1AHRA

Calmodulin mutant with a two residue deletion in the central helix
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ahrA00
1A75A 1YX8A 5JJGA 4C0JA 1FF1A 3GOFA 5CSFA 1WLMA 1IGVA 4ZCUA 1A75B 2WORA 1WY9A 1JF0A 2KQ6A 4OCIA 2BE6A 1C07A 1OQPA 2L0PA 1NYAA 3PM8A 4QJ5B 5HKWA 4HSZA 2VRGA 2HQWA 3AAKA 2M49B 2ZN8A 3JTDC 4F0ZB 3LK0A 1B7TZ 3GK2A 4MZKA 1V1GA 1YVHA 2JNXA 1ALVA 4PE4A 2GV5A 1YTZC 2HF5A 1H4BA 4MRYA 1KWOC 3RLZA 3OHMB 2BE4A 2NCOA 1W7IB 1S26D 1PK0D 2OTGB 5D69A 5AEQA 1DGUA 2KFFA 1TN4A 2M1UA 1L2OC 2LP2A 3O6BA 1OMDA 3CWGA 1EG4A 1NPQA 2K2AA 3PATA 4M2PA 2F2OA 2JU0A 4DUQA 1XVJA 3PALA 1CFCA 4ORBB 4QJ4B 2I7AA 3EK7A 1NCYA 2LV7A 1MHOA 1J1EA 1J7OA 4GGNA 4YBHB 1EJ3A 2IS9A 4C0KA 1WRLA 4AQIA 1PULA 2BCAA 3KEVA 5HLOA 4HRGA 1PALA 1JWDA 1K9PA 1YRUB 1PRWA 2LNKA 2HQ8A 1NX0A 1YUTA 2MBXA 4U8DA 1F70A 3NSOA 5ER4X 3VROA 1ALWA 3PSRA 1QXPA 4PE0A 1F4QA 1SKTA 2ISDA 3SG3A 3FWBA 2PASA 2CNPA 2KGBC 5F6TA 4D1EA 3CGAA 3DVJA 1NSHA 1HQVA 1QV0A 5DKRA 1TRFA 2KHNA 3PFVA 1WDCC 2AMIA 3I5IB 3SG4A 5KSZA 1FI5A 3DD4A 3TUYC 1KK8C 2FOTA 2KYFA 4HREE 4M2OA 3TDZA 3EVRA 1QJTA 2KDHA 1SR6C 1TNPA 1UP5A 2K7BA 2KI4B 2Y4QA 3CR2A 1S36A 1S5GY 1GGWA 4A4CA 1SBJA 1BODA 1RFJA 4P5OE 1AUIB 2KAXA 1OSAA 1KCYA 4PALA 2Y1MA 1SMGA 2KAYA 3EK8A 2LAPA 3A4UB 2LUCA 1BT6A 2WNDA 4HRHA 1IJ5A 2ZFDA 2LP3A 1J7RA 2FCEA 3LK1A 3NXAA 2LE9B 2F8PA 3WHUB 1UURA 2MRDA 3CTNA 3OB1B 3SG5A 2EC6C 2PVBA 3O2PA 1CTRA 5I2QA 3CS1A 4BY5A 3O4YA 4GGFC 1LA0A 1AHRA 2RGIA 1NWDA 2BECA 4MZJA 1DJXA 1JFJA 2LC5A 1XK4A 2D8NA 1ZUZA 3CR5X 4I5NB 1RJVA 1Y0VH 4AQJA 3SIAA 1SL8A 3KF9A 1S5GZ 2LANA 2JT0A 1GGZA 3DVKA 1DJWA 2H61C 3E3RA 1QASA 5PALA 1KSMA 2LVIA 1TTXA 2LHLA 3GK1A 2LVJA 1CLBA 1A29A 3SG7A 1QLSA 1UWOA 1OZOA 2G2BA 4YI9A 2ZN9A 2L98A 2LUXA 1MQ1A 1PVBA 1UHJA 5HYDA 1NCZA 3BUMB 4PCWA 2MA2A 3JTDB 2JZIA 2MAZA 1QX5B 4DCKA 4PHKA 5DKQA 2WOSA 1DTLA 2NXQA 1G8IA 2GGZA 4CIDA 1XFUO 1FBVA 1KWOB 2B1UA 2K7DA 3KHEA 4XJKA 3LCPC 1UHNA 1BMOA 1M46A 3TS5C 1L2OB 1AJ5A 4XJKB 1DVIA 1DGVA 1EH2A 4USLA 1SYMA 3DF0A 4AOMA 5HKYA 3FIAA 2JXCA 1C7VA 4NDDA 5I8NA 4GPLB 5GQQC 1OZSA 1B47A 2JULA 3DF0B 2JC2A 1CMFA 3DVMA 2KYCA 1ODBA 2PMYA 3BQ3A 2BL0C 1B8RA 1M63B 2BKHB 3AKAA 1MUXA 4DRWA 4MSPA 1S6IA 2ZRSA 2KQYA 