2RGIA

Crystal structure of ca2+-free s100a2 at 1.6 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
MSSSLEQALAVLVTTFHKYSSQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMSNDFFQGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A2
publication title Crystal structure of Ca2+ -free S100A2 at 1.6-A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2rgiA00
1QVIZ 3BUWB 1TNQA 3BYAA 3LCPC 2LMUA 2MBXA 1YUSA 2KAYA 1CLLA 5TNCA 1SMGA 2KFFA 3I5FB 1SL7A 4HRGA 1MF8B 1JFKA 1N0YA 1UHJA 2JPTA 2K7CA 3VRNA 2WCBA 1ALWA 4I5NB 5CSIA 5CPVA 3CGAA 1CDNA 1NX2A 1SW8A 2F3ZA 1QATA 1M39A 1TNPA 3CTNA 3NSKA 4P2YB 4QJ4B 2LUCA 1NYAA 1ODBA 1Y1UA 4ZCUA 5HKWA 3DVEA 1UHHA 4E68A 4GPLB 1ZUZA 1HQVA 1QV0A 1XFXO 3EK4A 4GBAA 1XFUO 1ZFSA 1K9PA 2JT0A 4BY4A 2HPSA 2LVIA 1AJ5A 1SYMA 2OS8B 4TNCA 2AAOA 1DJHA 4PALA 2M7NA 2L4HA 2LANA 4PDZA 1WY9A 1SR6C 2O60A 1CMFA 2M97A 1Q80A 2DOQA 1CNPA 2M7LA 5ER5A 3FIAA 2LLSA 4PHMA 4YGAA 4DS7A 3ZNIA 1SR6B 4DIRA 3JVTB 2OTGC 4GGFA 3WXAA 2LMVA 1JC2A 1IGVA 1KSOA 2F33A 2L98A 5G08A 1BODA 1QTXA 1CDLA 3D0YB 1FI5A 4YGDB 1J55A 2MAZA 4L9MA 5HYDA 3OP0A 1MUXA 1UUSA 2OTGB 4C0LA 1YUUA 4GFTA 1KFUS 2WNDA 1BR4B 1DGUA 4I5LB 2GV5A 1A03A 1NWDA 1W7IB 3M0WA 2BECA 3I5GC 2FOTA 1YURA 2KI6D 2G9BA 4ORBB 1KQVA 1S1EA 2KI4C 3OHMB 3LK1A 2BKIB 2P6BB 1EG3A 1EH2A 4GGNA 3LK0A 3LL8B 4YGBB 1SCVA 4GNKB 4PHJA 3PN7B 1FW4A 1TNWA 4NDCA 2LHIA 5PALA 2MA2A 1C7WA 4CPVA 4GGFC 1ZOTB 2FCDA 1IRJA 3KEVA 1BG1A 4MLWA 1EL4A 1IJ5A 2O5GA 1JUOA 1B7TY 1QJTA 1EJ3A 1UP5A 2Y1NA 2H61A 4CIDA 2G2BA 1J7RA 1BT6A 1CFDA 3O6BA 5CSNA 5KTYA 1F71A 5AFPA 1BF5A 1NPQA 2FJUB 2R2IA 5AERA 5KU1A 1JSAA 2VRGA 2ISDA 4D1EA 1S5GZ 3OX6A 1IH0A 1DJYA 3CWGA 4YGEB 1M45A 2F3YA 2LMTA 2KAVA 1IJ6A 1A4PA 1YR5A 2JTTA 3F45A 1TN4A 2NXQA 1OMRA 5BPJA 2AUCA 5HLOA 1DTLA 2COLB 1DJWA 3HCMA 5JJGA 1KWOC 1XVJA 2K2AA 2JNXA 1CKKA 1XFYO 2KBMA 5AEQA 1JFJA 3AAJA 1FI6A 5HKZA 1HT9A 2LV7A 1ALVA 5AANA 3I5FC 5K89A 1H8BA 3KO0A 1B8CA 4DCKA 4I5KA 1FPWA 4NDDA 2Q4UA 2Y5IA 5D69A 3SG2A 1A29A 1NIWA 1OSAA 2KGRA 3D0YA 1A75A 3DVKA 1SPYA 1A2XA 2KGBC 2RGIA 1CFFA 1PRWA 2H61C 2MJWB 1ZACA 1C7VA 2KFHA 1OOJA 2KOTA 3SG6A 3VRRA 1PULA 1KCYA 2PRUA 3NXAA 2M8UA 4YBHB 1YUTA 1UHKA 3EKJA 1K2HA 4OR9B 1RECA 1J1DA 2K2FA 2E30A 3BUOB 1NP8A 3PFVA 4FQOA 2Q91A 2WOSA 5DKQA 2OS8C 4WQ3A 2K7OA 4CLNA 4M2PA 1LVCD 1KK7Y 3GK4X 1LKJA 1AHRA 4JWQA 1NSHA 3KPXA 2KNEA 1KFXS 4PCWA 3OB2B 3BUXB 4XYNA 2IS9A 3TUYB 1TCOB 3EVVA 3FWBA 2L51A 4MN0A 3JVTC 1M63B 1IQ3A 1Y6WA 2M1UA 2MLFC 1XFVO 3O4YA 2M29A 2D8NA 5DKRA 3I5IC 1QVIY 4N1GA 4AOMA 1XK4A 1IG5A 1QLSA 1TOPA 1QASA 1DGVA 3NSIA 2OPOA 4OCIA 1WRZA 1B1GA 2LM5A 1S3PA 1TIZA 2LNKA 1A75B 1XYDA 2ZRTA 3I5IB 3PALA 2SASA 1J7QA 2K8MB 2JC2A 3C1VA 1DMOA 2EGDA 4YI9A 1PK0D 1Y1AA 2PVBA 2PASA 2LLUA 3MSEB 5J3XA 1IKUA 1NUBA 2LVVA 2BE4A 4NDBA 5JOLA 1UHNA 1CDPA 3AKAA 3E3RA 3RLZA 1TRFA 2NCOA 2HQWA 3SG7A 1KFUL 1SNLA 2F2PA 3OX5A 1YTZC 5HLVA 1LXFC 1RWYA 2SCPA 1B7TZ 3PN7C 4MBEA 2WORA 3ICBA 2I2RE 1N65A 1SBJA 1F4QA 1K93D 4HSZA 1NX3A 2EC6C 2M49B 1U5IA 1MQ1A 3EK8A 2E6WA 1XFWO 3OB1B 1SL9A 2LC5A 2NLNA 3DD4A 3K21A 3BUNB 4MSPA 1JBAA 1Y1XA 1NCXA 1KK8C 1VRKA 1XK4C 3QRXA 3ZWHA 3JTDB 2EHBA 1MXLC 3SG4A 5KSZA 1BU3A 1OZOA 2EC6B 2CBLA 4PE1A 3VRPA 2KI6C 3KF9A 1L7ZA 2JWWA 2HETA 2JZIA 1V1GA 2NZ0A 2HQ8A 2K0JA 2JOJA 1KK8B 2H2KA 4PE7A 1DJIA 1XA5A 4IL1A 4AQJA 1PALA 2K7DA 2BL0C 1J7OA 2KAXA 2LHLA 1X02A 1QLKA 2BBNA 2KQ6A 4AQIA 3NSLA 1SKTA 2ZN9A 4GAOA 5AXIA 2LVKA 4CFQA 4BY5A 4P5OE 2LAPA 3IQQA 2BL0B 1OE9B 2GGZA 1MR8A 1PSBA 3BOWB 3SG5A 1B8RA 1TCFA 3CLNA 3I5HC 4NQGA 1DJGA 4I5JA 1AUIB 4PE4A 2MLEC 2CCMA 1SK6D 4MRYA 2LP3A 2JT3A 4ORAB 1WRLA 4F0ZB 3I5HB 2ZN8A 1L2OC 3PATA 1NX1A 2ZFDA 1NCZA 2KDHA 3H4SE 3DVJA 1CFPA 1PVBA 1EXRA 2I94A 2V53A 1XO5A 1U5IB 1TTXA 1R6PA 2GGMA 4PHKA 1J7PA 2CTNA 4XJKA 5GQQC 2ZNDA 3TS5C 1KK7Z 2JXCA 1S6JA 1V1FA 1L2OB 2JU0A 2LCPA 4QJ3B 3FS7A 1GQMA 2QPTA 4ZCVA 2JTZA 2I7AA 4Q04A 1KSMA 2KYFA 1GGWA 1G8IA 3GK1A 4GUKA 3TS5B 2BE6A 3D10A 2AMIA 1CM1A 3BQ3A 2M9GA 3LLEA 2LLTA 3O78A 4WQ2A 1CMGA 1WLZA 1LINA 1QIWA 2I18A 2L50A 1J1EA 1B4CA 4JQ0D 3WNXB 3IF7A 4HRHA 4A4CA 5I2OA 1AK8A 4MZLA 4YI8A 3NSOA 3TUYC 1UWOA 4HREE 1C07A 1SL8A 1FF1A 4MEWA 1MXEA 1TNXA 1DT7B 1RFJA 3HX4A 2NCPA 2A4JA 2JQ6A 2ZKMX 3EK7A 3RM1A 1AVSA 1W7JB 1B8LA 2M3WA 1K95A 2LE9B 2L4IA 1DF0A 1SCMC 1G33A 3DF0B 3TDIA 1BLQA 1K9UA 3TZ1A 3BXKA 1DJXA 5I8NA 1F70A 2B1UA 1KFXL 4USLA 2BCBA 1OZSA 2PALA 2Y1MA 2JULA 2PSRA 2PMYA 1AJ4A 1G4YR 1RK9A 1SCMB 2BCAA 2WCFA 4CFRA 2ZNEA 1QIVA 1JF0A 1YVLA 2K61A 3EKHA 4XJKB 4N5XA 4ETOA 1QV1A 5I2LA 1BR1B 4UPGA 1CM4A 3EVRA 1KQMC 1UHIA 1QX7A 1AP4A 2ZRSA 3SIAA 1Y0VH 2KBIA 1YVHA 3EVUA 3BOWA 4PHNA 1PSRA 1KQMB 2BBMA 3AAKA 1S26D 2JXLA 1F8HA 3A8RA 4QJ5B 3SJSA 1CLMA 3PM8A 5CSFA 1D1OA 4DUQA 2MHHA 5FYXA 3VRQA 4OVNF 1F54A 1B9AA 2CXJA 1UURA 3JTDC 3VGOA 3PLFB 3WHTB 1QX5B 1SRAA 1FBVA 2MRDA 5F6TA 3SIBA 2JNFA 3A4UB 1YRUB 4MZKA 1BMOA 1DF0B 2WC8A 4FTGA 5CSJA 1SY9A 1DVIA 1CTRA 1S6CA 1JF2A 3BUMB 1N2DA 4YRUA 1QS7A 1CLBA 3IQOA 1RJVA 1RROA 4N1FA 4OV2A 3CZTX 2JT8A 3GOFA 5I2QA 3SG3A 2M0RA 1EG4A 1XFZO 3KHEA 1K9KA 5DKNA 1M46A 2K7BA 2M1KB 2QACA 3GK2A 4M2QA 1WRKA 4MVFA 1MHOA 3I5GB 4C0KA 1NCYA 1IQ5A 1CB1A 1GGZA 1F55A 3DVMA 3PSRA 2KI4B 2WCEA 5D7FA 2L0PA 1IWQA 3TDZA 1B47A 1QX2A 4U8DA 1LA3A 4PE0A 1DJZA 3O2PA 4ORCB 1K96A 3TDUA 3DF0A 1S36A 1MWNA 1PVAA 4OKHA 4R1EA 1R2UA 3CR4X 2KHNA 2BKHB 3CS1A 2FCEA 2LVJA 2F2OA 1BOCA 5ER4X 2KQYA 2KYCA 4M2OA 4A4BA 1K8UA 1RTP1 2KSPA 1QXPA 3FWCA 2KFGA 1NX0A 1CFCA 4YGCB 2LP2A 2Y4QA 1M31A 1YX7A 1GJYA 2CNPA 4JPZB 4C0JA 1LA0A 2F8PA 5HKYA 2CT9A 2JRFA 1E8AA 3WHUB 4DRWA 1WDCC 3AKBA 1S6IA 1OMVA 1ZMZA 4MRXA 1JWDA 1K94A 1YX8A 1YRTB 2LUXA 4WRIA 2L5XB 5B8IB 1OMDA 4ICBA 1OQPA 1K90D 3CR5X 2TN4A 1F4OA 1CDMA 4MZJA 2L2EA 1WLMA 1WDCB 1H4BA 3VROA 2BCXA 2HF5A 1KWOB 1S5GY 5IBWA 1BJFA 3CR2A
