WRKA 3TDIA 1MXLC 2AAOA 2K7CA 1J1EA 1OMDA 1H4BA 1U5IB 1MR8A 2JPTA 5FI6A 2JT0A 2L51A 3KPXA 5F6TA 5TNCA 1CFCA 2KI4B 3R1VA 1JFJA 4C0KA 2KFHA 3GK4X 2PQLA 1C7VA 1BLQA 3UNWA 3CWGA 1K8UA 1XFVO 1ZMZA 2PRUA 4YGCB 1D1OA 3DF0A 3BYAA 3NHIA 4WQ2A 2L4HA 3ICBA 4PCWA 1YVLA 1KQVA 5I94A 2M9GA 2LNKA 2ZKMX 2O5GA 3IQQA 1SCMC 2JNFA 4N1FA 5AFPA 3TZ1A 1F70A 3DVJA 4JD9A 3QRXA 1CM4A 1TIZA 1SKTA 3CGAA 3UO9A 1B8LA 3GK1A 5CSNA 1WDCC 2LMTA 1DGVA 1QS7A 3NGVA 1UWOA 4PE7A 1CM1A 3AAKA 1AJ5A 1KFUL 3LK1A 4D1EA 5HL1A 2B1UA 4GPLB 4ORBB 2JRFA 1RTP1 1S3PA 2LMVA 2YGUA 1SK6D 3BUMB 2JT3A 1SR6C 1YRTB 3AAJA 2K2FA 3LCPC 1RECA 3I5GB 3O78A 1JC2A 2EC6B 4FQTA 1HQVA 1YUUA 1DJZA 5D7FA 1SNLA 4HRHA 1DJIA 1MWNA 1K9KA 1FI5A 4HREE 1CNPA 3QMEA 1S6IA 1OW4A 2KBMA 2KHNA 1TRFA 2KGBC 2Y4QA 2KPHA 3L4LA 4XJKA 1DC1A 4E68A 1A29A 3B88A 3FWBA 4PHKA 1NX2A 3ZWHA 1NWDA 1QX2A 4YGAA 2JXLA 1CDPA 2M1KB 5AXIA 4OKHA 1NSHA
chains in the Genus database with same CATH topology
2P6BB 2KBIA 4GGNA 1Q80A 1SCVA 1TNXA 3DVEA 2KGRA 2F2OA 5ER4X 4AQJA 1RFJA 1BT6A 2FOTA 1XYDA 3EK4A 1KWOB 2K0JA 2MJWB 4MN0A 4PHMA 1J7RA 2LLSA 2NLNA 3FIAA 4GGFA 5K89A 1CKKA 1NPQA 3VRNA 1LA3A 3WNXB 4GGFC 1OZOA 2JQ6A 2Y5IA 1V1FA 1EG4A 1IG5A 2Q4UA 1CDMA 4PALA 2L5XB 3CZTX 2LAPA 3OHMB 5KU1A 4PHJA 2A4JA 1OQPA 1F4QA 1UURA 5KSZA 3SJSA 2KAXA 1KCYA 1XK4A 5PALA 1QV0A 4NQGA 1K90D 2G9BA 3NXAA 1XK4C 2LANA 4FQOA 4JWQA 2M49B 1ZUZA 2JXCA 2K2AA 2H61A 1F8HA 3GOFA 4F0ZB 1G8IA 4NDDA 5HLOA 2H61C 3OX6A 2KNEA 4WQ3A 2F3ZA 1NP8A 4OV2A 5D69A 3SIBA 1F71A 3PM8A 2BBMA 4TNCA 2HQ8A 1SCMB 2JULA 1BMOA 3EVRA 4YGDB 1IQ5A 1N2DA 5AEQA 2E30A 3BOWA 1CFDA 4MBEA 1K95A 2BE6A 1JWDA 4YI8A 1UHNA 2JU0A 1KK8C 1CB1A 1YTZC 1ZFSA 2KI6C 1IJ5A 1XFUO 1IRJA 4N5XA 4MLWA 1S6JA 2LHLA 1NX1A 1SY9A 3IQOA 1AJ4A 2GGMA 2Y1NA 4BY5A 1RJVA 1SMGA 2I2RE 1KQMC 4GAOA 1SL7A 1YUSA 2NCPA 1XFYO 3FS7A 2GGZA 4DIRA 1KFXL 5DKRA 3EVVA 3CR5X 4CFRA 3GK2A 1K93D 2KFFA 1C7WA 1Y6WA 2Y1MA 2KI6D 3JVTB 2KOTA 1NCXA 2JWWA 2JNXA 3CR4X 3NSKA 3PN7B 1QLKA 1BG1A 1DGUA 1IJ6A 5DKNA 2JOJA 1M39A 1GGZA 1M46A 3JTDC 5HKWA 2BCAA 2ZRSA 1YURA 2BL0C 1BR4B 1DF0A 4XYNA 1V1GA 1M45A 1KSOA 2V53A 4PE1A 3CTNA 1IH0A 2QPTA 2BCBA 3DD4A 4Q04A 4R1EA 2LUCA 2OPOA 3RLZA 1QVIZ 1CLBA 1SL9A 1CDNA 1QIWA 2L4IA 1J55A 2ZNEA 2ZFDA 2HQWA 3BUWB 1GGWA 5AERA 3TUYC 3HX4A 1SRAA 2MA2A 1F4OA 2MBXA 3SG7A 2LVJA 5JJGA 1M63B 1B4CA 2LLTA 2MHHA 2LP2A 1UP5A 1KK7Z 4GBAA 4YI9A 1FF1A 1DJGA 2L98A 4GNKB 5JOLA 1QTXA 2LLUA 2WOSA 5HYDA 5G08A 2CTNA 4QJ5B 1XFXO 4GFTA 3KHEA 1PRWA 1CFFA 3LL8B 3NSIA 5FYXA 2LE9B 3HCMA 2BKHB 1TTXA 1W7IB 2NCOA 4ETOA 1H8BA 3VROA 3PALA 3OX5A 1A75A 1B47A 3VGOA 4DS7A 3VRPA 5IBWA 1SYMA 1CMFA 1OSAA 1TCOB 3EVUA 1Y1UA 1MF8B 1Y0VH 2LVKA 4C0JA 1CDLA 1RK9A 4PE0A 4I5NB 3SG5A 2JT8A 2WNDA 3CR2A 1Y1XA 4C0LA 1DJXA 1EJ3A 1A03A 3RM1A 1J7OA 3TS5C 1PSRA 2NXQA 1M31A 4YGBB 1KK8B 1RROA 1WRZA 2OTGC 3OP0A 1EL4A 1BR1B 1PULA 1FI6A 1E8AA 3PSRA 2MRDA 1KQMB 4NDBA 2E6WA 3AKAA 2L50A 1LXFC 2LUXA 3DVMA 1NX3A 3PLFB 2I18A 3SG2A 4QJ4B 1K96A 2WCBA 2ZN8A 3TDZA 4M2PA 2FCDA 3KF9A 1QVIY 1J7PA 2PASA 2I7AA 5J3XA 5GQQC 1CFPA 2AUCA 2GV5A 2MLEC 1YR5A 2VRGA 3BXKA 2L0PA 1OE9B 3SG4A 2JTZA 4HRGA 1KSMA 3E3RA 2SASA 1KK7Y 1XFZO 3H4SE 1DMOA 5DKQA 2RGIA 2LVVA 3NSLA 3VRRA 4CIDA 2WC8A 1DJHA 2CT9A 4N1GA 2TN4A 4QJ3B 1SBJA 1DF0B 2WORA 3I5HC 5CSFA 2PVBA 1UHIA 3K21A 1MXEA 1QXPA 3DF0B 1TNPA 2K7BA 1L2OC 1NX0A 1B1GA 1PSBA 1PVBA 1SL8A 2AMIA 1QATA 4MZKA 1A4PA 3KO0A 4IL1A 1WDCB 1QX7A 1R6PA 2ZN9A 3LLEA 1K2HA 1UHHA 2Q91A 1B9AA 1SR6B 3EK7A 1S1EA 1IWQA 5CSIA 1JSAA 1YX7A 3F45A 1J1DA 1BF5A 2KQYA 2KSPA 3O4YA 1DTLA 3BUNB 5BPJA 1JBAA 2K8MB 2MLFC 4HSZA 1G4YR 1TOPA 4U8DA 2HF5A 4DUQA 2ZNDA 5I8NA 2KDHA 3CLNA 4MEWA 3TDUA 2NZ0A 4XJKB 1PVAA 3LK0A 3OB2B 2M0RA 2PSRA 4MVFA 1G33A 1S6CA 1OZSA 2KFGA 2OS8C 1IKUA 3PFVA 1TN4A 2M1UA 2F8PA 1EH2A 1QIVA 3I5IC 1CLLA 4MZLA 1XA5A 3D0YA 2LV7A 4GUKA 4CLNA 2OTGB 1BJFA 4AOMA 2FJUB 4BY4A 2CXJA 1KFXS 2SCPA 3I5FC 4ZCVA 2KYFA 2M29A 3EKHA 1QLSA 4A4CA 1VRKA 4NDCA 1ALVA 3SG6A 1GJYA 1FW4A 1UUSA 4ICBA 4I5KA 1B7TZ 1SW8A 2BBNA 