2RGIA

Crystal structure of ca2+-free s100a2 at 1.6 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
MSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ca2+ -free S100A2 at 1.6-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A2
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2rgiA00
1RWYA 1NCYA 4I5NB 1XVJA 1Y6WA 4XJKB 1BG1A 2LCPA 2BCXA 2EHBA 2COLB 1U5IA 4GGFC 1XK4C 1WDCB 3CS1A 2JT0A 1UHJA 2JNXA 2LVVA 5J3XA 2A4JA 2I2RE 4MZJA 3EKHA 5AEQA 4YGBB 2L4IA 3CWGA 3EK7A 3KF9A 4NDDA 1J7QA 1YUTA 2F2PA 4HRHA 4PE4A 4PDZA 3O2PA 3WHUB 2BBMA 4CLNA 2KNEA 1NWDA 3BOWA 5I2OA 5HKYA 1J1EA 1MWNA 1V1FA 1J7OA 1XFXO 1UUSA 4GUKA 3EKJA 1SR6B 2LP2A 2JZIA 3BYAA 3LK1A 1MXLC 2JTZA 1GQMA 4XYNA 3I5GC 1HT9A 1ALVA 1NX2A 1UP5A 1WRKA 3CR4X 4N5XA 2LM5A 1S6IA 3WXAA 2LAPA 3VGOA 2LUCA 2PALA 3PATA 1TNXA 2CCMA 1A4PA 3PN7C 1S36A 2IS9A 3PFVA 1MF8B 2BCBA 2ZFDA 3FWCA 5F6TA 4ICBA 2MJWB 1OMVA 4YI8A 1TIZA 5KSZA 1K90D 2FOTA 2CNPA 2KQYA 1BT6A 1TN4A 2LC5A 4MBEA 4MRYA 4U8DA 1A2XA 1QXPA 1M39A 4P5OE 2MRDA 1CFFA 2E30A 2KGRA 4PCWA 1CFCA 4PHNA 1IWQA 2NZ0A 3EK8A 1B7TZ 3NSOA 2K0JA 1KFUS 3HX4A 1QV0A 4I5LB 2EC6C 1W7IB 2Q4UA 1JFKA 1FI6A 1S26D 1KQMC 3SG3A 1H8BA 2KBMA 1CMGA 1QIWA 3RLZA 2EGDA 1QVIY 2R2IA 1PVAA 1NX1A 5K89A 1NIWA 1CLMA 1W7JB 1MXEA 2JT8A 3D0YA 2MA2A 1NX3A 4M2QA 3A4UB 2MBXA 1IJ5A 1FF1A 2BKHB 3PSRA 2BECA 1XFZO 5HYDA 2JOJA 4HRGA 5HLOA 4DUQA 1JF0A 2GGZA 2BE6A 1CM4A 1R6PA 5CSNA 1JBAA 3VRPA 4NQGA 2K7CA 1WRLA 2F2OA 1B8LA 1DJIA 1PALA 1QX5B 2SCPA 2KFHA 3QRXA 2SASA 1F4OA 2EC6B 1SMGA 1AP4A 1K2HA 2HQ8A 1HQVA 4YGEB 2B1UA 2M49B 3M0WA 2BBNA 1KFXS 1M31A 2H2KA 2M3WA 4PALA 4DCKA 1C7WA 1DJYA 4YRUA 1EG4A 4PE0A 1MQ1A 1NP8A 3SG5A 1DJHA 3O78A 1KFUL 5I2QA 4YGCB 2LVJA 4FQOA 1QIVA 2WC8A 4MZLA 1TNQA 1ODBA 1DJZA 4A4BA 4QJ4B 1PULA 1ZUZA 4BY4A 3I5FC 1C7VA 2H61C 1PK0D 5CSJA 1NCXA 5AANA 2K7OA 2HETA 3D10A 3SIAA 2KI6C 2K61A 3ICBA 2DOQA 2KYFA 3KO0A 1CNPA 1X02A 4MVFA 1C07A 2KOTA 1FBVA 1SL9A 1CFDA 1YVHA 4MEWA 1DF0B 3DF0B 1K93D 2F3YA 2KHNA 1CB1A 1NPQA 2VRGA 4PHJA 1KQVA 2OTGC 2V53A 1F71A 5PALA 3TS5B 4OCIA 2NXQA 4JPZB 3F45A 1AJ5A 2HPSA 2JC2A 1KWOB 2CBLA 4YGDB 2WOSA 3O4YA 1RROA 2KFFA 1OE9B 2M7LA 1YX8A 1ZFSA 2H61A 2M9GA 1TCOB 1UHNA 3EVRA 1F4QA 2NLNA 1LKJA 5I2LA 1YRUB 2ISDA 4CIDA 2LANA 1DVIA 3GK1A 1PRWA 3EVVA 2E6WA 1NX0A 3AAKA 5JJGA 1UWOA 2CXJA 2WNDA 2ZNEA 1BLQA 3BUMB 3KPXA 5DKRA 1AK8A 1AJ4A 2NCOA 2G2BA 3LK0A 1GGZA 3DVKA 1NUBA 2WCEA 5AFPA 1TNPA 2JQ6A 2M97A 1Y1XA 2ZN8A 4CFRA 4M2OA 1CFPA 1VRKA 3TS5C 2NCPA 1B1GA 4D1EA 1CM1A 1U5IB 4ORAB 1TNWA 3EVUA 1OMDA 5ER4X 1BODA 4PE1A 2Y1MA 1K9UA 2LNKA 3BUXB 5FYXA 2PMYA 1IRJA 2K2AA 1S5GZ 1CLLA 2L51A 1ZACA 2FCDA 2QACA 4DS7A 1B7TY 1QASA 1UURA 1AVSA 1YUUA 3TUYC 1FI5A 5DKQA 2K2FA 5DKNA 1N2DA 1NCZA 1ZOTB 2MAZA 2Y5IA 3DD4A 3JTDC 1SCVA 2KI4B 1A03A 1SK6D 4NDCA 1K94A 3SG2A 3VRNA 1ALWA 2KDHA 2JU0A 3H4SE 3SG6A 2KGBC 2BL0B 4Q04A 1M45A 1SKTA 4OKHA 1KSMA 4FTGA 2HF5A 1S6JA 1DJGA 4MLWA 1RECA 1CKKA 1LVCD 1DT7B 1B47A 1N65A 3ZWHA 4WQ3A 1J55A 1IG5A 4HSZA 2LHLA 1R2UA 1GGWA 2LE9B 2JT3A 3TDUA 3OHMB 1DMOA 3I5GB 5D7FA 4WQ2A 2I18A 5AERA 1OZOA 4MZKA 1BMOA 4AOMA 1TRFA 4N1GA 1XFWO 2BL0C 2KAXA 2KQ6A 4GGNA 1SW8A 2GGMA 4AQJA 4C0JA 4ORBB 3PALA 3C1VA 2JTTA 2JWWA 3FS7A 2MLEC 2JRFA 1K9PA 3SJSA 1MR8A 1QX2A 1MHOA 2WCFA 4GPLB 2L0PA 3SG7A 4MSPA 4PHKA 5HKWA 3VRRA 2OS8B 3I5HC 1JF2A 1B4CA 1H4BA 1G8IA 2ZRTA 1KK8C 3BUNB 4DIRA 1YURA 3CLNA 4N1FA 2Q91A 3TZ1A 2K8MB 3IQQA 1SRAA 5HKZA 2BCAA 3PLFB 1DTLA 1A75A 4P2YB 2M29A 4USLA 1UHIA 1JSAA 4IL1A 4DRWA 3I5FB 5CSIA 1DF0A 3DF0A 5CSFA 1EL4A 1KCYA 2GV5A 1SPYA 3PM8A 1KQMB 1DJWA 1FPWA 1F8HA 1K9KA 1OOJA 3OP0A 1B9AA 1XO5A 1WY9A 1IQ3A 1NSHA 1Y0VH 1YR5A 4GFTA 1J7PA 1F54A 1M63B 1SNLA 2LUXA 1UHHA 1TCFA 3O6BA 2L50A 1CLBA 1JWDA 3BUWB 2ZKMX 2MLFC 4OR9B 2HQWA 1WLZA 3TDIA 1QTXA 3DVJA 3NXAA 3BXKA 2OS8C 1QLSA 1E8AA 5JOLA 5GQQC 2KSPA 2LP3A 4L9MA 1PSBA 2FJUB 4YGAA 3FIAA 3JTDB 1K95A 4F0ZB 4HREE 5CPVA 1OSAA 4CFQA 3K21A 4A4CA 1LINA 2M1KB 2LVKA 1S1EA 3TUYB 1TOPA 2KI6D 1CDNA 4YBHB 3WHTB 2MHHA 1SBJA 4I5JA 4GGFA 1AHRA 1DJXA 2P6BB 1G4YR 2JPTA 2AMIA 3JVTC 1XFUO 2OPOA 5I8NA 3E3RA 3LCPC 2L4HA 5HLVA 1L2OB 3AKBA 5KTYA 4NDBA 1QS7A 1EG3A 4JWQA 3OB2B 3HCMA 1F55A 3WNXB 2JULA 1AUIB 4UPGA 1IQ5A 2F8PA 1N0YA 2JXLA 2PRUA 3VRQA 1L2OC 3GOFA 1F70A 1TTXA 4CPVA 1SL7A 1DGVA 1KK7Y 1WLMA 1IJ6A 1J1DA 1SCMC 2PASA 3I5IC 4M2PA 2LMUA 5G08A 4QJ3B 1Y1AA 2WCBA 1BU3A 4PE7A 1S5GY 4C0LA 5D69A 5IBWA 2LLSA 2OTGB 2M8UA 2KAVA 1BR1B 2K7DA 3I5IB 3KHEA 3PN7B 3AKAA 1SR6C 1D1OA 2ZNDA 1QVIZ 2LLTA 3GK2A 3LLEA 4BY5A 1A75B 1KWOC 1BJFA 1YUSA 2FCEA 1YRTB 3TDZA 1NYAA 1RTP1 2K7BA 3IF7A 5TNCA 2AAOA 2F33A 1B8CA 1V1GA 3NSIA 2CTNA 3RM1A 1BOCA 4TNCA 1OMRA 5BPJA 2KAYA 2KYCA 3A8RA 3DVMA 3EK4A 4YI9A 2LLUA 3SIBA 3NSKA 2KFGA 1QATA 1Q80A 1L7ZA 5B8IB 1SY9A 1K96A 3CZTX 4AQIA 4C0KA 3BOWB 4WRIA 2TN4A 4JQ0D 4ZCVA 1IGVA 3DVEA 1WDCC 2RGIA 1G33A 1XA5A 2D8NA 2BE4A 2Y4QA 1RFJA 2I7AA 2WORA 2LMVA 1CTRA 1CDPA 1XYDA 2O60A 1RJVA 1BR4B 2KI4C 1PSRA 2PSRA 1RK9A 2JNFA 3JVTB 4XJKA 3NSLA 4QJ5B 1K8UA 3KEVA 4GAOA 1JFJA 2L98A 3BQ3A 2LVIA 2L5XB 3BUOB 1BF5A 1IKUA 1MUXA 5AXIA 4MRXA 1QV1A 4OV2A 1JC2A 4ORCB 1JUOA 3LL8B 1KK8B 1OQPA 4ZCUA 1EJ3A 2BKIB 2AUCA 1YVLA 1J7RA 1LXFC 1QX7A 2O5GA 2M0RA 2LV7A 2ZRSA 2JXCA 1FW4A 1QLKA 3VROA 4GNKB 1ZMZA 3GK4X 1UHKA 2QPTA 3CR5X 3OX5A 4GBAA 1M46A 3IQOA 4I5KA 4PHMA 1CMFA 2LMTA 3I5HB 2M7NA 2LHIA 5ER5A 3CGAA 3FWBA 1PVBA 1XFYO 1Y1UA 2L2EA 3OB1B 5KU1A 1S6CA 3AAJA 1KSOA 3D0YB 1QJTA 1LA3A 1LA0A 1B8RA 1KFXL 1EH2A 1EXRA 2KBIA 3SG4A 4ETOA 1S3PA 1CDLA 2ZN9A 1YTZC 2M1UA 1XFVO 4E68A 1IH0A 2Y1NA 2F3ZA 1DGUA 1OZSA 3MSEB 1SYMA 2G9BA 1GJYA 1CDMA 2PVBA 1SCMB 1A29A 1SL8A 3ZNIA 2CT9A 2I94A 3CR2A 4R1EA 3CTNA 1WRZA 4OVNF 1KK7Z 4MN0A 1YX7A 1XK4A 3OX6A