1RK9A 2F33A 2ZKMX 1EL4A 4NDCA 1SCMC 4MN0A 3LLEA 1K93D 1B8LA 1QS7A 1RROA 3KO0A 3NSLA 1K95A 2WCFA 3I5FC 3O78A 5I2OA 3NSKA 4FTGA 4YGCB 2BBMA 2BCXA 3BUOB 3EK4A 4MLWA 1S6CA 2P6BB 2KBIA 3K21A 2LHIA 1WDCB 2LM5A 5IBWA 2Y1NA 1JFKA 2CTNA 3TUYB 2JT3A 1KK8B 2K7OA 2KAVA 2V53A 4L9MA 1SR6B 1M39A 4ICBA 4ETOA 2KI6D 4YGAA 1LINA 1L7ZA 1B9AA 2LVVA 3QRXA 3I5GC 1TNQA 1NCXA 1N65A 4N1GA 2HETA 1CDNA 1ZOTB 2AUCA 2JTTA 3ZWHA 1MXEA 4OV2A 1CKKA 1ZACA 2A4JA 1OOJA 3GK4X 1MXLC 2SASA 1QX2A 2WCEA 1K94A 5DKNA 1XYDA 2K0JA 1EXRA 2G9BA 5G08A 1AK8A 2M1KB 2LMTA 3LL8B 4GGFA 2BKIB 2EC6B 2WC8A 3SG6A 5K89A 1G33A 2M3WA 4UPGA 4M2QA 3PLFB 2JNFA 4BY4A 1Q80A 2CT9A 2JOJA 4N5XA 3OX6A 1R6PA 1UUSA 2F3ZA 1BLQA 1BOCA 1QVIY 4TNCA 1M45A 1A4PA 3WHTB 1KFXL 1NUBA 2PSRA 1WRKA 1JBAA 3VRPA 1SRAA 1A03A 2EGDA 2WCBA 3CLNA 4MBEA 4N1FA 4OR9B 1KSOA 1S6JA 1IH0A 2MJWB 1YVLA 1V1FA 3M0WA 2GGMA 1OE9B 2JT8A 2I94A 2QACA 3I5HC 5ER5A 1WRZA 1TCFA 4GFTA 2CXJA 1XFWO 2BCBA 1XFYO 1SL9A 3ZNIA 1IWQA 1QV1A 1DMOA 1RTP1 3FS7A 1K90D 1S1EA 2MLEC 1OMVA 1JC2A 4YGEB 1B1GA 2CBLA 1BF5A 4FQOA 5D7FA 3DVEA 2KGRA 1MWNA 4PE1A 1QVIZ 5KTYA 1NX3A 2LMVA 3VRNA 1W7JB 1AJ4A 1ZFSA 3IQOA 1DJHA 2OS8C 4CFRA 1JSAA 3TS5B 1CM1A 1U5IA 1YURA 1PSRA 1YRTB 1CDMA 1QATA 2O60A 5TNCA 5J3XA 2K61A 2DOQA 1CFFA 5AANA 1G4YR 5KU1A 1LKJA 1FW4A 1U5IB 2PALA 1XA5A 5AXIA 1LVCD 4MZLA 1KFXS 3RM1A 3TDIA 3IQQA 5AERA 1B4CA 3SG2A 2CCMA 1DJZA 1IG5A 2BL0B 4MEWA 4OVNF 1J55A 4CLNA 2OPOA 1OMRA 2LMUA 1E8AA 1SCMB 1YUUA 2KFGA 1YX7A 1LA3A 1GQMA 2R2IA 1F54A 4DS7A 3I5FB 5I2LA 1FPWA 3WXAA 3JVTC 3OB2B 2TN4A 3SJSA 2JWWA 4JWQA 4ORAB 1XFZO 1K8UA 2M8UA 2L2EA 4YGBB 2JPTA 3EKJA 1KFUL 4QJ3B 4PDZA 3TDUA 1SPYA 2K8MB 1DJYA 2M7NA 2NCPA 5AFPA 1UHHA 4PHMA 4P2YB 3A8RA 3EVVA 3OP0A 1IRJA 1CDLA 1TIZA 2F2PA 4DIRA 2ZNDA 1KQVA 2LCPA 3I5GB 2AAOA 4PHJA 2I18A 1J7PA 1Y1UA 1PSBA 2KBMA 4YGDB 1KQMC 4WQ2A 1KK7Z 2NZ0A 1BU3A 2KSPA 1A2XA 1CFDA 1C7WA 2ZNEA 1F55A 1CDPA 2JQ6A 1SY9A 1IQ5A 2M97A 3PN7C 2JTZA 5CSJA 1YR5A 2NLNA 1H8BA 1NX2A 1DJIA 2KFHA 1UHIA 1BR1B 2EHBA 2BBNA 1CLLA 3VRQA 2PRUA 5B8IB 1KFUS 1R2UA 1TCOB 1XFXO 1ZMZA 2K2FA 4MVFA 4WQ3A 2H2KA 4PHNA 4C0LA 1CMGA 2QPTA 1QLKA 3D0YA 3MSEB 3AKBA 3I5HB 3EKHA 2F3YA 1NX1A 2MLFC 1QTXA 1CNPA 4WRIA 