2RGIA

Crystal structure of ca2+-free s100a2 at 1.6 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
MSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A2
publication title Crystal structure of Ca2+ -free S100A2 at 1.6-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2rgiA00
1RTP1 3BYAA 4AQJA 1QX2A 1SR6C 2JTZA 2CTNA 4FTGA 3EVVA 5D69A 2H2KA 1K96A 3WHTB 2JQ6A 2M1UA 2M49B 3SG2A 1PRWA 3AAKA 1NYAA 3BUMB 3VROA 3I5IB 4PCWA 3A8RA 1A29A 5CSIA 3AKBA 1K8UA 1KK7Z 3OB2B 1QVIY 2SCPA 4ICBA 1K93D 1A03A 1CLMA 2KGRA 5PALA 1BJFA 3KPXA 1Y1XA 5HYDA 2KSPA 3K21A 2KNEA 3LLEA 1J7QA 4E68A 3PSRA 1KWOC 1LA0A 1YTZC 1YX8A 2F2PA 1F8HA 3EK4A 3BOWA 5HKWA 5CPVA 1CM4A 4QJ4B 5F6TA 1J7OA 5AXIA 3JVTC 3VGOA 2H61A 2KI4B 2LVKA 4PE7A 3O4YA 4PE1A 2LP2A 1UUSA 1HT9A 1CB1A 1JF2A 1L7ZA 1NX2A 1BR1B 1XVJA 1ZACA 3GK1A 1MXLC 2I18A 1JF0A 2ZRTA 3OX6A 1YRTB 4WQ3A 3CZTX 2L2EA 3DVMA 1W7JB 1XYDA 5BPJA 2VRGA 1K90D 4MZJA 1FI5A 2BBMA 2FJUB 3I5HB 1SRAA 4ORAB 1B1GA 1JUOA 2LMTA 2KDHA 1S1EA 2JZIA 3D0YB 5CSJA 1MQ1A 1SR6B 1MWNA 3NSKA 4WQ2A 2KAXA 2O5GA 1RROA 1XA5A 1OZSA 3GK2A 2ZFDA 1SCVA 2CT9A 1F54A 5AERA 3TDUA 1OMVA 2F2OA 1BODA 1BG1A 3NSIA 2ZKMX 1QJTA 1GQMA 3CR4X 4MBEA 2JTTA 4AOMA 2JXLA 1TNWA 2K7DA 1B7TY 1IQ3A 1MF8B 1CFPA 1SCMC 1FF1A 2Q4UA 2G2BA 1NCXA 2BL0C 1TIZA 2V53A 4OV2A 4YRUA 2L5XB 2JNFA 5JJGA 2L4HA 4JWQA 3I5IC 4YBHB 3IF7A 4PE0A 1J7RA 3AKAA 2K2AA 1XFVO 2PMYA 2LUCA 1B9AA 3M0WA 1TCFA 2AUCA 4ZCVA 1AJ5A 1B8RA 4PE4A 1SK6D 1YVLA 1S36A 1ZMZA 2I7AA 2AAOA 2M9GA 1QV0A 2FOTA 1OMRA 5ER4X 1QXPA 1YURA 4GPLB 1WRKA 4GFTA 5IBWA 2EC6C 4DUQA 4GGFC 1BU3A 1TCOB 1B4CA 1YVHA 2KBMA 3RM1A 3NXAA 4D1EA 1C7WA 2F8PA 1GGZA 2KFFA 1MUXA 2OS8C 2ZN8A 4I5JA 2COLB 1ODBA 5I8NA 4C0KA 4PHMA 4M2QA 4YI8A 1XFWO 1U5IB 3GK4X 3KF9A 2MBXA 3I5HC 3WXAA 1DGUA 1KQMC 2EGDA 1WRLA 1RJVA 2LP3A 1QLKA 2I94A 4A4BA 1RWYA 1XFYO 3KO0A 3EK8A 1YX7A 1SCMB 4HRGA 1XFZO 4MVFA 2BE4A 2BL0B 1G33A 3CR5X 1CMGA 5ER5A 4BY4A 2AMIA 4OVNF 1UHJA 3ICBA 4N1FA 1TNXA 1NIWA 1PVBA 1TRFA 4MZKA 1JFKA 2JXCA 2KHNA 4UPGA 1MHOA 4PDZA 3BQ3A 3BXKA 1AJ4A 3SG7A 1KQVA 4I5LB 1IJ6A 4M2PA 1KFXL 4YGEB 4ORBB 2NZ0A 1PK0D 1DJGA 4TNCA 4C0JA 2BBNA 4QJ3B 5I2LA 1CM1A 3MSEB 3BUOB 2KGBC 2M1KB 3CR2A 3DF0B 2EC6B 2TN4A 4MZLA 1CMFA 3D0YA 1EL4A 1ZUZA 1QS7A 1PVAA 1QX5B 3BUNB 1R2UA 3A4UB 1JC2A 1EG3A 1DF0B 1FBVA 5AEQA 4DCKA 1DJXA 1B47A 3OHMB 2OPOA 2L4IA 4DS7A 4FQOA 1N2DA 4MEWA 3PATA 2MHHA 2OS8B 4F0ZB 2M7NA 2ZN9A 1NSHA 1SY9A 1SL9A 2JU0A 1PSBA 1F4QA 1Y6WA 3TDZA 1NCZA 1SNLA 1KQMB 1PALA 2Q91A 2M0RA 4MN0A 1IKUA 5AFPA 3TZ1A 4NDCA 1KFUL 3WNXB 1ZFSA 4AQIA 1OQPA 1KCYA 1JBAA 1B7TZ 1S5GZ 3BUXB 2ZRSA 2WCBA 5DKNA 1M46A 1DJHA 1XFUO 1Y1AA 4QJ5B 2NCOA 1OMDA 2WCEA 1K9UA 1N65A 2M97A 5TNCA 2KYCA 1A2XA 3LCPC 1DT7B 4U8DA 1YR5A 1TNQA 2MLFC 3SG3A 3IQQA 2K8MB 1KSOA 1VRKA 2LANA 4CFRA 2HF5A 4OR9B 3I5GC 2E6WA 2Y1MA 2BCAA 3EK7A 1LA3A 2NLNA 2SASA 2KOTA 2PRUA 1WY9A 5HKZA 3BUWB 1K9PA 3CS1A 1WRZA 2NXQA 1FPWA 3ZWHA 5HLVA 1GJYA 1E8AA 2L0PA 2O60A 3GOFA 2BECA 5DKQA 4DRWA 3PLFB 4C0LA 1RFJA 3O6BA 1SL8A 4P5OE 1SW8A 1J7PA 1K2HA 2HETA 2JOJA 2HPSA 2M29A 4N5XA 2FCEA 3PFVA 4USLA 2MLEC 3PN7C 4GGNA 1CKKA 4CFQA 4N1GA 2KYFA 4JPZB 4Q04A 3NSLA 1ALVA 2KQ6A 1U5IA 1NWDA 2OTGC 4YGCB 4OKHA 5KSZA 2KAYA 1DJZA 2CNPA 2P6BB 3QRXA 3CWGA 1TN4A 3FS7A 1QASA 2IS9A 1CLBA 1QIWA 1F55A 1L2OC 3HX4A 2LVJA 1CDPA 3LK0A 1UWOA 3TUYB 5DKRA 2LVIA 3HCMA 3JTDC 1TTXA 1G8IA 3TS5C 3FIAA 1F71A 2LM5A 1SMGA 1OOJA 1WDCC 2K0JA 4A4CA 2I2RE 1WLZA 1NX0A 1LXFC 2PSRA 3I5FC 2G9BA 1UURA 2K7CA 4I5KA 4L9MA 2KBIA 1K9KA 2LAPA 2CBLA 2MAZA 1AUIB 1TNPA 3LL8B 3OP0A 2JWWA 2BE6A 1A75B 1YUUA 3I5GB 2CXJA 4CLNA 1BOCA 1DGVA 1UHNA 1NUBA 1QVIZ 1IH0A 2K7BA 2Y5IA 2PASA 2LNKA 5FYXA 1LINA 1LVCD 1CFFA 3DF0A 2A4JA 1PSRA 2K61A 5D7FA 2JT0A 4YI9A 4GGFA 1QX7A 5HLOA 1IGVA 1DJIA 4ZCUA 4MSPA 2JT8A 4XJKB 1DF0A 2WCFA 1BT6A 1X02A 3DVKA 1DTLA 1SPYA 2Y1NA 1S3PA 2Y4QA 3DD4A 2L50A 1AP4A 1CDMA 1H8BA 4YGBB 3EKJA 1W7IB 3CGAA 1UHHA 2GGMA 3FWCA 3PN7B 4GAOA 2NCPA 3F45A 1XK4C 3VRPA 2LC5A 3TDIA 2H61C 2MJWB 2OTGB 2BCBA 4JQ0D 4R1EA 3ZNIA 1CFDA 1M45A 3NSOA 2R2IA 2LHIA 1Q80A 1M31A 2ZNDA 4NQGA 1L2OB 2WORA 3IQOA 4CIDA 1B8LA 1BMOA 2K7OA 2ISDA 4HREE 4PHJA 2F3ZA 1CTRA 1YRUB 4P2YB 2KQYA 3JTDB 1QTXA 3TS5B 1EJ3A 3E3RA 3LK1A 4XYNA 1WDCB 2LE9B 4YGAA 4MLWA 2PALA 4HRHA 1AHRA 1G4YR 3OX5A 5G08A 4YGDB 1BLQA 3SG5A 2CCMA 3EKHA 3I5FB 1OZOA 4DIRA 5AANA 3TUYC 1F70A 1KK8C 5I2OA 4OCIA 1UHIA 3KHEA 1KK7Y 1IJ5A 1D1OA 1JSAA 1NX1A 2M8UA 4NDDA 4NDBA 1AK8A 1XK4A 2JC2A 1EXRA 2JULA 2F3YA 2MRDA 2BKHB 1UP5A 1FW4A 2LCPA 1RK9A 5HKYA 2LLUA 1AVSA 1KFXS 2B1UA 2HQWA 1J55A 1XFXO 3SJSA 2LLTA 2WNDA 4M2OA 1CDLA 1OE9B 3AAJA 1GGWA 3VRRA 5I2QA 2LV7A 1K95A 1NCYA 1NP8A 1QV1A 1BF5A 2LVVA 3RLZA 1IWQA 1V1FA 2JPTA 2WOSA 1JWDA 3BOWB 1QLSA 1XO5A 2D8NA 3CTNA 2FCDA 1S6CA 1R6PA 2LLSA 1JFJA 3VRQA 1RECA 1SL7A 2HQ8A 3C1VA 2E30A 1CNPA 2DOQA 1A4PA 5J3XA 3VRNA 5K89A 3SIBA 5KTYA 1CFCA 3H4SE 3SG4A 1CDNA 1S6IA 1FI6A 2LMUA 3FWBA 4WRIA 2K2FA 4BY5A 2JT3A 5B8IB 1BR4B 5KU1A 2BCXA 1NX3A 1S26D 1S5GY 3O2PA 2PVBA 1KSMA 3SIAA 1KFUS 3WHUB 1PULA 1SKTA 2L51A 5JOLA 3O78A 2M7LA 3PM8A 5CSNA 2ZNEA 2QPTA 1V1GA 1J1DA 1YUTA 2EHBA 1A75A 1KWOB 2QACA 2KI6C 2L98A 4PALA 4MRXA 2MA2A 1TOPA 3CLNA 1KK8B 1OSAA 1MXEA 1B8CA 4HSZA 4MRYA 5CSFA 1NPQA 3DVEA 2LHLA 3EVUA 1K94A 3JVTB 1J1EA 3SG6A 1S6JA 1SBJA 1C7VA 1F4OA 2KFGA 4XJKA 1LKJA 1EG4A 1DMOA 1MR8A 1Y0VH 1DJYA 2JNXA 3EVRA 2GV5A 1Y1UA 1ZOTB 4ETOA 1DJWA 4ORCB 5GQQC 2KI6D 1WLMA 1N0YA 2GGZA 1ALWA 2LUXA 3PALA 1H4BA 1IQ5A 1M39A 2LMVA 2WC8A 2KI4C 4PHKA 4GNKB 3DVJA 4PHNA 1IRJA 4GBAA 2KAVA 2M3WA 4CPVA 1UHKA 2RGIA 1HQVA 1SYMA 2JRFA 1C07A 1QATA 1M63B 1DVIA 1IG5A 1YUSA 4I5NB 4IL1A 4GUKA 1EH2A 2BKIB 1QIVA 2KFHA 3OB1B 1CLLA 3D10A 2F33A 3KEVA