chains in the Genus database with same CATH superfamily
1QVIZ 3BUWB 1TNQA 3BYAA 2ERBA 2LMUA 3LCPC 2MBXA 1YUSA 2KAYA 3FE8A 1CLLA 5TNCA 1SMGA 2KFFA 3I5FB 1SL7A 4HRGA 1MF8B 1JFKA 1N0YA 1UHJA 2JPTA 2K7CA 3VRNA 2WCBA 1ALWA 4I5NB 5CSIA 5CPVA 3CGAA 2KLDA 1CDNA 2YGUA 1NX2A 1SW8A 2F3ZA 1QATA 1M39A 1TNPA 3CTNA 3NSKA 4P2YB 4QJ4B 2LUCA 1NYAA 1ODBA 1Y1UA 1P28A 4ZCUA 5HKWA 3OGNA 5EL2A 1LS8A 1UHHA 3DVEA 4E68A 2GTEA 4GPLB 1ZUZA 1HQVA 1QV0A 1XFXO 3D76A 3EK4A 4GBAA 1XFUO 2BNXA 1ZFSA 1K9PA 2JT0A 4BY4A 2HPSA 2LVIA 1AJ5A 1SYMA 2OS8B 4TNCA 2AAOA 1DJHA 4PALA 2M7NA 3DYEA 2L4HA 2LANA 4PDZA 1WY9A 1SR6C 2O60A 1CMFA 2M97A 3B86A 1Q80A 2DOQA 1CNPA 3BFBA 2M7LA 5ER5A 3FIAA 2LLSA 4PHMA 4YGAA 4DS7A 3ZNIA 1SR6B 4KYNA 4DIRA 3JVTB 2OTGC 4GGFA 3WXAA 2LMVA 1JC2A 1IGVA 1KSOA 2F33A 2L98A 5G08A 3EG5B 1QTXA 1CDLA 2PYQA 3D0YB 5FI7A 3NHTA 4YGDB 1J55A 2MAZA 4L9MA 5HYDA 3OP0A 3K1EA 1MUXA 1UUSA 2OTGB 4C0LA 1YUUA 4GFTA 1KFUS 2WNDA 1BR4B 3BFAA 1DGUA 4I5LB 2GV5A 3D73A 1A03A 1NWDA 1W7IB 3M0WA 2BECA 3SS4A 3I5GC 3UO9A 1C3YA 2FOTA 1YURA 2KI6D 2G9BA 2QDIA 3D74A 4ORBB 1KQVA 1S1EA 1TUZA 2KI4C 3OHMB 3R1VA 3LK1A 2BKIB 2P6BB 1EG3A 1EH2A 4GGNA 3LK0A 3OBVA 3LL8B 4YGBB 1OW4A 1SCVA 4GNKB 4PHJA 3PN7B 1FW4A 1TNWA 4NDCA 2LHIA 5PALA 2MA2A 1C7WA 4CPVA 4GGFC 1ZOTB 2FCDA 1IRJA 3KEVA 1BG1A 4MLWA 1OOIX 2L2CA 1EL4A 1IJ5A 3BFHA 2O5GA 1JUOA 1B7TY 1QJTA 1EJ3A 1UP5A 2Y1NA 2H61A 4CIDA 2G2BA 4JKTA 1J7RA 4INWA 1DC1A 1BT6A 1CFDA 3O6BA 5CSNA 5KTYA 1F71A 5AFPA 1BF5A 1NPQA 2FJUB 2R2IA 5AERA 5KU1A 1JSAA 2P70A 2VRGA 2ISDA 4D1EA 1S5GZ 1OOHA 3OX6A 1IH0A 1DJYA 3CWGA 2WCMA 4YGEB 1M45A 2F3YA 2LMTA 2KAVA 1IJ6A 1A4PA 1YR5A 2JTTA 3F45A 1TN4A 2NXQA 1OMRA 5BPJA 2AUCA 5HLOA 1DTLA 2COLB 1DJWA 3HCMA 5JJGA 1KWOC 1XVJA 2K2AA 2JNXA 1CKKA 1XFYO 2KBMA 5AEQA 1JFJA 3AAJA 2PQLA 1FI6A 3SS5A 5HKZA 3FE6A 1HT9A 3RZSA 2LV7A 1ALVA 3L4AA 5AANA 3I5FC 5K89A 1H8BA 3KO0A 1B8CA 4DCKA 4I5KA 1FPWA 4NDDA 2Q4UA 2Y5IA 5D69A 3SG2A 1A29A 1NIWA 1OSAA 2KGRA 3D0YA 1A75A 3DVKA 1SPYA 1A2XA 2KGBC 2RGIA 1CFFA 1PRWA 2H61C 2WC6A 2MJWB 5HKYA 1ZACA 1C7VA 2KFHA 1OOJA 2KOTA 3SG6A 3VRRA 1PULA 4PT1A 1KCYA 2PRUA 3NXAA 2M8UA 4YBHB 1YUTA 1UHKA 3EKJA 1K2HA 4OR9B 1RECA 1J1DA 2K2FA 2E30A 3BUOB 1NP8A 3PFVA 4FQOA 2Q91A 2WOSA 3BJHA 5DKQA 2OS8C 4WQ3A 2WCKA 2K7OA 4CLNA 4M2PA 1LVCD 1KK7Y 3GK4X 1LKJA 1AHRA 4JWQA 4JD9A 1NSHA 3KPXA 2KNEA 1KFXS 4PCWA 3OB2B 3BUXB 4XYNA 2IS9A 1OOGA 1TCOB 3TUYB 3EVVA 3FWBA 1Z4HA 2L51A 4MN0A 3JVTC 1M63B 1IQ3A 1Y6WA 2M1UA 2MLFC 1XFVO 3O4YA 3D75A 2M29A 2D8NA 5DKRA 3I5IC 1QVIY 5HL1A 1W9ZA 4N1GA 4AOMA 1XK4A 1IG5A 3R1OA 3R1PA 1QLSA 1TOPA 1QASA 1DGVA 3NSIA 2OPOA 4OCIA 1WRZA 1B1GA 2LM5A 1S3PA 1TIZA 2LNKA 1A75B 1XYDA 2ZRTA 3I5IB 3PALA 2SASA 3PM2A 1J7QA 2K8MB 2JC2A 3C1VA 3CZ1A 1XFRA 2EGDA 4YI9A 1DMOA 1PK0D 2FJYA 1Y1AA 2PVBA 2QEOA 1TUJA 2PASA 2LLUA 3MSEB 5J3XA 1IKUA 1NUBA 2LVVA 2BE4A 4NDBA 2WCLA 5JOLA 3SS3A 1UHNA 1CDPA 3AKAA 3E3RA 4OZDA 3RLZA 1TRFA 2NCOA 2HQWA 1IIOA 3SG7A 1KFUL 1SNLA 2F2PA 3OX5A 1YTZC 5HLVA 1LXFC 1RWYA 2SCPA 1B7TZ 3D78A 3PN7C 4MBEA 3CABA 2WORA 3ICBA 3S0GA 2I2RE 1QWVA 1N65A 1SBJA 1F4QA 1K93D 1DQEA 1NX3A 2KLEA 3PJIA 2EC6C 2M49B 1U5IA 4HSZA 1MQ1A 3EK8A 2E6WA 1XFWO 3OB1B 1SL9A 2LC5A 2NLNA 3DD4A 3K21A 3BUNB 4MSPA 1JBAA 1Y1XA 1NCXA 1KK8C 1VRKA 1XK4C 3QRXA 3ZWHA 3JTDB 2EHBA 1MXLC 3SG4A 5KSZA 1BU3A 1OZOA 2EC6B 2CBLA 4PE1A 3VRPA 2KI6C 3KF9A 1L7ZA 2JWWA 2HETA 2JZIA 1V1GA 2NZ0A 1SSEB 2HQ8A 2K0JA 2JOJA 1KK8B 2H2KA 4PE7A 1DJIA 1XA5A 4IL1A 4AQJA 1PALA 2K7DA 2BL0C 1J7OA 2KAXA 2LHLA 3V2LA 1X02A 1QLKA 3B6XA 2L5YA 2BBNA 2KQ6A 4AQIA 3NSLA 1SKTA 2ZN9A 4GAOA 5AXIA 2LVKA 3B7AA 4CFQA 4BY5A 4P5OE 2LAPA 2BAPA 3IQQA 2BL0B 1OE9B 2GGZA 1MR8A 1PSBA 1Z2CB 3BOWB 3SG5A 1B8RA 1TCFA 3CLNA 3I5HC 3S0BA 4NQGA 1DJGA 4I5JA 1AUIB 4PE4A 2MLEC 2CCMA 1C3ZA 1SK6D 4MRYA 2LP3A 2QEVA 2JT3A 4ORAB 1WRLA 4F0ZB 3QMEA 3I5HB 2ZN8A 1L2OC 3PATA 1NX1A 2ZFDA 1NCZA 2KDHA 3H4SE 3DVJA 1CFPA 1PVBA 1EXRA 2I94A 2V53A 1XO5A 1U5IB 1TTXA 1R6PA 2GGMA 4PHKA 1J7PA 2CTNA 4XJKA 5D3OA 5GQQC 2ZNDA 3NGVA 3TS5C 1KK7Z 2JXCA 5FI6A 1S6JA 1V1FA 1L2OB 2JU0A 2LCPA 4QJ3B 3FS7A 1GQMA 2QPTA 4ZCVA 2JTZA 2I7AA 4Q04A 1KSMA 2KYFA 1GGWA 3N7HA 1G8IA 3GK1A 4GUKA 3TS5B 2BE6A 3D10A 2AMIA 1DELA 1CM1A 3BQ3A 2M9GA 3LLEA 2LLTA 3O78A 4WQ2A 1CMGA 1WLZA 1LINA 1QIWA 2I18A 2L50A 1J1EA 3DY9A 4JQ0D 1T14A 3WNXB 1B4CA 3IF7A 4HRHA 4A4CA 2WC5A 5I2OA 3S0DA 1AK8A 4FQTA 4MZLA 4YI8A 3NSOA 3TUYC 1UWOA 4HREE 1C07A 1SL8A 1FF1A 4MEWA 1MXEA 1TNXA 1DT7B 1RFJA 3HX4A 2NCPA 2A4JA 2JQ6A 2ZKMX 3EK7A 3RM1A 1AVSA 1W7JB 1B8LA 2M3WA 1K95A 2LE9B 2L4IA 1DF0A 1SCMC 1G33A 3DF0B 3TDIA 1BLQA 1K9UA 3D77A 3TZ1A 3BXKA 1DJXA 5I8NA 1F70A 2B1UA 1KFXL 4USLA 2BCBA 1OZSA 2PALA 3L47A 2Y1MA 2JULA 3O4XA 3VB1A 2QEHA 2PSRA 2PMYA 1AJ4A 1G4YR 1RK9A 1SCMB 2BCAA 2WCFA 4CFRA 2ZNEA 1QIVA 1JF0A 1YVLA 2K61A 3NHIA 3EKHA 4XJKB 4N5XA 4ETOA 1QV1A 5I2LA 1BR1B 4UPGA 5DICA 1CM4A 3EVRA 1DEKA 3DXLA 1KQMC 1UHIA 1QX7A 1AP4A 2ZRSA 3UNWA 3SIAA 1Y0VH 2KBIA 1YVHA 3EVUA 3BOWA 3L4LA 4PHNA 1PSRA 3B88A 1KQMB 2BBMA 3AAKA 1S26D 2JXLA 1F8HA 3A8RA 4QJ5B 3SJSA 1CLMA 3PM8A 5CSFA 