2LLSA 1RECA 3D0YB 3WNXB 2L5XB 1BG1A 3BYAA 2L51A 2L50A 4IL1A 2JRFA 4PE7A 1Y6WA 3H4SE 2OTGC 4XYNA 1DT7B 1AP4A 1Y1AA 4NDBA 2H61A 2M7LA 1TOPA 2E6WA 1DJGA 3EVUA 4CPVA 1F8HA 4GAOA 1F4OA 4GUKA 2KI6C 2Y5IA 3F45A 1SL7A 1WLZA 2FJUB 3BXKA 4OKHA 1EG3A 1X02A 2OS8B 1GJYA 2SCPA 3NSIA 3ICBA 4I5JA 5CSNA 5CPVA 5BPJA 2LLUA 1HT9A 2M29A 3HX4A 3VRRA 4YRUA 4I5KA 1SNLA 2L4HA 2JXLA 4GBAA 3OX5A 3AAJA 1J1DA 3BUNB 1K96A 3CZTX 1CM4A 2COLB 2FCDA 2Q4UA 1RWYA 1BJFA 3IF7A 3I5IC 1S3PA 3C1VA 4NQGA 4YI8A 4Q04A 1NIWA 1QIWA 2E30A 3HCMA 2KI4C 4JQ0D 4E68A 1DF0A 3JVTB 3VGOA 2K7CA 1IJ6A 1N2DA 1LXFC 3CR4X 5JOLA 2LLTA 1JUOA 1DF0B 1SCVA 1MF8B 2M0RA 1D1OA 2ZRTA 4GNKB 1Y1XA 4ORCB 1FI6A 2KNEA 3BOWA 1J7QA 4R1EA 5HLVA 1QX7A 1QIVA 1PVAA 3BOWB 1VRKA 2KOTA 3BUXB 1AVSA 4CFQA 1NP8A 1XO5A 1K9UA 1CFPA 1KK7Y 1TNWA 3TZ1A 2L4IA 1IQ3A 1SK6D 4MRXA 4JPZB 2Q91A 2O5GA 1K2HA 1B7TY 5CSIA 4ZCVA 4I5LB 1KQMB 1BR4B 2HPSA 1YUSA 5FYXA 3KPXA 1MR8A 1JF2A 2LVKA 1CB1A 1N0YA 1SW8A 3FWCA 1TNXA 1F71A 1UHKA 2MHHA 3D10A 4A4BA 1XK4C 2I2RE 1B8CA 3PN7B 1XFVO 2M9GA 3BUWB 1IKUA 3SIBA 1K9KA 1CLMA 5HKZA 1M31A
chains in the Genus database with same CATH superfamily
1A75A 1YX8A 5JJGA 4C0JA 1FF1A 2QEVA 3GOFA 5CSFA 1WLMA 1IGVA 4ZCUA 1A75B 2QEHA 2WORA 1WY9A 1JF0A 2KQ6A 4OCIA 2BE6A 1C07A 1OQPA 2L0PA 1NYAA 3PM8A 4QJ5B 5HKWA 3R1VA 3CZ1A 4HSZA 2VRGA 2HQWA 3AAKA 2M49B 2ZN8A 3JTDC 4F0ZB 3LK0A 1B7TZ 3GK2A 4MZKA 1V1GA 1YVHA 2JNXA 1ALVA 4PE4A 2GV5A 1YTZC 1OW4A 2HF5A 1H4BA 4MRYA 1KWOC 3RLZA 3OHMB 2PQLA 2BE4A 2NCOA 1W7IB 1S26D 1PK0D 2OTGB 5D69A 5AEQA 1DGUA 2KFFA 1TN4A 2M1UA 1L2OC 4OZDA 2LP2A 3O6BA 1OMDA 3CWGA 1EG4A 1NPQA 2K2AA 3PATA 4M2PA 3B7AA 2F2OA 2JU0A 3FE9A 4DUQA 1XVJA 3NHIA 3PALA 1CFCA 4ORBB 4QJ4B 2I7AA 3EK7A 1NCYA 2LV7A 1MHOA 1J1EA 1J7OA 4GGNA 4YBHB 1EJ3A 2IS9A 4C0KA 1WRLA 4AQIA 1PULA 2BCAA 3KEVA 5HLOA 3R1OA 4HRGA 1PALA 1JWDA 1K9PA 1YRUB 2YGUA 1PRWA 2LNKA 2HQ8A 1NX0A 1YUTA 2MBXA 4U8DA 3S0DA 5I94A 1F70A 1GM0A 3NSOA 5ER4X 1IIOA 3VROA 1ALWA 3PSRA 1QXPA 4PE0A 1F4QA 1SKTA 2ISDA 1P28A 3FWBA 2PASA 2CNPA 2KGBC 3SG3A 5F6TA 4D1EA 3CGAA 3DVJA 1NSHA 1HQVA 1QV0A 5DKRA 1TRFA 2KHNA 3PFVA 1WDCC 2AMIA 3I5IB 3SG4A 5KSZA 1FI5A 3DD4A 3TUYC 1KK8C 2FOTA 2KYFA 4HREE 4M2OA 3TDZA 