chains in the Genus database with same CATH superfamily
1TWOA 1RTP1 3BYAA 2P71A 2WCJA 3SS4A 4AQJA 2WCLA 1QX2A 1SR6C 2JTZA 2CTNA 4FTGA 3EVVA 3R1OA 2YGUA 5D69A 2H2KA 1K96A 3WHTB 2JQ6A 4F7FA 1OOHA 2M1UA 2M49B 3SG2A 1PRWA 3AAKA 1NYAA 3BUMB 3VROA 3I5IB 4PCWA 3A8RA 1A29A 5CSIA 1QWVA 3AKBA 3B6XA 1K8UA 1KK7Z 3OB2B 1QVIY 2SCPA 1DELA 4ICBA 1K93D 1A03A 1CLMA 2KGRA 5PALA 1BJFA 3KPXA 1Y1XA 5HYDA 2KSPA 3K21A 3NHIA 2KNEA 3LLEA 5FI7A 3S0FA 1DC1A 1J7QA 4E68A 3PSRA 1KWOC 1LA0A 1YTZC 1YX8A 2F2PA 2QEOA 1F8HA 3EK4A 3BOWA 5HKWA 5CPVA 1CM4A 4QJ4B 5F6TA 1J7OA 5AXIA 3JVTC 3VGOA 2H61A 2KI4B 2LVKA 4PE7A 3O4YA 4PE1A 2LP2A 1OOIX 1UUSA 3L47A 1HT9A 1CB1A 1JF2A 1L7ZA 1NX2A 3EG5B 1BR1B 1XVJA 1ZACA 3GK1A 5FI6A 1TUZA 1MXLC 2I18A 1JF0A 5EL2A 2ZRTA 3OX6A 1YRTB 4WQ3A 3CZTX 2L2EA 3DVMA 1W7JB 1XYDA 5BPJA 2VRGA 1K90D 5DICA 4MZJA 1FI5A 2BBMA 2FJUB 3I5HB 1SRAA 4ORAB 1B1GA 1JUOA 2LMTA 2KDHA 1S1EA 2JZIA 3D0YB 2K60A 5CSJA 1MQ1A 1SR6B 1MWNA 3NSKA 4WQ2A 2KAXA 2O5GA 1RROA 1XA5A 1OZSA 3GK2A 2ZFDA 1SCVA 2WC5A 2CT9A 1F54A 5AERA 3TDUA 3VB1A 1OMVA 2F2OA 1BODA 1BG1A 3NSIA 2ZKMX 3S0GA 3DYEA 1QJTA 2JPOA 3L4LA 1GQMA 3CR4X 4MBEA 2JTTA 5HL1A 4AOMA 2JXLA 1TNWA 2K7DA 1B7TY 1IQ3A 1MF8B 1CFPA 1SCMC 1FF1A 2Q4UA 2G2BA 1NCXA 2BL0C 1TIZA 2V53A 4OV2A 4YRUA 2L5XB 2JNFA 5JJGA 2L4HA 4FQTA 3I5IC 4JWQA 4YBHB 3IF7A 4PE0A 1J7RA 3AKAA 1OOFA 2K2AA 1XFVO 2PMYA 2LUCA 1B9AA 3M0WA 1TCFA 2AUCA 5D3OA 4ZCVA 1AJ5A 1B8RA 4PE4A 1SK6D 1YVLA 1S36A 1ZMZA 2I7AA 2AAOA 2M9GA 3N7HA 5I94A 1QV0A 2FOTA 3V2LA 1OMRA 2PQLA 1OOGA 5ER4X 1QXPA 1YURA 4GPLB 1WRKA 4GFTA 5IBWA 2EC6C 3SS5A 4DUQA 4GGFC 3FE8A 3B86A 1BU3A 1TCOB 1B4CA 3NHTA 1YVHA 2KBMA 3RM1A 3NXAA 4D1EA 1C7WA 2F8PA 1GGZA 2KFFA 1MUXA 2OS8C 2ZN8A 4I5JA 2COLB 1ODBA 5I8NA 4C0KA 4PHMA 4M2QA 3CDNA 1XFWO 4YI8A 1U5IB 3GK4X 3KF9A 2MBXA 3I5HC 3WXAA 1DGUA 1KQMC 2EGDA 4JKTA 1WRLA 1RJVA 1W9ZA 2LP3A 1QLKA 2I94A 4A4BA 1RWYA 1XFYO 3KO0A 3EK8A 1YX7A 1SCMB 4HRGA 1XFZO 4MVFA 2BE4A 2BL0B 1G33A 3CR5X 1CMGA 5ER5A 4BY4A 2AMIA 4OVNF 2P70A 1UHJA 3ICBA 4N1FA 3O4XA 3K1EA 1TNXA 1NIWA 1PVBA 1TRFA 4MZKA 1JFKA 2JXCA 2KHNA 4UPGA 1MHOA 2GTEA 3BQ3A 3BXKA 1AJ4A 1Z2CB 4PDZA 3SG7A 1KQVA 4I5LB 1IJ6A 4M2PA 1KFXL 4YGEB 4ORBB 2NZ0A 1PK0D 1DJGA 4TNCA 4C0JA 2BBNA 4QJ3B 2BAPA 2QEBA 3UNWA 3BFAA 5I2LA 1CM1A 3MSEB 1Z4HA 3BUOB 3S0AA 2KGBC 2M1KB 3CR2A 3CYZA 3DF0B 1T14A 2EC6B 2TN4A 4MZLA 1CMFA 3D0YA 1EL4A 1ZUZA 1QS7A 1PVAA 1QX5B 3BUNB 1R2UA 3A4UB 1JC2A 1EG3A 1DF0B 1FBVA 5AEQA 4DCKA 1DJXA 1B47A 2L5YA 2OPOA 3FE9A 2L4IA 3OHMB 3SS3A 4FQOA 4DS7A 1N2DA 4MEWA 3PATA 2MHHA 3RZSA 2OS8B 3PJIA 4F0ZB 2M7NA 2ZN9A 1NSHA 1SY9A 1SL9A 2JU0A 1LS8A 1PSBA 1F4QA 1Y6WA 3TDZA 3UO9A 1NCZA 1SNLA 1KQMB 1PALA 2Q91A 2M0RA 4MN0A 1IKUA 5AFPA 3TZ1A 4NDCA 1KFUL 3WNXB 1ZFSA 4AQIA 1OQPA 1KCYA 1JBAA 1B7TZ 1S5GZ 3BUXB 2ZRSA 2WCBA 5DKNA 1M46A 1DJHA 1XFUO 1Y1AA 4QJ5B 2NCOA 1OMDA 2WCEA 1K9UA 1DEKA 1OW4A 1N65A 4OZDA 2M97A 5TNCA 2KYCA 1A2XA 3LCPC 1DT7B 4U8DA 1YR5A 1TNQA 2MLFC 3SG3A 3IQQA 2K8MB 1KSOA 1VRKA 2LANA 4CFRA 2HF5A 3DXLA 4OR9B 3I5GC 2E6WA 2Y1MA 2BCAA 3EK7A 1LA3A 2NLNA 2SASA 2KOTA 2PRUA 3DZTA 1WY9A 5HKZA 1C3YA 3BUWB 1K9PA 3D77A 3CS1A 1WRZA 2NXQA 1FPWA 1IIOA 3ZWHA 5HLVA 1GJYA 1E8AA 2QEVA 2L0PA 2O60A 3GOFA 2BECA 5DKQA 4DRWA 3PLFB 4PT1A 4C0LA 1RFJA 3D78A 3O6BA 1SL8A 4P5OE 1SW8A 1J7PA 1K2HA 2HETA 2JOJA 2HPSA 2M29A 4N5XA 2FCEA 3PFVA 4USLA 2MLEC 1XFRA 3PN7C 4GGNA 1CKKA 4CFQA 4N1GA 2KYFA 4JPZB 4Q04A 3NSLA 1ALVA 2KQ6A 1U5IA 1NWDA 2OTGC 3R1VA 4OKHA 4YGCB 5KSZA 2KAYA 1DJZA 1DQEA 2CNPA 2P6BB 3QRXA 3CWGA 1TN4A 3FS7A 3CABA 1QASA 2IS9A 1CLBA 1QIWA 1F55A 1L2OC 3HX4A 2LVJA 1CDPA 3LK0A 1UWOA 3TUYB 5DKRA 2LVIA 3HCMA 4KYNA 3S0BA 3JTDC 3NGVA 1TTXA 1G8IA 3TS5C 1TUJA 2KLEA 3FIAA 1F71A 2LM5A 1SMGA 1OOJA 1WDCC 2K0JA 4A4CA 2KLDA 2I2RE 1WLZA 1NX0A 1LXFC 2PSRA 3I5FC 2G9BA 1UURA 2K7CA 4I5KA 4L9MA 2KBIA 1K9KA 2LAPA 2CBLA 2MAZA 1AUIB 1TNPA 3LL8B 3OP0A 2JWWA 2BE6A 1A75B 1YUUA 3D74A 3I5GB 2CXJA 4CLNA 1BOCA 1DGVA 1UHNA 1NUBA 1QVIZ 1IH0A 2K7BA 2Y5IA 2PASA 2LNKA 5FYXA 1LINA 1LVCD 1P28A 3DY9A 3DF0A 1CFFA 2A4JA 1PSRA 1SSEB 2K61A 5D7FA 2JT0A 4YI9A 4GGFA 1QX7A 5HLOA 1IGVA 1DJIA 4ZCUA 4MSPA 2JT8A 4XJKB 1DF0A 2WCFA 1BT6A 3D76A 1X02A 3DVKA 1DTLA 1SPYA 2Y1NA 1S3PA 2Y4QA 3DD4A 2L50A 1AP4A 1CDMA 1H8BA 4YGBB 3EKJA 1W7IB 3CGAA 1UHHA 3R72A 2GGMA 2KPHA 3FWCA 4IJ7A 3PN7B 4GAOA 3S0EA 2NCPA 3F45A 2QEHA 1XK4C 3Q8IA 3VRPA 2LC5A 3FE6A 3TDIA 5FI2A 2H61C 2MJWB 2OTGB 3BFBA 3CZ1A 2BCBA 4JQ0D 4R1EA 3ZNIA 1CFDA 1M45A 3NSOA 2R2IA 2LHIA 1Q80A 1M31A 2ZNDA 3PM2A 4NQGA 1L2OB 2WORA 3IQOA 4JD9A 4CIDA 2QDIA 1B8LA 1BMOA 2H8VA 2K7OA 2ISDA 4HREE 4PHJA 2F3ZA 1CTRA 1YRUB 4P2YB 2KQYA 3JTDB 1QTXA 2WCMA 3TS5B 1EJ3A 3B87A 3E3RA 3OGNA 3LK1A 4XYNA 1WDCB 2LE9B 4YGAA 4MLWA 2PALA 4HRHA 1AHRA 1G4YR 3OX5A 2FJYA 4YGDB 5G08A 1BLQA 2ERBA 3SG5A 2CCMA 3EKHA 3I5FB 1OZOA 4DIRA 5AANA 3TUYC 1F70A 1KK8C 5I2OA 4OCIA 1UHIA 3KHEA 1KK7Y 1IJ5A 1D1OA 1JSAA 1NX1A 2M8UA 4NDDA 4NDBA 1AK8A 1XK4A 2JC2A 1EXRA 2JULA 1C3ZA 2F3YA 2MRDA 2BKHB 1UP5A 1FW4A 2LCPA 3OBVA 1RK9A 5HKYA 2LLUA 1AVSA 3QMEA 1KFXS 2B1UA 2HQWA 1J55A 1XFXO 3SJSA 2LLTA 2WNDA 4M2OA 1CDLA 1OE9B 3AAJA 1GGWA 3B88A 