1UHKA 1JF2A 1NUBA 1HT9A 1WLMA 1NIWA 2LMUA 5CPVA 1LINA 3O6BA 1C07A 1LA0A 3WHUB 2LHIA 4OCIA 1A2XA 4OVNF 1TCFA 1WRLA 4PDZA 1NCYA 3C1VA 4JPZB 1ODBA 1YX8A 1S36A 1OOJA 1WLZA 2PMYA 3I5HB 2BKIB 1ALWA 1TNWA 2O60A 4P2YB 2ZRTA 4I5JA 3A8RA 1L2OB 1AP4A 2KQ6A 5HLVA 1DT7B 1JUOA 1KFUS 1OMVA 1GQMA 2DOQA 3ZNIA 1Y1AA 5AANA 4ZCUA 1LVCD 4UPGA 1ZOTB 4I5LB 5I2OA 3KEVA 2WCFA 2PALA 4YGEB 3WXAA 3BOWB 2CCMA 1JF0A 4CFQA 3M0WA 3FWCA 2ISDA 4PE4A 1DJYA 2M8UA 1YVHA 1BODA 2IS9A 4PHNA 2M97A 1IGVA 2I94A 1X02A 1F54A 2HPSA 3JVTC 1MHOA 3BQ3A 1PALA 3PN7C 2K61A 1U5IA 1NCZA 5CSJA 1B8RA 1N0YA 2COLB 5HKYA 1SPYA 2KI4C 4FTGA 4OR9B 4CPVA 2LVIA 4JQ0D 1K94A 1WY9A 1AHRA 2HETA 2M3WA 4MRYA 2LC5A 1N65A 2OS8B 4M2QA 3JTDB 3IF7A 1BU3A 1CLMA 1XO5A 2R2IA 4YBHB 1S5GZ 2BL0B 3EKJA 3BUOB 1B7TY 3I5IB 2BE4A 2BCXA 2F2PA 4USLA 3D0YB 4WRIA 3WHTB 1J7QA 3I5FB 5I2LA 2LM5A 4YRUA 1RWYA 3TUYB 1QASA 1AUIB 2KYCA 1DVIA 2K7DA 1F55A 1JFKA 5B8IB 1NYAA 3I5GC 2QACA 2EC6C 1FBVA 2G2BA 2D8NA 3EK8A 4MZJA 1BOCA 5KTYA 1CMGA 3DVKA 3CS1A 4MSPA 1XVJA 2F3YA 3AKBA 1OMRA 2CNPA 2K7OA 2L2EA 1LKJA 1YUTA 1MUXA 2M7NA 2EHBA 2H2KA 4ORCB 2M7LA 1IQ3A 4MRXA 1DJWA 3A4UB 2JTTA 5I2QA 1L7ZA 2KAVA 3D10A 1B8CA 1K9PA 1YRUB 3O2PA 4DCKA 3PATA 1A75B 1QJTA 4AQIA 1R2UA 3MSEB 1FPWA 4ORAB 2FCEA 2BECA 1QX5B 2F33A 4P5OE 2LP3A 3SIAA 1XFWO 1S26D 1AVSA 1ZACA 1EXRA 1QV1A 2EGDA 1KWOC 2JZIA 1EG3A 3OB1B 5HKZA 2LCPA 4M2OA 1W7JB 1PK0D 3TS5B 3VRQA 2KAYA 4DRWA 1K9UA 1UHJA 1MQ1A 1TNQA 2CBLA 1AK8A 2WCEA 3SG3A 5ER5A 1CTRA 2MAZA 4L9MA 2JC2A 4A4BA 3NSOA 1S5GY 3BUXB 1WRKA 3TDIA 1MXLC 2AAOA 2K7CA 1J1EA 1OMDA 1H4BA 1U5IB 1MR8A 2JPTA 2JT0A 2L51A 3KPXA 5F6TA 5TNCA 1CFCA 2KI4B 1JFJA 4C0KA 2KFHA 3GK4X 1C7VA 1BLQA 1D1OA 3CWGA 1K8UA 1XFVO 1ZMZA 2PRUA 4YGCB 3DF0A 3BYAA 4WQ2A 2L4HA 3ICBA 4PCWA 1YVLA 1KQVA 2M9GA 2LNKA 2ZKMX 2O5GA 3IQQA 1SCMC 2JNFA 4N1FA 5AFPA 3TZ1A 1F70A 3DVJA 3QRXA 1CM4A 1TIZA 1SKTA 3CGAA 1B8LA 3GK1A 5CSNA 1WDCC 2LMTA 1DGVA 1QS7A 4PE7A 1UWOA 1CM1A 3AAKA 1AJ5A 1KFUL 3LK1A 4D1EA 2B1UA 4GPLB 4ORBB 2JRFA 1RTP1 1S3PA 2LMVA 1SK6D 3BUMB 2JT3A 1SR6C 1YRTB 3AAJA 2K2FA 3LCPC 1RECA 3I5GB 3O78A 1JC2A 2EC6B 1HQVA 1YUUA 1DJZA 5D7FA 1SNLA 4HRHA 1DJIA 1MWNA 1K9KA 1FI5A 4HREE 1CNPA 1S6IA 2KBMA 2KHNA 2Y4QA 1TRFA 2KGBC 4XJKA 4E68A 1A29A 3FWBA 4PHKA 1NX2A 3ZWHA 1NWDA 1QX2A 4YGAA 2JXLA 1CDPA 2M1KB 5AXIA 4OKHA 1NSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6B B;  2KBI A;  4GGN A;  1Q80 A;  1SCV A;  1TNX A;  3DVE A;  2KGR A;  2F2O A;  5ER4 X;  4AQJ A;  1RFJ A;  1BT6 A;  2FOT A;  1XYD A;  3EK4 A;  1KWO B;  2K0J A;  2MJW B;  4MN0 A;  4PHM A;  1J7R A;  2LLS A;  2NLN A;  3FIA A;  4GGF A;  5K89 A;  1CKK A;  1NPQ A;  3VRN A;  1LA3 A;  3WNX B;  4GGF C;  1OZO A;  2JQ6 A;  2Y5I A;  1V1F A;  1EG4 A;  1IG5 A;  2Q4U A;  1CDM A;  4PAL A;  2L5X B;  3CZT X;  2LAP A;  3OHM B;  5KU1 A;  4PHJ A;  2A4J A;  1OQP A;  1F4Q A;  1UUR A;  5KSZ A;  3SJS A;  2KAX A;  1KCY A;  1XK4 A;  5PAL A;  1QV0 A;  4NQG A;  1K90 D;  2G9B A;  3NXA A;  1XK4 C;  2LAN A;  4FQO A;  4JWQ A;  2M49 B;  1ZUZ A;  2JXC A;  2K2A A;  2H61 A;  1F8H A;  3GOF A;  4F0Z B;  1G8I A;  4NDD A;  5HLO A;  2H61 C;  3OX6 A;  2KNE A;  4WQ3 A;  2F3Z A;  1NP8 A;  4OV2 A;  5D69 A;  3SIB A;  1F71 A;  3PM8 A;  2BBM A;  4TNC A;  2HQ8 A;  1SCM B;  2JUL A;  1BMO A;  3EVR A;  4YGD B;  1IQ5 A;  1N2D A;  5AEQ A;  2E30 A;  3BOW A;  1CFD A;  4MBE A;  1K95 A;  2BE6 A;  1JWD A;  4YI8 A;  1UHN A;  2JU0 A;  1KK8 C;  1CB1 A;  1YTZ C;  1ZFS A;  2KI6 C;  1IJ5 A;  1XFU O;  1IRJ A;  4N5X A;  4MLW A;  1S6J A;  2LHL A;  1NX1 A;  1SY9 A;  3IQO A;  1AJ4 A;  2GGM A;  2Y1N A;  4BY5 A;  1RJV A;  1SMG A;  2I2R E;  1KQM C;  4GAO A;  1SL7 A;  1YUS A;  2NCP A;  1XFY O;  3FS7 A;  2GGZ A;  4DIR A;  1KFX L;  5DKR A;  3EVV A;  3CR5 X;  4CFR A;  3GK2 A;  1K93 D;  2KFF A;  1C7W A;  1Y6W A;  2Y1M A;  2KI6 D;  3JVT B;  2KOT A;  1NCX A;  2JWW A;  2JNX A;  3CR4 X;  3NSK A;  3PN7 B;  1QLK A;  1BG1 A;  1DGU A;  1IJ6 A;  5DKN A;  2JOJ A;  1M39 A;  1GGZ A;  1M46 A;  3JTD C;  