3EVRA 1QJTA 2KDHA 1SR6C 1TNPA 1UP5A 2K7BA 2KI4B 2Y4QA 3CR2A 3B6XA 1S36A 1S5GY 1GGWA 4A4CA 1SBJA 5FI2A 4F7FA 1RFJA 1BODA 1DQEA 1Z4HA 1AUIB 4P5OE 2KAXA 1OSAA 1KCYA 4PALA 2Y1MA 1SMGA 2KAYA 3EK8A 2LAPA 3A4UB 2LUCA 1BT6A 2WNDA 4HRHA 1IJ5A 2ZFDA 2LP3A 1J7RA 2FCEA 3LK1A 3NXAA 2LE9B 2F8PA 2K60A 1UURA 3UNWA 3WHUB 2MRDA 3CTNA 3OB1B 3SG5A 2EC6C 2PVBA 3O2PA 1CTRA 2BAPA 5I2QA 3CS1A 4BY5A 3O4YA 4GGFC 1LA0A 1AHRA 2RGIA 2P71A 1NWDA 2BECA 4MZJA 1DJXA 2L5YA 1JFJA 2LC5A 1XK4A 2D8NA 3NGVA 1ZUZA 3CR5X 4I5NB 1RJVA 1Y0VH 4AQJA 3SIAA 1SL8A 3KF9A 3DY9A 1S5GZ 2LANA 2JT0A 1GGZA 3DVKA 1DJWA 2H61C 3E3RA 1QASA 5PALA 1KSMA 2LVIA 3DZTA 1TTXA 2LHLA 3GK1A 2LVJA 4INXA 1A29A 2BNXA 3SG7A 1CLBA 1QLSA 1UWOA 1OZOA 2G2BA 4YI9A 2ZN9A 5HL1A 2L98A 2LUXA 1MQ1A 3IVTA 1PVBA 1UHJA 5HYDA 1NCZA 3BUMB 4PCWA 3UO9A 2MA2A 3JTDB 2JZIA 2MAZA 1QX5B 4DCKA 4PHKA 5FI7A 2QDIA 3CDNA 5DKQA 2WOSA 1DTLA 2NXQA 1G8IA 2GGZA 3S0EA 4CIDA 1XFUO 3PM2A 1FBVA 1KWOB 2B1UA 2K7DA 3KHEA 4JD9A 4XJKA 3LCPC 1UHNA 1BMOA 3R1PA 1M46A 3SS4A 3TS5C 1L2OB 1AJ5A 3CABA 4XJKB 1DVIA 1DGVA 1EH2A 4USLA 1SYMA 3DF0A 4AOMA 5HKYA 3S0AA 3FIAA 2JXCA 3OGNA 1C7VA 4NDDA 5I8NA 4GPLB 5GQQC 3CZ0A 1OZSA 1B47A 2JULA 3DF0B 2JC2A 1CMFA 3DVMA 2KYCA 1ODBA 2PMYA 3BQ3A 2BL0C 1B8RA 1M63B 2BKHB 2QEBA 1MUXA 2WC6A 3AKAA 4MSPA 4DRWA 1S6IA 2ZRSA 2KQYA 1RK9A 2F33A 2ZKMX 1EL4A 4NDCA 1SCMC 4MN0A 3LLEA 1K93D 1B8LA 1QS7A 1RROA 3KO0A 3NSLA 1K95A 2WCFA 3I5FC 2H8VA 3O78A 3NSKA 4FTGA 5I2OA 4YGCB 3S0FA 3B88A 2BBMA 2BCXA 3BUOB 3EK4A 4MLWA 1S6CA 2WC5A 3EG5B 2P6BB 2KBIA 3K21A 2LHIA 1WDCB 2LM5A 5IBWA 1DELA 1JFKA 2Y1NA 2CTNA 3TUYB 2JT3A 1KK8B 2K7OA 2KAVA 2V53A 4L9MA 1SR6B 1M39A 4ICBA 1QWVA 4ETOA 2KI6D 4YGAA 1LINA 1L7ZA 1B9AA 2LVVA 3QRXA 3I5GC 1TNQA 1NCXA 1N65A 4N1GA 2HETA 1CDNA 1ZOTB 2AUCA 2JTTA 3ZWHA 1MXEA 4OV2A 1CKKA 1ZACA 2A4JA 1OOJA 3GK4X 3SS5A 1MXLC 2SASA 1QX2A 2WCEA 1K94A 5DKNA 3S0GA 1XYDA 2K0JA 1EXRA 2G9BA 5G08A 1AK8A 2M1KB 2WCJA 2LMTA 3LL8B 4GGFA 2JPOA 1XFRA 2BKIB 2EC6B 2WC8A 3SG6A 5K89A 3BFAA 1G33A 1DEKA 3D77A 2M3WA 3BFHA 4UPGA 3D78A 4M2QA 3PLFB 2JNFA 4INWA 1Q80A 3SS3A 4BY4A 2PYQA 3L4AA 1ORGA 2CT9A 2JOJA 4N5XA 3OX6A 1R6PA 1UUSA 2F3ZA 1BLQA 1BOCA 1QVIY 4TNCA 1M45A 1A4PA 3WHTB 1KFXL 