3VRRA 5I2QA 2LV7A 1K95A 1NCYA 1NP8A 1QV1A 3IVTA 1BF5A 2LVVA 3RLZA 1IWQA 1V1FA 2JPTA 2WOSA 1JWDA 3BOWB 1QLSA 1XO5A 1ORGA 2D8NA 3CTNA 2FCDA 3D75A 1S6CA 1R6PA 2LLSA 1JFJA 3VRQA 2WC6A 3BFHA 3CZ0A 1RECA 1SL7A 2HQ8A 3C1VA 2E30A 1CNPA 2DOQA 1A4PA 5J3XA 3VRNA 5K89A 3SIBA 3B7AA 5KTYA 1CFCA 3H4SE 3SG4A 1CDNA 1S6IA 1FI6A 2LMUA 3FWBA 4WRIA 2K2FA 4BY5A 2JT3A 5B8IB 3BJHA 1BR4B 2L2CA 5KU1A 2BCXA 1NX3A 4INWA 1S26D 1S5GY 3D73A 3O2PA 2PVBA 1KSMA 3SIAA 3R1PA 1KFUS 3WHUB 1PULA 1SKTA 2BNXA 2L51A 3O78A 5JOLA 2M7LA 3PM8A 5CSNA 2ZNEA 2WCHA 2QPTA 1V1GA 1J1DA 1YUTA 2EHBA 1A75A 1KWOB 3L4AA 2QACA 2KI6C 2L98A 4PALA 4MRXA 2MA2A 1TOPA 3CLNA 1KK8B 1OSAA 1GM0A 2PYQA 1MXEA 1B8CA 4HSZA 4MRYA 5CSFA 1NPQA 3DVEA 2LHLA 3EVUA 1K94A 3JVTB 1J1EA 3SG6A 1S6JA 1SBJA 1C7VA 1F4OA 2KFGA 4XJKA 1LKJA 1EG4A 1DMOA 1MR8A 1Y0VH 4INXA 1DJYA 2JNXA 3EVRA 2GV5A 1Y1UA 1ZOTB 4ETOA 1DJWA 4ORCB 5GQQC 2WCKA 2KI6D 1WLMA 1N0YA 2GGZA 1ALWA 2LUXA 3PALA 1H4BA 1IQ5A 1M39A 2LMVA 2WC8A 2KI4C 4PHKA 4GNKB 3DVJA 4PHNA 1IRJA 4GBAA 2KAVA 2M3WA 3CZ2A 1UHKA 4CPVA 2RGIA 1HQVA 3S0DA 1SYMA 2JRFA 1C07A 1QATA 1M63B 1DVIA 1IG5A 1YUSA 4I5NB 4IL1A 4GUKA 1EH2A 2BKIB 1QIVA 2KFHA 3OB1B 1CLLA 3D10A 2F33A 3KEVA
chains in the Genus database with same CATH topology
1RTP1 3BYAA 4AQJA 1QX2A 1SR6C 2JTZA 2CTNA 4FTGA 3EVVA 5D69A 2H2KA 1K96A 3WHTB 2JQ6A 2M1UA 2M49B 3SG2A 1PRWA 3AAKA 1NYAA 3BUMB 3VROA 3I5IB 4PCWA 3A8RA 1A29A 5CSIA 3AKBA 1K8UA 1KK7Z 3OB2B 1QVIY 2SCPA 4ICBA 1K93D 1A03A 1CLMA 2KGRA 5PALA 1BJFA 3KPXA 1Y1XA 5HYDA 2KSPA 3K21A 2KNEA 3LLEA 1J7QA 4E68A 3PSRA 1KWOC 1LA0A 1YTZC 1YX8A 2F2PA 1F8HA 3EK4A 3BOWA 5HKWA 5CPVA 1CM4A 4QJ4B 5F6TA 1J7OA 5AXIA 3JVTC 3VGOA 2H61A 2KI4B 2LVKA 4PE7A 3O4YA 4PE1A 2LP2A 1UUSA 1HT9A 1CB1A 1JF2A 1L7ZA 1NX2A 1BR1B 1XVJA 1ZACA 3GK1A 1MXLC 2I18A 1JF0A 2ZRTA 3OX6A 1YRTB 4WQ3A 3CZTX 2L2EA 3DVMA 1W7JB 1XYDA 5BPJA 2VRGA 1K90D 4MZJA 1FI5A 2BBMA 2FJUB 3I5HB 1SRAA 4ORAB 1B1GA 1JUOA 2LMTA 2KDHA 1S1EA 2JZIA 3D0YB 5CSJA 1MQ1A 1SR6B 1MWNA 3NSKA 4WQ2A 2KAXA 2O5GA 1RROA 1XA5A 1OZSA 3GK2A 2ZFDA 1SCVA 2CT9A 1F54A 5AERA 3TDUA 1OMVA 2F2OA 1BODA 1BG1A 3NSIA 2ZKMX 1QJTA 1GQMA 3CR4X 4MBEA 2JTTA 4AOMA 2JXLA 1TNWA 2K7DA 1B7TY 1IQ3A 1MF8B 1CFPA 1SCMC 1FF1A 2Q4UA 2G2BA 1NCXA 2BL0C 1TIZA 2V53A 4OV2A 4YRUA 2L5XB 2JNFA 5JJGA 2L4HA 4JWQA 3I5IC 4YBHB 3IF7A 4PE0A 1J7RA 3AKAA 2K2AA 1XFVO 2PMYA 2LUCA 1B9AA 3M0WA 1TCFA 2AUCA 4ZCVA 1AJ5A 1B8RA 4PE4A 1SK6D 1YVLA 1S36A 1ZMZA 2I7AA 2AAOA 2M9GA 1QV0A 2FOTA 1OMRA 5ER4X 1QXPA 1YURA 4GPLB 1WRKA 4GFTA 5IBWA 2EC6C 4DUQA 4GGFC 1BU3A 1TCOB 1B4CA 1YVHA 2KBMA 3RM1A 3NXAA 4D1EA 1C7WA 2F8PA 1GGZA 2KFFA 1MUXA 2OS8C 2ZN8A 4I5JA 2COLB 1ODBA 5I8NA 4C0KA 4PHMA 4M2QA 4YI8A 1XFWO 1U5IB 3GK4X 3KF9A 2MBXA 3I5HC 3WXAA 1DGUA 1KQMC 2EGDA 1WRLA 1RJVA 2LP3A 1QLKA 2I94A 4A4BA 1RWYA 1XFYO 3KO0A 3EK8A 1YX7A 1SCMB 4HRGA 1XFZO 4MVFA 2BE4A 2BL0B 1G33A 3CR5X 1CMGA 5ER5A 4BY4A 2AMIA 4OVNF 1UHJA 3ICBA 4N1FA 1TNXA 1NIWA 1PVBA 1TRFA 4MZKA 1JFKA 2JXCA 2KHNA 4UPGA 1MHOA 4PDZA 3BQ3A 3BXKA 1AJ4A 3SG7A 1KQVA 4I5LB 1IJ6A 4M2PA 1KFXL 4YGEB 4ORBB 2NZ0A 1PK0D 1DJGA 4TNCA 4C0JA 2BBNA 4QJ3B 5I2LA 1CM1A 3MSEB 3BUOB 2KGBC 2M1KB 3CR2A 3DF0B 2EC6B 2TN4A 4MZLA 1CMFA 3D0YA 1EL4A 1ZUZA 1QS7A 1PVAA 1QX5B 3BUNB 1R2UA 3A4UB 1JC2A 1EG3A 1DF0B 1FBVA 5AEQA 4DCKA 1DJXA 1B47A 3OHMB 2OPOA 2L4IA 4DS7A 4FQOA 1N2DA 4MEWA 3PATA 2MHHA 2OS8B 4F0ZB 2M7NA 2ZN9A 1NSHA 1SY9A 1SL9A 2JU0A 1PSBA 1F4QA 1Y6WA 3TDZA 1NCZA 1SNLA 1KQMB 1PALA 2Q91A 2M0RA 4MN0A 1IKUA 5AFPA 3TZ1A 4NDCA 1KFUL 3WNXB 1ZFSA 4AQIA 1OQPA 1KCYA 1JBAA 1B7TZ 1S5GZ 3BUXB 2ZRSA 2WCBA 5DKNA 1M46A 1DJHA 1XFUO 1Y1AA 4QJ5B 2NCOA 1OMDA 2WCEA 1K9UA 1N65A 2M97A 5TNCA 2KYCA 1A2XA 3LCPC 1DT7B 4U8DA 1YR5A 1TNQA 2MLFC 3SG3A 3IQQA 2K8MB 1KSOA 1VRKA 2LANA 4CFRA 2HF5A 4OR9B 3I5GC 2E6WA 2Y1MA 2BCAA 3EK7A 1LA3A 2NLNA 2SASA 2KOTA 2PRUA 1WY9A 5HKZA 3BUWB 1K9PA 3CS1A 1WRZA 2NXQA 1FPWA 3ZWHA 5HLVA 1GJYA 1E8AA 2L0PA 2O60A 3GOFA 2BECA 5DKQA 4DRWA 3PLFB 4C0LA 1RFJA 3O6BA 1SL8A 4P5OE 1SW8A 1J7PA 1K2HA 2HETA 2JOJA 2HPSA 2M29A 4N5XA 2FCEA 3PFVA 4USLA 2MLEC 3PN7C 4GGNA 1CKKA 4CFQA 4N1GA 2KYFA 4JPZB 4Q04A 3NSLA 1ALVA 2KQ6A 1U5IA 1NWDA 2OTGC 4YGCB 4OKHA 5KSZA 2KAYA 1DJZA 2CNPA 2P6BB 3QRXA 3CWGA 1TN4A 3FS7A 1QASA 2IS9A 1CLBA 1QIWA 1F55A 1L2OC 3HX4A 2LVJA 1CDPA 3LK0A 1UWOA 3TUYB 5DKRA 2LVIA 3HCMA 3JTDC 1TTXA 1G8IA 3TS5C 3FIAA 1F71A 2LM5A 1SMGA 1OOJA 1WDCC 2K0JA 4A4CA 2I2RE 1WLZA 1NX0A 1LXFC 2PSRA 3I5FC 2G9BA 1UURA 2K7CA 4I5KA 4L9MA 2KBIA 1K9KA 2LAPA 2CBLA 2MAZA 1AUIB 1TNPA 3LL8B 3OP0A 2JWWA 2BE6A 1A75B 1YUUA 3I5GB 2CXJA 4CLNA 1BOCA 1DGVA 1UHNA 1NUBA 1QVIZ 1IH0A 2K7BA 2Y5IA 2PASA 2LNKA 5FYXA 1LINA 1LVCD 1CFFA 3DF0A 2A4JA 1PSRA 2K61A 5D7FA 2JT0A 4YI9A 4GGFA 1QX7A 5HLOA 1IGVA 1DJIA 4ZCUA 4MSPA 2JT8A 4XJKB 1DF0A 2WCFA 1BT6A 1X02A 3DVKA 1DTLA 1SPYA 2Y1NA 1S3PA 2Y4QA 3DD4A 2L50A 1AP4A 1CDMA 1H8BA 4YGBB 3EKJA 1W7IB 3CGAA 1UHHA 2GGMA 3FWCA 3PN7B 4GAOA 2NCPA 3F45A 1XK4C 3VRPA 2LC5A 3TDIA 2H61C 2MJWB 2OTGB 2BCBA 4JQ0D 4R1EA 3ZNIA 1CFDA 1M45A 3NSOA 2R2IA 2LHIA 1Q80A 1M31A 2ZNDA 4NQGA 1L2OB 2WORA 3IQOA 4CIDA 1B8LA 1BMOA 2K7OA 2ISDA 4HREE 4PHJA 2F3ZA 1CTRA 1YRUB 4P2YB 2KQYA 3JTDB 1QTXA 3TS5B 1EJ3A 3E3RA 3LK1A 4XYNA 1WDCB 2LE9B 4YGAA 4MLWA 2PALA 4HRHA 1AHRA 1G4YR 3OX5A 5G08A 4YGDB 1BLQA 3SG5A 2CCMA 3EKHA 3I5FB 1OZOA 4DIRA 5AANA 3TUYC 1F70A 1KK8C 5I2OA 4OCIA 1UHIA 3KHEA 1KK7Y 1IJ5A 1D1OA 1JSAA 1NX1A 2M8UA 4NDDA 4NDBA 1AK8A 