chains in the Genus database with same CATH superfamily
1RWYA 1NCYA 4I5NB 1XVJA 1Y6WA 4XJKB 2K60A 1BG1A 2LCPA 2BCXA 2EHBA 2COLB 1U5IA 4GGFC 1XK4C 1WDCB 3CS1A 4IJ7A 2JT0A 1UHJA 2JNXA 2LVVA 5J3XA 2A4JA 2I2RE 4MZJA 3EKHA 5AEQA 4YGBB 3S0GA 2L4IA 3CWGA 3EK7A 3KF9A 2PYQA 4NDDA 1J7QA 1YUTA 2F2PA 3B88A 4HRHA 4PE4A 4PDZA 3O2PA 3WHUB 2BBMA 4CLNA 2KNEA 1NWDA 3BOWA 5I2OA 5HKYA 1J1EA 1MWNA 1V1FA 1J7OA 1XFXO 1UUSA 4GUKA 3EKJA 1SR6B 2LP2A 2JZIA 3BYAA 2KLEA 1MXLC 2JTZA 3LK1A 1GQMA 4XYNA 3I5GC 1HT9A 1ALVA 1NX2A 1UP5A 1WRKA 3CR4X 4N5XA 2LM5A 1S6IA 3WXAA 2LAPA 3VGOA 2LUCA 2PALA 2YGUA 3PATA 1TNXA 2CCMA 2JPOA 1A4PA 3PN7C 1S36A 2IS9A 3PFVA 1MF8B 2BCBA 2ZFDA 3FWCA 2WCJA 3QMEA 5F6TA 4ICBA 2MJWB 5D3OA 1OMVA 1Z4HA 4YI8A 1TIZA 3R1PA 5KSZA 1K90D 2FOTA 2CNPA 2KQYA 1BT6A 1TN4A 2LC5A 4MBEA 4MRYA 4U8DA 1A2XA 1OOGA 1QXPA 1M39A 4P5OE 2MRDA 1CFFA 2E30A 2KGRA 4PCWA 1CFCA 4PHNA 1IWQA 2NZ0A 3EK8A 1B7TZ 3NSOA 2K0JA 1KFUS 3HX4A 1QV0A 4I5LB 2EC6C 1W7IB 2Q4UA 1JFKA 1FI6A 1S26D 2WCKA 1KQMC 3SG3A 1H8BA 2KBMA 1IIOA 1CMGA 2L5YA 1QIWA 3RLZA 2EGDA 3VB1A 1QVIY 2R2IA 1PVAA 1NX1A 2KPHA 5K89A 1NIWA 1CLMA 1W7JB 1MXEA 2JT8A 3D0YA 2MA2A 1NX3A 4M2QA 3A4UB 3S0FA 2MBXA 1IJ5A 1FF1A 2BKHB 3PSRA 2BECA 3R1VA 1XFZO 5HYDA 2JOJA 4HRGA 5HLOA 4DUQA 4F7FA 1JF0A 2GGZA 2BE6A 1CM4A 2BAPA 1R6PA 5CSNA 1JBAA 3FE8A 3VRPA 4NQGA 2K7CA 1WRLA 2F2OA 1B8LA 3IVTA 1DJIA 2QEBA 1PALA 4PT1A 2SCPA 2KFHA 3QRXA 2SASA 1F4OA 2EC6B 1SMGA 1AP4A 1K2HA 1HQVA 2HQ8A 2FJYA 4YGEB 2L2CA 2B1UA 2M49B 3M0WA 2BBNA 1KFXS 1M31A 2H2KA 2M3WA 4PALA 4DCKA 5HL1A 3D78A 1C7WA 1DJYA 4YRUA 3CDNA 3R1OA 1DEKA 1EG4A 4PE0A 1MQ1A 1NP8A 3SS5A 3SG5A 1DJHA 3O78A 1KFUL 5I2QA 4YGCB 2LVJA 4FQOA 1QIVA 1GM0A 2WC8A 4MZLA 1TNQA 1ODBA 1DJZA 4A4BA 4QJ4B 3B7AA 1PULA 1ZUZA 4BY4A 3OBVA 3I5FC 1C7VA 2H61C 1PK0D 5CSJA 1NCXA 5AANA 2K7OA 2HETA 3D10A 3SIAA 2KI6C 2K61A 3ICBA 2DOQA 2KYFA 3KO0A 1CNPA 1X02A 4MVFA 1C07A 2KOTA 1FBVA 1SL9A 1CFDA 1YVHA 3DXLA 4MEWA 1DF0B 3DF0B 1K93D 2F3YA 2KHNA 1CB1A 1NPQA 1OOHA 2VRGA 4PHJA 2OTGC 1KQVA 2V53A 1F71A 5PALA 3TS5B 4OCIA 2NXQA 4JPZB 1T14A 3F45A 1AJ5A 2HPSA 2JC2A 1KWOB 2CBLA 3B86A 4YGDB 2WOSA 3O4YA 1RROA 2KFFA 1OE9B 2M7LA 1W9ZA 1YX8A 3NHIA 2ERBA 1ZFSA 3D76A 3FE6A 2H61A 2M9GA 1TCOB 1UHNA 2QEVA 3EVRA 2QDIA 1F4QA 2NLNA 1LKJA 5I2LA 1YRUB 2ISDA 4CIDA 2LANA 1DVIA 3GK1A 1PRWA 3EVVA 2E6WA 1NX0A 3AAKA 5JJGA 1UWOA 2CXJA 2WNDA 2ZNEA 1BLQA 3BUMB 3KPXA 5DKRA 3Q8IA 1AK8A 1AJ4A 2NCOA 2G2BA 2WCHA 3LK0A 1GGZA 3DVKA 1NUBA 2WCEA 2QEHA 3N7HA 5AFPA 1TNPA 2JQ6A 2M97A 1Y1XA 2ZN8A 4CFRA 4M2OA 1CFPA 1VRKA 3TS5C 2NCPA 1B1GA 4D1EA 1CM1A 1U5IB 4ORAB 1TNWA 3EVUA 1OMDA 5ER4X 1BODA 4PE1A 2Y1MA 1K9UA 2LNKA 3BUXB 5FYXA 2PMYA 1IRJA 2K2AA 1S5GZ 1CLLA 2L51A 1ZACA 2FCDA 2QACA 3L4LA 4DS7A 1DC1A 1B7TY 1QASA 5FI7A 1UURA 1AVSA 2H8VA 1YUUA 3D77A 3TUYC 1FI5A 5DKQA 2K2FA 5DKNA 1N2DA 1NCZA 1ZOTB 2MAZA 2Y5IA 3DD4A 3JTDC 1SCVA 2KI4B 1A03A 1SK6D 4NDCA 1K94A 4INWA 3SG2A 3VRNA 1ALWA 3CZ1A 2KDHA 2JU0A 3H4SE 3SG7A 3SG6A 2KGBC 2BL0B 4Q04A 1M45A 1SKTA 4OKHA 1KSMA 4FTGA 2HF5A 1S6JA 1SSEB 1DJGA 4MLWA 1RECA 1CKKA 1LVCD 5I94A 1DT7B 2WCLA 1B47A 1N65A 3ZWHA 4WQ3A 1J55A 1IG5A 1XK4A 4HSZA 2LHLA 1R2UA 1GGWA 2LE9B 2JT3A 3FE9A 1Z2CB 3TDUA 3L4AA 3OHMB 1DMOA 3I5GB 5D7FA 4WQ2A 1P28A 2I18A 5AERA 3CYZA 3SS3A 1OZOA 4MZKA 1BMOA 4AOMA 1TRFA 4N1GA 3K1EA 1XFWO 2BL0C 3CABA 2KAXA 2KQ6A 4GGNA 1SW8A 2GGMA 4AQJA 4C0JA 3SS4A 4ORBB 3PALA 3C1VA 2JTTA 2JWWA 3FS7A 3O4XA 2MLEC 2JRFA 1K9PA 3SJSA 1MR8A 1QX2A 1MHOA 1QWVA 2WCFA 2L0PA 2PQLA 3BJHA 4GPLB 4KYNA 1DQEA 4MSPA 2BNXA 2OS8B 4PHKA 3I5HC 5HKWA 1JF2A 3VRRA 1B4CA 1H4BA 1G8IA 2ZRTA 1KK8C 3BUNB 4DIRA 1YURA 3CLNA 4N1FA 1LS8A 2Q91A 3TZ1A 2K8MB 3IQQA 1SRAA 5HKZA 3UNWA 2BCAA 3PLFB 1DTLA 1A75A 4P2YB 2M29A 4USLA 3S0AA 1UHIA 1JSAA 4IL1A 4DRWA 3I5FB 5CSIA 1DF0A 3DF0A 5CSFA 1EL4A 1KCYA 2GV5A 1SPYA 3PM8A 1KQMB 1DJWA 1FPWA 1F8HA 1K9KA 1OOJA 3OP0A 1B9AA 1XO5A 1WY9A 1IQ3A 1NSHA 1Y0VH 1YR5A 4GFTA 1J7PA 1F54A 1M63B 1SNLA 2LUXA 1UHHA 1TCFA 3O6BA 2L50A 2WC6A 1CLBA 3BUWB 1JWDA 2ZKMX 3BFHA 2MLFC 4OR9B 2HQWA 1WLZA 3TDIA 1QTXA 3DVJA 3NXAA 3BXKA 3DYEA 4INXA 2OS8C 1QLSA 1E8AA 5JOLA 5GQQC 2KSPA 3B87A 2LP3A 4L9MA 1PSBA 2FJUB 4YGAA 1TUJA 3CZ0A 3FIAA 3JTDB 1K95A 4F0ZB 4HREE 2KLDA 1OSAA 5CPVA 3K21A 4A4CA 4CFQA 1LINA 2M1KB 2QEOA 2LVKA 1S1EA 3TUYB 1TOPA 3PJIA 2KI6D 1CDNA 4YBHB 3WHTB 2MHHA 3S0EA 1SBJA 4I5JA 4GGFA 1AHRA 1DJXA 2P6BB 1G4YR 2JPTA 2AMIA 3JVTC 1XFUO 2OPOA 5I8NA 3E3RA 3LCPC 3DZTA 2L4HA 5HLVA 1L2OB 3AKBA 5KTYA 4NDBA 1QS7A 1EG3A 4JWQA 3OB2B 3HCMA 1F55A 3WNXB 2JULA 1AUIB 4UPGA 1IQ5A 2F8PA 1N0YA 2JXLA 2PRUA 3VRQA 1L2OC 3GOFA 1F70A 1TTXA 4CPVA 1SL7A 1DGVA 1KK7Y 1WLMA 1IJ6A 1J1DA 1SCMC 2PASA 3BFBA 3I5IC 3NGVA 3R72A 4M2PA 2LMUA 5G08A 4QJ3B 4FQTA 1Y1AA 2WCBA 1BU3A 4PE7A 1S5GY 4C0LA 5D69A 5IBWA 2LLSA 1XFRA 2OTGB 2M8UA 2KAVA 1BR1B 2K7DA 3I5IB 3KHEA 3PN7B 3AKAA 1SR6C 1D1OA 2ZNDA 1QVIZ 2LLTA 3GK2A 3LLEA 2P71A 4BY5A 1A75B 1KWOC 1BJFA 1YUSA 2FCEA 1YRTB 2WC5A 3NHTA 3TDZA 1NYAA 1RTP1 2K7BA 3IF7A 5EL2A 2AAOA 5TNCA 2F33A 1B8CA 1V1GA 3NSIA 2CTNA 3RM1A 1BOCA 4TNCA 1OMRA 2P70A 5BPJA 2KAYA 2KYCA 3A8RA 3DVMA 3EK4A 