1NUBA 2PSRA 1WRKA 1JBAA 3VRPA 1SRAA 1A03A 2EGDA 2WCBA 3OBVA 3CLNA 4MBEA 4N1FA 4OR9B 1KSOA 1S6JA 1IH0A 2MJWB 1YVLA 1V1FA 3M0WA 2GGMA 1OE9B 2JT8A 2I94A 2QACA 2GTEA 3I5HC 5ER5A 1WRZA 1TCFA 4GFTA 2CXJA 1TUZA 1XFWO 2BCBA 1XFYO 2WCMA 1SL9A 3ZNIA 1IWQA 3CZ2A 1QV1A 1DMOA 1RTP1 3FS7A 1W9ZA 1K90D 1S1EA 2MLEC 1OMVA 1JC2A 4FQTA 4YGEB 2CBLA 1B1GA 1BF5A 4KYNA 4FQOA 5D3OA 5D7FA 5FI6A 3DVEA 2KGRA 1MWNA 4PE1A 1QVIZ 5KTYA 1NX3A 2LMVA 3VRNA 1W7JB 1AJ4A 1ZFSA 3IQOA 1DJHA 2OS8C 4CFRA 1JSAA 1OOHA 1CM1A 3TS5B 1U5IA 1YURA 1PSRA 1YRTB 1CDMA 1QATA 2O60A 5TNCA 5J3XA 2K61A 2DOQA 1CFFA 2FJYA 1Z2CB 1G4YR 5AANA 1LKJA 1FW4A 1U5IB 2KLEA 5KU1A 2PALA 1XA5A 5AXIA 1LVCD 4MZLA 1KFXS 3RM1A 3TDIA 3IQQA 5AERA 1B4CA 3SG2A 2CCMA 1DJZA 1IG5A 2BL0B 4MEWA 4PT1A 4OVNF 1J55A 4CLNA 2OPOA 1OMRA 2LMUA 1E8AA 3V2LA 2P70A 1SCMB 1YUUA 2KFGA 1YX7A 3NHTA 4JKTA 1LA3A 1GQMA 2R2IA 1F54A 4DS7A 3I5FB 5I2LA 1FPWA 3WXAA 3JVTC 3OB2B 2TN4A 3SJSA 2JWWA 4JWQA 4ORAB 1XFZO 3DYEA 1K8UA 2M8UA 2L2EA 4YGBB 2JPTA 3EKJA 1KFUL 4QJ3B 4PDZA 3TDUA 1SPYA 2K8MB 1DJYA 2M7NA 2NCPA 3D76A 5AFPA 1UHHA 2KLDA 4PHMA 4P2YB 3A8RA 3EVVA 3OP0A 1IRJA 1CDLA 1TIZA 2F2PA 4DIRA 2ZNDA 1KQVA 2LCPA 3I5GB 2AAOA 4PHJA 2ERBA 5DICA 2I18A 1J7PA 1Y1UA 1PSBA 2KBMA 3RZSA 4YGDB 1KQMC 4WQ2A 1KK7Z 1OOFA 2NZ0A 1BU3A 2KSPA 3R72A 1A2XA 1CFDA 1C7WA 2ZNEA 1F55A 1CDPA 2JQ6A 1SY9A 1IQ5A 2M97A 3BJHA 3PN7C 2JTZA 5CSJA 1SSEB 1YR5A 2NLNA 3DXLA 2L2CA 1H8BA 1OOIX 1NX2A 1DJIA 2KFHA 1UHIA 1BR1B 1TWOA 2EHBA 2BBNA 3FE8A 1CLLA 3VRQA 2PRUA 5B8IB 1KFUS 1R2UA 1TCOB 1XFXO 1ZMZA 2K2FA 4MVFA 4WQ3A 2H2KA 4PHNA 2WCHA 4C0LA 1CMGA 2QPTA 1QLKA 3D0YA 3MSEB 3AKBA 3I5HB 5EL2A 3EKHA 2F3YA 1NX1A 2MLFC 1QTXA 1CNPA 4WRIA 2LLSA 1RECA 3D0YB 2KPHA 2L5XB 3WNXB 1BG1A 3D73A 3BYAA 2WCLA 2L51A 2L50A 4IL1A 2JRFA 4PE7A 1Y6WA 3H4SE 2OTGC 4XYNA 1DT7B 1AP4A 3FE6A 1Y1AA 4NDBA 2H61A 3QMEA 2M7LA 1TOPA 2E6WA 1DJGA 1C3ZA 3EVUA 4CPVA 1F8HA 4GAOA 1F4OA 2WCKA 3D74A 4GUKA 2KI6C 2Y5IA 3F45A 1SL7A 1WLZA 2FJUB 3BXKA 4OKHA 1EG3A 1X02A 2OS8B 1GJYA 2SCPA 3K1EA 3L47A 3ICBA 3NSIA 4I5JA 4IJ7A 5CPVA 3B87A 5CSNA 5BPJA 2LLUA 1HT9A 2M29A 3HX4A 3B86A 3VRRA 1TUJA 4YRUA 4I5KA 1SNLA 2L4HA 3D75A 2JXLA 4GBAA 3VB1A 3OX5A 3AAJA 1J1DA 3BUNB 1K96A 