1XK4A 2JC2A 1EXRA 2JULA 2F3YA 2MRDA 2BKHB 1UP5A 1FW4A 2LCPA 1RK9A 5HKYA 2LLUA 1AVSA 1KFXS 2B1UA 2HQWA 1J55A 1XFXO 3SJSA 2LLTA 2WNDA 4M2OA 1CDLA 1OE9B 3AAJA 1GGWA 3VRRA 5I2QA 2LV7A 1K95A 1NCYA 1NP8A 1QV1A 1BF5A 2LVVA 3RLZA 1IWQA 1V1FA 2JPTA 2WOSA 1JWDA 3BOWB 1QLSA 1XO5A 2D8NA 3CTNA 2FCDA 1S6CA 1R6PA 2LLSA 1JFJA 3VRQA 1RECA 1SL7A 2HQ8A 3C1VA 2E30A 1CNPA 2DOQA 1A4PA 5J3XA 3VRNA 5K89A 3SIBA 5KTYA 1CFCA 3H4SE 3SG4A 1CDNA 1S6IA 1FI6A 2LMUA 3FWBA 4WRIA 2K2FA 4BY5A 2JT3A 5B8IB 1BR4B 5KU1A 2BCXA 1NX3A 1S26D 1S5GY 3O2PA 2PVBA 1KSMA 3SIAA 1KFUS 3WHUB 1PULA 1SKTA 2L51A 5JOLA 3O78A 2M7LA 3PM8A 5CSNA 2ZNEA 2QPTA 1V1GA 1J1DA 1YUTA 2EHBA 1A75A 1KWOB 2QACA 2KI6C 2L98A 4PALA 4MRXA 2MA2A 1TOPA 3CLNA 1KK8B 1OSAA 1MXEA 1B8CA 4HSZA 4MRYA 5CSFA 1NPQA 3DVEA 2LHLA 3EVUA 1K94A 3JVTB 1J1EA 3SG6A 1S6JA 1SBJA 1C7VA 1F4OA 2KFGA 4XJKA 1LKJA 1EG4A 1DMOA 1MR8A 1Y0VH 1DJYA 2JNXA 3EVRA 2GV5A 1Y1UA 1ZOTB 4ETOA 1DJWA 4ORCB 5GQQC 2KI6D 1WLMA 1N0YA 2GGZA 1ALWA 2LUXA 3PALA 1H4BA 1IQ5A 1M39A 2LMVA 2WC8A 2KI4C 4PHKA 4GNKB 3DVJA 4PHNA 1IRJA 4GBAA 2KAVA 2M3WA 4CPVA 1UHKA 2RGIA 1HQVA 1SYMA 2JRFA 1C07A 1QATA 1M63B 1DVIA 1IG5A 1YUSA 4I5NB 4IL1A 4GUKA 1EH2A 2BKIB 1QIVA 2KFHA 3OB1B 1CLLA 3D10A 2F33A 3KEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTP 1;  3BYA A;  4AQJ A;  1QX2 A;  1SR6 C;  2JTZ A;  2CTN A;  4FTG A;  3EVV A;  5D69 A;  2H2K A;  1K96 A;  3WHT B;  2JQ6 A;  2M1U A;  2M49 B;  3SG2 A;  1PRW A;  3AAK A;  1NYA A;  3BUM B;  3VRO A;  3I5I B;  4PCW A;  3A8R A;  1A29 A;  5CSI A;  3AKB A;  1K8U A;  1KK7 Z;  3OB2 B;  1QVI Y;  2SCP A;  4ICB A;  1K93 D;  1A03 A;  1CLM A;  2KGR A;  5PAL A;  1BJF A;  3KPX A;  1Y1X A;  5HYD A;  2KSP A;  3K21 A;  2KNE A;  3LLE A;  1J7Q A;  4E68 A;  3PSR A;  1KWO C;  1LA0 A;  1YTZ C;  1YX8 A;  2F2P A;  1F8H A;  3EK4 A;  3BOW A;  5HKW A;  5CPV A;  1CM4 A;  4QJ4 B;  5F6T A;  1J7O A;  5AXI A;  3JVT C;  3VGO A;  2H61 A;  2KI4 B;  2LVK A;  4PE7 A;  3O4Y A;  4PE1 A;  2LP2 A;  1UUS A;  1HT9 A;  1CB1 A;  1JF2 A;  1L7Z A;  1NX2 A;  1BR1 B;  1XVJ A;  1ZAC A;  3GK1 A;  1MXL C;  2I18 A;  1JF0 A;  2ZRT A;  3OX6 A;  1YRT B;  4WQ3 A;  3CZT X;  2L2E A;  3DVM A;  1W7J B;  1XYD A;  5BPJ A;  2VRG A;  1K90 D;  4MZJ A;  1FI5 A;  2BBM A;  2FJU B;  3I5H B;  1SRA A;  4ORA B;  1B1G A;  1JUO A;  2LMT A;  2KDH A;  1S1E A;  2JZI A;  3D0Y B;  5CSJ A;  1MQ1 A;  1SR6 B;  1MWN A;  3NSK A;  4WQ2 A;  2KAX A;  2O5G A;  1RRO A;  1XA5 A;  1OZS A;  3GK2 A;  2ZFD A;  1SCV A;  2CT9 A;  1F54 A;  5AER A;  3TDU A;  1OMV A;  2F2O A;  1BOD A;  1BG1 A;  3NSI A;  2ZKM X;  1QJT A;  1GQM A;  3CR4 X;  4MBE A;  2JTT A;  4AOM A;  2JXL A;  1TNW A;  2K7D A;  1B7T Y;  1IQ3 A;  1MF8 B;  1CFP A;  1SCM C;  1FF1 A;  2Q4U A;  2G2B A;  1NCX A;  2BL0 C;  1TIZ A;  2V53 A;  4OV2 A;  4YRU A;  2L5X B;  2JNF A;  5JJG A;  2L4H A;  4JWQ A;  3I5I C;  4YBH B;  3IF7 A;  4PE0 A;  1J7R A;  3AKA A;  2K2A A;  1XFV O;  2PMY A;  2LUC A;  1B9A A;  3M0W A;  1TCF A;  2AUC A;  4ZCV A;  1AJ5 A;  1B8R A;  4PE4 A;  1SK6 D;  1YVL A;  1S36 A;  1ZMZ A;  2I7A A;  2AAO A;  2M9G A;  1QV0 A;  2FOT A;  1OMR A;  5ER4 X;  1QXP A;  1YUR A;  4GPL B;  1WRK A;  4GFT A;  5IBW A;  2EC6 C;  4DUQ A;  4GGF C;  1BU3 A;  1TCO B;  1B4C A;  1YVH A;  2KBM A;  3RM1 A;  3NXA A;  4D1E A;  1C7W A;  2F8P A;  1GGZ A;  2KFF A;  1MUX A;  2OS8 C;  2ZN8 A;  4I5J A;  2COL B;  1ODB A;  5I8N A;  4C0K A;  4PHM A;  4M2Q A;  4YI8 A;  1XFW O;  1U5I B;  3GK4 X;  3KF9 A;  2MBX A;  3I5H C;  3WXA A;  1DGU A;  1KQM C;  2EGD A;  1WRL A;  1RJV A;  2LP3 A;  1QLK A;  2I94 A;  4A4B A;  1RWY A;  1XFY O;  3KO0 A;  3EK8 A;  1YX7 A;  1SCM B;  4HRG A;  1XFZ O;  4MVF A;  2BE4 A;  2BL0 B;  1G33 A;  3CR5 X;  1CMG A;  5ER5 A;  4BY4 A;  2AMI A;  4OVN F;  1UHJ A;  3ICB A;  4N1F A;  1TNX A;  1NIW A;  1PVB A;  1TRF A;  4MZK A;  1JFK A;  2JXC A;  2KHN A;  4UPG A;  1MHO A;  4PDZ A;  3BQ3 A;  3BXK A;  1AJ4 A;  3SG7 A;  1KQV A;  4I5L B;  1IJ6 A;  4M2P A;  1KFX L;  4YGE B;  4ORB B;  2NZ0 A;  1PK0 D;  1DJG A;  4TNC A;  4C0J A;  2BBN A;  4QJ3 B;  5I2L A;  1CM1 A;  3MSE B;  3BUO B;  2KGB C;  2M1K B;  3CR2 A;  3DF0 B;  2EC6 B;  2TN4 A;  4MZL A;  1CMF A;  3D0Y A;  1EL4 A;  1ZUZ A;  1QS7 A;  1PVA A;  1QX5 B;  3BUN B;  1R2U A;  3A4U B;  1JC2 A;  1EG3 A;  1DF0 B;  1FBV A;  5AEQ A;  4DCK A;  1DJX A;  1B47 A;  3OHM B;  2OPO A;  2L4I A;  4DS7 A;  4FQO A;  1N2D A;  4MEW A;  3PAT A;  2MHH A;  2OS8 B;  4F0Z B;  2M7N A;  2ZN9 A;  1NSH A;  1SY9 A;  1SL9 A;  2JU0 A;  1PSB A;  1F4Q A;  1Y6W A;  3TDZ A;  1NCZ A;  1SNL A;  1KQM B;  1PAL A;  2Q91 A;  2M0R A;  4MN0 A;  1IKU A;  5AFP A;  3TZ1 A;  4NDC A;  1KFU L;  3WNX B;  1ZFS A;  4AQI A;  1OQP A;  1KCY A;  1JBA A;  1B7T Z;  1S5G Z;  3BUX B;  2ZRS A;  2WCB A;  5DKN A;  1M46 A;  1DJH A;  1XFU O;  1Y1A A;  4QJ5 B;  2NCO A;  1OMD A;  2WCE A;  1K9U A;  1N65 A;  2M97 A;  5TNC A;  2KYC A;  1A2X A;  3LCP C;  1DT7 B;  4U8D A;  1YR5 A;  1TNQ A;  2MLF C;  3SG3 A;  3IQQ A;  2K8M B;  1KSO A;  1VRK A;  2LAN A;  4CFR A;  2HF5 A;  4OR9 B;  3I5G C;  2E6W A;  2Y1M A;  2BCA A;  3EK7 A;  1LA3 A;  2NLN A;  2SAS A;  2KOT A;  2PRU A;  1WY9 A;  5HKZ A;  3BUW B;  1K9P A;  3CS1 A;  1WRZ A;  2NXQ A;  1FPW A;  3ZWH A;  5HLV A;  1GJY A;  1E8A A;  2L0P A;  2O60 A;  3GOF A;  2BEC A;  5DKQ A;  4DRW A;  3PLF B;  4C0L A;  1RFJ A;  3O6B A;  1SL8 A;  4P5O E;  1SW8 A;  1J7P A;  1K2H