3L47A 4YI9A 2LLUA 3SIBA 3NSKA 2KFGA 1QATA 1TUZA 3S0DA 1Q80A 3S0BA 1L7ZA 1OOIX 3D73A 5FI2A 1ORGA 5B8IB 3PM2A 1SY9A 3B6XA 1K96A 3CZTX 3BFAA 4AQIA 1OOFA 4C0KA 3BOWB 4WRIA 2TN4A 4JQ0D 4ZCVA 1IGVA 3DVEA 5FI6A 1WDCC 2RGIA 1G33A 1XA5A 2WCMA 2D8NA 2BE4A 2Y4QA 1RFJA 1C3ZA 2I7AA 2WORA 3OGNA 2LMVA 1CTRA 2GTEA 1CDPA 1XYDA 2O60A 1RJVA 3CZ2A 3EG5B 1BR4B 2KI4C 1PSRA 2PSRA 1RK9A 2JNFA 3JVTB 4XJKA 3NSLA 4QJ5B 1K8UA 3KEVA 4GAOA 1JFJA 2L98A 3BQ3A 2LVIA 2L5XB 3BUOB 1BF5A 1IKUA 1MUXA 5AXIA 4MRXA 1QV1A 4OV2A 1JC2A 4ORCB 1JUOA 3LL8B 3V2LA 1KK8B 1OQPA 4ZCUA 1EJ3A 2BKIB 2AUCA 1YVLA 1J7RA 1LXFC 1QX7A 2O5GA 2M0RA 2LV7A 2ZRSA 2JXCA 1FW4A 1QLKA 4JD9A 3UO9A 3D74A 3VROA 4GNKB 1ZMZA 3GK4X 4JKTA 1UHKA 2QPTA 3CR5X 3OX5A 4GBAA 4OZDA 1M46A 3IQOA 4I5KA 4PHMA 1C3YA 1CMFA 2LMTA 3I5HB 2M7NA 2LHIA 5ER5A 3CGAA 1DELA 3FWBA 1PVBA 1XFYO 1Y1UA 2L2EA 3OB1B 5KU1A 1S6CA 3AAJA 1KSOA 3D0YB 1QJTA 1LA3A 1LA0A 1B8RA 1KFXL 1EH2A 1EXRA 2KBIA 3SG4A 4ETOA 1S3PA 1CDLA 2ZN9A 1YTZC 2M1UA 3RZSA 5DICA 1XFVO 4E68A 1IH0A 3DY9A 2Y1NA 3D75A 2F3ZA 1DGUA 1TWOA 1OZSA 1OW4A 3MSEB 1SYMA 2G9BA 1GJYA 1CDMA 2PVBA 1SCMB 1A29A 1SL8A 3ZNIA 2CT9A 2I94A 3CR2A 4R1EA 3CTNA 1WRZA 4OVNF 1KK7Z 4MN0A 1YX7A 1QX5B 3OX6A
chains in the Genus database with same CATH topology
1RWYA 1NCYA 4I5NB 1XVJA 1Y6WA 4XJKB 1BG1A 2LCPA 2BCXA 2EHBA 2COLB 1U5IA 4GGFC 1XK4C 1WDCB 3CS1A 2JT0A 1UHJA 2JNXA 2LVVA 5J3XA 2A4JA 2I2RE 4MZJA 3EKHA 5AEQA 4YGBB 2L4IA 3CWGA 3EK7A 3KF9A 4NDDA 1J7QA 1YUTA 2F2PA 4HRHA 4PE4A 4PDZA 3O2PA 3WHUB 2BBMA 4CLNA 2KNEA 1NWDA 3BOWA 5I2OA 5HKYA 1J1EA 1MWNA 1V1FA 1J7OA 1XFXO 1UUSA 4GUKA 3EKJA 1SR6B 2LP2A 2JZIA 3BYAA 3LK1A 1MXLC 2JTZA 1GQMA 4XYNA 3I5GC 1HT9A 1ALVA 1NX2A 1UP5A 1WRKA 3CR4X 4N5XA 2LM5A 1S6IA 3WXAA 2LAPA 3VGOA 2LUCA 2PALA 3PATA 1TNXA 2CCMA 1A4PA 3PN7C 1S36A 2IS9A 3PFVA 1MF8B 2BCBA 2ZFDA 3FWCA 5F6TA 4ICBA 2MJWB 1OMVA 4YI8A 1TIZA 5KSZA 1K90D 2FOTA 2CNPA 2KQYA 1BT6A 1TN4A 2LC5A 4MBEA 4MRYA 4U8DA 1A2XA 1QXPA 1M39A 4P5OE 2MRDA 1CFFA 2E30A 2KGRA 4PCWA 1CFCA 4PHNA 1IWQA 2NZ0A 3EK8A 1B7TZ 3NSOA 2K0JA 1KFUS 3HX4A 1QV0A 4I5LB 2EC6C 1W7IB 2Q4UA 1JFKA 1FI6A 1S26D 1KQMC 3SG3A 1H8BA 2KBMA 1CMGA 1QIWA 3RLZA 2EGDA 1QVIY 2R2IA 1PVAA 1NX1A 5K89A 1NIWA 1CLMA 1W7JB 1MXEA 2JT8A 3D0YA 2MA2A 1NX3A 4M2QA 3A4UB 2MBXA 1IJ5A 1FF1A 2BKHB 3PSRA 2BECA 1XFZO 5HYDA 2JOJA 4HRGA 5HLOA 4DUQA 1JF0A 2GGZA 2BE6A 1CM4A 1R6PA 5CSNA 1JBAA 3VRPA 4NQGA 2K7CA 1WRLA 2F2OA 1B8LA 1DJIA 1PALA 1QX5B 2SCPA 2KFHA 3QRXA 2SASA 1F4OA 2EC6B 1SMGA 1AP4A 1K2HA 2HQ8A 1HQVA 4YGEB 2B1UA 2M49B 3M0WA 2BBNA 1KFXS 1M31A 2H2KA 2M3WA 4PALA 4DCKA 1C7WA 1DJYA 4YRUA 1EG4A 4PE0A 1MQ1A 1NP8A 3SG5A 1DJHA 3O78A 1KFUL 5I2QA 4YGCB 2LVJA 4FQOA 1QIVA 2WC8A 4MZLA 1TNQA 1ODBA 1DJZA 4A4BA 4QJ4B 1PULA 1ZUZA 4BY4A 3I5FC 1C7VA 2H61C 1PK0D 5CSJA 1NCXA 5AANA 2K7OA 2HETA 3D10A 3SIAA 2KI6C 2K61A 3ICBA 2DOQA 2KYFA 3KO0A 1CNPA 1X02A 4MVFA 1C07A 2KOTA 1FBVA 1SL9A 1CFDA 1YVHA 4MEWA 1DF0B 3DF0B 1K93D 2F3YA 2KHNA 1CB1A 1NPQA 2VRGA 4PHJA 1KQVA 2OTGC 2V53A 1F71A 5PALA 3TS5B 4OCIA 2NXQA 4JPZB 3F45A 1AJ5A 2HPSA 2JC2A 1KWOB 2CBLA 4YGDB 2WOSA 3O4YA 1RROA 2KFFA 1OE9B 2M7LA 1YX8A 1ZFSA 2H61A 2M9GA 1TCOB 1UHNA 3EVRA 1F4QA 2NLNA 1LKJA 5I2LA 1YRUB 2ISDA 4CIDA 2LANA 1DVIA 3GK1A 1PRWA 3EVVA 2E6WA 1NX0A 3AAKA 5JJGA 1UWOA 2CXJA 2WNDA 2ZNEA 1BLQA 3BUMB 3KPXA 5DKRA 1AK8A 1AJ4A 2NCOA 2G2BA 3LK0A 1GGZA 3DVKA 1NUBA 2WCEA 5AFPA 1TNPA 2JQ6A 2M97A 1Y1XA 2ZN8A 4CFRA 4M2OA 1CFPA 1VRKA 3TS5C 2NCPA 1B1GA 4D1EA 1CM1A 1U5IB 4ORAB 1TNWA 3EVUA 1OMDA 5ER4X 1BODA 4PE1A 2Y1MA 1K9UA 2LNKA 3BUXB 5FYXA 2PMYA 1IRJA 2K2AA 1S5GZ 1CLLA 2L51A 1ZACA 2FCDA 2QACA 4DS7A 1B7TY 1QASA 1UURA 1AVSA 1YUUA 3TUYC 1FI5A 5DKQA 2K2FA 5DKNA 1N2DA 1NCZA 1ZOTB 2MAZA 2Y5IA 3DD4A 3JTDC 1SCVA 2KI4B 1A03A 1SK6D 4NDCA 1K94A 3SG2A 3VRNA 1ALWA 2KDHA 2JU0A 3H4SE 3SG6A 2KGBC 2BL0B 4Q04A 1M45A 1SKTA 4OKHA 1KSMA 4FTGA 2HF5A 1S6JA 1DJGA 4MLWA 1RECA 1CKKA 1LVCD 1DT7B 1B47A 1N65A 3ZWHA 4WQ3A 1J55A 1IG5A 4HSZA 2LHLA 1R2UA 1GGWA 2LE9B 2JT3A 3TDUA 3OHMB 1DMOA 3I5GB 5D7FA 4WQ2A 2I18A 5AERA 1OZOA 4MZKA 1BMOA 4AOMA 1TRFA 4N1GA 1XFWO 2BL0C 2KAXA 2KQ6A 4GGNA 1SW8A 2GGMA 4AQJA 4C0JA 4ORBB 3PALA 3C1VA 2JTTA 2JWWA 3FS7A 2MLEC 2JRFA 1K9PA 3SJSA 1MR8A 1QX2A 1MHOA 2WCFA 4GPLB 2L0PA 3SG7A 4MSPA 4PHKA 5HKWA 3VRRA 2OS8B 3I5HC 1JF2A 1B4CA 1H4BA 1G8IA 2ZRTA 1KK8C 3BUNB 4DIRA 1YURA 3CLNA 4N1FA 2Q91A 3TZ1A 2K8MB 3IQQA 1SRAA 5HKZA 2BCAA 3PLFB 1DTLA 1A75A 4P2YB 2M29A 4USLA 1UHIA 1JSAA 4IL1A 4DRWA 3I5FB 5CSIA 1DF0A 3DF0A 5CSFA 1EL4A 1KCYA 2GV5A 1SPYA 3PM8A 1KQMB 1DJWA 1FPWA 1F8HA 1K9KA 1OOJA 3OP0A 1B9AA 1XO5A 1WY9A 1IQ3A 1NSHA 1Y0VH 1YR5A 4GFTA 1J7PA 1F54A 1M63B 1SNLA 2LUXA 1UHHA 1TCFA 3O6BA 2L50A 1CLBA 1JWDA 3BUWB 2ZKMX 2MLFC 4OR9B 2HQWA 1WLZA 3TDIA 1QTXA 3DVJA 3NXAA 3BXKA 2OS8C 1QLSA 1E8AA 5JOLA 5GQQC 2KSPA 2LP3A 4L9MA 1PSBA 2FJUB 4YGAA 3FIAA 3JTDB 1K95A 4F0ZB 4HREE 5CPVA 1OSAA 4CFQA 3K21A 4A4CA 1LINA 2M1KB 2LVKA 1S1EA 3TUYB 1TOPA 2KI6D 1CDNA 4YBHB 3WHTB 2MHHA 1SBJA 4I5JA 4GGFA 1AHRA 1DJXA 2P6BB 1G4YR 2JPTA 2AMIA 3JVTC 1XFUO 2OPOA 5I8NA 3E3RA 3LCPC 2L4HA 5HLVA 1L2OB 3AKBA 5KTYA 4NDBA 1QS7A 1EG3A 4JWQA 3OB2B 3HCMA 1F55A 3WNXB 2JULA 1AUIB 4UPGA 1IQ5A 2F8PA 1N0YA 2JXLA 2PRUA 3VRQA 1L2OC 3GOFA 1F70A 1TTXA 4CPVA 1SL7A 1DGVA 1KK7Y 1WLMA 1IJ6A 1J1DA 1SCMC 2PASA 3I5IC 4M2PA 2LMUA 5G08A 4QJ3B 1Y1AA 2WCBA 1BU3A 4PE7A 1S5GY 4C0LA 5D69A 5IBWA 2LLSA 2OTGB 2M8UA 2KAVA 1BR1B 2K7DA 3I5IB 