3CYZA 1CM4A 2COLB 3CZTX 3L4LA 2FCDA 2Q4UA 1RWYA 1BJFA 3IF7A 3I5IC 1S3PA 3C1VA 1DC1A 4NQGA 4YI8A 4Q04A 1LS8A 1NIWA 1QIWA 2E30A 3HCMA 2KI4C 4JQ0D 4E68A 1DF0A 3JVTB 3VGOA 2K7CA 1IJ6A 1N2DA 1LXFC 3CR4X 5JOLA 2LLTA 1JUOA 1DF0B 1SCVA 1T14A 1MF8B 3O4XA 2M0RA 1D1OA 2ZRTA 4GNKB 1Y1XA 4ORCB 1C3YA 1FI6A 2KNEA 3BOWA 1J7QA 4R1EA 5HLVA 1QX7A 1QIVA 3BFBA 1PVAA 3BOWB 1VRKA 1OOGA 2KOTA 3BUXB 1AVSA 4CFQA 1NP8A 1XO5A 1K9UA 1CFPA 1KK7Y 1TNWA 3TZ1A 2L4IA 1IQ3A 1SK6D 4MRXA 4JPZB 2Q91A 2O5GA 3S0BA 1K2HA 1B7TY 5CSIA 4ZCVA 2QEOA 4I5LB 1KQMB 1BR4B 2HPSA 1YUSA 3Q8IA 5FYXA 3KPXA 1MR8A 1JF2A 2LVKA 1CB1A 1N0YA 1SW8A 3FWCA 1TNXA 1F71A 1UHKA 2MHHA 3D10A 4A4BA 1XK4C 2I2RE 1B8CA 3N7HA 1XFVO 3PN7B 2M9GA 3BUWB 1IKUA 3PJIA 3SIBA 1K9KA 1CLMA 5HKZA 1M31A
chains in the Genus database with same CATH topology
1A75A 1YX8A 5JJGA 4C0JA 1FF1A 3GOFA 5CSFA 1WLMA 1IGVA 4ZCUA 1A75B 2WORA 1WY9A 1JF0A 2KQ6A 4OCIA 2BE6A 1C07A 1OQPA 2L0PA 1NYAA 3PM8A 4QJ5B 5HKWA 4HSZA 2VRGA 2HQWA 3AAKA 2M49B 2ZN8A 3JTDC 4F0ZB 3LK0A 1B7TZ 3GK2A 4MZKA 1V1GA 1YVHA 2JNXA 1ALVA 4PE4A 2GV5A 1YTZC 2HF5A 1H4BA 4MRYA 1KWOC 3RLZA 3OHMB 2BE4A 2NCOA 1W7IB 1S26D 1PK0D 2OTGB 5D69A 5AEQA 1DGUA 2KFFA 1TN4A 2M1UA 1L2OC 2LP2A 3O6BA 1OMDA 3CWGA 1EG4A 1NPQA 2K2AA 3PATA 4M2PA 2F2OA 2JU0A 4DUQA 1XVJA 3PALA 1CFCA 4ORBB 4QJ4B 2I7AA 3EK7A 1NCYA 2LV7A 1MHOA 1J1EA 1J7OA 4GGNA 4YBHB 1EJ3A 2IS9A 4C0KA 1WRLA 4AQIA 1PULA 2BCAA 3KEVA 5HLOA 4HRGA 1PALA 1JWDA 1K9PA 1YRUB 1PRWA 2LNKA 2HQ8A 1NX0A 1YUTA 2MBXA 4U8DA 1F70A 3NSOA 5ER4X 3VROA 1ALWA 3PSRA 1QXPA 4PE0A 1F4QA 1SKTA 2ISDA 3SG3A 3FWBA 2PASA 2CNPA 2KGBC 5F6TA 4D1EA 3CGAA 3DVJA 1NSHA 1HQVA 1QV0A 5DKRA 1TRFA 2KHNA 3PFVA 1WDCC 2AMIA 3I5IB 3SG4A 5KSZA 1FI5A 3DD4A 3TUYC 1KK8C 2FOTA 2KYFA 4HREE 4M2OA 3TDZA 3EVRA 1QJTA 2KDHA 1SR6C 1TNPA 1UP5A 2K7BA 2KI4B 2Y4QA 3CR2A 1S36A 1S5GY 1GGWA 4A4CA 1SBJA 1BODA 1RFJA 4P5OE 1AUIB 2KAXA 1OSAA 1KCYA 4PALA 2Y1MA 1SMGA 2KAYA 3EK8A 2LAPA 3A4UB 2LUCA 1BT6A 2WNDA 4HRHA 1IJ5A 2ZFDA 2LP3A 1J7RA 2FCEA 3LK1A 3NXAA 2LE9B 2F8PA 3WHUB 1UURA 2MRDA 3CTNA 3OB1B 3SG5A 2EC6C 2PVBA 3O2PA 1CTRA 5I2QA 3CS1A 4BY5A 3O4YA 4GGFC 1LA0A 1AHRA 2RGIA 1NWDA 2BECA 4MZJA 1DJXA 1JFJA 2LC5A 1XK4A 2D8NA 1ZUZA 