A;  2HET A;  2JOJ A;  2HPS A;  2M29 A;  4N5X A;  2FCE A;  3PFV A;  4USL A;  2MLE C;  3PN7 C;  4GGN A;  1CKK A;  4CFQ A;  4N1G A;  2KYF A;  4JPZ B;  4Q04 A;  3NSL A;  1ALV A;  2KQ6 A;  1U5I A;  1NWD A;  2OTG C;  4YGC B;  4OKH A;  5KSZ A;  2KAY A;  1DJZ A;  2CNP A;  2P6B B;  3QRX A;  3CWG A;  1TN4 A;  3FS7 A;  1QAS A;  2IS9 A;  1CLB A;  1QIW A;  1F55 A;  1L2O C;  3HX4 A;  2LVJ A;  1CDP A;  3LK0 A;  1UWO A;  3TUY B;  5DKR A;  2LVI A;  3HCM A;  3JTD C;  1TTX A;  1G8I A;  3TS5 C;  3FIA A;  1F71 A;  2LM5 A;  1SMG A;  1OOJ A;  1WDC C;  2K0J A;  4A4C A;  2I2R E;  1WLZ A;  1NX0 A;  1LXF C;  2PSR A;  3I5F C;  2G9B A;  1UUR A;  2K7C A;  4I5K A;  4L9M A;  2KBI A;  1K9K A;  2LAP A;  2CBL A;  2MAZ A;  1AUI B;  1TNP A;  3LL8 B;  3OP0 A;  2JWW A;  2BE6 A;  1A75 B;  1YUU A;  3I5G B;  2CXJ A;  4CLN A;  1BOC A;  1DGV A;  1UHN A;  1NUB A;  1QVI Z;  1IH0 A;  2K7B A;  2Y5I A;  2PAS A;  2LNK A;  5FYX A;  1LIN A;  1LVC D;  1CFF A;  3DF0 A;  2A4J A;  1PSR A;  2K61 A;  5D7F A;  2JT0 A;  4YI9 A;  4GGF A;  1QX7 A;  5HLO A;  1IGV A;  1DJI A;  4ZCU A;  4MSP A;  2JT8 A;  4XJK B;  1DF0 A;  2WCF A;  1BT6 A;  1X02 A;  3DVK A;  1DTL A;  1SPY A;  2Y1N A;  1S3P A;  2Y4Q A;  3DD4 A;  2L50 A;  1AP4 A;  1CDM A;  1H8B A;  4YGB B;  3EKJ A;  1W7I B;  3CGA A;  1UHH A;  2GGM A;  3FWC A;  3PN7 B;  4GAO A;  2NCP A;  3F45 A;  1XK4 C;  3VRP A;  2LC5 A;  3TDI A;  2H61 C;  2MJW B;  2OTG B;  2BCB A;  4JQ0 D;  4R1E A;  3ZNI A;  1CFD A;  1M45 A;  3NSO A;  2R2I A;  2LHI A;  1Q80 A;  1M31 A;  2ZND A;  4NQG A;  1L2O B;  2WOR A;  3IQO A;  4CID A;  1B8L A;  1BMO A;  2K7O A;  2ISD A;  4HRE E;  4PHJ A;  2F3Z A;  1CTR A;  1YRU B;  4P2Y B;  2KQY A;  3JTD B;  1QTX A;  3TS5 B;  1EJ3 A;  3E3R A;  3LK1 A;  4XYN A;  1WDC B;  2LE9 B;  4YGA A;  4MLW A;  2PAL A;  4HRH A;  1AHR A;  1G4Y R;  3OX5 A;  5G08 A;  4YGD B;  1BLQ A;  3SG5 A;  2CCM A;  3EKH A;  3I5F B;  1OZO A;  4DIR A;  5AAN A;  3TUY C;  1F70 A;  1KK8 C;  5I2O A;  4OCI A;  1UHI A;  3KHE A;  1KK7 Y;  1IJ5 A;  1D1O A;  1JSA A;  1NX1 A;  2M8U A;  4NDD A;  4NDB A;  1AK8 A;  1XK4 A;  2JC2 A;  1EXR A;  2JUL A;  2F3Y A;  2MRD A;  2BKH B;  1UP5 A;  1FW4 A;  2LCP A;  1RK9 A;  5HKY A;  2LLU A;  1AVS A;  1KFX S;  2B1U A;  2HQW A;  1J55 A;  1XFX O;  3SJS A;  2LLT A;  2WND A;  4M2O A;  1CDL A;  1OE9 B;  3AAJ A;  1GGW A;  3VRR A;  5I2Q A;  2LV7 A;  1K95 A;  1NCY A;  1NP8 A;  1QV1 A;  1BF5 A;  2LVV A;  3RLZ A;  1IWQ A;  1V1F A;  2JPT A;  2WOS A;  1JWD A;  3BOW B;  1QLS A;  1XO5 A;  2D8N A;  3CTN A;  2FCD A;  1S6C A;  1R6P A;  2LLS A;  1JFJ A;  3VRQ A;  1REC A;  1SL7 A;  2HQ8 A;  3C1V A;  2E30 A;  1CNP A;  2DOQ A;  1A4P A;  5J3X A;  3VRN A;  5K89 A;  3SIB A;  5KTY A;  1CFC A;  3H4S E;  3SG4 A;  1CDN A;  1S6I A;  1FI6 A;  2LMU A;  3FWB A;  4WRI A;  2K2F A;  4BY5 A;  2JT3 A;  5B8I B;  1BR4 B;  5KU1 A;  2BCX A;  1NX3 A;  1S26 D;  1S5G Y;  3O2P A;  2PVB A;  1KSM A;  3SIA A;  1KFU S;  3WHU B;  1PUL A;  1SKT A;  2L51 A;  5JOL A;  3O78 A;  2M7L A;  3PM8 A;  5CSN A;  2ZNE A;  2QPT A;  1V1G A;  1J1D A;  1YUT A;  2EHB A;  1A75 A;  1KWO B;  2QAC A;  2KI6 C;  2L98 A;  4PAL A;  4MRX A;  2MA2 A;  1TOP A;  3CLN A;  1KK8 B;  1OSA A;  1MXE A;  1B8C A;  4HSZ A;  4MRY A;  5CSF A;  1NPQ A;  3DVE A;  2LHL A;  3EVU A;  1K94 A;  3JVT B;  1J1E A;  3SG6 A;  1S6J A;  1SBJ A;  1C7V A;  1F4O A;  2KFG A;  4XJK A;  1LKJ A;  1EG4 A;  1DMO A;  1MR8 A;  1Y0V H;  1DJY A;  2JNX A;  3EVR A;  2GV5 A;  1Y1U A;  1ZOT B;  4ETO A;  1DJW A;  4ORC B;  5GQQ C;  2KI6 D;  1WLM A;  1N0Y A;  2GGZ A;  1ALW A;  2LUX A;  3PAL A;  1H4B A;  1IQ5 A;  1M39 A;  2LMV A;  2WC8 A;  2KI4 C;  4PHK A;  4GNK B;  3DVJ A;  4PHN A;  1IRJ A;  4GBA A;  2KAV A;  2M3W A;  4CPV A;  1UHK A;  2RGI A;  1HQV A;  1SYM A;  2JRF A;  1C07 A;  1QAT A;  1M63 B;  1DVI A;  1IG5 A;  1YUS A;  4I5N B;  4IL1 A;  4GUK A;  1EH2 A;  2BKI B;  1QIV A;  2KFH A;  3OB1 B;  1CLL A;  3D10 A;  2F33 A;  3KEV A; 
#chains in the Genus database with same CATH topology
 1TWO A;  1RTP 1;  3BYA A;  2P71 A;  2WCJ A;  3SS4 A;  4AQJ A;  2WCL A;  1QX2 A;  1SR6 C;  2JTZ A;  2CTN A;  4FTG A;  3EVV A;  3R1O A;  2YGU A;  5D69 A;  2H2K A;  1K96 A;  3WHT B;  2JQ6 A;  4F7F A;  1OOH A;  2M1U A;  2M49 B;  3SG2 A;  1PRW A;  3AAK A;  1NYA A;  3BUM B;  3VRO A;  3I5I B;  4PCW A;  3A8R A;  1A29 A;  5CSI A;  1QWV A;  3AKB A;  3B6X A;  1K8U A;  1KK7 Z;  3OB2 B;  1QVI Y;  2SCP A;  1DEL A;  4ICB A;  1K93 D;  1A03 A;  1CLM A;  2KGR A;  5PAL A;  1BJF A;  3KPX A;  1Y1X A;  5HYD A;  2KSP A;  3K21 A;  3NHI A;  2KNE A;  3LLE A;  5FI7 A;  3S0F A;  1DC1 A;  1J7Q A;  4E68 A;  3PSR A;  1KWO C;  1LA0 A;  1YTZ C;  1YX8 A;  2F2P A;  2QEO A;  1F8H A;  3EK4 A;  3BOW A;  5HKW A;  5CPV A;  1CM4 A;  4QJ4 B;  5F6T A;  1J7O A;  5AXI A;  3JVT C;  3VGO A;  2H61 A;  2KI4 B;  2LVK A;  4PE7 A;  3O4Y A;  4PE1 A;  2LP2 A;  1OOI X;  1UUS A;  3L47 A;  1HT9 A;  1CB1 A;  1JF2 A;  1L7Z A;  1NX2 A;  3EG5 B;  1BR1 B;  1XVJ A;  1ZAC A;  3GK1 A;  5FI6 A;  1TUZ A;  1MXL C;  2I18 A;  1JF0 A;  5EL2 A;  2ZRT A;  3OX6 A;  1YRT B;  4WQ3 A;  3CZT X;  2L2E A;  3DVM A;  1W7J B;  1XYD A;  5BPJ A;  2VRG A;  1K90 D;  5DIC A;  4MZJ A;  1FI5 A;  2BBM A;  2FJU B;  3I5H B;  1SRA A;  4ORA B;  1B1G A;  1JUO A;  2LMT A;  2KDH A;  1S1E A;  2JZI A;  3D0Y B;  2K60 A;  5CSJ A;  1MQ1 A;  1SR6 B;  1MWN A;  3NSK A;  4WQ2 A;  