5HKW A;  2BCA A;  2ZRS A;  1YUR A;  2BL0 C;  1BR4 B;  1DF0 A;  4XYN A;  1V1G A;  1M45 A;  1KSO A;  2V53 A;  4PE1 A;  3CTN A;  1IH0 A;  2QPT A;  2BCB A;  3DD4 A;  4Q04 A;  4R1E A;  2LUC A;  2OPO A;  3RLZ A;  1QVI Z;  1CLB A;  1SL9 A;  1CDN A;  1QIW A;  2L4I A;  1J55 A;  2ZNE A;  2ZFD A;  2HQW A;  3BUW B;  1GGW A;  5AER A;  3TUY C;  3HX4 A;  1SRA A;  2MA2 A;  1F4O A;  2MBX A;  3SG7 A;  2LVJ A;  5JJG A;  1M63 B;  1B4C A;  2LLT A;  2MHH A;  2LP2 A;  1UP5 A;  1KK7 Z;  4GBA A;  4YI9 A;  1FF1 A;  1DJG A;  2L98 A;  4GNK B;  5JOL A;  1QTX A;  2LLU A;  2WOS A;  5HYD A;  5G08 A;  2CTN A;  4QJ5 B;  1XFX O;  4GFT A;  3KHE A;  1PRW A;  1CFF A;  3LL8 B;  3NSI A;  5FYX A;  2LE9 B;  3HCM A;  2BKH B;  1TTX A;  1W7I B;  2NCO A;  4ETO A;  1H8B A;  3VRO A;  3PAL A;  3OX5 A;  1A75 A;  1B47 A;  3VGO A;  4DS7 A;  3VRP A;  5IBW A;  1SYM A;  1CMF A;  1OSA A;  1TCO B;  3EVU A;  1Y1U A;  1MF8 B;  1Y0V H;  2LVK A;  4C0J A;  1CDL A;  1RK9 A;  4PE0 A;  4I5N B;  3SG5 A;  2JT8 A;  2WND A;  3CR2 A;  1Y1X A;  4C0L A;  1DJX A;  1EJ3 A;  1A03 A;  3RM1 A;  1J7O A;  3TS5 C;  1PSR A;  2NXQ A;  1M31 A;  4YGB B;  1KK8 B;  1RRO A;  1WRZ A;  2OTG C;  3OP0 A;  1EL4 A;  1BR1 B;  1PUL A;  1FI6 A;  1E8A A;  3PSR A;  2MRD A;  1KQM B;  4NDB A;  2E6W A;  3AKA A;  2L50 A;  1LXF C;  2LUX A;  3DVM A;  1NX3 A;  3PLF B;  2I18 A;  3SG2 A;  4QJ4 B;  1K96 A;  2WCB A;  2ZN8 A;  3TDZ A;  4M2P A;  2FCD A;  3KF9 A;  1QVI Y;  1J7P A;  2PAS A;  2I7A A;  5J3X A;  5GQQ C;  1CFP A;  2AUC A;  2GV5 A;  2MLE C;  1YR5 A;  2VRG A;  3BXK A;  2L0P A;  1OE9 B;  3SG4 A;  2JTZ A;  4HRG A;  1KSM A;  3E3R A;  2SAS A;  1KK7 Y;  1XFZ O;  3H4S E;  1DMO A;  5DKQ A;  2RGI A;  2LVV A;  3NSL A;  3VRR A;  4CID A;  2WC8 A;  1DJH A;  2CT9 A;  4N1G A;  2TN4 A;  4QJ3 B;  1SBJ A;  1DF0 B;  2WOR A;  3I5H C;  5CSF A;  2PVB A;  1UHI A;  3K21 A;  1MXE A;  1QXP A;  3DF0 B;  1TNP A;  2K7B A;  1L2O C;  1NX0 A;  1B1G A;  1PSB A;  1PVB A;  1SL8 A;  2AMI A;  1QAT A;  4MZK A;  1A4P A;  3KO0 A;  4IL1 A;  1WDC B;  1QX7 A;  1R6P A;  2ZN9 A;  3LLE A;  1K2H A;  1UHH A;  2Q91 A;  1B9A A;  1SR6 B;  3EK7 A;  1S1E A;  1IWQ A;  5CSI A;  1JSA A;  1YX7 A;  3F45 A;  1J1D A;  1BF5 A;  2KQY A;  2KSP A;  3O4Y A;  1DTL A;  3BUN B;  5BPJ A;  1JBA A;  2K8M B;  2MLF C;  4HSZ A;  1G4Y R;  1TOP A;  4U8D A;  2HF5 A;  4DUQ A;  2ZND A;  5I8N A;  2KDH A;  3CLN A;  4MEW A;  3TDU A;  2NZ0 A;  4XJK B;  1PVA A;  3LK0 A;  3OB2 B;  2M0R A;  2PSR A;  4MVF A;  1G33 A;  1S6C A;  1OZS A;  2KFG A;  2OS8 C;  1IKU A;  3PFV A;  1TN4 A;  2M1U A;  2F8P A;  1EH2 A;  1QIV A;  3I5I C;  1CLL A;  4MZL A;  1XA5 A;  3D0Y A;  2LV7 A;  4GUK A;  4CLN A;  2OTG B;  1BJF A;  4AOM A;  2FJU B;  4BY4 A;  2CXJ A;  1KFX S;  2SCP A;  3I5F C;  4ZCV A;  2KYF A;  2M29 A;  3EKH A;  1QLS A;  4A4C A;  1VRK A;  4NDC A;  1ALV A;  3SG6 A;  1GJY A;  1FW4 A;  1UUS A;  4ICB A;  4I5K A;  1B7T Z;  1SW8 A;  2BBN A;  1UHK A;  1JF2 A;  1NUB A;  1HT9 A;  1WLM A;  1NIW A;  2LMU A;  5CPV A;  1LIN A;  3O6B A;  1C07 A;  1LA0 A;  3WHU B;  2LHI A;  4OCI A;  1A2X A;  4OVN F;  1TCF A;  1WRL A;  4PDZ A;  1NCY A;  3C1V A;  4JPZ B;  1ODB A;  1YX8 A;  1S36 A;  1OOJ A;  1WLZ A;  2PMY A;  3I5H B;  2BKI B;  1ALW A;  1TNW A;  2O60 A;  4P2Y B;  2ZRT A;  4I5J A;  3A8R A;  1L2O B;  1AP4 A;  2KQ6 A;  5HLV A;  1DT7 B;  1JUO A;  1KFU S;  1OMV A;  1GQM A;  2DOQ A;  3ZNI A;  1Y1A A;  5AAN A;  4ZCU A;  1LVC D;  4UPG A;  1ZOT B;  4I5L B;  5I2O A;  3KEV A;  2WCF A;  2PAL A;  4YGE B;  3WXA A;  3BOW B;  2CCM A;  1JF0 A;  4CFQ A;  3M0W A;  3FWC A;  2ISD A;  4PE4 A;  1DJY A;  2M8U A;  1YVH A;  1BOD A;  2IS9 A;  4PHN A;  2M97 A;  1IGV A;  2I94 A;  1X02 A;  1F54 A;  2HPS A;  3JVT C;  1MHO A;  3BQ3 A;  1PAL A;  3PN7 C;  2K61 A;  1U5I A;  1NCZ A;  5CSJ A;  1B8R A;  1N0Y A;  2COL B;  5HKY A;  1SPY A;  2KI4 C;  4FTG A;  4OR9 B;  4CPV A;  2LVI A;  4JQ0 D;  1K94 A;  1WY9 A;  1AHR A;  2HET A;  2M3W A;  4MRY A;  2LC5 A;  1N65 A;  2OS8 B;  4M2Q A;  