3CR5X 4I5NB 1RJVA 1Y0VH 4AQJA 3SIAA 1SL8A 3KF9A 1S5GZ 2LANA 2JT0A 1GGZA 3DVKA 1DJWA 2H61C 3E3RA 1QASA 5PALA 1KSMA 2LVIA 1TTXA 2LHLA 3GK1A 2LVJA 1CLBA 1A29A 3SG7A 1QLSA 1UWOA 1OZOA 2G2BA 4YI9A 2ZN9A 2L98A 2LUXA 1MQ1A 1PVBA 1UHJA 5HYDA 1NCZA 3BUMB 4PCWA 2MA2A 3JTDB 2JZIA 2MAZA 1QX5B 4DCKA 4PHKA 5DKQA 2WOSA 1DTLA 2NXQA 1G8IA 2GGZA 4CIDA 1XFUO 1FBVA 1KWOB 2B1UA 2K7DA 3KHEA 4XJKA 3LCPC 1UHNA 1BMOA 1M46A 3TS5C 1L2OB 1AJ5A 4XJKB 1DVIA 1DGVA 1EH2A 4USLA 1SYMA 3DF0A 4AOMA 5HKYA 3FIAA 2JXCA 1C7VA 4NDDA 5I8NA 4GPLB 5GQQC 1OZSA 1B47A 2JULA 3DF0B 2JC2A 1CMFA 3DVMA 2KYCA 1ODBA 2PMYA 3BQ3A 2BL0C 1B8RA 1M63B 2BKHB 3AKAA 1MUXA 4DRWA 4MSPA 1S6IA 2ZRSA 2KQYA 1RK9A 2F33A 2ZKMX 1EL4A 4NDCA 1SCMC 4MN0A 3LLEA 1K93D 1B8LA 1QS7A 1RROA 3KO0A 3NSLA 1K95A 2WCFA 3I5FC 3O78A 5I2OA 3NSKA 4FTGA 4YGCB 2BBMA 2BCXA 3BUOB 3EK4A 4MLWA 1S6CA 2P6BB 2KBIA 3K21A 2LHIA 1WDCB 2LM5A 5IBWA 2Y1NA 1JFKA 2CTNA 3TUYB 2JT3A 1KK8B 2K7OA 2KAVA 2V53A 4L9MA 1SR6B 1M39A 4ICBA 4ETOA 2KI6D 4YGAA 1LINA 1L7ZA 1B9AA 2LVVA 3QRXA 3I5GC 1TNQA 1NCXA 1N65A 4N1GA 2HETA 1CDNA 1ZOTB 2AUCA 2JTTA 3ZWHA 1MXEA 4OV2A 1CKKA 1ZACA 2A4JA 1OOJA 3GK4X 1MXLC 2SASA 1QX2A 2WCEA 1K94A 5DKNA 1XYDA 2K0JA 1EXRA 2G9BA 5G08A 1AK8A 2M1KB 2LMTA 3LL8B 4GGFA 2BKIB 2EC6B 2WC8A 3SG6A 5K89A 1G33A 2M3WA 4UPGA 4M2QA 3PLFB 2JNFA 4BY4A 1Q80A 2CT9A 2JOJA 4N5XA 3OX6A 1R6PA 1UUSA 2F3ZA 1BLQA 1BOCA 1QVIY 4TNCA 1M45A 1A4PA 3WHTB 1KFXL 1NUBA 2PSRA 1WRKA 1JBAA 3VRPA 1SRAA 1A03A 2EGDA 2WCBA 3CLNA 4MBEA 4N1FA 4OR9B 1KSOA 1S6JA 1IH0A 2MJWB 1YVLA 1V1FA 3M0WA 2GGMA 1OE9B 2JT8A 2I94A 2QACA 3I5HC 5ER5A 1WRZA 1TCFA 4GFTA 2CXJA 1XFWO 2BCBA 1XFYO 1SL9A 3ZNIA 1IWQA 1QV1A 1DMOA 1RTP1 3FS7A 1K90D 1S1EA 2MLEC 1OMVA 1JC2A 4YGEB 1B1GA 2CBLA 1BF5A 4FQOA 5D7FA 3DVEA 2KGRA 1MWNA 4PE1A 1QVIZ 5KTYA 1NX3A 2LMVA 3VRNA 1W7JB 1AJ4A 1ZFSA 3IQOA 1DJHA 2OS8C 4CFRA 1JSAA 3TS5B 1CM1A 1U5IA 1YURA 1PSRA 1YRTB 1CDMA 1QATA 2O60A 5TNCA 5J3XA 2K61A 2DOQA 1CFFA 5AANA 1G4YR 5KU1A 1LKJA 1FW4A 1U5IB 2PALA 1XA5A 5AXIA 1LVCD 4MZLA 1KFXS 3RM1A 3TDIA 3IQQA 5AERA 1B4CA 3SG2A 2CCMA 1DJZA 1IG5A 2BL0B 4MEWA 4OVNF 1J55A 4CLNA 2OPOA 1OMRA 2LMUA 1E8AA 1SCMB 1YUUA 2KFGA 1YX7A 1LA3A 1GQMA 2R2IA 1F54A 4DS7A 3I5FB 5I2LA 