2KAX A;  2O5G A;  1RRO A;  1XA5 A;  1OZS A;  3GK2 A;  2ZFD A;  1SCV A;  2WC5 A;  2CT9 A;  1F54 A;  5AER A;  3TDU A;  3VB1 A;  1OMV A;  2F2O A;  1BOD A;  1BG1 A;  3NSI A;  2ZKM X;  3S0G A;  3DYE A;  1QJT A;  2JPO A;  3L4L A;  1GQM A;  3CR4 X;  4MBE A;  2JTT A;  5HL1 A;  4AOM A;  2JXL A;  1TNW A;  2K7D A;  1B7T Y;  1IQ3 A;  1MF8 B;  1CFP A;  1SCM C;  1FF1 A;  2Q4U A;  2G2B A;  1NCX A;  2BL0 C;  1TIZ A;  2V53 A;  4OV2 A;  4YRU A;  2L5X B;  2JNF A;  5JJG A;  2L4H A;  4FQT A;  3I5I C;  4JWQ A;  4YBH B;  3IF7 A;  4PE0 A;  1J7R A;  3AKA A;  1OOF A;  2K2A A;  1XFV O;  2PMY A;  2LUC A;  1B9A A;  3M0W A;  1TCF A;  2AUC A;  5D3O A;  4ZCV A;  1AJ5 A;  1B8R A;  4PE4 A;  1SK6 D;  1YVL A;  1S36 A;  1ZMZ A;  2I7A A;  2AAO A;  2M9G A;  3N7H A;  5I94 A;  1QV0 A;  2FOT A;  3V2L A;  1OMR A;  2PQL A;  1OOG A;  5ER4 X;  1QXP A;  1YUR A;  4GPL B;  1WRK A;  4GFT A;  5IBW A;  2EC6 C;  3SS5 A;  4DUQ A;  4GGF C;  3FE8 A;  3B86 A;  1BU3 A;  1TCO B;  1B4C A;  3NHT A;  1YVH A;  2KBM A;  3RM1 A;  3NXA A;  4D1E A;  1C7W A;  2F8P A;  1GGZ A;  2KFF A;  1MUX A;  2OS8 C;  2ZN8 A;  4I5J A;  2COL B;  1ODB A;  5I8N A;  4C0K A;  4PHM A;  4M2Q A;  3CDN A;  1XFW O;  4YI8 A;  1U5I B;  3GK4 X;  3KF9 A;  2MBX A;  3I5H C;  3WXA A;  1DGU A;  1KQM C;  2EGD A;  4JKT A;  1WRL A;  1RJV A;  1W9Z A;  2LP3 A;  1QLK A;  2I94 A;  4A4B A;  1RWY A;  1XFY O;  3KO0 A;  3EK8 A;  1YX7 A;  1SCM B;  4HRG A;  1XFZ O;  4MVF A;  2BE4 A;  2BL0 B;  1G33 A;  3CR5 X;  1CMG A;  5ER5 A;  4BY4 A;  2AMI A;  4OVN F;  2P70 A;  1UHJ A;  3ICB A;  4N1F A;  3O4X A;  3K1E A;  1TNX A;  1NIW A;  1PVB A;  1TRF A;  4MZK A;  1JFK A;  2JXC A;  2KHN A;  4UPG A;  1MHO A;  2GTE A;  3BQ3 A;  3BXK A;  1AJ4 A;  1Z2C B;  4PDZ A;  3SG7 A;  1KQV A;  4I5L B;  1IJ6 A;  4M2P A;  1KFX L;  4YGE B;  4ORB B;  2NZ0 A;  1PK0 D;  1DJG A;  4TNC A;  4C0J A;  2BBN A;  4QJ3 B;  2BAP A;  2QEB A;  3UNW A;  3BFA A;  5I2L A;  1CM1 A;  3MSE B;  1Z4H A;  3BUO B;  3S0A A;  2KGB C;  2M1K B;  3CR2 A;  3CYZ A;  3DF0 B;  1T14 A;  2EC6 B;  2TN4 A;  4MZL A;  1CMF A;  3D0Y A;  1EL4 A;  1ZUZ A;  1QS7 A;  1PVA A;  1QX5 B;  3BUN B;  1R2U A;  3A4U B;  1JC2 A;  1EG3 A;  1DF0 B;  1FBV A;  5AEQ A;  4DCK A;  1DJX A;  1B47 A;  2L5Y A;  2OPO A;  3FE9 A;  2L4I A;  3OHM B;  3SS3 A;  4FQO A;  4DS7 A;  1N2D A;  4MEW A;  3PAT A;  2MHH A;  3RZS A;  2OS8 B;  3PJI A;  4F0Z B;  2M7N A;  2ZN9 A;  1NSH A;  1SY9 A;  1SL9 A;  2JU0 A;  1LS8 A;  1PSB A;  1F4Q A;  1Y6W A;  3TDZ A;  3UO9 A;  1NCZ A;  1SNL A;  1KQM B;  1PAL A;  2Q91 A;  2M0R A;  4MN0 A;  1IKU A;  5AFP A;  3TZ1 A;  4NDC A;  1KFU L;  3WNX B;  1ZFS A;  4AQI A;  1OQP A;  1KCY A;  1JBA A;  1B7T Z;  1S5G Z;  3BUX B;  2ZRS A;  2WCB A;  5DKN A;  1M46 A;  1DJH A;  1XFU O;  1Y1A A;  4QJ5 B;  2NCO A;  1OMD A;  2WCE A;  1K9U A;  1DEK A;  1OW4 A;  1N65 A;  4OZD A;  2M97 A;  5TNC A;  2KYC A;  1A2X A;  3LCP C;  1DT7 B;  4U8D A;  1YR5 A;  1TNQ A;  2MLF C;  3SG3 A;  3IQQ A;  2K8M B;  1KSO A;  1VRK A;  2LAN A;  4CFR A;  2HF5 A;  3DXL A;  4OR9 B;  3I5G C;  2E6W A;  2Y1M A;  2BCA A;  3EK7 A;  1LA3 A;  2NLN A;  2SAS A;  2KOT A;  2PRU A;  3DZT A;  1WY9 A;  5HKZ A;  1C3Y A;  3BUW B;  1K9P A;  3D77 A;  3CS1 A;  1WRZ A;  2NXQ A;  1FPW A;  1IIO A;  3ZWH A;  5HLV A;  1GJY A;  1E8A A;  2QEV A;  2L0P A;  2O60 A;  3GOF A;  2BEC A;  5DKQ A;  4DRW A;  3PLF B;  4PT1 A;  4C0L A;  1RFJ A;  3D78 A;  3O6B A;  1SL8 A;  4P5O E;  1SW8 A;  1J7P A;  1K2H A;  2HET A;  2JOJ A;  2HPS A;  2M29 A;  4N5X A;  2FCE A;  3PFV A;  4USL A;  2MLE C;  1XFR A;  3PN7 C;  4GGN A;  1CKK A;  4CFQ A;  4N1G A;  2KYF A;  4JPZ B;  4Q04 A;  3NSL A;  1ALV A;  2KQ6 A;  1U5I A;  1NWD A;  2OTG C;  3R1V A;  4OKH A;  4YGC B;  5KSZ A;  2KAY A;  1DJZ A;  1DQE A;  2CNP A;  2P6B B;  3QRX A;  3CWG A;  1TN4 A;  3FS7 A;  3CAB A;  1QAS A;  2IS9 A;  1CLB A;  1QIW A;  1F55 A;  1L2O C;  3HX4 A;  2LVJ A;  1CDP A;  3LK0 A;  1UWO A;  3TUY B;  5DKR A;  2LVI A;  3HCM A;  4KYN A;  3S0B A;  3JTD C;  3NGV A;  1TTX A;  1G8I A;  3TS5 C;  1TUJ A;  2KLE A;  3FIA A;  1F71 A;  2LM5 A;  1SMG A;  1OOJ A;  1WDC C;  2K0J A;  4A4C A;  2KLD A;  2I2R E;  1WLZ A;  1NX0 A;  1LXF C;  2PSR A;  3I5F C;  2G9B A;  1UUR A;  2K7C A;  4I5K A;  4L9M A;  2KBI A;  1K9K A;  2LAP A;  2CBL A;  2MAZ A;  1AUI B;  1TNP A;  3LL8 B;  3OP0 A;  2JWW A;  2BE6 A;  1A75 B;  1YUU A;  3D74 A;  3I5G B;  2CXJ A;  4CLN A;  1BOC A;  1DGV A;  1UHN A;  1NUB A;  1QVI Z;  1IH0 A;  2K7B A;  2Y5I A;  2PAS A;  2LNK A;  5FYX A;  1LIN A;  1LVC D;  1P28 A;  3DY9 A;  3DF0 A;  1CFF A;  2A4J A;  1PSR A;  1SSE B;  2K61 A;  5D7F A;  2JT0 A;  4YI9 A;  4GGF A;  1QX7 A;  5HLO A;  1IGV A;  1DJI A;  4ZCU A;  4MSP A;  2JT8 A;  4XJK B;  1DF0 A;  2WCF A;  1BT6 A;  3D76 A;  1X02 A;  3DVK A;  1DTL A;  1SPY A;  2Y1N A;  1S3P A;  2Y4Q A;  3DD4 A;  2L50 A;  1AP4 A;  1CDM A;  1H8B A;  4YGB B;  3EKJ A;  1W7I B;  3CGA A;  1UHH A;  3R72 A;  2GGM A;  2KPH A;  3FWC A;  4IJ7 A;  3PN7 B;  4GAO A;  3S0E A;  2NCP A;  3F45 A;  2QEH A;  1XK4 C;  3Q8I A;  3VRP A;  2LC5 A;  3FE6 A;  3TDI A;  5FI2 A;  2H61 C;  2MJW B;  2OTG B;  3BFB A;  3CZ1 A;  2BCB A;  4JQ0 D;  4R1E A;  3ZNI A;  1CFD A;  1M45 A;  3NSO A;  2R2I A;  2LHI A;  1Q80 A;  1M31 A;  2ZND A;  3PM2 A;  4NQG A;  1L2O B;  2WOR A;  3IQO A;  4JD9 A;  4CID A;  2QDI A;  1B8L A;  1BMO A;  2H8V A;  2K7O A;  2ISD A;  4HRE