3KHEA 3PN7B 3AKAA 1SR6C 1D1OA 2ZNDA 1QVIZ 2LLTA 3GK2A 3LLEA 4BY5A 1A75B 1KWOC 1BJFA 1YUSA 2FCEA 1YRTB 3TDZA 1NYAA 1RTP1 2K7BA 3IF7A 5TNCA 2AAOA 2F33A 1B8CA 1V1GA 3NSIA 2CTNA 3RM1A 1BOCA 4TNCA 1OMRA 5BPJA 2KAYA 2KYCA 3A8RA 3DVMA 3EK4A 4YI9A 2LLUA 3SIBA 3NSKA 2KFGA 1QATA 1Q80A 1L7ZA 5B8IB 1SY9A 1K96A 3CZTX 4AQIA 4C0KA 3BOWB 4WRIA 2TN4A 4JQ0D 4ZCVA 1IGVA 3DVEA 1WDCC 2RGIA 1G33A 1XA5A 2D8NA 2BE4A 2Y4QA 1RFJA 2I7AA 2WORA 2LMVA 1CTRA 1CDPA 1XYDA 2O60A 1RJVA 1BR4B 2KI4C 1PSRA 2PSRA 1RK9A 2JNFA 3JVTB 4XJKA 3NSLA 4QJ5B 1K8UA 3KEVA 4GAOA 1JFJA 2L98A 3BQ3A 2LVIA 2L5XB 3BUOB 1BF5A 1IKUA 1MUXA 5AXIA 4MRXA 1QV1A 4OV2A 1JC2A 4ORCB 1JUOA 3LL8B 1KK8B 1OQPA 4ZCUA 1EJ3A 2BKIB 2AUCA 1YVLA 1J7RA 1LXFC 1QX7A 2O5GA 2M0RA 2LV7A 2ZRSA 2JXCA 1FW4A 1QLKA 3VROA 4GNKB 1ZMZA 3GK4X 1UHKA 2QPTA 3CR5X 3OX5A 4GBAA 1M46A 3IQOA 4I5KA 4PHMA 1CMFA 2LMTA 3I5HB 2M7NA 2LHIA 5ER5A 3CGAA 3FWBA 1PVBA 1XFYO 1Y1UA 2L2EA 3OB1B 5KU1A 1S6CA 3AAJA 1KSOA 3D0YB 1QJTA 1LA3A 1LA0A 1B8RA 1KFXL 1EH2A 1EXRA 2KBIA 3SG4A 4ETOA 1S3PA 1CDLA 2ZN9A 1YTZC 2M1UA 1XFVO 4E68A 1IH0A 2Y1NA 2F3ZA 1DGUA 1OZSA 3MSEB 1SYMA 2G9BA 1GJYA 1CDMA 2PVBA 1SCMB 1A29A 1SL8A 3ZNIA 2CT9A 2I94A 3CR2A 4R1EA 3CTNA 1WRZA 4OVNF 1KK7Z 4MN0A 1YX7A 1XK4A 3OX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWY A;  1NCY A;  4I5N B;  1XVJ A;  1Y6W A;  4XJK B;  1BG1 A;  2LCP A;  2BCX A;  2EHB A;  2COL B;  1U5I A;  4GGF C;  1XK4 C;  1WDC B;  3CS1 A;  2JT0 A;  1UHJ A;  2JNX A;  2LVV A;  5J3X A;  2A4J A;  2I2R E;  4MZJ A;  3EKH A;  5AEQ A;  4YGB B;  2L4I A;  3CWG A;  3EK7 A;  3KF9 A;  4NDD A;  1J7Q A;  1YUT A;  2F2P A;  4HRH A;  4PE4 A;  4PDZ A;  3O2P A;  3WHU B;  2BBM A;  4CLN A;  2KNE A;  1NWD A;  3BOW A;  5I2O A;  5HKY A;  1J1E A;  1MWN A;  1V1F A;  1J7O A;  1XFX O;  1UUS A;  4GUK A;  3EKJ A;  1SR6 B;  2LP2 A;  2JZI A;  3BYA A;  3LK1 A;  1MXL C;  2JTZ A;  1GQM A;  4XYN A;  3I5G C;  1HT9 A;  1ALV A;  1NX2 A;  1UP5 A;  1WRK A;  3CR4 X;  4N5X A;  2LM5 A;  1S6I A;  3WXA A;  2LAP A;  3VGO A;  2LUC A;  2PAL A;  3PAT A;  1TNX A;  2CCM A;  1A4P A;  3PN7 C;  1S36 A;  2IS9 A;  3PFV A;  1MF8 B;  2BCB A;  2ZFD A;  3FWC A;  5F6T A;  4ICB A;  2MJW B;  1OMV A;  4YI8 A;  1TIZ A;  5KSZ A;  1K90 D;  2FOT A;  2CNP A;  2KQY A;  1BT6 A;  1TN4 A;  2LC5 A;  4MBE A;  4MRY A;  4U8D A;  1A2X A;  1QXP A;  1M39 A;  4P5O E;  2MRD A;  1CFF A;  2E30 A;  2KGR A;  4PCW A;  1CFC A;  4PHN A;  1IWQ A;  2NZ0 A;  3EK8 A;  1B7T Z;  3NSO A;  2K0J A;  1KFU S;  3HX4 A;  1QV0 A;  4I5L B;  2EC6 C;  1W7I B;  2Q4U A;  1JFK A;  1FI6 A;  1S26 D;  1KQM C;  3SG3 A;  1H8B A;  2KBM A;  1CMG A;  1QIW A;  3RLZ A;  2EGD A;  1QVI Y;  2R2I A;  1PVA A;  1NX1 A;  5K89 A;  1NIW A;  1CLM A;  1W7J B;  1MXE A;  2JT8 A;  3D0Y A;  2MA2 A;  1NX3 A;  4M2Q A;  3A4U B;  2MBX A;  1IJ5 A;  1FF1 A;  2BKH B;  3PSR A;  2BEC A;  1XFZ O;  5HYD A;  2JOJ A;  4HRG A;  5HLO A;  4DUQ A;  1JF0 A;  2GGZ A;  2BE6 A;  1CM4 A;  1R6P A;  5CSN A;  1JBA A;  3VRP A;  4NQG A;  2K7C A;  1WRL A;  2F2O A;  1B8L A;  1DJI A;  1PAL A;  1QX5 B;  2SCP A;  2KFH A;  3QRX A;  2SAS A;  1F4O A;  2EC6 B;  1SMG A;  1AP4 A;  1K2H A;  2HQ8 A;  1HQV A;  4YGE B;  2B1U A;  2M49 B;  3M0W A;  2BBN A;  1KFX S;  1M31 A;  2H2K A;  2M3W A;  4PAL A;  4DCK A;  1C7W A;  1DJY A;  4YRU A;  1EG4 A;  4PE0 A;  1MQ1 A;  1NP8 A;  3SG5 A;  1DJH A;  3O78 A;  1KFU L;  5I2Q A;  4YGC B;  2LVJ A;  4FQO A;  1QIV A;  2WC8 A;  4MZL A;  1TNQ A;  1ODB A;  1DJZ A;  4A4B A;  4QJ4 B;  1PUL A;  1ZUZ A;  4BY4 A;  3I5F C;  1C7V A;  2H61 C;  1PK0 D;  5CSJ A;  1NCX A;  5AAN A;  2K7O A;  2HET A;  3D10 A;  3SIA A;  2KI6 C;  2K61 A;  3ICB A;  2DOQ A;  2KYF A;  3KO0 A;  1CNP A;  1X02 A;  4MVF A;  1C07 A;  2KOT A;  1FBV A;  1SL9 A;  1CFD A;  1YVH A;  4MEW A;  1DF0 B;  3DF0 B;  1K93 D;  2F3Y A;  2KHN A;  1CB1 A;  1NPQ A;  2VRG A;  4PHJ A;  1KQV A;  2OTG C;  2V53 A;  1F71 A;  5PAL A;  3TS5 B;  4OCI A;  2NXQ A;  4JPZ B;  3F45 A;  1AJ5 A;  2HPS A;  2JC2 A;  1KWO B;  2CBL A;  4YGD B;  2WOS A;  3O4Y A;  1RRO A;  2KFF A;  1OE9 B;  2M7L A;  1YX8 A;  1ZFS A;  2H61 A;  2M9G A;  1TCO B;  1UHN A;  3EVR A;  1F4Q A;  2NLN A;  1LKJ A;  5I2L A;  1YRU B;  2ISD A;  4CID A;  2LAN A;  1DVI A;  3GK1 A;  1PRW A;  3EVV A;  2E6W A;  1NX0 A;  3AAK A;  5JJG A;  1UWO A;  2CXJ A;  2WND A;  2ZNE A;  1BLQ A;  3BUM B;  3KPX A;  5DKR A;  1AK8 A;  1AJ4 A;  2NCO A;  2G2B A;  3LK0 A;  1GGZ A;  3DVK A;  1NUB A;  2WCE A;  5AFP A;  1TNP A;  2JQ6 A;  2M97 A;  1Y1X A;  2ZN8 A;  4CFR A;  4M2O A;  1CFP A;  1VRK A;  3TS5 C;  2NCP A;  1B1G A;  4D1E A;  1CM1 A;  1U5I B;  4ORA B;  1TNW A;  3EVU A;  1OMD A;  5ER4 X;  1BOD A;  4PE1 A;  2Y1M A;  1K9U A;  2LNK A;  3BUX B;  5FYX A;  2PMY A;  1IRJ A;  2K2A A;  1S5G Z;  1CLL A;  2L51 A;  1ZAC A;  2FCD A;  2QAC A;  4DS7 A;  1B7T Y;  1QAS A;  1UUR A;  1AVS A;  1YUU A;  3TUY C;  1FI5 A;  5DKQ A;  2K2F A;  5DKN A;  1N2D A;  1NCZ A;  1ZOT B;  2MAZ A;  2Y5I A;  3DD4 A;  3JTD C;  1SCV A;  2KI4 B;  1A03 A;  1SK6 D;  4NDC A;  1K94 A;  3SG2 A;  3VRN A;  1ALW A;  2KDH A;  2JU0 A;  3H4S E;  3SG6 A;  2KGB C;  2BL0 B;  4Q04 A;  1M45 A;  1SKT A;  4OKH A;  1KSM A;  4FTG A;  2HF5 A;  1S6J A;  1DJG A;  4MLW A;  1REC A;  1CKK A;  1LVC D;  1DT7 B;  1B47 A;  1N65 A;  3ZWH A;  4WQ3 A;  1J55 A;  1IG5 A;  4HSZ A;  2LHL A;  1R2U A;  1GGW A;  2LE9 B;  2JT3 A;  3TDU A;  3OHM B;  1DMO