3JTD B;  3IF7 A;  1BU3 A;  1CLM A;  1XO5 A;  2R2I A;  4YBH B;  1S5G Z;  2BL0 B;  3EKJ A;  3BUO B;  1B7T Y;  3I5I B;  2BE4 A;  2BCX A;  2F2P A;  4USL A;  3D0Y B;  4WRI A;  3WHT B;  1J7Q A;  3I5F B;  5I2L A;  2LM5 A;  4YRU A;  1RWY A;  3TUY B;  1QAS A;  1AUI B;  2KYC A;  1DVI A;  2K7D A;  1F55 A;  1JFK A;  5B8I B;  1NYA A;  3I5G C;  2QAC A;  2EC6 C;  1FBV A;  2G2B A;  2D8N A;  3EK8 A;  4MZJ A;  1BOC A;  5KTY A;  1CMG A;  3DVK A;  3CS1 A;  4MSP A;  1XVJ A;  2F3Y A;  3AKB A;  1OMR A;  2CNP A;  2K7O A;  2L2E A;  1LKJ A;  1YUT A;  1MUX A;  2M7N A;  2EHB A;  2H2K A;  4ORC B;  2M7L A;  1IQ3 A;  4MRX A;  1DJW A;  3A4U B;  2JTT A;  5I2Q A;  1L7Z A;  2KAV A;  3D10 A;  1B8C A;  1K9P A;  1YRU B;  3O2P A;  4DCK A;  3PAT A;  1A75 B;  1QJT A;  4AQI A;  1R2U A;  3MSE B;  1FPW A;  4ORA B;  2FCE A;  2BEC A;  1QX5 B;  2F33 A;  4P5O E;  2LP3 A;  3SIA A;  1XFW O;  1S26 D;  1AVS A;  1ZAC A;  1EXR A;  1QV1 A;  2EGD A;  1KWO C;  2JZI A;  1EG3 A;  3OB1 B;  5HKZ A;  2LCP A;  4M2O A;  1W7J B;  1PK0 D;  3TS5 B;  3VRQ A;  2KAY A;  4DRW A;  1K9U A;  1UHJ A;  1MQ1 A;  1TNQ A;  2CBL A;  1AK8 A;  2WCE A;  3SG3 A;  5ER5 A;  1CTR A;  2MAZ A;  4L9M A;  2JC2 A;  4A4B A;  3NSO A;  1S5G Y;  3BUX B;  1WRK A;  3TDI A;  1MXL C;  2AAO A;  2K7C A;  1J1E A;  1OMD A;  1H4B A;  1U5I B;  1MR8 A;  2JPT A;  2JT0 A;  2L51 A;  3KPX A;  5F6T A;  5TNC A;  1CFC A;  2KI4 B;  1JFJ A;  4C0K A;  2KFH A;  3GK4 X;  1C7V A;  1BLQ A;  1D1O A;  3CWG A;  1K8U A;  1XFV O;  1ZMZ A;  2PRU A;  4YGC B;  3DF0 A;  3BYA A;  4WQ2 A;  2L4H A;  3ICB A;  4PCW A;  1YVL A;  1KQV A;  2M9G A;  2LNK A;  2ZKM X;  2O5G A;  3IQQ A;  1SCM C;  2JNF A;  4N1F A;  5AFP A;  3TZ1 A;  1F70 A;  3DVJ A;  3QRX A;  1CM4 A;  1TIZ A;  1SKT A;  3CGA A;  1B8L A;  3GK1 A;  5CSN A;  1WDC C;  2LMT A;  1DGV A;  1QS7 A;  4PE7 A;  1UWO A;  1CM1 A;  3AAK A;  1AJ5 A;  1KFU L;  3LK1 A;  4D1E A;  2B1U A;  4GPL B;  4ORB B;  2JRF A;  1RTP 1;  1S3P A;  2LMV A;  1SK6 D;  3BUM B;  2JT3 A;  1SR6 C;  1YRT B;  3AAJ A;  2K2F A;  3LCP C;  1REC A;  3I5G B;  3O78 A;  1JC2 A;  2EC6 B;  1HQV A;  1YUU A;  1DJZ A;  5D7F A;  1SNL A;  4HRH A;  1DJI A;  1MWN A;  1K9K A;  1FI5 A;  4HRE E;  1CNP A;  1S6I A;  2KBM A;  2KHN A;  2Y4Q A;  1TRF A;  2KGB C;  4XJK A;  4E68 A;  1A29 A;  3FWB A;  4PHK A;  1NX2 A;  3ZWH A;  1NWD A;  1QX2 A;  4YGA A;  2JXL A;  1CDP A;  2M1K B;  5AXI A;  4OKH A;  1NSH A; 
#chains in the Genus database with same CATH topology
 2P6B B;  2KBI A;  4GGN A;  3IVT A;  1Q80 A;  1SCV A;  1TNX A;  3DVE A;  2KGR A;  2F2O A;  3SS4 A;  5ER4 X;  4AQJ A;  1RFJ A;  1BT6 A;  2FOT A;  1XYD A;  3EK4 A;  3NHT A;  1KWO B;  2K0J A;  2MJW B;  4MN0 A;  4PHM A;  1J7R A;  2LLS A;  2NLN A;  3FIA A;  4GGF A;  5K89 A;  1CKK A;  1NPQ A;  3VRN A;  1LA3 A;  3WNX B;  4GGF C;  1OZO A;  2JQ6 A;  2Y5I A;  1V1F A;  1EG4 A;  1IG5 A;  2Q4U A;  1CDM A;  3SS3 A;  4PAL A;  2L5X B;  3CZT X;  2LAP A;  3OHM B;  5KU1 A;  1C3Z A;  4PHJ A;  2A4J A;  5FI7 A;  1OQP A;  1F4Q A;  1UUR A;  5KSZ A;  3SJS A;  2KAX A;  1OOH A;  1KCY A;  1XK4 A;  5PAL A;  3CZ0 A;  1QV0 A;  4NQG A;  1K90 D;  2G9B A;  3NXA A;  1XK4 C;  3PM2 A;  2LAN A;  4FQO A;  4JWQ A;  2M49 B;  1ZUZ A;  2JXC A;  2K2A A;  3CAB A;  2H61 A;  1F8H A;  3GOF A;  4F0Z B;  1G8I A;  1TUZ A;  4NDD A;  5HLO A;  2H61 C;  3OX6 A;  2KNE A;  4WQ3 A;  2F3Z A;  1NP8 A;  4OV2 A;  5D69 A;  3SIB A;  1F71 A;  1LS8 A;  3PM8 A;  2BBM A;  4TNC A;  1Z4H A;  2HQ8 A;  1SCM B;  2JUL A;  1BMO A;  3EVR A;  4YGD B;  1IQ5 A;  1N2D A;  5AEQ A;  2E30 A;  1XFR A;  1CFD A;  3BOW A;  4MBE A;  1K95 A;  2BE6 A;  1JWD A;  4YI8 A;  1UHN A;  2JU0 A;  1KK8 C;  1CB1 A;  1YTZ C;  1ZFS A;  2KI6 C;  1IJ5 A;  1XFU O;  1IRJ A;  4N5X A;  4MLW A;  1S6J A;  2LHL A;  1NX1 A;  1SY9 A;  3IQO A;  1AJ4 A;  2GGM A;  2Y1N A;  4BY5 A;  1RJV A;  1SMG A;  3D75 A;  2I2R E;  1KQM C;  1DEL A;  3BFA A;  4GAO A;  1SL7 A;  1YUS A;  2NCP A;  1XFY O;  3FS7 A;  3SS5 A;  2FJY A;  2GGZ A;  4DIR