E;  4PHJ A;  2F3Z A;  1CTR A;  1YRU B;  4P2Y B;  2KQY A;  3JTD B;  1QTX A;  2WCM A;  3TS5 B;  1EJ3 A;  3B87 A;  3E3R A;  3OGN A;  3LK1 A;  4XYN A;  1WDC B;  2LE9 B;  4YGA A;  4MLW A;  2PAL A;  4HRH A;  1AHR A;  1G4Y R;  3OX5 A;  2FJY A;  4YGD B;  5G08 A;  1BLQ A;  2ERB A;  3SG5 A;  2CCM A;  3EKH A;  3I5F B;  1OZO A;  4DIR A;  5AAN A;  3TUY C;  1F70 A;  1KK8 C;  5I2O A;  4OCI A;  1UHI A;  3KHE A;  1KK7 Y;  1IJ5 A;  1D1O A;  1JSA A;  1NX1 A;  2M8U A;  4NDD A;  4NDB A;  1AK8 A;  1XK4 A;  2JC2 A;  1EXR A;  2JUL A;  1C3Z A;  2F3Y A;  2MRD A;  2BKH B;  1UP5 A;  1FW4 A;  2LCP A;  3OBV A;  1RK9 A;  5HKY A;  2LLU A;  1AVS A;  3QME A;  1KFX S;  2B1U A;  2HQW A;  1J55 A;  1XFX O;  3SJS A;  2LLT A;  2WND A;  4M2O A;  1CDL A;  1OE9 B;  3AAJ A;  1GGW A;  3B88 A;  3VRR A;  5I2Q A;  2LV7 A;  1K95 A;  1NCY A;  1NP8 A;  1QV1 A;  3IVT A;  1BF5 A;  2LVV A;  3RLZ A;  1IWQ A;  1V1F A;  2JPT A;  2WOS A;  1JWD A;  3BOW B;  1QLS A;  1XO5 A;  1ORG A;  2D8N A;  3CTN A;  2FCD A;  3D75 A;  1S6C A;  1R6P A;  2LLS A;  1JFJ A;  3VRQ A;  2WC6 A;  3BFH A;  3CZ0 A;  1REC A;  1SL7 A;  2HQ8 A;  3C1V A;  2E30 A;  1CNP A;  2DOQ A;  1A4P A;  5J3X A;  3VRN A;  5K89 A;  3SIB A;  3B7A A;  5KTY A;  1CFC A;  3H4S E;  3SG4 A;  1CDN A;  1S6I A;  1FI6 A;  2LMU A;  3FWB A;  4WRI A;  2K2F A;  4BY5 A;  2JT3 A;  5B8I B;  3BJH A;  1BR4 B;  2L2C A;  5KU1 A;  2BCX A;  1NX3 A;  4INW A;  1S26 D;  1S5G Y;  3D73 A;  3O2P A;  2PVB A;  1KSM A;  3SIA A;  3R1P A;  1KFU S;  3WHU B;  1PUL A;  1SKT A;  2BNX A;  2L51 A;  3O78 A;  5JOL A;  2M7L A;  3PM8 A;  5CSN A;  2ZNE A;  2WCH A;  2QPT A;  1V1G A;  1J1D A;  1YUT A;  2EHB A;  1A75 A;  1KWO B;  3L4A A;  2QAC A;  2KI6 C;  2L98 A;  4PAL A;  4MRX A;  2MA2 A;  1TOP A;  3CLN A;  1KK8 B;  1OSA A;  1GM0 A;  2PYQ A;  1MXE A;  1B8C A;  4HSZ A;  4MRY A;  5CSF A;  1NPQ A;  3DVE A;  2LHL A;  3EVU A;  1K94 A;  3JVT B;  1J1E A;  3SG6 A;  1S6J A;  1SBJ A;  1C7V A;  1F4O A;  2KFG A;  4XJK A;  1LKJ A;  1EG4 A;  1DMO A;  1MR8 A;  1Y0V H;  4INX A;  1DJY A;  2JNX A;  3EVR A;  2GV5 A;  1Y1U A;  1ZOT B;  4ETO A;  1DJW A;  4ORC B;  5GQQ C;  2WCK A;  2KI6 D;  1WLM A;  1N0Y A;  2GGZ A;  1ALW A;  2LUX A;  3PAL A;  1H4B A;  1IQ5 A;  1M39 A;  2LMV A;  2WC8 A;  2KI4 C;  4PHK A;  4GNK B;  3DVJ A;  4PHN A;  1IRJ A;  4GBA A;  2KAV A;  2M3W A;  3CZ2 A;  1UHK A;  4CPV A;  2RGI A;  1HQV A;  3S0D A;  1SYM A;  2JRF A;  1C07 A;  1QAT A;  1M63 B;  1DVI A;  1IG5 A;  1YUS A;  4I5N B;  4IL1 A;  4GUK A;  1EH2 A;  2BKI B;  1QIV A;  2KFH A;  3OB1 B;  1CLL A;  3D10 A;  2F33 A;  3KEV A; 
#chains in the Genus database with same CATH homology
 1RTP 1;  3BYA A;  4AQJ A;  1QX2 A;  1SR6 C;  2JTZ A;  2CTN A;  4FTG A;  3EVV A;  5D69 A;  2H2K A;  1K96 A;  3WHT B;  2JQ6 A;  2M1U A;  2M49 B;  3SG2 A;  1PRW A;  3AAK A;  1NYA A;  3BUM B;  3VRO A;  3I5I B;  4PCW A;  3A8R A;  1A29 A;  5CSI A;  3AKB A;  1K8U A;  1KK7 Z;  3OB2 B;  1QVI Y;  2SCP A;  4ICB A;  1K93 D;  1A03 A;  1CLM A;  2KGR A;  5PAL A;  1BJF A;  3KPX A;  1Y1X A;  5HYD A;  2KSP A;  3K21 A;  2KNE A;  3LLE A;  1J7Q A;  4E68 A;  3PSR A;  1KWO C;  1LA0 A;  1YTZ C;  1YX8 A;  2F2P A;  1F8H A;  3EK4 A;  3BOW A;  5HKW A;  5CPV A;  1CM4 A;  4QJ4 B;  5F6T A;  1J7O A;  5AXI A;  3JVT C;  3VGO A;  2H61 A;  2KI4 B;  2LVK A;  4PE7 A;  3O4Y A;  4PE1 A;  2LP2 A;  1UUS A;  1HT9 A;  1CB1 A;  1JF2 A;  1L7Z A;  1NX2 A;  1BR1 B;  1XVJ A;  1ZAC A;  3GK1 A;  1MXL C;  2I18 A;  1JF0 A;  2ZRT A;  3OX6 A;  1YRT B;  4WQ3 A;  3CZT X;  2L2E A;  3DVM A;  1W7J B;  1XYD A;  5BPJ A;  2VRG A;  1K90 D;  4MZJ A;  1FI5 A;  2BBM A;  2FJU B;  3I5H B;  1SRA A;  4ORA B;  1B1G A;  1JUO A;  2LMT A;  2KDH A;  1S1E A;  2JZI A;  3D0Y B;  5CSJ A;  1MQ1 A;  1SR6 B;  1MWN A;  3NSK A;  4WQ2 A;  2KAX A;  2O5G A;  1RRO A;  1XA5 A;  1OZS A;  3GK2 A;  2ZFD A;  1SCV A;  2CT9 A;  1F54 A;  5AER A;  3TDU A;  1OMV A;  2F2O A;  1BOD A;  1BG1 A;  3NSI A;  2ZKM X;  1QJT A;  1GQM A;  3CR4 X;  4MBE A;  2JTT A;  4AOM A;  2JXL A;  1TNW A;  2K7D A;  1B7T Y;  1IQ3 A;  1MF8 B;  1CFP A;  1SCM C;  1FF1 A;  2Q4U A;  2G2B A;  1NCX A;  2BL0 C;  1TIZ A;  2V53 A;  4OV2 A;  4YRU A;  2L5X B;  2JNF A;  5JJG A;  2L4H A;  4JWQ A;  3I5I C;  4YBH B;  3IF7 A;  4PE0 A;  1J7R A;  3AKA A;  2K2A A;  1XFV O;  2PMY A;  2LUC A;  1B9A A;  3M0W A;  1TCF A;  2AUC A;  4ZCV A;  1AJ5 A;  1B8R A;  4PE4 A;  1SK6 D;  1YVL A;  1S36 A;  1ZMZ A;  2I7A A;  2AAO A;  2M9G A;  1QV0 A;  2FOT A;  1OMR A;  5ER4 X;  1QXP A;  1YUR A;  4GPL B;  1WRK A;  4GFT A;  5IBW A;  2EC6 C;  4DUQ A;  4GGF C;  1BU3 A;  1TCO B;  1B4C A;  1YVH A;  2KBM A;  3RM1 A;  3NXA A;  4D1E A;  1C7W A;  2F8P A;  1GGZ A;  2KFF A;  1MUX A;  2OS8 C;  2ZN8 A;  4I5J A;  2COL B;  1ODB A;  5I8N A;  4C0K A;  4PHM A;  4M2Q A;  4YI8 A;  1XFW O;  1U5I B;  3GK4 X;  3KF9 A;  2MBX A;  3I5H C;  3WXA A;  1DGU A;  1KQM C;  2EGD A;  1WRL A;  1RJV A;  2LP3 A;  1QLK A;  2I94 A;  4A4B A;  1RWY A;  1XFY O;  3KO0 A;  3EK8 A;  1YX7 A;  1SCM B;  4HRG A;  1XFZ O;  4MVF A;  2BE4 A;  2BL0 B;  1G33 A;  3CR5 X;  1CMG A;  5ER5 A;  4BY4 A;  2AMI A;  4OVN F;  1UHJ A;  3ICB A;  4N1F A;  1TNX A;  1NIW A;  1PVB A;  1TRF A;  4MZK A;  1JFK A;  2JXC A;  2KHN A;  4UPG A;  1MHO A;  4PDZ A;  3BQ3 A;  3BXK A;  1AJ4 A;  3SG7 A;  1KQV A;  4I5L B;  1IJ6 A;  4M2P A;  1KFX L;  4YGE B;  4ORB B;  2NZ0 A;  1PK0 D;  