A;  3I5G B;  5D7F A;  4WQ2 A;  2I18 A;  5AER A;  1OZO A;  4MZK A;  1BMO A;  4AOM A;  1TRF A;  4N1G A;  1XFW O;  2BL0 C;  2KAX A;  2KQ6 A;  4GGN A;  1SW8 A;  2GGM A;  4AQJ A;  4C0J A;  4ORB B;  3PAL A;  3C1V A;  2JTT A;  2JWW A;  3FS7 A;  2MLE C;  2JRF A;  1K9P A;  3SJS A;  1MR8 A;  1QX2 A;  1MHO A;  2WCF A;  4GPL B;  2L0P A;  3SG7 A;  4MSP A;  4PHK A;  5HKW A;  3VRR A;  2OS8 B;  3I5H C;  1JF2 A;  1B4C A;  1H4B A;  1G8I A;  2ZRT A;  1KK8 C;  3BUN B;  4DIR A;  1YUR A;  3CLN A;  4N1F A;  2Q91 A;  3TZ1 A;  2K8M B;  3IQQ A;  1SRA A;  5HKZ A;  2BCA A;  3PLF B;  1DTL A;  1A75 A;  4P2Y B;  2M29 A;  4USL A;  1UHI A;  1JSA A;  4IL1 A;  4DRW A;  3I5F B;  5CSI A;  1DF0 A;  3DF0 A;  5CSF A;  1EL4 A;  1KCY A;  2GV5 A;  1SPY A;  3PM8 A;  1KQM B;  1DJW A;  1FPW A;  1F8H A;  1K9K A;  1OOJ A;  3OP0 A;  1B9A A;  1XO5 A;  1WY9 A;  1IQ3 A;  1NSH A;  1Y0V H;  1YR5 A;  4GFT A;  1J7P A;  1F54 A;  1M63 B;  1SNL A;  2LUX A;  1UHH A;  1TCF A;  3O6B A;  2L50 A;  1CLB A;  1JWD A;  3BUW B;  2ZKM X;  2MLF C;  4OR9 B;  2HQW A;  1WLZ A;  3TDI A;  1QTX A;  3DVJ A;  3NXA A;  3BXK A;  2OS8 C;  1QLS A;  1E8A A;  5JOL A;  5GQQ C;  2KSP A;  2LP3 A;  4L9M A;  1PSB A;  2FJU B;  4YGA A;  3FIA A;  3JTD B;  1K95 A;  4F0Z B;  4HRE E;  5CPV A;  1OSA A;  4CFQ A;  3K21 A;  4A4C A;  1LIN A;  2M1K B;  2LVK A;  1S1E A;  3TUY B;  1TOP A;  2KI6 D;  1CDN A;  4YBH B;  3WHT B;  2MHH A;  1SBJ A;  4I5J A;  4GGF A;  1AHR A;  1DJX A;  2P6B B;  1G4Y R;  2JPT A;  2AMI A;  3JVT C;  1XFU O;  2OPO A;  5I8N A;  3E3R A;  3LCP C;  2L4H A;  5HLV A;  1L2O B;  3AKB A;  5KTY A;  4NDB A;  1QS7 A;  1EG3 A;  4JWQ A;  3OB2 B;  3HCM A;  1F55 A;  3WNX B;  2JUL A;  1AUI B;  4UPG A;  1IQ5 A;  2F8P A;  1N0Y A;  2JXL A;  2PRU A;  3VRQ A;  1L2O C;  3GOF A;  1F70 A;  1TTX A;  4CPV A;  1SL7 A;  1DGV A;  1KK7 Y;  1WLM A;  1IJ6 A;  1J1D A;  1SCM C;  2PAS A;  3I5I C;  4M2P A;  2LMU A;  5G08 A;  4QJ3 B;  1Y1A A;  2WCB A;  1BU3 A;  4PE7 A;  1S5G Y;  4C0L A;  5D69 A;  5IBW A;  2LLS A;  2OTG B;  2M8U A;  2KAV A;  1BR1 B;  2K7D A;  3I5I B;  3KHE A;  3PN7 B;  3AKA A;  1SR6 C;  1D1O A;  2ZND A;  1QVI Z;  2LLT A;  3GK2 A;  3LLE A;  4BY5 A;  1A75 B;  1KWO C;  1BJF A;  1YUS A;  2FCE A;  1YRT B;  3TDZ A;  1NYA A;  1RTP 1;  2K7B A;  3IF7 A;  5TNC A;  2AAO A;  2F33 A;  1B8C A;  1V1G A;  3NSI A;  2CTN A;  3RM1 A;  1BOC A;  4TNC A;  1OMR A;  5BPJ A;  2KAY A;  2KYC A;  3A8R A;  3DVM A;  3EK4 A;  4YI9 A;  2LLU A;  3SIB A;  3NSK A;  2KFG A;  1QAT A;  1Q80 A;  1L7Z A;  5B8I B;  1SY9 A;  1K96 A;  3CZT X;  4AQI A;  4C0K A;  3BOW B;  4WRI A;  2TN4 A;  4JQ0 D;  4ZCV A;  1IGV A;  3DVE A;  1WDC C;  2RGI A;  1G33 A;  1XA5 A;  2D8N A;  2BE4 A;  2Y4Q A;  1RFJ A;  2I7A A;  2WOR A;  2LMV A;  1CTR A;  1CDP A;  1XYD A;  2O60 A;  1RJV A;  1BR4 B;  2KI4 C;  1PSR A;  2PSR A;  1RK9 A;  2JNF A;  3JVT B;  4XJK A;  3NSL A;  4QJ5 B;  1K8U A;  3KEV A;  4GAO A;  1JFJ A;  2L98 A;  3BQ3 A;  2LVI A;  2L5X B;  3BUO B;  1BF5 A;  1IKU A;  1MUX A;  5AXI A;  4MRX A;  1QV1 A;  4OV2 A;  1JC2 A;  4ORC B;  1JUO A;  3LL8 B;  1KK8 B;  1OQP A;  4ZCU A;  1EJ3 A;  2BKI B;  2AUC A;  1YVL A;  1J7R A;  1LXF C;  1QX7 A;  2O5G A;  2M0R A;  2LV7 A;  2ZRS A;  2JXC A;  1FW4 A;  1QLK A;  3VRO A;  4GNK B;  1ZMZ A;  3GK4 X;  1UHK A;  2QPT A;  3CR5 X;  3OX5 A;  4GBA A;  1M46 A;  3IQO A;  4I5K A;  4PHM A;  1CMF A;  2LMT A;  3I5H B;  2M7N A;  2LHI A;  5ER5 A;  3CGA A;  3FWB A;  1PVB A;  1XFY O;  1Y1U A;  2L2E A;  3OB1 B;  5KU1 A;  1S6C A;  3AAJ A;  1KSO A;  3D0Y B;  1QJT A;  1LA3 A;  1LA0 A;  1B8R A;  1KFX L;  1EH2 A;  1EXR A;  2KBI A;  3SG4 A;  4ETO A;  1S3P A;  1CDL A;  2ZN9 A;  1YTZ C;  2M1U A;  1XFV O;  4E68 A;  1IH0 A;  2Y1N A;  2F3Z A;  1DGU A;  1OZS A;  3MSE B;  1SYM A;  2G9B A;  1GJY A;  1CDM A;  2PVB A;  1SCM B;  1A29 A;  1SL8 A;  3ZNI A;  2CT9 A;  2I94 A;  3CR2 A;  4R1E A;  3CTN A;  1WRZ A;  4OVN F;  1KK7 Z;  4MN0 A;  1YX7 A;  1XK4 A;  3OX6 A; 
#chains in the Genus database with same CATH topology
 1RWY A;  1NCY A;  4I5N B;  1XVJ A;  1Y6W A;  4XJK B;  2K60 A;  1BG1 A;  2LCP A;  2BCX A;  2EHB A;  2COL B;  1U5I A;  4GGF C;  1XK4 C;  1WDC B;  3CS1 A;  4IJ7 A;  2JT0 A;  1UHJ A;  2JNX A;  2LVV A;  5J3X A;  2A4J A;  2I2R E;  4MZJ A;  3EKH A;  5AEQ A;  4YGB B;  3S0G A;  2L4I A;  3CWG A;  3EK7 A;  3KF9 A;  2PYQ A;  4NDD A;  1J7Q A;  1YUT A;  2F2P A;  3B88 A;  4HRH A;  4PE4 A;  4PDZ A;  3O2P A;  3WHU B;  2BBM A;  4CLN A;  2KNE A;  1NWD A;  3BOW A;  5I2O A;  5HKY A;  1J1E A;  1MWN A;  1V1F A;  1J7O A;  1XFX O;  1UUS A;  4GUK A;  3EKJ A;  1SR6 B;  2LP2 A;  2JZI A;  3BYA A;  2KLE A;  1MXL C;  2JTZ A;  3LK1 A;  1GQM A;  4XYN A;  3I5G C;  1HT9 A;  1ALV A;  1NX2 A;  1UP5 A;  1WRK A;  3CR4 X;  4N5X A;  2LM5 A;  1S6I A;  3WXA A;  2LAP A;  3VGO A;  2LUC A;  2PAL A;  2YGU A;  3PAT A;  1TNX A;  2CCM A;  2JPO A;  1A4P A;  3PN7 C;  1S36 A;  2IS9 A;  3PFV A;  1MF8 B;  2BCB A;  2ZFD A;  3FWC A;  2WCJ A;  3QME A;  5F6T A;  4ICB A;  2MJW B;  5D3O A;  1OMV A;  1Z4H A;  4YI8 A;  1TIZ A;  3R1P A;  5KSZ A;  1K90 D;  2FOT A;  2CNP A;  2KQY A;  1BT6 A;  1TN4 A;  2LC5 A;  4MBE A;  4MRY A;  4U8D A;  1A2X A;  1OOG A;  1QXP A;  1M39 A;  4P5O E;  2MRD A;  1CFF A;  2E30 A;  2KGR A;  4PCW A;  1CFC A;  4PHN A;  1IWQ A;  2NZ0 A;  3EK8 A;  1B7T Z;  3NSO A;  2K0J A;  1KFU S;  3HX4 A;  1QV0 A;  4I5L B;  2EC6 