A;  1KFX L;  5DKR A;  3CZ1 A;  3CR5 X;  3EVV A;  4CFR A;  3GK2 A;  1K93 D;  2KFF A;  1C7W A;  1Y6W A;  2Y1M A;  2KI6 D;  3JVT B;  2KOT A;  1NCX A;  2JWW A;  2JNX A;  3CR4 X;  2GTE A;  3NSK A;  1QLK A;  2H8V A;  3PN7 B;  1BG1 A;  1DGU A;  1IJ6 A;  5DKN A;  2JOJ A;  1M39 A;  1GGZ A;  1M46 A;  3JTD C;  5HKW A;  2BCA A;  2ZRS A;  3EG5 B;  1YUR A;  2BL0 C;  1BR4 B;  1DF0 A;  4KYN A;  1V1G A;  1M45 A;  1KSO A;  2V53 A;  4PE1 A;  3CTN A;  4XYN A;  1IH0 A;  2QPT A;  2BCB A;  3DD4 A;  4Q04 A;  4R1E A;  3FE8 A;  2LUC A;  2OPO A;  3RLZ A;  1QVI Z;  1CLB A;  1SL9 A;  1CDN A;  1QIW A;  2L4I A;  1J55 A;  2ZNE A;  2KLD A;  2ZFD A;  2HQW A;  3BUW B;  1GGW A;  5AER A;  2QDI A;  3TUY C;  3HX4 A;  1SRA A;  2MA2 A;  3L4A A;  1F4O A;  2MBX A;  3SG7 A;  2LVJ A;  5JJG A;  1M63 B;  1B4C A;  2LLT A;  2MHH A;  2LP2 A;  1UP5 A;  1KK7 Z;  4GBA A;  4YI9 A;  1FF1 A;  1DJG A;  2L98 A;  4GNK B;  5JOL A;  1QTX A;  2LLU A;  2WOS A;  5HYD A;  5G08 A;  2CTN A;  4QJ5 B;  1XFX O;  4GFT A;  3KHE A;  1PRW A;  1CFF A;  3LL8 B;  1Z2C B;  1TUJ A;  3O4X A;  3NSI A;  5FYX A;  2LE9 B;  2QEO A;  3HCM A;  2BKH B;  3N7H A;  1TTX A;  1W7I B;  2NCO A;  4ETO A;  1H8B A;  3VRO A;  3PAL A;  3OX5 A;  1A75 A;  1B47 A;  3VGO A;  4DS7 A;  1OOG A;  3VRP A;  3DY9 A;  1SYM A;  5IBW A;  1CMF A;  1OSA A;  1TCO B;  3EVU A;  1Y1U A;  1MF8 B;  1Y0V H;  2LVK A;  4C0J A;  1CDL A;  1RK9 A;  3OBV A;  4I5N B;  4PE0 A;  2JT8 A;  3SG5 A;  1TWO A;  2WND A;  3CR2 A;  2QEB A;  1DEK A;  1Y1X A;  1DJX A;  1EJ3 A;  4C0L A;  3RM1 A;  1A03 A;  1J7O A;  3TS5 C;  1PSR A;  2NXQ A;  1M31 A;  4YGB B;  1KK8 B;  1RRO A;  2BNX A;  1WRZ A;  2OTG C;  3CZ2 A;  3OP0 A;  1EL4 A;  1BR1 B;  1PUL A;  3DXL A;  1E8A A;  1FI6 A;  3PSR A;  2MRD A;  1KQM B;  4NDB A;  2E6W A;  3AKA A;  2L50 A;  1LXF C;  2LUX A;  3DVM A;  1NX3 A;  3PLF B;  2I18 A;  3SG2 A;  3VB1 A;  4QJ4 B;  1K96 A;  1QWV A;  2WCB A;  2ZN8 A;  3TDZ A;  4M2P A;  2FCD A;  3KF9 A;  1QVI Y;  1J7P A;  2PAS A;  2I7A A;  5J3X A;  5GQQ C;  1CFP A;  2AUC A;  2GV5 A;  2MLE C;  3B87 A;  1YR5 A;  2VRG A;  3BXK A;  2L0P A;  1DQE A;  1OE9 B;  2JTZ A;  4HRG A;  1SSE B;  1KSM A;  4INX A;  3E3R A;  3SG4 A;  2SAS A;  1KK7 Y;  3Q8I A;  1XFZ O;  3H4S E;  1DMO A;  5DKQ A;  2RGI A;  2LVV A;  3NSL A;  3VRR A;  4CID A;  2WC8 A;  1DJH A;  2CT9 A;  4N1G A;  2TN4 A;  4QJ3 B;  1SBJ A;  1DF0 B;  2WOR A;  3I5H C;  5CSF A;  2PVB A;  1UHI A;  3K21 A;  1MXE A;  1QXP A;  3DF0 B;  1TNP A;  2K7B A;  1L2O C;  1NX0 A;  1B1G A;  1PSB A;  1PVB A;  1SL8 A;  2AMI A;  1QAT A;  3RZS A;  4MZK A;  1A4P A;  3KO0 A;  4IL1 A;  1WDC B;  1QX7 A;  1R6P A;  2L5Y A;  2ZN9 A;  3LLE A;  1K2H A;  1UHH A;  2Q91 A;  1B9A A;  1OOI X;  3D77 A;  3CDN A;  1SR6 B;  3EK7 A;  1S1E A;  1IWQ A;  5CSI A;  1JSA A;  1YX7 A;  3F45 A;  2JPO A;  1J1D A;  1BF5 A;  2KLE A;  2KQY A;  2KSP A;  3O4Y A;  1DTL A;  3BUN B;  5BPJ A;  1JBA A;  2K8M B;  2MLF C;  4HSZ A;  1G4Y R;  1TOP A;  2WCJ A;  2HF5 A;  4U8D A;  2WCK A;  4DUQ A;  2ZND A;  3DZT A;  2KDH A;  3CLN A;  5I8N A;  4MEW A;  3TDU A;  2NZ0 A;  4XJK B;  1PVA A;  3LK0 A;  3OB2 B;  2M0R A;  2PSR A;  3CYZ A;  4MVF A;  1G33 A;  1S6C A;  1OZS A;  2KFG A;  2OS8 C;  1IKU A;  3PFV A;  1OOF A;  1TN4 A;  2M1U A;  2F8P A;  1EH2 A;  3OGN A;  1QIV A;  3I5I C;  1CLL A;  4MZL A;  1XA5 A;  3D0Y A;  2LV7 A;  3FE6 A;  4GUK A;  4CLN A;  2OTG B;  1BJF A;  4AOM A;  2FJU B;  4BY4 A;  2CXJ A;  1KFX S;  2SCP A;  3I5F C;  4ZCV A;  3BFH A;  2KYF A;  2M29 A;  3EKH A;  1QLS A;  3S0G A;  1VRK A;  4A4C A;  2QEV A;  4NDC A;  3DYE A;  3D76 A;  1ALV A;  3SG6 A;  1GJY A;  3R1P A;  1FW4 A;  1P28 A;  1UUS A;  4ICB A;  4I5K A;  1B7T Z;  1SW8 A;  2BAP A;  2BBN A;  1UHK A;  1JF2 A;  1NUB A;  1HT9 A;  1WLM A;  3B7A A;  1NIW A;  2LMU A;  3D74 A;  2WCM A;  1LIN A;  3O6B A;  5CPV A;  1C07 A;  1LA0 A;  3WHU B;  2LHI A;  4OCI A;  1A2X A;  3S0E A;  4OVN F;  1TCF A;  1WRL A;  4PDZ A;  1NCY A;  3C1V A;  4JPZ B;  1ODB A;  1YX8 A;  1S36 