1D1OA 4DUQA 2MHHA 5FYXA 3VRQA 4OVNF 1F54A 1B9AA 2K60A 2CXJA 1FI5A 1UURA 3JTDC 3VGOA 3PLFB 3WHTB 3FE9A 1QX5B 1SRAA 1FBVA 2MRDA 5F6TA 3SIBA 2JNFA 3A4UB 1YRUB 4MZKA 1BMOA 1DF0B 2WC8A 4FTGA 5CSJA 3CYZA 1SY9A 1DVIA 1CTRA 1S6CA 3S0EA 1JF2A 3BUMB 2QEBA 1N2DA 4YRUA 1QS7A 1CLBA 3IQOA 1RJVA 1RROA 4N1FA 4OV2A 3CZTX 2JT8A 3GOFA 5I2QA 3SG3A 2M0RA 3DZTA 1EG4A 1XFZO 3KHEA 1K9KA 5DKNA 1M46A 2K7BA 4F7FA 2M1KB 2QACA 3GK2A 4M2QA 1WRKA 4MVFA 1MHOA 3I5GB 4C0KA 1NCYA 1IQ5A 1CB1A 1GGZA 4IJ7A 1F55A 3DVMA 4INXA 1GM0A 3PSRA 2KI4B 2WCEA 5D7FA 2L0PA 1IWQA 3TDZA 3Q8IA 1B47A 1QX2A 4U8DA 1LA3A 4PE0A 3CZ0A 1DJZA 2P71A 3O2PA 1BODA 3CDNA 1OOFA 4ORCB 1K96A 3TDUA 3DF0A 3S0FA 1S36A 1MWNA 1PVAA 4OKHA 4R1EA 1R2UA 2WCHA 3CR4X 2JPOA 2KHNA 2BKHB 3CS1A 2FCEA 1TWOA 2LVJA 3IVTA 2F2OA 1BOCA 5ER4X 2KQYA 2KYCA 4M2OA 4A4BA 1K8UA 1RTP1 2KSPA 1QXPA 3FWCA 3S0AA 2KFGA 1NX0A 1CFCA 4YGCB 2LP2A 2WCJA 2Y4QA 1M31A 1YX7A 1GJYA 2CNPA 4JPZB 5FI2A 1LA0A 2F8PA 3B87A 2CT9A 4C0JA 2JRFA 1E8AA 3WHUB 4DRWA 1WDCC 3AKBA 1S6IA 1OMVA 1ZMZA 4MRXA 1JWDA 1K94A 1YX8A 1YRTB 2LUXA 4WRIA 2L5XB 5B8IB 1OMDA 5I94A 4ICBA 1OQPA 1K90D 3CR5X 2TN4A 1F4OA 1ORGA 3CZ2A 3R72A 1CDMA 4MZJA 2H8VA 2L2EA 1WLMA 1WDCB 1H4BA 3VROA 2BCXA 2HF5A 1KWOB 1S5GY 2KPHA 5IBWA 1BJFA 3CR2A
chains in the Genus database with same CATH topology
1QVIZ 3BUWB 1TNQA 3BYAA 3LCPC 2LMUA 2MBXA 1YUSA 2KAYA 1CLLA 5TNCA 1SMGA 2KFFA 3I5FB 1SL7A 4HRGA 1MF8B 1JFKA 1N0YA 1UHJA 2JPTA 2K7CA 3VRNA 2WCBA 1ALWA 4I5NB 5CSIA 5CPVA 3CGAA 1CDNA 1NX2A 1SW8A 2F3ZA 1QATA 1M39A 1TNPA 3CTNA 3NSKA 4P2YB 4QJ4B 2LUCA 1NYAA 1ODBA 1Y1UA 4ZCUA 5HKWA 3DVEA 1UHHA 4E68A 4GPLB 1ZUZA 1HQVA 1QV0A 1XFXO 3EK4A 4GBAA 1XFUO 1ZFSA 1K9PA 2JT0A 4BY4A 2HPSA 2LVIA 1AJ5A 1SYMA 2OS8B 4TNCA 2AAOA 1DJHA 4PALA 2M7NA 2L4HA 2LANA 4PDZA 1WY9A 1SR6C 2O60A 1CMFA 2M97A 1Q80A 2DOQA 1CNPA 2M7LA 5ER5A 3FIAA 2LLSA 4PHMA 4YGAA 4DS7A 3ZNIA 1SR6B 4DIRA 3JVTB 2OTGC 4GGFA 3WXAA 2LMVA 1JC2A 1IGVA 1KSOA 2F33A 2L98A 5G08A 1BODA 1QTXA 1CDLA 3D0YB 1FI5A 4YGDB 1J55A 2MAZA 4L9MA 5HYDA 3OP0A 1MUXA 1UUSA 2OTGB 4C0LA 1YUUA 4GFTA 1KFUS 2WNDA 1BR4B 1DGUA 4I5LB 2GV5A 1A03A 1NWDA 1W7IB 3M0WA 2BECA 3I5GC 2FOTA 1YURA 2KI6D 2G9BA 4ORBB 1KQVA 1S1EA 2KI4C 3OHMB 3LK1A 2BKIB 2P6BB 1EG3A 1EH2A 4GGNA 3LK0A 3LL8B 4YGBB 1SCVA 4GNKB 4PHJA 3PN7B 1FW4A 1TNWA 4NDCA 2LHIA 5PALA 2MA2A 1C7WA 4CPVA 4GGFC 1ZOTB 2FCDA 1IRJA 3KEVA 1BG1A 4MLWA 1EL4A 1IJ5A 2O5GA 1JUOA 1B7TY 1QJTA 1EJ3A 1UP5A 2Y1NA 2H61A 4CIDA 2G2BA 1J7RA 1BT6A 1CFDA 3O6BA 5CSNA 5KTYA 1F71A 5AFPA 1BF5A 1NPQA 2FJUB 2R2IA 5AERA 5KU1A 1JSAA 2VRGA 2ISDA 4D1EA 1S5GZ 3OX6A 1IH0A 1DJYA 3CWGA 4YGEB 1M45A 2F3YA 2LMTA 2KAVA 1IJ6A 1A4PA 1YR5A 2JTTA 3F45A 1TN4A 2NXQA 1OMRA 5BPJA 2AUCA 5HLOA 1DTLA 2COLB 1DJWA 3HCMA 5JJGA 1KWOC 1XVJA 2K2AA 2JNXA 1CKKA 1XFYO 2KBMA 5AEQA 1JFJA 3AAJA 1FI6A 5HKZA 1HT9A 2LV7A 1ALVA 5AANA 3I5FC 5K89A 1H8BA 3KO0A 1B8CA 4DCKA 4I5KA 1FPWA 4NDDA 2Q4UA 2Y5IA 5D69A 3SG2A 1A29A 1NIWA 1OSAA 2KGRA 3D0YA 1A75A 3DVKA 1SPYA 1A2XA 2KGBC 2RGIA 1CFFA 1PRWA 2H61C 2MJWB 1ZACA 1C7VA 2KFHA 1OOJA 2KOTA 3SG6A 3VRRA 1PULA 1KCYA 2PRUA 3NXAA 2M8UA 4YBHB 1YUTA 1UHKA 3EKJA 1K2HA 4OR9B 1RECA 1J1DA 2K2FA 2E30A 3BUOB 1NP8A 3PFVA 4FQOA 2Q91A 2WOSA 5DKQA 2OS8C 4WQ3A 2K7OA 4CLNA 4M2PA 1LVCD 1KK7Y 3GK4X 1LKJA 1AHRA 4JWQA 1NSHA 3KPXA 2KNEA 1KFXS 4PCWA 3OB2B 3BUXB 4XYNA 2IS9A 3TUYB 1TCOB 3EVVA 3FWBA 2L51A 4MN0A 3JVTC 1M63B 1IQ3A 1Y6WA 2M1UA 2MLFC 1XFVO 3O4YA 2M29A 2D8NA 5DKRA 3I5IC 1QVIY 4N1GA 4AOMA 1XK4A 1IG5A 1QLSA 1TOPA 1QASA 1DGVA 3NSIA 2OPOA 4OCIA 1WRZA 1B1GA 2LM5A 1S3PA 1TIZA 2LNKA 1A75B 1XYDA 2ZRTA 3I5IB 3PALA 2SASA 1J7QA 2K8MB 2JC2A 3C1VA 1DMOA 2EGDA 4YI9A 1PK0D 1Y1AA 2PVBA 2PASA 2LLUA 3MSEB 5J3XA 1IKUA 1NUBA 2LVVA 2BE4A 4NDBA 5JOLA 1UHNA 1CDPA 3AKAA 3E3RA 3RLZA 1TRFA 2NCOA 2HQWA 3SG7A 1KFUL 1SNLA 2F2PA 3OX5A 1YTZC 5HLVA 1LXFC 1RWYA 2SCPA 1B7TZ 3PN7C 4MBEA 2WORA 3ICBA 2I2RE 1N65A 1SBJA 1F4QA 1K93D 4HSZA 1NX3A 2EC6C 2M49B 1U5IA 1MQ1A 3EK8A 2E6WA 1XFWO 3OB1B 1SL9A 2LC5A 2NLNA 3DD4A 3K21A 3BUNB 4MSPA 1JBAA 1Y1XA 1NCXA 1KK8C 1VRKA 1XK4C 3QRXA 3ZWHA 3JTDB 2EHBA 1MXLC 3SG4A 5KSZA 1BU3A 1OZOA 2EC6B 2CBLA 4PE1A 3VRPA 2KI6C 3KF9A 1L7ZA 2JWWA 2HETA 2JZIA 1V1GA 2NZ0A 2HQ8A 2K0JA 2JOJA 1KK8B 2H2KA 4PE7A 1DJIA 1XA5A 4IL1A 4AQJA 1PALA 2K7DA 2BL0C 1J7OA 2KAXA 2LHLA 1X02A 1QLKA 2BBNA 2KQ6A 4AQIA 3NSLA 1SKTA 2ZN9A 4GAOA 5AXIA 2LVKA 4CFQA 4BY5A 4P5OE 2LAPA 3IQQA 2BL0B 1OE9B 2GGZA 1MR8A 1PSBA 3BOWB 3SG5A 1B8RA 1TCFA 3CLNA 3I5HC 4NQGA 1DJGA 4I5JA 1AUIB 4PE4A 2MLEC 2CCMA 1SK6D 4MRYA 2LP3A 2JT3A 4ORAB 1WRLA 4F0ZB 3I5HB 2ZN8A 1L2OC 3PATA 1NX1A 2ZFDA 1NCZA 2KDHA 3H4SE 3DVJA 1CFPA 1PVBA 1EXRA 2I94A 2V53A 1XO5A 1U5IB 1TTXA 1R6PA 2GGMA 4PHKA 1J7PA 2CTNA 4XJKA 5GQQC 2ZNDA 3TS5C 1KK7Z 2JXCA 1S6JA 1V1FA 1L2OB 2JU0A 2LCPA 4QJ3B 3FS7A 1GQMA 2QPTA 4ZCVA 2JTZA 2I7AA 4Q04A 1KSMA 2KYFA 1GGWA 1G8IA 3GK1A 4GUKA 3TS5B 2BE6A 3D10A 2AMIA 1CM1A 3BQ3A 2M9GA 3LLEA 2LLTA 3O78A 4WQ2A 1CMGA 1WLZA 1LINA 1QIWA 2I18A 2L50A 1J1EA 1B4CA 4JQ0D 3WNXB 3IF7A 4HRHA 4A4CA 5I2OA 1AK8A 4MZLA 4YI8A 3NSOA 3TUYC 1UWOA 4HREE 1C07A 1SL8A 1FF1A 4MEWA 1MXEA 1TNXA 1DT7B 1RFJA 3HX4A 2NCPA 2A4JA 2JQ6A 2ZKMX 3EK7A 3RM1A 1AVSA 1W7JB 1B8LA 2M3WA 1K95A 2LE9B 2L4IA 1DF0A 1SCMC 1G33A 3DF0B 3TDIA 1BLQA 1K9UA 3TZ1A 3BXKA 1DJXA 5I8NA 1F70A 2B1UA 1KFXL 4USLA 2BCBA 1OZSA 2PALA 2Y1MA 2JULA 2PSRA 2PMYA 1AJ4A 1G4YR 1RK9A 1SCMB 2BCAA 2WCFA 4CFRA 2ZNEA 1QIVA 1JF0A 1YVLA 