C;  1W7I B;  2Q4U A;  1JFK A;  1FI6 A;  1S26 D;  2WCK A;  1KQM C;  3SG3 A;  1H8B A;  2KBM A;  1IIO A;  1CMG A;  2L5Y A;  1QIW A;  3RLZ A;  2EGD A;  3VB1 A;  1QVI Y;  2R2I A;  1PVA A;  1NX1 A;  2KPH A;  5K89 A;  1NIW A;  1CLM A;  1W7J B;  1MXE A;  2JT8 A;  3D0Y A;  2MA2 A;  1NX3 A;  4M2Q A;  3A4U B;  3S0F A;  2MBX A;  1IJ5 A;  1FF1 A;  2BKH B;  3PSR A;  2BEC A;  3R1V A;  1XFZ O;  5HYD A;  2JOJ A;  4HRG A;  5HLO A;  4DUQ A;  4F7F A;  1JF0 A;  2GGZ A;  2BE6 A;  1CM4 A;  2BAP A;  1R6P A;  5CSN A;  1JBA A;  3FE8 A;  3VRP A;  4NQG A;  2K7C A;  1WRL A;  2F2O A;  1B8L A;  3IVT A;  1DJI A;  2QEB A;  1PAL A;  4PT1 A;  2SCP A;  2KFH A;  3QRX A;  2SAS A;  1F4O A;  2EC6 B;  1SMG A;  1AP4 A;  1K2H A;  1HQV A;  2HQ8 A;  2FJY A;  4YGE B;  2L2C A;  2B1U A;  2M49 B;  3M0W A;  2BBN A;  1KFX S;  1M31 A;  2H2K A;  2M3W A;  4PAL A;  4DCK A;  5HL1 A;  3D78 A;  1C7W A;  1DJY A;  4YRU A;  3CDN A;  3R1O A;  1DEK A;  1EG4 A;  4PE0 A;  1MQ1 A;  1NP8 A;  3SS5 A;  3SG5 A;  1DJH A;  3O78 A;  1KFU L;  5I2Q A;  4YGC B;  2LVJ A;  4FQO A;  1QIV A;  1GM0 A;  2WC8 A;  4MZL A;  1TNQ A;  1ODB A;  1DJZ A;  4A4B A;  4QJ4 B;  3B7A A;  1PUL A;  1ZUZ A;  4BY4 A;  3OBV A;  3I5F C;  1C7V A;  2H61 C;  1PK0 D;  5CSJ A;  1NCX A;  5AAN A;  2K7O A;  2HET A;  3D10 A;  3SIA A;  2KI6 C;  2K61 A;  3ICB A;  2DOQ A;  2KYF A;  3KO0 A;  1CNP A;  1X02 A;  4MVF A;  1C07 A;  2KOT A;  1FBV A;  1SL9 A;  1CFD A;  1YVH A;  3DXL A;  4MEW A;  1DF0 B;  3DF0 B;  1K93 D;  2F3Y A;  2KHN A;  1CB1 A;  1NPQ A;  1OOH A;  2VRG A;  4PHJ A;  2OTG C;  1KQV A;  2V53 A;  1F71 A;  5PAL A;  3TS5 B;  4OCI A;  2NXQ A;  4JPZ B;  1T14 A;  3F45 A;  1AJ5 A;  2HPS A;  2JC2 A;  1KWO B;  2CBL A;  3B86 A;  4YGD B;  2WOS A;  3O4Y A;  1RRO A;  2KFF A;  1OE9 B;  2M7L A;  1W9Z A;  1YX8 A;  3NHI A;  2ERB A;  1ZFS A;  3D76 A;  3FE6 A;  2H61 A;  2M9G A;  1TCO B;  1UHN A;  2QEV A;  3EVR A;  2QDI A;  1F4Q A;  2NLN A;  1LKJ A;  5I2L A;  1YRU B;  2ISD A;  4CID A;  2LAN A;  1DVI A;  3GK1 A;  1PRW A;  3EVV A;  2E6W A;  1NX0 A;  3AAK A;  5JJG A;  1UWO A;  2CXJ A;  2WND A;  2ZNE A;  1BLQ A;  3BUM B;  3KPX A;  5DKR A;  3Q8I A;  1AK8 A;  1AJ4 A;  2NCO A;  2G2B A;  2WCH A;  3LK0 A;  1GGZ A;  3DVK A;  1NUB A;  2WCE A;  2QEH A;  3N7H A;  5AFP A;  1TNP A;  2JQ6 A;  2M97 A;  1Y1X A;  2ZN8 A;  4CFR A;  4M2O A;  1CFP A;  1VRK A;  3TS5 C;  2NCP A;  1B1G A;  4D1E A;  1CM1 A;  1U5I B;  4ORA B;  1TNW A;  3EVU A;  1OMD A;  5ER4 X;  1BOD A;  4PE1 A;  2Y1M A;  1K9U A;  2LNK A;  3BUX B;  5FYX A;  2PMY A;  1IRJ A;  2K2A A;  1S5G Z;  1CLL A;  2L51 A;  1ZAC A;  2FCD A;  2QAC A;  3L4L A;  4DS7 A;  1DC1 A;  1B7T Y;  1QAS A;  5FI7 A;  1UUR A;  1AVS A;  2H8V A;  1YUU A;  3D77 A;  3TUY C;  1FI5 A;  5DKQ A;  2K2F A;  5DKN A;  1N2D A;  1NCZ A;  1ZOT B;  2MAZ A;  2Y5I A;  3DD4 A;  3JTD C;  1SCV A;  2KI4 B;  1A03 A;  1SK6 D;  4NDC A;  1K94 A;  4INW A;  3SG2 A;  3VRN A;  1ALW A;  3CZ1 A;  2KDH A;  2JU0 A;  3H4S E;  3SG7 A;  3SG6 A;  2KGB C;  2BL0 B;  4Q04 A;  1M45 A;  1SKT A;  4OKH A;  1KSM A;  4FTG A;  2HF5 A;  1S6J A;  1SSE B;  1DJG A;  4MLW A;  1REC A;  1CKK A;  1LVC D;  5I94 A;  1DT7 B;  2WCL A;  1B47 A;  1N65 A;  3ZWH A;  4WQ3 A;  1J55 A;  1IG5 A;  1XK4 A;  4HSZ A;  2LHL A;  1R2U A;  1GGW A;  2LE9 B;  2JT3 A;  3FE9 A;  1Z2C B;  3TDU A;  3L4A A;  3OHM B;  1DMO A;  3I5G B;  5D7F A;  4WQ2 A;  1P28 A;  2I18 A;  5AER A;  3CYZ A;  3SS3 A;  1OZO A;  4MZK A;  1BMO A;  4AOM A;  1TRF A;  4N1G A;  3K1E A;  1XFW O;  2BL0 C;  3CAB A;  2KAX A;  2KQ6 A;  4GGN A;  1SW8 A;  2GGM A;  4AQJ A;  4C0J A;  3SS4 A;  4ORB B;  3PAL A;  3C1V A;  2JTT A;  2JWW A;  3FS7 A;  3O4X A;  2MLE C;  2JRF A;  1K9P A;  3SJS A;  1MR8 A;  1QX2 A;  1MHO A;  1QWV A;  2WCF A;  2L0P A;  2PQL A;  3BJH A;  4GPL B;  4KYN A;  1DQE A;  4MSP A;  2BNX A;  2OS8 B;  4PHK A;  3I5H C;  5HKW A;  1JF2 A;  3VRR A;  1B4C A;  1H4B A;  1G8I A;  2ZRT A;  1KK8 C;  3BUN B;  4DIR A;  1YUR A;  3CLN A;  4N1F A;  1LS8 A;  2Q91 A;  3TZ1 A;  2K8M B;  3IQQ A;  1SRA A;  5HKZ A;  3UNW A;  2BCA A;  3PLF B;  1DTL A;  1A75 A;  4P2Y B;  2M29 A;  4USL A;  3S0A A;  1UHI A;  1JSA A;  4IL1 A;  4DRW A;  3I5F B;  5CSI A;  1DF0 A;  3DF0 A;  5CSF A;  1EL4 A;  1KCY A;  2GV5 A;  1SPY A;  3PM8 A;  1KQM B;  1DJW A;  1FPW A;  1F8H A;  1K9K A;  1OOJ A;  3OP0 A;  1B9A A;  1XO5 A;  1WY9 A;  1IQ3 A;  1NSH A;  1Y0V H;  1YR5 A;  4GFT A;  1J7P A;  1F54 A;  1M63 B;  1SNL A;  2LUX A;  1UHH A;  1TCF A;  3O6B A;  2L50 A;  2WC6 A;  1CLB A;  3BUW B;  1JWD A;  2ZKM X;  3BFH A;  2MLF C;  4OR9 B;  2HQW A;  1WLZ A;  3TDI A;  1QTX A;  3DVJ A;  3NXA A;  3BXK A;  3DYE A;  4INX A;  2OS8 C;  1QLS A;  1E8A A;  5JOL A;  5GQQ C;  2KSP A;  3B87 A;  2LP3 A;  4L9M A;  1PSB A;  2FJU B;  4YGA A;  1TUJ A;  3CZ0 A;  3FIA A;  3JTD B;  1K95 A;  4F0Z B;  4HRE E;  2KLD A;  1OSA A;  5CPV A;  3K21 A;  4A4C A;  4CFQ A;  1LIN A;  2M1K B;  2QEO A;  2LVK A;  1S1E A;  3TUY B;  1TOP A;  3PJI A;  2KI6 D;  1CDN A;  4YBH B;  3WHT B;  2MHH A;  3S0E A;  1SBJ A;  4I5J A;  4GGF A;  1AHR A;  1DJX A;  2P6B B;  1G4Y R;  2JPT A;  2AMI A;  3JVT C;  1XFU O;  2OPO A;  5I8N A;  3E3R A;  3LCP C;  3DZT A;  2L4H A;  5HLV A;  1L2O B;  3AKB A;  5KTY A;  4NDB A;  1QS7 A;  1EG3 A;  4JWQ A;  3OB2 B;  3HCM A;  1F55 A;  3WNX B;  2JUL A;  1AUI B;  4UPG A;  1IQ5 A;  2F8P A;  1N0Y A;  2JXL A;  2PRU A;  