A;  1OOJ A;  1WLZ A;  2PMY A;  3I5H B;  2BKI B;  1ALW A;  1TNW A;  2O60 A;  4P2Y B;  2ZRT A;  4I5J A;  3A8R A;  1L2O B;  3L47 A;  1AP4 A;  2KQ6 A;  5HLV A;  4IJ7 A;  2ERB A;  3S0F A;  1DT7 B;  1JUO A;  1KFU S;  1OMV A;  1GQM A;  2DOQ A;  5DIC A;  3ZNI A;  1Y1A A;  5AAN A;  4ZCU A;  1LVC D;  1C3Y A;  4UPG A;  1ZOT B;  4I5L B;  3D73 A;  5I2O A;  3KEV A;  2WC5 A;  5D3O A;  4OZD A;  2WCF A;  2PYQ A;  2PAL A;  4YGE B;  3WXA A;  3BOW B;  2CCM A;  2L2C A;  1JF0 A;  3S0A A;  4CFQ A;  3M0W A;  3FWC A;  2ISD A;  4PE4 A;  1DJY A;  2M8U A;  3PJI A;  1YVH A;  5FI2 A;  3S0D A;  2IS9 A;  1BOD A;  4PHN A;  2M97 A;  1IGV A;  2QEH A;  2I94 A;  1X02 A;  1F54 A;  2HPS A;  3JVT C;  1MHO A;  3BQ3 A;  1PAL A;  3PN7 C;  2K61 A;  1U5I A;  1NCZ A;  5CSJ A;  1B8R A;  1N0Y A;  2COL B;  5HKY A;  3FE9 A;  1SPY A;  2KI4 C;  4FTG A;  4OR9 B;  5EL2 A;  2LVI A;  4JQ0 D;  1K94 A;  1WY9 A;  4CPV A;  3R72 A;  1AHR A;  2HET A;  2M3W A;  4MRY A;  2LC5 A;  1N65 A;  2OS8 B;  2P70 A;  4M2Q A;  3JTD B;  3IF7 A;  1BU3 A;  1CLM A;  1XO5 A;  2R2I A;  4YBH B;  1S5G Z;  2BL0 B;  3EKJ A;  3BUO B;  1B7T Y;  3I5I B;  4INW A;  2BE4 A;  2BCX A;  2K60 A;  2F2P A;  4USL A;  3BFB A;  3D0Y B;  4WRI A;  3WHT B;  1J7Q A;  3I5F B;  1W9Z A;  2LM5 A;  5I2L A;  4YRU A;  1RWY A;  3TUY B;  2P71 A;  1QAS A;  1AUI B;  2KYC A;  3K1E A;  1DVI A;  2K7D A;  1F55 A;  1JFK A;  5B8I B;  1NYA A;  3I5G C;  2QAC A;  2EC6 C;  1FBV A;  2G2B A;  2WCH A;  2D8N A;  3EK8 A;  4MZJ A;  1BOC A;  4F7F A;  5KTY A;  1CMG A;  2WCL A;  3DVK A;  3CS1 A;  3BJH A;  4MSP A;  1XVJ A;  2F3Y A;  3AKB A;  1OMR A;  2CNP A;  2K7O A;  2L2E A;  1T14 A;  1LKJ A;  1YUT A;  1MUX A;  4JKT A;  2M7N A;  2EHB A;  1ORG A;  2H2K A;  4ORC B;  2M7L A;  1IQ3 A;  4MRX A;  1DJW A;  3A4U B;  2JTT A;  3D78 A;  5I2Q A;  1L7Z A;  2KAV A;  3D10 A;  1B8C A;  1K9P A;  1YRU B;  3O2P A;  4DCK A;  3S0B A;  3PAT A;  1A75 B;  1QJT A;  4AQI A;  3B6X A;  1R2U A;  3MSE B;  1FPW A;  4ORA B;  2FCE A;  2WC6 A;  2BEC A;  1QX5 B;  2F33 A;  4P5O E;  2LP3 A;  3SIA A;  1XFW O;  1S26 D;  1AVS A;  1ZAC A;  1EXR A;  1QV1 A;  2EGD A;  1KWO C;  2JZI A;  1EG3 A;  3B86 A;  3OB1 B;  5HKZ A;  2LCP A;  4M2O A;  1W7J B;  1PK0 D;  3TS5 B;  3VRQ A;  2KAY A;  4DRW A;  1K9U A;  1UHJ A;  1MQ1 A;  1GM0 A;  1TNQ A;  3R1O A;  1IIO A;  2CBL A;  1AK8 A;  2WCE A;  3SG3 A;  5ER5 A;  1CTR A;  2MAZ A;  4L9M A;  2JC2 A;  3V2L A;  3NSO A;  1S5G Y;  3BUX B;  4A4B A;  4PT1 A;  1WRK A;  3TDI A;  1MXL C;  2AAO A;  2K7C A;  1J1E A;  1OMD A;  1H4B A;  1U5I B;  1MR8 A;  2JPT A;  5FI6 A;  2JT0 A;  2L51 A;  3KPX A;  5F6T A;  5TNC A;  1CFC A;  2KI4 B;  3R1V A;  1JFJ A;  4C0K A;  2KFH A;  3GK4 X;  2PQL A;  1C7V A;  1BLQ A;  3UNW A;  3CWG A;  1K8U A;  1XFV O;  1ZMZ A;  2PRU A;  4YGC B;  1D1O A;  3DF0 A;  3BYA A;  3NHI A;  4WQ2 A;  2L4H A;  3ICB A;  4PCW A;  1YVL A;  1KQV A;  5I94 A;  2M9G A;  2LNK A;  2ZKM X;  2O5G A;  3IQQ A;  1SCM C;  2JNF A;  4N1F A;  5AFP A;  3TZ1 A;  1F70 A;  3DVJ A;  4JD9 A;  3QRX A;  1CM4 A;  1TIZ A;  1SKT A;  3CGA A;  3UO9 A;  1B8L A;  3GK1 A;  5CSN A;  1WDC C;  2LMT A;  1DGV A;  1QS7 A;  3NGV A;  1UWO A;  4PE7 A;  1CM1 A;  3AAK A;  1AJ5 A;  1KFU L;  3LK1 A;  4D1E A;  5HL1 A;  2B1U A;  4GPL B;  4ORB B;  2JRF A;  1RTP 1;  1S3P A;  2LMV A;  2YGU A;  1SK6 D;  3BUM B;  2JT3 A;  1SR6 C;  1YRT B;  3AAJ A;  2K2F A;  3LCP C;  1REC A;  3I5G B;  3O78 A;  1JC2 A;  2EC6 B;  4FQT A;  1HQV A;  1YUU A;  1DJZ A;  5D7F A;  1SNL A;  4HRH A;  1DJI A;  1MWN A;  1K9K A;  1FI5 A;  4HRE E;  1CNP A;  3QME A;  1S6I A;  1OW4 A;  2KBM A;  2KHN A;  1TRF A;  2KGB C;  2Y4Q A;  2KPH A;  3L4L A;  4XJK A;  1DC1 A;  4E68 A;  1A29 A;  3B88 A;  3FWB A;  4PHK A;  1NX2 A;  3ZWH A;  1NWD A;  1QX2 A;  4YGA A;  2JXL A;  1CDP A;  2M1K B;  5AXI A;  4OKH A;  1NSH A; 
#chains in the Genus database with same CATH homology