2K61A 3EKHA 4XJKB 4N5XA 4ETOA 1QV1A 5I2LA 1BR1B 4UPGA 1CM4A 3EVRA 1KQMC 1UHIA 1QX7A 1AP4A 2ZRSA 3SIAA 1Y0VH 2KBIA 1YVHA 3EVUA 3BOWA 4PHNA 1PSRA 1KQMB 2BBMA 3AAKA 1S26D 2JXLA 1F8HA 3A8RA 4QJ5B 3SJSA 1CLMA 3PM8A 5CSFA 1D1OA 4DUQA 2MHHA 5FYXA 3VRQA 4OVNF 1F54A 1B9AA 2CXJA 1UURA 3JTDC 3VGOA 3PLFB 3WHTB 1QX5B 1SRAA 1FBVA 2MRDA 5F6TA 3SIBA 2JNFA 3A4UB 1YRUB 4MZKA 1BMOA 1DF0B 2WC8A 4FTGA 5CSJA 1SY9A 1DVIA 1CTRA 1S6CA 1JF2A 3BUMB 1N2DA 4YRUA 1QS7A 1CLBA 3IQOA 1RJVA 1RROA 4N1FA 4OV2A 3CZTX 2JT8A 3GOFA 5I2QA 3SG3A 2M0RA 1EG4A 1XFZO 3KHEA 1K9KA 5DKNA 1M46A 2K7BA 2M1KB 2QACA 3GK2A 4M2QA 1WRKA 4MVFA 1MHOA 3I5GB 4C0KA 1NCYA 1IQ5A 1CB1A 1GGZA 1F55A 3DVMA 3PSRA 2KI4B 2WCEA 5D7FA 2L0PA 1IWQA 3TDZA 1B47A 1QX2A 4U8DA 1LA3A 4PE0A 1DJZA 3O2PA 4ORCB 1K96A 3TDUA 3DF0A 1S36A 1MWNA 1PVAA 4OKHA 4R1EA 1R2UA 3CR4X 2KHNA 2BKHB 3CS1A 2FCEA 2LVJA 2F2OA 1BOCA 5ER4X 2KQYA 2KYCA 4M2OA 4A4BA 1K8UA 1RTP1 2KSPA 1QXPA 3FWCA 2KFGA 1NX0A 1CFCA 4YGCB 2LP2A 2Y4QA 1M31A 1YX7A 1GJYA 2CNPA 4JPZB 4C0JA 1LA0A 2F8PA 5HKYA 2CT9A 2JRFA 1E8AA 3WHUB 4DRWA 1WDCC 3AKBA 1S6IA 1OMVA 1ZMZA 4MRXA 1JWDA 1K94A 1YX8A 1YRTB 2LUXA 4WRIA 2L5XB 5B8IB 1OMDA 4ICBA 1OQPA 1K90D 3CR5X 2TN4A 1F4OA 1CDMA 4MZJA 2L2EA 1WLMA 1WDCB 1H4BA 3VROA 2BCXA 2HF5A 1KWOB 1S5GY 5IBWA 1BJFA 3CR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVI Z;  3BUW B;  1TNQ A;  3BYA A;  3LCP C;  2LMU A;  2MBX A;  1YUS A;  2KAY A;  1CLL A;  5TNC A;  1SMG A;  2KFF A;  3I5F B;  1SL7 A;  4HRG A;  1MF8 B;  1JFK A;  1N0Y A;  1UHJ A;  2JPT A;  2K7C A;  3VRN A;  2WCB A;  1ALW A;  4I5N B;  5CSI A;  5CPV A;  3CGA A;  1CDN A;  1NX2 A;  1SW8 A;  2F3Z A;  1QAT A;  1M39 A;  1TNP A;  3CTN A;  3NSK A;  4P2Y B;  4QJ4 B;  2LUC A;  1NYA A;  1ODB A;  1Y1U A;  4ZCU A;  5HKW A;  3DVE A;  1UHH A;  4E68 A;  4GPL B;  1ZUZ A;  1HQV A;  1QV0 A;  1XFX O;  3EK4 A;  4GBA A;  1XFU O;  1ZFS A;  1K9P A;  2JT0 A;  4BY4 A;  2HPS A;  2LVI A;  1AJ5 A;  1SYM A;  2OS8 B;  4TNC A;  2AAO A;  1DJH A;  4PAL A;  2M7N A;  2L4H A;  2LAN A;  4PDZ A;  1WY9 A;  1SR6 C;  2O60 A;  1CMF A;  2M97 A;  1Q80 A;  2DOQ A;  1CNP A;  2M7L A;  5ER5 A;  3FIA A;  2LLS A;  4PHM A;  4YGA A;  4DS7 A;  3ZNI A;  1SR6 B;  4DIR A;  3JVT B;  2OTG C;  4GGF A;  3WXA A;  2LMV A;  1JC2 A;  1IGV A;  1KSO A;  2F33 A;  2L98 A;  5G08 A;  1BOD A;  1QTX A;  1CDL A;  3D0Y B;  1FI5 A;  4YGD B;  1J55 A;  2MAZ A;  4L9M A;  5HYD A;  3OP0 A;  1MUX A;  1UUS A;  2OTG B;  4C0L A;  1YUU A;  4GFT A;  1KFU S;  2WND A;  1BR4 B;  1DGU A;  4I5L B;  2GV5 A;  1A03 A;  1NWD A;  1W7I B;  3M0W A;  2BEC A;  3I5G C;  2FOT A;  1YUR A;  2KI6 D;  2G9B A;  4ORB B;  1KQV A;  1S1E A;  2KI4 C;  3OHM B;  3LK1 A;  2BKI B;  2P6B B;  1EG3 A;  1EH2 A;  4GGN A;  3LK0 A;  3LL8 B;  4YGB B;  1SCV A;  4GNK B;  4PHJ A;  3PN7 B;  1FW4 A;  1TNW A;  4NDC A;  2LHI A;  5PAL A;  2MA2 A;  1C7W A;  4CPV A;  4GGF C;  1ZOT B;  2FCD A;  1IRJ A;  3KEV A;  1BG1 A;  4MLW A;  1EL4 A;  1IJ5 A;  2O5G A;  1JUO A;  1B7T Y;  1QJT A;  1EJ3 A;  1UP5 A;  2Y1N A;  2H61 A;  4CID A;  2G2B A;  1J7R A;  1BT6 A;  1CFD A;  3O6B A;  5CSN A;  5KTY A;  1F71 A;  5AFP A;  1BF5 A;  1NPQ A;  2FJU B;  2R2I A;  5AER A;  5KU1 A;  1JSA A;  2VRG A;  2ISD A;  4D1E A;  1S5G Z;  3OX6 A;  1IH0 A;  1DJY A;  3CWG A;  4YGE B;  1M45 A;  2F3Y A;  2LMT A;  2KAV A;  1IJ6 A;  1A4P A;  1YR5 A;  2JTT A;  3F45 A;  1TN4 A;  2NXQ A;  1OMR A;  5BPJ A;  2AUC A;  5HLO A;  1DTL A;  2COL B;  1DJW A;  3HCM A;  5JJG A;  1KWO C;  1XVJ A;  2K2A A;  2JNX A;  1CKK A;  1XFY O;  2KBM A;  5AEQ A;  1JFJ A;  3AAJ A;  1FI6 A;  5HKZ A;  1HT9 A;  2LV7 A;  1ALV A;  5AAN A;  3I5F C;  5K89 A;  1H8B A;  3KO0 A;  1B8C A;  4DCK A;  4I5K A;  1FPW A;  4NDD A;  2Q4U A;  2Y5I A;  5D69 A;  3SG2 A;  1A29 A;  1NIW A;  1OSA A;  2KGR A;  3D0Y A;  1A75 A;  3DVK A;  1SPY A;  1A2X A;  2KGB C;  2RGI A;  1CFF A;  1PRW A;  2H61 C;  2MJW B;  1ZAC A;  1C7V A;  2KFH A;  1OOJ A;  2KOT A;  3SG6 A;  3VRR A;  1PUL A;  1KCY A;  2PRU A;  3NXA A;  2M8U A;  4YBH B;  1YUT A;  1UHK A;  3EKJ A;  1K2H A;  4OR9 B;  1REC A;  1J1D A;  2K2F A;  2E30 A;  3BUO B;  1NP8 A;  3PFV A;  4FQO A;  2Q91 A;  2WOS A;  5DKQ A;  2OS8 C;  4WQ3 A;  2K7O A;  4CLN A;  4M2P A;  1LVC D;  1KK7 Y;  3GK4 X;  1LKJ A;  1AHR A;  4JWQ A;  1NSH A;  3KPX A;  2KNE A;  1KFX S;  4PCW A;  3OB2 B;  3BUX B;  4XYN A;  2IS9 A;  3TUY B;  1TCO B;  3EVV A;  3FWB A;  2L51 A;  4MN0 A;  3JVT C;  1M63 B;  1IQ3 A;  1Y6W A;  2M1U A;  2MLF C;  1XFV O;  3O4Y A;  2M29 A;  2D8N A;  5DKR A;  3I5I C;  1QVI Y;  4N1G A;  4AOM A;  1XK4 A;  1IG5 A;  1QLS A;  1TOP A;  1QAS A;  1DGV A;  3NSI A;  2OPO A;  4OCI A;  1WRZ A;  1B1G A;  2LM5 A;  1S3P A;  1TIZ A;  2LNK A;  1A75 B;  1XYD A;  2ZRT A;  3I5I B;  3PAL A;  2SAS A;  1J7Q A;  2K8M B;  2JC2 A;  3C1V A;  1DMO A;  2EGD A;  4YI9 A;  1PK0 D;  1Y1A A;  2PVB A;  2PAS A;  2LLU A;  3MSE B;  5J3X A;  1IKU A;  1NUB A;  2LVV A;  2BE4 A;  4NDB A;  5JOL A;  1UHN A;  1CDP A;  3AKA A;  3E3R A;  3RLZ A;  1TRF A;  2NCO A;  2HQW A;  3SG7 A;  1KFU L;  1SNL A;  2F2P A;  3OX5 A;  1YTZ C;  5HLV A;  1LXF C;  1RWY A;  2SCP A;  1B7T Z;  3PN7 C;  4MBE A;  2WOR A;  3ICB A;  2I2R E;  1N65 A;  1SBJ A;  1F4Q A;  1K93 D;  4HSZ A;  1NX3 A;  2EC6 C;  2M49 B;  1U5I A;  1MQ1 A;  3EK8 A;  2E6W A;  1XFW O;  3OB1 B;  1SL9 A;  2LC5 A;  2NLN A;  3DD4 A;  3K21 A;  3BUN B;  4MSP A;  1JBA A;  1Y1X A;  