3VRQ A;  1L2O C;  3GOF A;  1F70 A;  1TTX A;  4CPV A;  1SL7 A;  1DGV A;  1KK7 Y;  1WLM A;  1IJ6 A;  1J1D A;  1SCM C;  2PAS A;  3BFB A;  3I5I C;  3NGV A;  3R72 A;  4M2P A;  2LMU A;  5G08 A;  4QJ3 B;  4FQT A;  1Y1A A;  2WCB A;  1BU3 A;  4PE7 A;  1S5G Y;  4C0L A;  5D69 A;  5IBW A;  2LLS A;  1XFR A;  2OTG B;  2M8U A;  2KAV A;  1BR1 B;  2K7D A;  3I5I B;  3KHE A;  3PN7 B;  3AKA A;  1SR6 C;  1D1O A;  2ZND A;  1QVI Z;  2LLT A;  3GK2 A;  3LLE A;  2P71 A;  4BY5 A;  1A75 B;  1KWO C;  1BJF A;  1YUS A;  2FCE A;  1YRT B;  2WC5 A;  3NHT A;  3TDZ A;  1NYA A;  1RTP 1;  2K7B A;  3IF7 A;  5EL2 A;  2AAO A;  5TNC A;  2F33 A;  1B8C A;  1V1G A;  3NSI A;  2CTN A;  3RM1 A;  1BOC A;  4TNC A;  1OMR A;  2P70 A;  5BPJ A;  2KAY A;  2KYC A;  3A8R A;  3DVM A;  3EK4 A;  3L47 A;  4YI9 A;  2LLU A;  3SIB A;  3NSK A;  2KFG A;  1QAT A;  1TUZ A;  3S0D A;  1Q80 A;  3S0B A;  1L7Z A;  1OOI X;  3D73 A;  5FI2 A;  1ORG A;  5B8I B;  3PM2 A;  1SY9 A;  3B6X A;  1K96 A;  3CZT X;  3BFA A;  4AQI A;  1OOF A;  4C0K A;  3BOW B;  4WRI A;  2TN4 A;  4JQ0 D;  4ZCV A;  1IGV A;  3DVE A;  5FI6 A;  1WDC C;  2RGI A;  1G33 A;  1XA5 A;  2WCM A;  2D8N A;  2BE4 A;  2Y4Q A;  1RFJ A;  1C3Z A;  2I7A A;  2WOR A;  3OGN A;  2LMV A;  1CTR A;  2GTE A;  1CDP A;  1XYD A;  2O60 A;  1RJV A;  3CZ2 A;  3EG5 B;  1BR4 B;  2KI4 C;  1PSR A;  2PSR A;  1RK9 A;  2JNF A;  3JVT B;  4XJK A;  3NSL A;  4QJ5 B;  1K8U A;  3KEV A;  4GAO A;  1JFJ A;  2L98 A;  3BQ3 A;  2LVI A;  2L5X B;  3BUO B;  1BF5 A;  1IKU A;  1MUX A;  5AXI A;  4MRX A;  1QV1 A;  4OV2 A;  1JC2 A;  4ORC B;  1JUO A;  3LL8 B;  3V2L A;  1KK8 B;  1OQP A;  4ZCU A;  1EJ3 A;  2BKI B;  2AUC A;  1YVL A;  1J7R A;  1LXF C;  1QX7 A;  2O5G A;  2M0R A;  2LV7 A;  2ZRS A;  2JXC A;  1FW4 A;  1QLK A;  4JD9 A;  3UO9 A;  3D74 A;  3VRO A;  4GNK B;  1ZMZ A;  3GK4 X;  4JKT A;  1UHK A;  2QPT A;  3CR5 X;  3OX5 A;  4GBA A;  4OZD A;  1M46 A;  3IQO A;  4I5K A;  4PHM A;  1C3Y A;  1CMF A;  2LMT A;  3I5H B;  2M7N A;  2LHI A;  5ER5 A;  3CGA A;  1DEL A;  3FWB A;  1PVB A;  1XFY O;  1Y1U A;  2L2E A;  3OB1 B;  5KU1 A;  1S6C A;  3AAJ A;  1KSO A;  3D0Y B;  1QJT A;  1LA3 A;  1LA0 A;  1B8R A;  1KFX L;  1EH2 A;  1EXR A;  2KBI A;  3SG4 A;  4ETO A;  1S3P A;  1CDL A;  2ZN9 A;  1YTZ C;  2M1U A;  3RZS A;  5DIC A;  1XFV O;  4E68 A;  1IH0 A;  3DY9 A;  2Y1N A;  3D75 A;  2F3Z A;  1DGU A;  1TWO A;  1OZS A;  1OW4 A;  3MSE B;  1SYM A;  2G9B A;  1GJY A;  1CDM A;  2PVB A;  1SCM B;  1A29 A;  1SL8 A;  3ZNI A;  2CT9 A;  2I94 A;  3CR2 A;  4R1E A;  3CTN A;  1WRZ A;  4OVN F;  1KK7 Z;  4MN0 A;  1YX7 A;  1QX5 B;  3OX6 A; 
#chains in the Genus database with same CATH homology
 1RWY A;  1NCY A;  4I5N B;  1XVJ A;  1Y6W A;  4XJK B;  1BG1 A;  2LCP A;  2BCX A;  2EHB A;  2COL B;  1U5I A;  4GGF C;  1XK4 C;  1WDC B;  3CS1 A;  2JT0 A;  1UHJ A;  2JNX A;  2LVV A;  5J3X A;  2A4J A;  2I2R E;  4MZJ A;  3EKH A;  5AEQ A;  4YGB B;  2L4I A;  3CWG A;  3EK7 A;  3KF9 A;  4NDD A;  1J7Q A;  1YUT A;  2F2P A;  4HRH A;  4PE4 A;  4PDZ A;  3O2P A;  3WHU B;  2BBM A;  4CLN A;  2KNE A;  1NWD A;  3BOW A;  5I2O A;  5HKY A;  1J1E A;  1MWN A;  1V1F A;  1J7O A;  1XFX O;  1UUS A;  4GUK A;  3EKJ A;  1SR6 B;  2LP2 A;  2JZI A;  3BYA A;  3LK1 A;  1MXL C;  2JTZ A;  1GQM A;  4XYN A;  3I5G C;  1HT9 A;  1ALV A;  1NX2 A;  1UP5 A;  1WRK A;  3CR4 X;  4N5X A;  2LM5 A;  1S6I A;  3WXA A;  2LAP A;  3VGO A;  2LUC A;  2PAL A;  3PAT A;  1TNX A;  2CCM A;  1A4P A;  3PN7 C;  1S36 A;  2IS9 A;  3PFV A;  1MF8 B;  2BCB A;  2ZFD A;  3FWC A;  5F6T A;  4ICB A;  2MJW B;  1OMV A;  4YI8 A;  1TIZ A;  5KSZ A;  1K90 D;  2FOT A;  2CNP A;  2KQY A;  1BT6 A;  1TN4 A;  2LC5 A;  4MBE A;  4MRY A;  4U8D A;  1A2X A;  1QXP A;  1M39 A;  4P5O E;  2MRD A;  1CFF A;  2E30 A;  2KGR A;  4PCW A;  1CFC A;  4PHN A;  1IWQ A;  2NZ0 A;  3EK8 A;  1B7T Z;  3NSO A;  2K0J A;  1KFU S;  3HX4 A;  1QV0 A;  4I5L B;  2EC6 C;  1W7I B;  2Q4U A;  1JFK A;  1FI6 A;  1S26 D;  1KQM C;  3SG3 A;  1H8B A;  2KBM A;  1CMG A;  1QIW A;  3RLZ A;  2EGD A;  1QVI Y;  2R2I A;  1PVA A;  1NX1 A;  5K89 A;  1NIW A;  1CLM A;  1W7J B;  1MXE A;  2JT8 A;  3D0Y A;  2MA2 A;  1NX3 A;  4M2Q A;  3A4U B;  2MBX A;  1IJ5 A;  1FF1 A;  2BKH B;  3PSR A;  2BEC A;  1XFZ O;  5HYD A;  2JOJ A;  4HRG A;  5HLO A;  4DUQ A;  1JF0 A;  2GGZ A;  2BE6 A;  1CM4 A;  1R6P A;  5CSN A;  1JBA A;  3VRP A;  4NQG A;  2K7C A;  1WRL A;  2F2O A;  1B8L A;  1DJI A;  1PAL A;  1QX5 B;  2SCP A;  2KFH A;  3QRX A;  2SAS A;  1F4O A;  2EC6 B;  1SMG A;  1AP4 A;  1K2H A;  2HQ8 A;  1HQV A;  4YGE B;  2B1U A;  2M49 B;  3M0W A;  2BBN A;  1KFX S;  1M31 A;  2H2K A;  2M3W A;  4PAL A;  4DCK A;  1C7W A;  1DJY A;  4YRU A;  1EG4 A;  4PE0 A;  1MQ1 A;  1NP8 A;  3SG5 A;  1DJH A;  3O78 A;  1KFU L;  5I2Q A;  4YGC B;  2LVJ A;  4FQO A;  1QIV A;  2WC8 A;  4MZL A;  1TNQ A;  1ODB A;  1DJZ A;  4A4B A;  4QJ4 B;  1PUL A;  1ZUZ A;  4BY4 A;  3I5F C;  1C7V A;  2H61 C;  1PK0 D;  5CSJ A;  1NCX A;  5AAN A;  2K7O A;  2HET A;  3D10 A;  3SIA A;  2KI6 C;  2K61 A;  3ICB A;  2DOQ A;  2KYF A;  3KO0 A;  1CNP A;  1X02 A;  4MVF A;  1C07 A;  2KOT A;  1FBV A;  1SL9 A;  1CFD A;  1YVH A;  4MEW A;  1DF0 B;  3DF0 B;  1K93 D;  2F3Y A;  2KHN A;  1CB1 A;  1NPQ A;  2VRG A;  4PHJ A;  1KQV A;  2OTG C;  2V53 A;  1F71 A;  5PAL A;  3TS5 B;  4OCI A;  2NXQ A;  4JPZ B;  3F45 A;  1AJ5 A;  2HPS A;  2JC2 A;  1KWO B;  2CBL A;  4YGD B;  2WOS