 2P6B B;  2KBI A;  4GGN A;  1Q80 A;  1SCV A;  1TNX A;  3DVE A;  2KGR A;  2F2O A;  5ER4 X;  4AQJ A;  1RFJ A;  1BT6 A;  2FOT A;  1XYD A;  3EK4 A;  1KWO B;  2K0J A;  2MJW B;  4MN0 A;  4PHM A;  1J7R A;  2LLS A;  2NLN A;  3FIA A;  4GGF A;  5K89 A;  1CKK A;  1NPQ A;  3VRN A;  1LA3 A;  3WNX B;  4GGF C;  1OZO A;  2JQ6 A;  2Y5I A;  1V1F A;  1EG4 A;  1IG5 A;  2Q4U A;  1CDM A;  4PAL A;  2L5X B;  3CZT X;  2LAP A;  3OHM B;  5KU1 A;  4PHJ A;  2A4J A;  1OQP A;  1F4Q A;  1UUR A;  5KSZ A;  3SJS A;  2KAX A;  1KCY A;  1XK4 A;  5PAL A;  1QV0 A;  4NQG A;  1K90 D;  2G9B A;  3NXA A;  1XK4 C;  2LAN A;  4FQO A;  4JWQ A;  2M49 B;  1ZUZ A;  2JXC A;  2K2A A;  2H61 A;  1F8H A;  3GOF A;  4F0Z B;  1G8I A;  4NDD A;  5HLO A;  2H61 C;  3OX6 A;  2KNE A;  4WQ3 A;  2F3Z A;  1NP8 A;  4OV2 A;  5D69 A;  3SIB A;  1F71 A;  3PM8 A;  2BBM A;  4TNC A;  2HQ8 A;  1SCM B;  2JUL A;  1BMO A;  3EVR A;  4YGD B;  1IQ5 A;  1N2D A;  5AEQ A;  2E30 A;  3BOW A;  1CFD A;  4MBE A;  1K95 A;  2BE6 A;  1JWD A;  4YI8 A;  1UHN A;  2JU0 A;  1KK8 C;  1CB1 A;  1YTZ C;  1ZFS A;  2KI6 C;  1IJ5 A;  1XFU O;  1IRJ A;  4N5X A;  4MLW A;  1S6J A;  2LHL A;  1NX1 A;  1SY9 A;  3IQO A;  1AJ4 A;  2GGM A;  2Y1N A;  4BY5 A;  1RJV A;  1SMG A;  2I2R E;  1KQM C;  4GAO A;  1SL7 A;  1YUS A;  2NCP A;  1XFY O;  3FS7 A;  2GGZ A;  4DIR A;  1KFX L;  5DKR A;  3EVV A;  3CR5 X;  4CFR A;  3GK2 A;  1K93 D;  2KFF A;  1C7W A;  1Y6W A;  2Y1M A;  2KI6 D;  3JVT B;  2KOT A;  1NCX A;  2JWW A;  2JNX A;  3CR4 X;  3NSK A;  3PN7 B;  1QLK A;  1BG1 A;  1DGU A;  1IJ6 A;  5DKN A;  2JOJ A;  1M39 A;  1GGZ A;  1M46 A;  3JTD C;  5HKW A;  2BCA A;  2ZRS A;  1YUR A;  2BL0 C;  1BR4 B;  1DF0 A;  4XYN A;  1V1G A;  1M45 A;  1KSO A;  2V53 A;  4PE1 A;  3CTN A;  1IH0 A;  2QPT A;  2BCB A;  3DD4 A;  4Q04 A;  4R1E A;  2LUC A;  2OPO A;  3RLZ A;  1QVI Z;  1CLB A;  1SL9 A;  1CDN A;  1QIW A;  2L4I A;  1J55 A;  2ZNE A;  2ZFD A;  2HQW A;  3BUW B;  1GGW A;  5AER A;  3TUY C;  3HX4 A;  1SRA A;  2MA2 A;  1F4O A;  2MBX A;  3SG7 A;  2LVJ A;  5JJG A;  1M63 B;  1B4C A;  2LLT A;  2MHH A;  2LP2 A;  1UP5 A;  1KK7 Z;  4GBA A;  4YI9 A;  1FF1 A;  1DJG A;  2L98 A;  4GNK B;  5JOL A;  1QTX A;  2LLU A;  2WOS A;  5HYD A;  5G08 A;  2CTN A;  4QJ5 B;  1XFX O;  4GFT A;  3KHE A;  1PRW A;  1CFF A;  3LL8 B;  3NSI A;  5FYX A;  2LE9 B;  3HCM A;  2BKH B;  1TTX A;  1W7I B;  2NCO A;  4ETO A;  1H8B A;  3VRO A;  3PAL A;  3OX5 A;  1A75 A;  1B47 A;  3VGO A;  4DS7 A;  3VRP A;  5IBW A;  1SYM A;  1CMF A;  1OSA A;  1TCO B;  3EVU A;  1Y1U A;  1MF8 B;  1Y0V H;  2LVK A;  4C0J A;  1CDL A;  1RK9 A;  4PE0 A;  4I5N B;  3SG5 A;  2JT8 A;  2WND A;  3CR2 A;  1Y1X A;  4C0L A;  1DJX A;  1EJ3 A;  1A03 A;  3RM1 A;  1J7O A;  3TS5 C;  1PSR A;  2NXQ A;  1M31 A;  4YGB B;  1KK8 B;  1RRO A;  1WRZ A;  2OTG C;  3OP0 A;  1EL4 A;  1BR1 B;  1PUL A;  1FI6 A;  1E8A A;  3PSR A;  2MRD A;  1KQM B;  4NDB A;  2E6W A;  3AKA A;  2L50 A;  1LXF C;  2LUX A;  3DVM A;  1NX3 A;  3PLF B;  2I18 A;  3SG2 A;  4QJ4 B;  1K96 A;  2WCB A;  2ZN8 A;  3TDZ A;  4M2P A;  2FCD A;  3KF9 A;  1QVI Y;  1J7P A;  2PAS A;  2I7A A;  5J3X A;  5GQQ C;  1CFP A;  2AUC A;  2GV5 A;  2MLE C;  1YR5 A;  2VRG A;  3BXK A;  2L0P A;  1OE9 B;  3SG4 A;  2JTZ A;  4HRG A;  1KSM A;  3E3R A;  2SAS A;  1KK7 Y;  1XFZ O;  3H4S E;  1DMO A;  5DKQ A;  2RGI A;  2LVV A;  3NSL A;  3VRR A;  4CID A;  2WC8 A;  1DJH A;  2CT9 A;  4N1G A;  2TN4 A;  4QJ3 B;  1SBJ A;  1DF0 B;  2WOR A;  3I5H C;  5CSF A;  2PVB A;  1UHI A;  3K21 A;  1MXE A;  1QXP A;  3DF0 B;  1TNP A;  2K7B A;  1L2O C;  1NX0 A;  1B1G A;  1PSB A;  1PVB A;  1SL8 A;  2AMI A;  1QAT A;  4MZK A;  1A4P A;  3KO0 A;  4IL1 A;  1WDC B;  1QX7 A;  1R6P A;  2ZN9 A;  3LLE A;  1K2H A;  1UHH A;  2Q91 A;  1B9A A;  1SR6 B;  3EK7 A;  1S1E A;  1IWQ A;  5CSI A;  1JSA A;  1YX7 A;  3F45 A;  1J1D A;  1BF5 A;  2KQY A;  2KSP A;  3O4Y A;  1DTL A;  3BUN B;  5BPJ A;  1JBA A;  2K8M B;  2MLF C;  4HSZ A;  1G4Y R;  1TOP A;  4U8D A;  2HF5 A;  4DUQ A;  2ZND A;  5I8N A;  2KDH A;  3CLN A;  4MEW A;  3TDU A;  2NZ0 A;  4XJK B;  1PVA A;  3LK0 A;  3OB2 B;  2M0R A;  2PSR