1NCX A;  1KK8 C;  1VRK A;  1XK4 C;  3QRX A;  3ZWH A;  3JTD B;  2EHB A;  1MXL C;  3SG4 A;  5KSZ A;  1BU3 A;  1OZO A;  2EC6 B;  2CBL A;  4PE1 A;  3VRP A;  2KI6 C;  3KF9 A;  1L7Z A;  2JWW A;  2HET A;  2JZI A;  1V1G A;  2NZ0 A;  2HQ8 A;  2K0J A;  2JOJ A;  1KK8 B;  2H2K A;  4PE7 A;  1DJI A;  1XA5 A;  4IL1 A;  4AQJ A;  1PAL A;  2K7D A;  2BL0 C;  1J7O A;  2KAX A;  2LHL A;  1X02 A;  1QLK A;  2BBN A;  2KQ6 A;  4AQI A;  3NSL A;  1SKT A;  2ZN9 A;  4GAO A;  5AXI A;  2LVK A;  4CFQ A;  4BY5 A;  4P5O E;  2LAP A;  3IQQ A;  2BL0 B;  1OE9 B;  2GGZ A;  1MR8 A;  1PSB A;  3BOW B;  3SG5 A;  1B8R A;  1TCF A;  3CLN A;  3I5H C;  4NQG A;  1DJG A;  4I5J A;  1AUI B;  4PE4 A;  2MLE C;  2CCM A;  1SK6 D;  4MRY A;  2LP3 A;  2JT3 A;  4ORA B;  1WRL A;  4F0Z B;  3I5H B;  2ZN8 A;  1L2O C;  3PAT A;  1NX1 A;  2ZFD A;  1NCZ A;  2KDH A;  3H4S E;  3DVJ A;  1CFP A;  1PVB A;  1EXR A;  2I94 A;  2V53 A;  1XO5 A;  1U5I B;  1TTX A;  1R6P A;  2GGM A;  4PHK A;  1J7P A;  2CTN A;  4XJK A;  5GQQ C;  2ZND A;  3TS5 C;  1KK7 Z;  2JXC A;  1S6J A;  1V1F A;  1L2O B;  2JU0 A;  2LCP A;  4QJ3 B;  3FS7 A;  1GQM A;  2QPT A;  4ZCV A;  2JTZ A;  2I7A A;  4Q04 A;  1KSM A;  2KYF A;  1GGW A;  1G8I A;  3GK1 A;  4GUK A;  3TS5 B;  2BE6 A;  3D10 A;  2AMI A;  1CM1 A;  3BQ3 A;  2M9G A;  3LLE A;  2LLT A;  3O78 A;  4WQ2 A;  1CMG A;  1WLZ A;  1LIN A;  1QIW A;  2I18 A;  2L50 A;  1J1E A;  1B4C A;  4JQ0 D;  3WNX B;  3IF7 A;  4HRH A;  4A4C A;  5I2O A;  1AK8 A;  4MZL A;  4YI8 A;  3NSO A;  3TUY C;  1UWO A;  4HRE E;  1C07 A;  1SL8 A;  1FF1 A;  4MEW A;  1MXE A;  1TNX A;  1DT7 B;  1RFJ A;  3HX4 A;  2NCP A;  2A4J A;  2JQ6 A;  2ZKM X;  3EK7 A;  3RM1 A;  1AVS A;  1W7J B;  1B8L A;  2M3W A;  1K95 A;  2LE9 B;  2L4I A;  1DF0 A;  1SCM C;  1G33 A;  3DF0 B;  3TDI A;  1BLQ A;  1K9U A;  3TZ1 A;  3BXK A;  1DJX A;  5I8N A;  1F70 A;  2B1U A;  1KFX L;  4USL A;  2BCB A;  1OZS A;  2PAL A;  2Y1M A;  2JUL A;  2PSR A;  2PMY A;  1AJ4 A;  1G4Y R;  1RK9 A;  1SCM B;  2BCA A;  2WCF A;  4CFR A;  2ZNE A;  1QIV A;  1JF0 A;  1YVL A;  2K61 A;  3EKH A;  4XJK B;  4N5X A;  4ETO A;  1QV1 A;  5I2L A;  1BR1 B;  4UPG A;  1CM4 A;  3EVR A;  1KQM C;  1UHI A;  1QX7 A;  1AP4 A;  2ZRS A;  3SIA A;  1Y0V H;  2KBI A;  1YVH A;  3EVU A;  3BOW A;  4PHN A;  1PSR A;  1KQM B;  2BBM A;  3AAK A;  1S26 D;  2JXL A;  1F8H A;  3A8R A;  4QJ5 B;  3SJS A;  1CLM A;  3PM8 A;  5CSF A;  1D1O A;  4DUQ A;  2MHH A;  5FYX A;  3VRQ A;  4OVN F;  1F54 A;  1B9A A;  2CXJ A;  1UUR A;  3JTD C;  3VGO A;  3PLF B;  3WHT B;  1QX5 B;  1SRA A;  1FBV A;  2MRD A;  5F6T A;  3SIB A;  2JNF A;  3A4U B;  1YRU B;  4MZK A;  1BMO A;  1DF0 B;  2WC8 A;  4FTG A;  5CSJ A;  1SY9 A;  1DVI A;  1CTR A;  1S6C A;  1JF2 A;  3BUM B;  1N2D A;  4YRU A;  1QS7 A;  1CLB A;  3IQO A;  1RJV A;  1RRO A;  4N1F A;  4OV2 A;  3CZT X;  2JT8 A;  3GOF A;  5I2Q A;  3SG3 A;  2M0R A;  1EG4 A;  1XFZ O;  3KHE A;  1K9K A;  5DKN A;  1M46 A;  2K7B A;  2M1K B;  2QAC A;  3GK2 A;  4M2Q A;  1WRK A;  4MVF A;  1MHO A;  3I5G B;  4C0K A;  1NCY A;  1IQ5 A;  1CB1 A;  1GGZ A;  1F55 A;  3DVM A;  3PSR A;  2KI4 B;  2WCE A;  5D7F A;  2L0P A;  1IWQ A;  3TDZ A;  1B47 A;  1QX2 A;  4U8D A;  1LA3 A;  4PE0 A;  1DJZ A;  3O2P A;  4ORC B;  1K96 A;  3TDU A;  3DF0 A;  1S36 A;  1MWN A;  1PVA A;  4OKH A;  4R1E A;  1R2U A;  3CR4 X;  2KHN A;  2BKH B;  3CS1 A;  2FCE A;  2LVJ A;  2F2O A;  1BOC A;  5ER4 X;  2KQY A;  2KYC A;  4M2O A;  4A4B A;  1K8U A;  1RTP 1;  2KSP A;  1QXP A;  3FWC A;  2KFG A;  1NX0 A;  1CFC A;  4YGC B;  2LP2 A;  2Y4Q A;  1M31 A;  1YX7 A;  1GJY A;  2CNP A;  4JPZ B;  4C0J A;  1LA0 A;  2F8P A;  5HKY A;  2CT9 A;  2JRF A;  1E8A A;  3WHU B;  4DRW A;  1WDC C;  3AKB A;  1S6I A;  1OMV A;  1ZMZ A;  4MRX A;  1JWD A;  1K94 A;  1YX8 A;  1YRT B;  2LUX A;  4WRI A;  2L5X B;  5B8I B;  1OMD A;  4ICB A;  1OQP A;  1K90 D;  3CR5 X;  2TN4 A;  1F4O A;  1CDM A;  4MZJ A;  2L2E A;  1WLM A;  1WDC B;  1H4B A;  3VRO A;  2BCX A;  2HF5 A;  1KWO B;  1S5G Y;  5IBW A;  1BJF A;  3CR2 A; 
#chains in the Genus database with same CATH topology
 1QVI Z;  3BUW B;  1TNQ A;  3BYA A;  2ERB A;  2LMU A;  3LCP C;  2MBX A;  1YUS A;  2KAY A;  3FE8 A;  1CLL A;  5TNC A;  1SMG A;  2KFF A;  3I5F B;  1SL7 A;  4HRG A;  1MF8 B;  1JFK A;  1N0Y A;  1UHJ A;  2JPT A;  2K7C A;  3VRN A;  2WCB A;  1ALW A;  4I5N B;  5CSI A;  5CPV A;  3CGA A;  2KLD A;  1CDN A;  2YGU A;  1NX2 A;  1SW8 A;  2F3Z A;  1QAT A;  1M39 A;  1TNP A;  3CTN A;  3NSK A;  4P2Y B;  4QJ4 B;  2LUC A;  1NYA A;  1ODB A;  1Y1U A;  1P28 A;  4ZCU A;  5HKW A;  3OGN A;  5EL2 A;  1LS8 A;  1UHH A;  3DVE A;  4E68 A;  2GTE A;  4GPL B;  1ZUZ A;  1HQV A;  1QV0 A;  1XFX O;  3D76 A;  3EK4 A;  4GBA A;  1XFU O;  2BNX A;  1ZFS A;  1K9P A;  2JT0 A;  4BY4 A;  2HPS A;  2LVI A;  1AJ5 A;  1SYM A;  2OS8 B;  4TNC A;  2AAO A;  1DJH A;  4PAL A;  2M7N A;  3DYE A;  2L4H A;  2LAN A;  4PDZ A;  1WY9 A;  1SR6 C;  2O60 A;  1CMF A;  2M97 A;  3B86 A;  1Q80 A;  2DOQ A;  1CNP A;  3BFB A;  2M7L A;  5ER5 A;  3FIA A;  2LLS A;  4PHM A;  4YGA A;  4DS7 A;  3ZNI A;  1SR6 B;  4KYN A;  4DIR A;  3JVT B;  2OTG C;  4GGF A;  3WXA A;  2LMV A;  1JC2 A;  1IGV A;  1KSO A;  2F33 A;  2L98 A;  5G08 A;  3EG5 B;  1QTX A;  1CDL A;  2PYQ A;  3D0Y B;  5FI7 A;  3NHT A;  4YGD B;  1J55 A;  2MAZ A;  4L9M A;  5HYD A;  3OP0 A;  3K1E A;  1MUX A;  1UUS A;  2OTG B;  4C0L A;  1YUU A;  4GFT A;  1KFU S;  2WND A;  1BR4 