1DJG A;  4TNC A;  4C0J A;  2BBN A;  4QJ3 B;  5I2L A;  1CM1 A;  3MSE B;  3BUO B;  2KGB C;  2M1K B;  3CR2 A;  3DF0 B;  2EC6 B;  2TN4 A;  4MZL A;  1CMF A;  3D0Y A;  1EL4 A;  1ZUZ A;  1QS7 A;  1PVA A;  1QX5 B;  3BUN B;  1R2U A;  3A4U B;  1JC2 A;  1EG3 A;  1DF0 B;  1FBV A;  5AEQ A;  4DCK A;  1DJX A;  1B47 A;  3OHM B;  2OPO A;  2L4I A;  4DS7 A;  4FQO A;  1N2D A;  4MEW A;  3PAT A;  2MHH A;  2OS8 B;  4F0Z B;  2M7N A;  2ZN9 A;  1NSH A;  1SY9 A;  1SL9 A;  2JU0 A;  1PSB A;  1F4Q A;  1Y6W A;  3TDZ A;  1NCZ A;  1SNL A;  1KQM B;  1PAL A;  2Q91 A;  2M0R A;  4MN0 A;  1IKU A;  5AFP A;  3TZ1 A;  4NDC A;  1KFU L;  3WNX B;  1ZFS A;  4AQI A;  1OQP A;  1KCY A;  1JBA A;  1B7T Z;  1S5G Z;  3BUX B;  2ZRS A;  2WCB A;  5DKN A;  1M46 A;  1DJH A;  1XFU O;  1Y1A A;  4QJ5 B;  2NCO A;  1OMD A;  2WCE A;  1K9U A;  1N65 A;  2M97 A;  5TNC A;  2KYC A;  1A2X A;  3LCP C;  1DT7 B;  4U8D A;  1YR5 A;  1TNQ A;  2MLF C;  3SG3 A;  3IQQ A;  2K8M B;  1KSO A;  1VRK A;  2LAN A;  4CFR A;  2HF5 A;  4OR9 B;  3I5G C;  2E6W A;  2Y1M A;  2BCA A;  3EK7 A;  1LA3 A;  2NLN A;  2SAS A;  2KOT A;  2PRU A;  1WY9 A;  5HKZ A;  3BUW B;  1K9P A;  3CS1 A;  1WRZ A;  2NXQ A;  1FPW A;  3ZWH A;  5HLV A;  1GJY A;  1E8A A;  2L0P A;  2O60 A;  3GOF A;  2BEC A;  5DKQ A;  4DRW A;  3PLF B;  4C0L A;  1RFJ A;  3O6B A;  1SL8 A;  4P5O E;  1SW8 A;  1J7P A;  1K2H A;  2HET A;  2JOJ A;  2HPS A;  2M29 A;  4N5X A;  2FCE A;  3PFV A;  4USL A;  2MLE C;  3PN7 C;  4GGN A;  1CKK A;  4CFQ A;  4N1G A;  2KYF A;  4JPZ B;  4Q04 A;  3NSL A;  1ALV A;  2KQ6 A;  1U5I A;  1NWD A;  2OTG C;  4YGC B;  4OKH A;  5KSZ A;  2KAY A;  1DJZ A;  2CNP A;  2P6B B;  3QRX A;  3CWG A;  1TN4 A;  3FS7 A;  1QAS A;  2IS9 A;  1CLB A;  1QIW A;  1F55 A;  1L2O C;  3HX4 A;  2LVJ A;  1CDP A;  3LK0 A;  1UWO A;  3TUY B;  5DKR A;  2LVI A;  3HCM A;  3JTD C;  1TTX A;  1G8I A;  3TS5 C;  3FIA A;  1F71 A;  2LM5 A;  1SMG A;  1OOJ A;  1WDC C;  2K0J A;  4A4C A;  2I2R E;  1WLZ A;  1NX0 A;  1LXF C;  2PSR A;  3I5F C;  2G9B A;  1UUR A;  2K7C A;  4I5K A;  4L9M A;  2KBI A;  1K9K A;  2LAP A;  2CBL A;  2MAZ A;  1AUI B;  1TNP A;  3LL8 B;  3OP0 A;  2JWW A;  2BE6 A;  1A75 B;  1YUU A;  3I5G B;  2CXJ A;  4CLN A;  1BOC A;  1DGV A;  1UHN A;  1NUB A;  1QVI Z;  1IH0 A;  2K7B A;  2Y5I A;  2PAS A;  2LNK A;  5FYX A;  1LIN A;  1LVC D;  1CFF A;  3DF0 A;  2A4J A;  1PSR A;  2K61 A;  5D7F A;  2JT0 A;  4YI9 A;  4GGF A;  1QX7 A;  5HLO A;  1IGV A;  1DJI A;  4ZCU A;  4MSP A;  2JT8 A;  4XJK B;  1DF0 A;  2WCF A;  1BT6 A;  1X02 A;  3DVK A;  1DTL A;  1SPY A;  2Y1N A;  1S3P A;  2Y4Q A;  3DD4 A;  2L50 A;  1AP4 A;  1CDM A;  1H8B A;  4YGB B;  3EKJ A;  1W7I B;  3CGA A;  1UHH A;  2GGM A;  3FWC A;  3PN7 B;  4GAO A;  2NCP A;  3F45 A;  1XK4 C;  3VRP A;  2LC5 A;  3TDI A;  2H61 C;  2MJW B;  2OTG B;  2BCB A;  4JQ0 D;  4R1E A;  3ZNI A;  1CFD A;  1M45 A;  3NSO A;  2R2I A;  2LHI A;  1Q80 A;  1M31 A;  2ZND A;  4NQG A;  1L2O B;  2WOR A;  3IQO A;  4CID A;  1B8L A;  1BMO A;  2K7O A;  2ISD A;  4HRE E;  4PHJ A;  2F3Z A;  1CTR A;  1YRU B;  4P2Y B;  2KQY A;  3JTD B;  1QTX A;  3TS5 B;  1EJ3 A;  3E3R A;  3LK1 A;  4XYN A;  1WDC B;  2LE9 B;  4YGA A;  4MLW A;  2PAL A;  4HRH A;  1AHR A;  1G4Y R;  3OX5 A;  5G08 A;  4YGD B;  1BLQ A;  3SG5 A;  2CCM A;  3EKH A;  3I5F B;  1OZO A;  4DIR A;  5AAN A;  3TUY C;  1F70 A;  1KK8 C;  5I2O A;  4OCI A;  1UHI A;  3KHE A;  1KK7 Y;  1IJ5 A;  1D1O A;  1JSA A;  1NX1 A;  2M8U A;  4NDD A;  4NDB A;  1AK8 A;  1XK4 A;  2JC2 A;  1EXR A;  2JUL A;  2F3Y A;  2MRD A;  2BKH B;  1UP5 A;  1FW4 A;  2LCP A;  1RK9 A;  5HKY A;  2LLU A;  1AVS A;  1KFX S;  2B1U A;  2HQW A;  1J55 A;  1XFX O;  3SJS A;  2LLT A;  2WND A;  4M2O A;  1CDL A;  1OE9 B;  3AAJ A;  1GGW A;  3VRR A;  5I2Q A;  2LV7 A;  1K95 A;  1NCY A;  1NP8 A;  1QV1 A;  1BF5 A;  2LVV A;  3RLZ A;  1IWQ A;  1V1F A;  2JPT A;  2WOS A;  1JWD A;  3BOW B;  1QLS A;  1XO5 A;  2D8N A;  3CTN A;  2FCD A;  1S6C A;  1R6P A;  2LLS A;  1JFJ A;  3VRQ A;  1REC A;  1SL7 A;  2HQ8 A;  3C1V A;  2E30 A;  1CNP A;  2DOQ A;  1A4P A;  5J3X A;  3VRN A;  5K89 A;  3SIB A;  5KTY A;  1CFC A;  3H4S E;  3SG4 A;  1CDN A;  1S6I A;  1FI6 A;  2LMU A;  3FWB A;  4WRI A;  2K2F A;  4BY5 A;  2JT3 A;  5B8I B;  1BR4 B;  5KU1 A;  2BCX A;  1NX3 A;  1S26 D;  1S5G Y;  3O2P A;  2PVB A;  1KSM A;  3SIA A;  1KFU S;  3WHU B;  1PUL A;  1SKT A;  2L51 A;  5JOL A;  3O78 A;  2M7L A;  3PM8 A;  5CSN A;  2ZNE A;  2QPT A;  1V1G A;  1J1D A;  1YUT A;  2EHB A;  1A75 A;  1KWO B;  2QAC A;  2KI6 C;  2L98 A;  4PAL A;  4MRX A;  2MA2 A;  1TOP A;  3CLN A;  1KK8 B;  1OSA A;  1MXE A;  1B8C A;  4HSZ A;  4MRY A;  5CSF A;  1NPQ A;  3DVE A;  2LHL A;  3EVU A;  1K94 A;  3JVT B;  1J1E A;  3SG6 A;  1S6J A;  1SBJ A;  1C7V A;  1F4O A;  2KFG A;  4XJK A;  1LKJ A;  1EG4 A;  1DMO A;  1MR8 A;  1Y0V H;  1DJY A;  2JNX A;  3EVR A;  2GV5 A;  1Y1U A;  1ZOT B;  4ETO A;  1DJW A;  4ORC B;  5GQQ C;  2KI6 D;  1WLM A;  1N0Y A;  2GGZ A;  1ALW A;  2LUX A;  3PAL A;  1H4B A;  1IQ5 A;  1M39 A;  2LMV A;  2WC8 A;  2KI4 C;  4PHK A;  4GNK B;  3DVJ A;  4PHN A;  1IRJ A;  4GBA A;  2KAV A;  2M3W A;  4CPV A;  1UHK A;  2RGI A;  1HQV A;  1SYM A;  2JRF A;  1C07 A;  1QAT A;  1M63 B;  1DVI A;  1IG5 A;  1YUS A;  4I5N B;  4IL1 A;  4GUK A;  1EH2 A;  2BKI B;  1QIV A;  2KFH A;  3OB1 B;  1CLL A;  3D10 A;  2F33 A;  3KEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...