A;  4MVF A;  1G33 A;  1S6C A;  1OZS A;  2KFG A;  2OS8 C;  1IKU A;  3PFV A;  1TN4 A;  2M1U A;  2F8P A;  1EH2 A;  1QIV A;  3I5I C;  1CLL A;  4MZL A;  1XA5 A;  3D0Y A;  2LV7 A;  4GUK A;  4CLN A;  2OTG B;  1BJF A;  4AOM A;  2FJU B;  4BY4 A;  2CXJ A;  1KFX S;  2SCP A;  3I5F C;  4ZCV A;  2KYF A;  2M29 A;  3EKH A;  1QLS A;  4A4C A;  1VRK A;  4NDC A;  1ALV A;  3SG6 A;  1GJY A;  1FW4 A;  1UUS A;  4ICB A;  4I5K A;  1B7T Z;  1SW8 A;  2BBN A;  1UHK A;  1JF2 A;  1NUB A;  1HT9 A;  1WLM A;  1NIW A;  2LMU A;  5CPV A;  1LIN A;  3O6B A;  1C07 A;  1LA0 A;  3WHU B;  2LHI A;  4OCI A;  1A2X A;  4OVN F;  1TCF A;  1WRL A;  4PDZ A;  1NCY A;  3C1V A;  4JPZ B;  1ODB A;  1YX8 A;  1S36 A;  1OOJ A;  1WLZ A;  2PMY A;  3I5H B;  2BKI B;  1ALW A;  1TNW A;  2O60 A;  4P2Y B;  2ZRT A;  4I5J A;  3A8R A;  1L2O B;  1AP4 A;  2KQ6 A;  5HLV A;  1DT7 B;  1JUO A;  1KFU S;  1OMV A;  1GQM A;  2DOQ A;  3ZNI A;  1Y1A A;  5AAN A;  4ZCU A;  1LVC D;  4UPG A;  1ZOT B;  4I5L B;  5I2O A;  3KEV A;  2WCF A;  2PAL A;  4YGE B;  3WXA A;  3BOW B;  2CCM A;  1JF0 A;  4CFQ A;  3M0W A;  3FWC A;  2ISD A;  4PE4 A;  1DJY A;  2M8U A;  1YVH A;  1BOD A;  2IS9 A;  4PHN A;  2M97 A;  1IGV A;  2I94 A;  1X02 A;  1F54 A;  2HPS A;  3JVT C;  1MHO A;  3BQ3 A;  1PAL A;  3PN7 C;  2K61 A;  1U5I A;  1NCZ A;  5CSJ A;  1B8R A;  1N0Y A;  2COL B;  5HKY A;  1SPY A;  2KI4 C;  4FTG A;  4OR9 B;  4CPV A;  2LVI A;  4JQ0 D;  1K94 A;  1WY9 A;  1AHR A;  2HET A;  2M3W A;  4MRY A;  2LC5 A;  1N65 A;  2OS8 B;  4M2Q A;  3JTD B;  3IF7 A;  1BU3 A;  1CLM A;  1XO5 A;  2R2I A;  4YBH B;  1S5G Z;  2BL0 B;  3EKJ A;  3BUO B;  1B7T Y;  3I5I B;  2BE4 A;  2BCX A;  2F2P A;  4USL A;  3D0Y B;  4WRI A;  3WHT B;  1J7Q A;  3I5F B;  5I2L A;  2LM5 A;  4YRU A;  1RWY A;  3TUY B;  1QAS A;  1AUI B;  2KYC A;  1DVI A;  2K7D A;  1F55 A;  1JFK A;  5B8I B;  1NYA A;  3I5G C;  2QAC A;  2EC6 C;  1FBV A;  2G2B A;  2D8N A;  3EK8 A;  4MZJ A;  1BOC A;  5KTY A;  1CMG A;  3DVK A;  3CS1 A;  4MSP A;  1XVJ A;  2F3Y A;  3AKB A;  1OMR A;  2CNP A;  2K7O A;  2L2E A;  1LKJ A;  1YUT A;  1MUX A;  2M7N A;  2EHB A;  2H2K A;  4ORC B;  2M7L A;  1IQ3 A;  4MRX A;  1DJW A;  3A4U B;  2JTT A;  5I2Q A;  1L7Z A;  2KAV A;  3D10 A;  1B8C A;  1K9P A;  1YRU B;  3O2P A;  4DCK A;  3PAT A;  1A75 B;  1QJT A;  4AQI A;  1R2U A;  3MSE B;  1FPW A;  4ORA B;  2FCE A;  2BEC A;  1QX5 B;  2F33 A;  4P5O E;  2LP3 A;  3SIA A;  1XFW O;  1S26 D;  1AVS A;  1ZAC A;  1EXR A;  1QV1 A;  2EGD A;  1KWO C;  2JZI A;  1EG3 A;  3OB1 B;  5HKZ A;  2LCP A;  4M2O A;  1W7J B;  1PK0 D;  3TS5 B;  3VRQ A;  2KAY A;  4DRW A;  1K9U A;  1UHJ A;  1MQ1 A;  1TNQ A;  2CBL A;  1AK8 A;  2WCE A;  3SG3 A;  5ER5 A;  1CTR A;  2MAZ A;  4L9M A;  2JC2 A;  4A4B A;  3NSO A;  1S5G Y;  3BUX B;  1WRK A;  3TDI A;  1MXL C;  2AAO A;  2K7C A;  1J1E A;  1OMD A;  1H4B A;  1U5I B;  1MR8 A;  2JPT A;  2JT0 A;  2L51 A;  3KPX A;  5F6T A;  5TNC A;  1CFC A;  2KI4 B;  1JFJ A;  4C0K A;  2KFH A;  3GK4 X;  1C7V A;  1BLQ A;  1D1O A;  3CWG A;  1K8U A;  1XFV O;  1ZMZ A;  2PRU A;  4YGC B;  3DF0 A;  3BYA A;  4WQ2 A;  2L4H A;  3ICB A;  4PCW A;  1YVL A;  1KQV A;  2M9G A;  2LNK A;  2ZKM X;  2O5G A;  3IQQ A;  1SCM C;  2JNF A;  4N1F A;  5AFP A;  3TZ1 A;  1F70 A;  3DVJ A;  3QRX A;  1CM4 A;  1TIZ A;  1SKT A;  3CGA A;  1B8L A;  3GK1 A;  5CSN A;  1WDC C;  2LMT A;  1DGV A;  1QS7 A;  4PE7 A;  1UWO A;  1CM1 A;  3AAK A;  1AJ5 A;  1KFU L;  3LK1 A;  4D1E A;  2B1U A;  4GPL B;  4ORB B;  2JRF A;  1RTP 1;  1S3P A;  2LMV A;  1SK6 D;  3BUM B;  2JT3 A;  1SR6 C;  1YRT B;  3AAJ A;  2K2F A;  3LCP C;  1REC A;  3I5G B;  3O78 A;  1JC2 A;  2EC6 B;  1HQV A;  1YUU A;  1DJZ A;  5D7F A;  1SNL A;  4HRH A;  1DJI A;  1MWN A;  1K9K A;  1FI5 A;  4HRE E;  1CNP A;  1S6I A;  2KBM A;  2KHN A;  2Y4Q A;  1TRF A;  2KGB C;  4XJK A;  4E68 A;  1A29 A;  3FWB A;  4PHK A;  1NX2 A;  3ZWH A;  1NWD A;  1QX2 A;  4YGA A;  2JXL A;  1CDP A;  2M1K B;  5AXI A;  4OKH A;  1NSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...