B;  3BFA A;  1DGU A;  4I5L B;  2GV5 A;  3D73 A;  1A03 A;  1NWD A;  1W7I B;  3M0W A;  2BEC A;  3SS4 A;  3I5G C;  3UO9 A;  1C3Y A;  2FOT A;  1YUR A;  2KI6 D;  2G9B A;  2QDI A;  3D74 A;  4ORB B;  1KQV A;  1S1E A;  1TUZ A;  2KI4 C;  3OHM B;  3R1V A;  3LK1 A;  2BKI B;  2P6B B;  1EG3 A;  1EH2 A;  4GGN A;  3LK0 A;  3OBV A;  3LL8 B;  4YGB B;  1OW4 A;  1SCV A;  4GNK B;  4PHJ A;  3PN7 B;  1FW4 A;  1TNW A;  4NDC A;  2LHI A;  5PAL A;  2MA2 A;  1C7W A;  4CPV A;  4GGF C;  1ZOT B;  2FCD A;  1IRJ A;  3KEV A;  1BG1 A;  4MLW A;  1OOI X;  2L2C A;  1EL4 A;  1IJ5 A;  3BFH A;  2O5G A;  1JUO A;  1B7T Y;  1QJT A;  1EJ3 A;  1UP5 A;  2Y1N A;  2H61 A;  4CID A;  2G2B A;  4JKT A;  1J7R A;  4INW A;  1DC1 A;  1BT6 A;  1CFD A;  3O6B A;  5CSN A;  5KTY A;  1F71 A;  5AFP A;  1BF5 A;  1NPQ A;  2FJU B;  2R2I A;  5AER A;  5KU1 A;  1JSA A;  2P70 A;  2VRG A;  2ISD A;  4D1E A;  1S5G Z;  1OOH A;  3OX6 A;  1IH0 A;  1DJY A;  3CWG A;  2WCM A;  4YGE B;  1M45 A;  2F3Y A;  2LMT A;  2KAV A;  1IJ6 A;  1A4P A;  1YR5 A;  2JTT A;  3F45 A;  1TN4 A;  2NXQ A;  1OMR A;  5BPJ A;  2AUC A;  5HLO A;  1DTL A;  2COL B;  1DJW A;  3HCM A;  5JJG A;  1KWO C;  1XVJ A;  2K2A A;  2JNX A;  1CKK A;  1XFY O;  2KBM A;  5AEQ A;  1JFJ A;  3AAJ A;  2PQL A;  1FI6 A;  3SS5 A;  5HKZ A;  3FE6 A;  1HT9 A;  3RZS A;  2LV7 A;  1ALV A;  3L4A A;  5AAN A;  3I5F C;  5K89 A;  1H8B A;  3KO0 A;  1B8C A;  4DCK A;  4I5K A;  1FPW A;  4NDD A;  2Q4U A;  2Y5I A;  5D69 A;  3SG2 A;  1A29 A;  1NIW A;  1OSA A;  2KGR A;  3D0Y A;  1A75 A;  3DVK A;  1SPY A;  1A2X A;  2KGB C;  2RGI A;  1CFF A;  1PRW A;  2H61 C;  2WC6 A;  2MJW B;  5HKY A;  1ZAC A;  1C7V A;  2KFH A;  1OOJ A;  2KOT A;  3SG6 A;  3VRR A;  1PUL A;  4PT1 A;  1KCY A;  2PRU A;  3NXA A;  2M8U A;  4YBH B;  1YUT A;  1UHK A;  3EKJ A;  1K2H A;  4OR9 B;  1REC A;  1J1D A;  2K2F A;  2E30 A;  3BUO B;  1NP8 A;  3PFV A;  4FQO A;  2Q91 A;  2WOS A;  3BJH A;  5DKQ A;  2OS8 C;  4WQ3 A;  2WCK A;  2K7O A;  4CLN A;  4M2P A;  1LVC D;  1KK7 Y;  3GK4 X;  1LKJ A;  1AHR A;  4JWQ A;  4JD9 A;  1NSH A;  3KPX A;  2KNE A;  1KFX S;  4PCW A;  3OB2 B;  3BUX B;  4XYN A;  2IS9 A;  1OOG A;  1TCO B;  3TUY B;  3EVV A;  3FWB A;  1Z4H A;  2L51 A;  4MN0 A;  3JVT C;  1M63 B;  1IQ3 A;  1Y6W A;  2M1U A;  2MLF C;  1XFV O;  3O4Y A;  3D75 A;  2M29 A;  2D8N A;  5DKR A;  3I5I C;  1QVI Y;  5HL1 A;  1W9Z A;  4N1G A;  4AOM A;  1XK4 A;  1IG5 A;  3R1O A;  3R1P A;  1QLS A;  1TOP A;  1QAS A;  1DGV A;  3NSI A;  2OPO A;  4OCI A;  1WRZ A;  1B1G A;  2LM5 A;  1S3P A;  1TIZ A;  2LNK A;  1A75 B;  1XYD A;  2ZRT A;  3I5I B;  3PAL A;  2SAS A;  3PM2 A;  1J7Q A;  2K8M B;  2JC2 A;  3C1V A;  3CZ1 A;  1XFR A;  2EGD A;  4YI9 A;  1DMO A;  1PK0 D;  2FJY A;  1Y1A A;  2PVB A;  2QEO A;  1TUJ A;  2PAS A;  2LLU A;  3MSE B;  5J3X A;  1IKU A;  1NUB A;  2LVV A;  2BE4 A;  4NDB A;  2WCL A;  5JOL A;  3SS3 A;  1UHN A;  1CDP A;  3AKA A;  3E3R A;  4OZD A;  3RLZ A;  1TRF A;  2NCO A;  2HQW A;  1IIO A;  3SG7 A;  1KFU L;  1SNL A;  2F2P A;  3OX5 A;  1YTZ C;  5HLV A;  1LXF C;  1RWY A;  2SCP A;  1B7T Z;  3D78 A;  3PN7 C;  4MBE A;  3CAB A;  2WOR A;  3ICB A;  3S0G A;  2I2R E;  1QWV A;  1N65 A;  1SBJ A;  1F4Q A;  1K93 D;  1DQE A;  1NX3 A;  2KLE A;  3PJI A;  2EC6 C;  2M49 B;  1U5I A;  4HSZ A;  1MQ1 A;  3EK8 A;  2E6W A;  1XFW O;  3OB1 B;  1SL9 A;  2LC5 A;  2NLN A;  3DD4 A;  3K21 A;  3BUN B;  4MSP A;  1JBA A;  1Y1X A;  1NCX A;  1KK8 C;  1VRK A;  1XK4 C;  3QRX A;  3ZWH A;  3JTD B;  2EHB A;  1MXL C;  3SG4 A;  5KSZ A;  1BU3 A;  1OZO A;  2EC6 B;  2CBL A;  4PE1 A;  3VRP A;  2KI6 C;  3KF9 A;  1L7Z A;  2JWW A;  2HET A;  2JZI A;  1V1G A;  2NZ0 A;  1SSE B;  2HQ8 A;  2K0J A;  2JOJ A;  1KK8 B;  2H2K A;  4PE7 A;  1DJI A;  1XA5 A;  4IL1 A;  4AQJ A;  1PAL A;  2K7D A;  2BL0 C;  1J7O A;  2KAX A;  2LHL A;  3V2L A;  1X02 A;  1QLK A;  3B6X A;  2L5Y A;  2BBN A;  2KQ6 A;  4AQI A;  3NSL A;  1SKT A;  2ZN9 A;  4GAO A;  5AXI A;  2LVK A;  3B7A A;  4CFQ A;  4BY5 A;  4P5O E;  2LAP A;  2BAP A;  3IQQ A;  2BL0 B;  1OE9 B;  2GGZ A;  1MR8 A;  1PSB A;  1Z2C B;  3BOW B;  3SG5 A;  1B8R A;  1TCF A;  3CLN A;  3I5H C;  3S0B A;  4NQG A;  1DJG A;  4I5J A;  1AUI B;  4PE4 A;  2MLE C;  2CCM A;  1C3Z A;  1SK6 D;  4MRY A;  2LP3 A;  2QEV A;  2JT3 A;  4ORA B;  1WRL A;  4F0Z B;  3QME A;  3I5H B;  2ZN8 A;  1L2O C;  3PAT A;  1NX1 A;  2ZFD A;  1NCZ A;  2KDH A;  3H4S E;  3DVJ A;  1CFP A;  1PVB A;  1EXR A;  2I94 A;  2V53 A;  1XO5 A;  1U5I B;  1TTX A;  1R6P A;  2GGM A;  4PHK A;  1J7P A;  2CTN A;  4XJK A;  5D3O A;  5GQQ C;  2ZND A;  3NGV A;  3TS5 C;  1KK7 Z;  2JXC A;  5FI6 A;  1S6J A;  1V1F A;  1L2O B;  2JU0 A;  2LCP A;  4QJ3 B;  3FS7 A;  1GQM A;  2QPT A;  4ZCV A;  2JTZ A;  2I7A A;  4Q04 A;  1KSM A;  2KYF A;  1GGW A;  3N7H A;  1G8I A;  3GK1 A;  4GUK A;  3TS5 B;  2BE6 A;  3D10 A;  2AMI A;  1DEL A;  1CM1 A;  3BQ3 A;  2M9G A;  3LLE A;  2LLT A;  3O78 A;  4WQ2 A;  1CMG A;  1WLZ A;  1LIN A;  1QIW A;  2I18 A;  2L50 A;  1J1E A;  3DY9 A;  4JQ0 D;  1T14 A;  3WNX B;  1B4C A;  3IF7 A;  4HRH A;  4A4C A;  2WC5 A;  5I2O A;  3S0D A;  1AK8 A;  4FQT A;  4MZL A;  4YI8 A;  3NSO A;  3TUY C;  1UWO A;  4HRE E;  1C07 A;  1SL8 A;  1FF1 A;  4MEW A;  1MXE A;  1TNX A;  1DT7 B;  1RFJ A;  3HX4 A;  2NCP A;  2A4J A;  2JQ6 A;  2ZKM X;  3EK7 A;  3RM1 A;  1AVS A;  1W7J B;  1B8L A;  2M3W A;  1K95 A;  2LE9 B;  2L4I A;  1DF0 A;  1SCM C;  1G33 A;  3DF0 B;  