A;  3O4Y A;  1RRO A;  2KFF A;  1OE9 B;  2M7L A;  1YX8 A;  1ZFS A;  2H61 A;  2M9G A;  1TCO B;  1UHN A;  3EVR A;  1F4Q A;  2NLN A;  1LKJ A;  5I2L A;  1YRU B;  2ISD A;  4CID A;  2LAN A;  1DVI A;  3GK1 A;  1PRW A;  3EVV A;  2E6W A;  1NX0 A;  3AAK A;  5JJG A;  1UWO A;  2CXJ A;  2WND A;  2ZNE A;  1BLQ A;  3BUM B;  3KPX A;  5DKR A;  1AK8 A;  1AJ4 A;  2NCO A;  2G2B A;  3LK0 A;  1GGZ A;  3DVK A;  1NUB A;  2WCE A;  5AFP A;  1TNP A;  2JQ6 A;  2M97 A;  1Y1X A;  2ZN8 A;  4CFR A;  4M2O A;  1CFP A;  1VRK A;  3TS5 C;  2NCP A;  1B1G A;  4D1E A;  1CM1 A;  1U5I B;  4ORA B;  1TNW A;  3EVU A;  1OMD A;  5ER4 X;  1BOD A;  4PE1 A;  2Y1M A;  1K9U A;  2LNK A;  3BUX B;  5FYX A;  2PMY A;  1IRJ A;  2K2A A;  1S5G Z;  1CLL A;  2L51 A;  1ZAC A;  2FCD A;  2QAC A;  4DS7 A;  1B7T Y;  1QAS A;  1UUR A;  1AVS A;  1YUU A;  3TUY C;  1FI5 A;  5DKQ A;  2K2F A;  5DKN A;  1N2D A;  1NCZ A;  1ZOT B;  2MAZ A;  2Y5I A;  3DD4 A;  3JTD C;  1SCV A;  2KI4 B;  1A03 A;  1SK6 D;  4NDC A;  1K94 A;  3SG2 A;  3VRN A;  1ALW A;  2KDH A;  2JU0 A;  3H4S E;  3SG6 A;  2KGB C;  2BL0 B;  4Q04 A;  1M45 A;  1SKT A;  4OKH A;  1KSM A;  4FTG A;  2HF5 A;  1S6J A;  1DJG A;  4MLW A;  1REC A;  1CKK A;  1LVC D;  1DT7 B;  1B47 A;  1N65 A;  3ZWH A;  4WQ3 A;  1J55 A;  1IG5 A;  4HSZ A;  2LHL A;  1R2U A;  1GGW A;  2LE9 B;  2JT3 A;  3TDU A;  3OHM B;  1DMO A;  3I5G B;  5D7F A;  4WQ2 A;  2I18 A;  5AER A;  1OZO A;  4MZK A;  1BMO A;  4AOM A;  1TRF A;  4N1G A;  1XFW O;  2BL0 C;  2KAX A;  2KQ6 A;  4GGN A;  1SW8 A;  2GGM A;  4AQJ A;  4C0J A;  4ORB B;  3PAL A;  3C1V A;  2JTT A;  2JWW A;  3FS7 A;  2MLE C;  2JRF A;  1K9P A;  3SJS A;  1MR8 A;  1QX2 A;  1MHO A;  2WCF A;  4GPL B;  2L0P A;  3SG7 A;  4MSP A;  4PHK A;  5HKW A;  3VRR A;  2OS8 B;  3I5H C;  1JF2 A;  1B4C A;  1H4B A;  1G8I A;  2ZRT A;  1KK8 C;  3BUN B;  4DIR A;  1YUR A;  3CLN A;  4N1F A;  2Q91 A;  3TZ1 A;  2K8M B;  3IQQ A;  1SRA A;  5HKZ A;  2BCA A;  3PLF B;  1DTL A;  1A75 A;  4P2Y B;  2M29 A;  4USL A;  1UHI A;  1JSA A;  4IL1 A;  4DRW A;  3I5F B;  5CSI A;  1DF0 A;  3DF0 A;  5CSF A;  1EL4 A;  1KCY A;  2GV5 A;  1SPY A;  3PM8 A;  1KQM B;  1DJW A;  1FPW A;  1F8H A;  1K9K A;  1OOJ A;  3OP0 A;  1B9A A;  1XO5 A;  1WY9 A;  1IQ3 A;  1NSH A;  1Y0V H;  1YR5 A;  4GFT A;  1J7P A;  1F54 A;  1M63 B;  1SNL A;  2LUX A;  1UHH A;  1TCF A;  3O6B A;  2L50 A;  1CLB A;  1JWD A;  3BUW B;  2ZKM X;  2MLF C;  4OR9 B;  2HQW A;  1WLZ A;  3TDI A;  1QTX A;  3DVJ A;  3NXA A;  3BXK A;  2OS8 C;  1QLS A;  1E8A A;  5JOL A;  5GQQ C;  2KSP A;  2LP3 A;  4L9M A;  1PSB A;  2FJU B;  4YGA A;  3FIA A;  3JTD B;  1K95 A;  4F0Z B;  4HRE E;  5CPV A;  1OSA A;  4CFQ A;  3K21 A;  4A4C A;  1LIN A;  2M1K B;  2LVK A;  1S1E A;  3TUY B;  1TOP A;  2KI6 D;  1CDN A;  4YBH B;  3WHT B;  2MHH A;  1SBJ A;  4I5J A;  4GGF A;  1AHR A;  1DJX A;  2P6B B;  1G4Y R;  2JPT A;  2AMI A;  3JVT C;  1XFU O;  2OPO A;  5I8N A;  3E3R A;  3LCP C;  2L4H A;  5HLV A;  1L2O B;  3AKB A;  5KTY A;  4NDB A;  1QS7 A;  1EG3 A;  4JWQ A;  3OB2 B;  3HCM A;  1F55 A;  3WNX B;  2JUL A;  1AUI B;  4UPG A;  1IQ5 A;  2F8P A;  1N0Y A;  2JXL A;  2PRU A;  3VRQ A;  1L2O C;  3GOF A;  1F70 A;  1TTX A;  4CPV A;  1SL7 A;  1DGV A;  1KK7 Y;  1WLM A;  1IJ6 A;  1J1D A;  1SCM C;  2PAS A;  3I5I C;  4M2P A;  2LMU A;  5G08 A;  4QJ3 B;  1Y1A A;  2WCB A;  1BU3 A;  4PE7 A;  1S5G Y;  4C0L A;  5D69 A;  5IBW A;  2LLS A;  2OTG B;  2M8U A;  2KAV A;  1BR1 B;  2K7D A;  3I5I B;  3KHE A;  3PN7 B;  3AKA A;  1SR6 C;  1D1O A;  2ZND A;  1QVI Z;  2LLT A;  3GK2 A;  3LLE A;  4BY5 A;  1A75 B;  1KWO C;  1BJF A;  1YUS A;  2FCE A;  1YRT B;  3TDZ A;  1NYA A;  1RTP 1;  2K7B A;  3IF7 A;  5TNC A;  2AAO A;  2F33 A;  1B8C A;  1V1G A;  3NSI A;  2CTN A;  3RM1 A;  1BOC A;  4TNC A;  1OMR A;  5BPJ A;  2KAY A;  2KYC A;  3A8R A;  3DVM A;  3EK4 A;  4YI9 A;  2LLU A;  3SIB A;  3NSK A;  2KFG A;  1QAT A;  1Q80 A;  1L7Z A;  5B8I B;  1SY9 A;  1K96 A;  3CZT X;  4AQI A;  4C0K A;  3BOW B;  4WRI A;  2TN4 A;  4JQ0 D;  4ZCV A;  1IGV A;  3DVE A;  1WDC C;  2RGI A;  1G33 A;  1XA5 A;  2D8N A;  2BE4 A;  2Y4Q A;  1RFJ A;  2I7A A;  2WOR A;  2LMV A;  1CTR A;  1CDP A;  1XYD A;  2O60 A;  1RJV A;  1BR4 B;  2KI4 C;  1PSR A;  2PSR A;  1RK9 A;  2JNF A;  3JVT B;  4XJK A;  3NSL A;  4QJ5 B;  1K8U A;  3KEV A;  4GAO A;  1JFJ A;  2L98 A;  3BQ3 A;  2LVI A;  2L5X B;  3BUO B;  1BF5 A;  1IKU A;  1MUX A;  5AXI A;  4MRX A;  1QV1 A;  4OV2 A;  1JC2 A;  4ORC B;  1JUO A;  3LL8 B;  1KK8 B;  1OQP A;  4ZCU A;  1EJ3 A;  2BKI B;  2AUC A;  1YVL A;  1J7R A;  1LXF C;  1QX7 A;  2O5G A;  2M0R A;  2LV7 A;  2ZRS A;  2JXC A;  1FW4 A;  1QLK A;  3VRO A;  4GNK B;  1ZMZ A;  3GK4 X;  1UHK A;  2QPT A;  3CR5 X;  3OX5 A;  4GBA A;  1M46 A;  3IQO A;  4I5K A;  4PHM A;  1CMF A;  2LMT A;  3I5H B;  2M7N A;  2LHI A;  5ER5 A;  3CGA A;  3FWB A;  1PVB A;  1XFY O;  1Y1U A;  2L2E A;  3OB1 B;  5KU1 A;  1S6C A;  3AAJ A;  1KSO A;  3D0Y B;  1QJT A;  1LA3 A;  1LA0 A;  1B8R A;  1KFX L;  1EH2 A;  1EXR A;  2KBI A;  3SG4 A;  4ETO A;  1S3P A;  1CDL A;  2ZN9 A;  1YTZ C;  2M1U A;  1XFV O;  4E68 A;  1IH0 A;  2Y1N A;  2F3Z A;  1DGU A;  1OZS A;  3MSE B;  1SYM A;  2G9B A;  1GJY A;  1CDM A;  2PVB A;  1SCM B;  1A29 A;  1SL8 A;  3ZNI A;  2CT9 A;  2I94 A;  3CR2 A;  4R1E A;  3CTN A;  1WRZ A;  4OVN F;  1KK7 Z;  4MN0 A;  1YX7 A;  1XK4 A;  3OX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...