3TDI A;  1BLQ A;  1K9U A;  3D77 A;  3TZ1 A;  3BXK A;  1DJX A;  5I8N A;  1F70 A;  2B1U A;  1KFX L;  4USL A;  2BCB A;  1OZS A;  2PAL A;  3L47 A;  2Y1M A;  2JUL A;  3O4X A;  3VB1 A;  2QEH A;  2PSR A;  2PMY A;  1AJ4 A;  1G4Y R;  1RK9 A;  1SCM B;  2BCA A;  2WCF A;  4CFR A;  2ZNE A;  1QIV A;  1JF0 A;  1YVL A;  2K61 A;  3NHI A;  3EKH A;  4XJK B;  4N5X A;  4ETO A;  1QV1 A;  5I2L A;  1BR1 B;  4UPG A;  5DIC A;  1CM4 A;  3EVR A;  1DEK A;  3DXL A;  1KQM C;  1UHI A;  1QX7 A;  1AP4 A;  2ZRS A;  3UNW A;  3SIA A;  1Y0V H;  2KBI A;  1YVH A;  3EVU A;  3BOW A;  3L4L A;  4PHN A;  1PSR A;  3B88 A;  1KQM B;  2BBM A;  3AAK A;  1S26 D;  2JXL A;  1F8H A;  3A8R A;  4QJ5 B;  3SJS A;  1CLM A;  3PM8 A;  5CSF A;  1D1O A;  4DUQ A;  2MHH A;  5FYX A;  3VRQ A;  4OVN F;  1F54 A;  1B9A A;  2K60 A;  2CXJ A;  1FI5 A;  1UUR A;  3JTD C;  3VGO A;  3PLF B;  3WHT B;  3FE9 A;  1QX5 B;  1SRA A;  1FBV A;  2MRD A;  5F6T A;  3SIB A;  2JNF A;  3A4U B;  1YRU B;  4MZK A;  1BMO A;  1DF0 B;  2WC8 A;  4FTG A;  5CSJ A;  3CYZ A;  1SY9 A;  1DVI A;  1CTR A;  1S6C A;  3S0E A;  1JF2 A;  3BUM B;  2QEB A;  1N2D A;  4YRU A;  1QS7 A;  1CLB A;  3IQO A;  1RJV A;  1RRO A;  4N1F A;  4OV2 A;  3CZT X;  2JT8 A;  3GOF A;  5I2Q A;  3SG3 A;  2M0R A;  3DZT A;  1EG4 A;  1XFZ O;  3KHE A;  1K9K A;  5DKN A;  1M46 A;  2K7B A;  4F7F A;  2M1K B;  2QAC A;  3GK2 A;  4M2Q A;  1WRK A;  4MVF A;  1MHO A;  3I5G B;  4C0K A;  1NCY A;  1IQ5 A;  1CB1 A;  1GGZ A;  4IJ7 A;  1F55 A;  3DVM A;  4INX A;  1GM0 A;  3PSR A;  2KI4 B;  2WCE A;  5D7F A;  2L0P A;  1IWQ A;  3TDZ A;  3Q8I A;  1B47 A;  1QX2 A;  4U8D A;  1LA3 A;  4PE0 A;  3CZ0 A;  1DJZ A;  2P71 A;  3O2P A;  1BOD A;  3CDN A;  1OOF A;  4ORC B;  1K96 A;  3TDU A;  3DF0 A;  3S0F A;  1S36 A;  1MWN A;  1PVA A;  4OKH A;  4R1E A;  1R2U A;  2WCH A;  3CR4 X;  2JPO A;  2KHN A;  2BKH B;  3CS1 A;  2FCE A;  1TWO A;  2LVJ A;  3IVT A;  2F2O A;  1BOC A;  5ER4 X;  2KQY A;  2KYC A;  4M2O A;  4A4B A;  1K8U A;  1RTP 1;  2KSP A;  1QXP A;  3FWC A;  3S0A A;  2KFG A;  1NX0 A;  1CFC A;  4YGC B;  2LP2 A;  2WCJ A;  2Y4Q A;  1M31 A;  1YX7 A;  1GJY A;  2CNP A;  4JPZ B;  5FI2 A;  1LA0 A;  2F8P A;  3B87 A;  2CT9 A;  4C0J A;  2JRF A;  1E8A A;  3WHU B;  4DRW A;  1WDC C;  3AKB A;  1S6I A;  1OMV A;  1ZMZ A;  4MRX A;  1JWD A;  1K94 A;  1YX8 A;  1YRT B;  2LUX A;  4WRI A;  2L5X B;  5B8I B;  1OMD A;  5I94 A;  4ICB A;  1OQP A;  1K90 D;  3CR5 X;  2TN4 A;  1F4O A;  1ORG A;  3CZ2 A;  3R72 A;  1CDM A;  4MZJ A;  2H8V A;  2L2E A;  1WLM A;  1WDC B;  1H4B A;  3VRO A;  2BCX A;  2HF5 A;  1KWO B;  1S5G Y;  2KPH A;  5IBW A;  1BJF A;  3CR2 A; 
#chains in the Genus database with same CATH homology
 1QVI Z;  3BUW B;  1TNQ A;  3BYA A;  3LCP C;  2LMU A;  2MBX A;  1YUS A;  2KAY A;  1CLL A;  5TNC A;  1SMG A;  2KFF A;  3I5F B;  1SL7 A;  4HRG A;  1MF8 B;  1JFK A;  1N0Y A;  1UHJ A;  2JPT A;  2K7C A;  3VRN A;  2WCB A;  1ALW A;  4I5N B;  5CSI A;  5CPV A;  3CGA A;  1CDN A;  1NX2 A;  1SW8 A;  2F3Z A;  1QAT A;  1M39 A;  1TNP A;  3CTN A;  3NSK A;  4P2Y B;  4QJ4 B;  2LUC A;  1NYA A;  1ODB A;  1Y1U A;  4ZCU A;  5HKW A;  3DVE A;  1UHH A;  4E68 A;  4GPL B;  1ZUZ A;  1HQV A;  1QV0 A;  1XFX O;  3EK4 A;  4GBA A;  1XFU O;  1ZFS A;  1K9P A;  2JT0 A;  4BY4 A;  2HPS A;  2LVI A;  1AJ5 A;  1SYM A;  2OS8 B;  4TNC A;  2AAO A;  1DJH A;  4PAL A;  2M7N A;  2L4H A;  2LAN A;  4PDZ A;  1WY9 A;  1SR6 C;  2O60 A;  1CMF A;  2M97 A;  1Q80 A;  2DOQ A;  1CNP A;  2M7L A;  5ER5 A;  3FIA A;  2LLS A;  4PHM A;  4YGA A;  4DS7 A;  3ZNI A;  1SR6 B;  4DIR A;  3JVT B;  2OTG C;  4GGF A;  3WXA A;  2LMV A;  1JC2 A;  1IGV A;  1KSO A;  2F33 A;  2L98 A;  5G08 A;  1BOD A;  1QTX A;  1CDL A;  3D0Y B;  1FI5 A;  4YGD B;  1J55 A;  2MAZ A;  4L9M A;  5HYD A;  3OP0 A;  1MUX A;  1UUS A;  2OTG B;  4C0L A;  1YUU A;  4GFT A;  1KFU S;  2WND A;  1BR4 B;  1DGU A;  4I5L B;  2GV5 A;  1A03 A;  1NWD A;  1W7I B;  3M0W A;  2BEC A;  3I5G C;  2FOT A;  1YUR A;  2KI6 D;  2G9B A;  4ORB B;  1KQV A;  1S1E A;  2KI4 C;  3OHM B;  3LK1 A;  2BKI B;  2P6B B;  1EG3 A;  1EH2 A;  4GGN A;  3LK0 A;  3LL8 B;  4YGB B;  1SCV A;  4GNK B;  4PHJ A;  3PN7 B;  1FW4 A;  1TNW A;  4NDC A;  2LHI A;  5PAL A;  2MA2 A;  1C7W A;  4CPV A;  4GGF C;  1ZOT B;  2FCD A;  1IRJ A;  3KEV A;  1BG1 A;  4MLW A;  1EL4 A;  1IJ5 A;  2O5G A;  1JUO A;  1B7T Y;  1QJT A;  1EJ3 A;  1UP5 A;  2Y1N A;  2H61 A;  4CID A;  2G2B A;  1J7R A;  1BT6 A;  1CFD A;  3O6B A;  5CSN A;  5KTY A;  1F71 A;  5AFP A;  1BF5 A;  1NPQ A;  2FJU B;  2R2I A;  5AER A;  5KU1 A;  1JSA A;  2VRG A;  2ISD A;  4D1E A;  1S5G Z;  3OX6 A;  1IH0 A;  1DJY A;  3CWG A;  4YGE B;  1M45 A;  2F3Y A;  2LMT A;  2KAV A;  1IJ6 A;  1A4P A;  1YR5 A;  2JTT A;  3F45 A;  1TN4 A;  2NXQ A;  1OMR A;  5BPJ A;  2AUC A;  5HLO A;  1DTL A;  2COL B;  1DJW A;  3HCM A;  5JJG A;  1KWO C;  1XVJ A;  2K2A A;  2JNX A;  1CKK A;  1XFY O;  2KBM A;  5AEQ A;  1JFJ A;  3AAJ A;  1FI6 A;  5HKZ A;  1HT9 A;  2LV7 A;  1ALV A;  5AAN A;  3I5F C;  5K89 A;  1H8B A;  3KO0 A;  1B8C A;  4DCK A;  4I5K A;  1FPW A;  4NDD A;  2Q4U A;  2Y5I A;  5D69 A;  3SG2 A;  1A29 A;  1NIW A;  1OSA A;  2KGR A;  3D0Y A;  1A75 A;  3DVK A;  1SPY A;  1A2X A;  2KGB C;  2RGI A;  1CFF A;  1PRW A;  2H61 C;  2MJW B;  1ZAC A;  1C7V A;  2KFH A;  1OOJ A;  2KOT A;  3SG6 A;  3VRR A;  1PUL A;  1KCY A;  2PRU A;  3NXA A;  2M8U A;  4YBH B;  1YUT A;  1UHK A;  3EKJ A;  1K2H A;  4OR9 B;  1REC A;  1J1D A;  2K2F A;  2E30 A;  3BUO B;  1NP8 A;  3PFV A;  4FQO A;  2Q91 A;  2WOS A;  5DKQ A;  2OS8 C;  4WQ3 A;  2K7O A;  4CLN A;  4M2P A;  1LVC D;  1KK7 Y;  3GK4 X;  1LKJ A;  1AHR A;  4JWQ A;  1NSH A;  3KPX A;  2KNE A;  1KFX S;  4PCW A;  3OB2 B;  3BUX B;  4XYN A;  2IS9 A;  3TUY B;  1TCO B;  3EVV A;  3FWB A;  2L51 A;  4MN0 A;  3JVT C;  1M63 B;  1IQ3 A;  1Y6W A;  2M1U A;  2MLF C;  1XFV O;  3O4Y A;  2M29 A;  2D8N A;  5DKR A;  3I5I C;  1QVI Y;  4N1G A;  4AOM A;  1XK4 A;  1IG5 A;  1QLS A;  1TOP A;  1QAS A;  1DGV A;  3NSI A;  2OPO A;  4OCI A;  1WRZ A;  1B1G A;  2LM5 A;  1S3P A;  1TIZ A;  2LNK A;  1A75 B;  1XYD A;  2ZRT A;  3I5I B;  3PAL A;  2SAS A;  1J7Q A;  2K8M B;  2JC2 A;  3C1V A;  1DMO A;  2EGD A;  4YI9 A;  1PK0 D;  1Y1A A;  2PVB A;  2PAS A;  2LLU A;  3MSE B;  5J3X A;  1IKU A;  1NUB A;  2LVV A;  2BE4 A;  4NDB A;  5JOL A;  1UHN A;  1CDP A;  3AKA A;  3E3R A;  3RLZ A;  1TRF A;  2NCO A;  2HQW A;  3SG7 A;  1KFU L;  1SNL A;  2F2P A;  3OX5 A;  1YTZ C;  5HLV A;  1LXF C;  1RWY A;  2SCP A;  1B7T Z;  3PN7 C;  4MBE A;  2WOR A;  3ICB A;  2I2R E;  1N65 A;  1SBJ A;  1F4Q A;  1K93 D;  4HSZ A;  1NX3 A;  2EC6 C;  2M49 B;  1U5I A;  1MQ1 A;  3EK8 A;  2E6W A;  1XFW O;  3OB1 B;  1SL9 A;  2LC5 A;  2NLN A;  3DD4 A;  3K21 A;  3BUN B;  4MSP A;  1JBA A;  1Y1X A;  1NCX A;  1KK8 C;  1VRK A;  1XK4 C;  3QRX A;  3ZWH A;  3JTD B;  2EHB A;  1MXL C;  3SG4 A;  5KSZ A;  1BU3 A;  1OZO A;  2EC6 B;  2CBL A;  4PE1 A;  3VRP A;  2KI6 C;  3KF9 A;  1L7Z A;  2JWW A;  2HET A;  2JZI A;  1V1G A;  2NZ0 A;  2HQ8 A;  2K0J A;  2JOJ A;  1KK8 B;  2H2K A;  4PE7 A;  1DJI A;  1XA5 A;  4IL1 A;  4AQJ A;  1PAL A;  2K7D A;  2BL0 C;  1J7O A;  2KAX A;  2LHL A;  1X02 A;  1QLK A;  2BBN A;  2KQ6 A;  4AQI A;  3NSL A;  1SKT A;  2ZN9 A;  4GAO A;  5AXI A;  2LVK A;  4CFQ A;  4BY5 A;  4P5O E;  2LAP A;  3IQQ A;  2BL0 B;  1OE9 B;  2GGZ A;  1MR8 A;  1PSB A;  3BOW B;  3SG5 A;  1B8R A;  1TCF A;  3CLN A;  3I5H C;  4NQG A;  1DJG A;  4I5J A;  1AUI B;  4PE4 A;  2MLE C;  2CCM A;  1SK6 D;  4MRY A;  2LP3 A;  2JT3 A;  4ORA B;  1WRL A;  4F0Z B;  3I5H B;  2ZN8 A;  1L2O C;  3PAT A;  1NX1 A;  2ZFD A;  1NCZ A;  2KDH A;  3H4S E;  3DVJ A;  1CFP A;  1PVB A;  1EXR A;  2I94 A;  2V53 A;  1XO5 A;  1U5I B;  1TTX A;  1R6P A;  2GGM A;  4PHK A;  1J7P A;  2CTN A;  4XJK A;  5GQQ C;  2ZND A;  3TS5 C;  1KK7 Z;  2JXC A;  1S6J A;  1V1F A;  1L2O B;  2JU0 A;  2LCP A;  4QJ3 B;  3FS7 A;  1GQM A;  2QPT A;  4ZCV A;  2JTZ A;  2I7A A;  4Q04 A;  1KSM A;  2KYF A;  1GGW A;  1G8I A;  3GK1 A;  4GUK A;  3TS5 B;  2BE6 A;  3D10 A;  2AMI A;  1CM1 A;  3BQ3 A;  2M9G A;  3LLE A;  2LLT A;  3O78 A;  4WQ2 A;  1CMG A;  1WLZ A;  1LIN A;  1QIW A;  2I18 A;  2L50 A;  1J1E A;  1B4C A;  4JQ0 D;  3WNX B;  3IF7 A;  4HRH A;  4A4C A;  5I2O A;  1AK8 A;  4MZL A;  4YI8 A;  3NSO A;  3TUY C;  1UWO A;  4HRE E;  1C07 A;  1SL8 A;  1FF1 A;  4MEW A;  1MXE A;  1TNX A;  1DT7 B;  1RFJ A;  3HX4 A;  2NCP A;  2A4J A;  2JQ6 A;  2ZKM X;  3EK7 A;  3RM1 A;  1AVS A;  1W7J B;  1B8L A;  2M3W A;  1K95 A;  2LE9 B;  2L4I A;  1DF0 A;  1SCM C;  1G33 A;  3DF0 B;  3TDI A;  1BLQ A;  1K9U A;  3TZ1 A;  3BXK A;  1DJX A;  5I8N A;  1F70 A;  2B1U A;  1KFX L;  4USL A;  2BCB A;  1OZS A;  2PAL A;  2Y1M A;  2JUL A;  2PSR A;  2PMY A;  1AJ4 A;  1G4Y R;  1RK9 A;  1SCM B;  2BCA A;  2WCF A;  4CFR A;  2ZNE A;  1QIV A;  1JF0 A;  1YVL A;  2K61 A;  3EKH A;  4XJK B;  4N5X A;  4ETO A;  1QV1 A;  5I2L A;  1BR1 B;  4UPG A;  1CM4 A;  3EVR A;  1KQM C;  1UHI A;  1QX7 A;  1AP4 A;  2ZRS A;  3SIA A;  1Y0V H;  2KBI A;  1YVH A;  3EVU A;  3BOW A;  4PHN A;  1PSR A;  1KQM B;  2BBM A;  3AAK A;  1S26 D;  2JXL A;  1F8H A;  3A8R A;  4QJ5 B;  3SJS A;  1CLM A;  3PM8 A;  5CSF A;  1D1O A;  4DUQ A;  2MHH A;  5FYX A;  3VRQ A;  4OVN F;  1F54 A;  1B9A A;  2CXJ A;  1UUR A;  3JTD C;  3VGO A;  3PLF B;  3WHT B;  1QX5 B;  1SRA A;  1FBV A;  2MRD A;  5F6T A;  3SIB A;  2JNF A;  3A4U B;  1YRU B;  4MZK A;  1BMO A;  1DF0 B;  2WC8 A;  4FTG A;  5CSJ A;  1SY9 A;  1DVI A;  1CTR A;  1S6C A;  1JF2 A;  3BUM B;  1N2D A;  4YRU A;  1QS7 A;  1CLB A;  3IQO A;  1RJV A;  1RRO A;  4N1F A;  4OV2 A;  3CZT X;  2JT8 A;  3GOF A;  5I2Q A;  3SG3 A;  2M0R A;  1EG4 A;  1XFZ O;  3KHE A;  1K9K A;  5DKN A;  1M46 A;  2K7B A;  2M1K B;  2QAC A;  3GK2 A;  4M2Q A;  1WRK A;  4MVF A;  1MHO A;  3I5G B;  4C0K A;  1NCY A;  1IQ5 A;  1CB1 A;  1GGZ A;  1F55 A;  3DVM A;  3PSR A;  2KI4 B;  2WCE A;  5D7F A;  2L0P A;  1IWQ A;  3TDZ A;  1B47 A;  1QX2 A;  4U8D A;  1LA3 A;  4PE0 A;  1DJZ A;  3O2P A;  4ORC B;  1K96 A;  3TDU A;  3DF0 A;  1S36 A;  1MWN A;  1PVA A;  4OKH A;  4R1E A;  1R2U A;  3CR4 X;  2KHN A;  2BKH B;  3CS1 A;  2FCE A;  2LVJ A;  2F2O A;  1BOC A;  5ER4 X;  2KQY A;  2KYC A;  4M2O A;  4A4B A;  1K8U A;  1RTP 1;  2KSP A;  1QXP A;  3FWC A;  2KFG A;  1NX0 A;  1CFC A;  4YGC B;  2LP2 A;  2Y4Q A;  1M31 A;  1YX7 A;  1GJY A;  2CNP A;  4JPZ B;  4C0J A;  1LA0 A;  2F8P A;  5HKY A;  2CT9 A;  2JRF A;  1E8A A;  3WHU B;  4DRW A;  1WDC C;  3AKB A;  1S6I A;  1OMV A;  1ZMZ A;  4MRX A;  1JWD A;  1K94 A;  1YX8 A;  1YRT B;  2LUX A;  4WRI A;  2L5X B;  5B8I B;  1OMD A;  4ICB A;  1OQP A;  1K90 D;  3CR5 X;  2TN4 A;  1F4O A;  1CDM A;  4MZJ A;  2L2E A;  1WLM A;  1WDC B;  1H4B A;  3VRO A;  2BCX A;  2HF5 A;  1KWO B;  1S5G Y;  5IBW A;  1BJF A;  3CR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...