1FPWA 3WXAA 3JVTC 3OB2B 2TN4A 3SJSA 2JWWA 4JWQA 4ORAB 1XFZO 1K8UA 2M8UA 2L2EA 4YGBB 2JPTA 3EKJA 1KFUL 4QJ3B 4PDZA 3TDUA 1SPYA 2K8MB 1DJYA 2M7NA 2NCPA 5AFPA 1UHHA 4PHMA 4P2YB 3A8RA 3EVVA 3OP0A 1IRJA 1CDLA 1TIZA 2F2PA 4DIRA 2ZNDA 1KQVA 2LCPA 3I5GB 2AAOA 4PHJA 2I18A 1J7PA 1Y1UA 1PSBA 2KBMA 4YGDB 1KQMC 4WQ2A 1KK7Z 2NZ0A 1BU3A 2KSPA 1A2XA 1CFDA 1C7WA 2ZNEA 1F55A 1CDPA 2JQ6A 1SY9A 1IQ5A 2M97A 3PN7C 2JTZA 5CSJA 1YR5A 2NLNA 1H8BA 1NX2A 1DJIA 2KFHA 1UHIA 1BR1B 2EHBA 2BBNA 1CLLA 3VRQA 2PRUA 5B8IB 1KFUS 1R2UA 1TCOB 1XFXO 1ZMZA 2K2FA 4MVFA 4WQ3A 2H2KA 4PHNA 4C0LA 1CMGA 2QPTA 1QLKA 3D0YA 3MSEB 3AKBA 3I5HB 3EKHA 2F3YA 1NX1A 2MLFC 1QTXA 1CNPA 4WRIA 2LLSA 1RECA 3D0YB 3WNXB 2L5XB 1BG1A 3BYAA 2L51A 2L50A 4IL1A 2JRFA 4PE7A 1Y6WA 3H4SE 2OTGC 4XYNA 1DT7B 1AP4A 1Y1AA 4NDBA 2H61A 2M7LA 1TOPA 2E6WA 1DJGA 3EVUA 4CPVA 1F8HA 4GAOA 1F4OA 4GUKA 2KI6C 2Y5IA 3F45A 1SL7A 1WLZA 2FJUB 3BXKA 4OKHA 1EG3A 1X02A 2OS8B 1GJYA 2SCPA 3NSIA 3ICBA 4I5JA 5CSNA 5CPVA 5BPJA 2LLUA 1HT9A 2M29A 3HX4A 3VRRA 4YRUA 4I5KA 1SNLA 2L4HA 2JXLA 4GBAA 3OX5A 3AAJA 1J1DA 3BUNB 1K96A 3CZTX 1CM4A 2COLB 2FCDA 2Q4UA 1RWYA 1BJFA 3IF7A 3I5IC 1S3PA 3C1VA 4NQGA 4YI8A 4Q04A 1NIWA 1QIWA 2E30A 3HCMA 2KI4C 4JQ0D 4E68A 1DF0A 3JVTB 3VGOA 2K7CA 1IJ6A 1N2DA 1LXFC 3CR4X 5JOLA 2LLTA 1JUOA 1DF0B 1SCVA 1MF8B 2M0RA 1D1OA 2ZRTA 4GNKB 1Y1XA 4ORCB 1FI6A 2KNEA 3BOWA 1J7QA 4R1EA 5HLVA 1QX7A 1QIVA 1PVAA 3BOWB 1VRKA 2KOTA 3BUXB 1AVSA 4CFQA 1NP8A 1XO5A 1K9UA 1CFPA 1KK7Y 1TNWA 3TZ1A 2L4IA 1IQ3A 1SK6D 4MRXA 4JPZB 2Q91A 2O5GA 1K2HA 1B7TY 5CSIA 4ZCVA 4I5LB 1KQMB 1BR4B 2HPSA 1YUSA 5FYXA 3KPXA 1MR8A 1JF2A 2LVKA 1CB1A 1N0YA 1SW8A 3FWCA 1TNXA 1F71A 1UHKA 2MHHA 3D10A 4A4BA 1XK4C 2I2RE 1B8CA 3PN7B 1XFVO 2M9GA 3BUWB 1IKUA 3SIBA 1K9KA 1CLMA 5HKZA 1M31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A75 A;  1YX8 A;  5JJG A;  4C0J A;  1FF1 A;  3GOF A;  5CSF A;  1WLM A;  1IGV A;  4ZCU A;  1A75 B;  2WOR A;  1WY9 A;  1JF0 A;  2KQ6 A;  4OCI A;  2BE6 A;  1C07 A;  1OQP A;  2L0P A;  1NYA A;  3PM8 A;  4QJ5 B;  5HKW A;  4HSZ A;  2VRG A;  2HQW A;  3AAK A;  2M49 B;  2ZN8 A;  3JTD C;  4F0Z B;  3LK0 A;  1B7T Z;  3GK2 A;  4MZK A;  1V1G A;  1YVH A;  2JNX A;  1ALV A;  4PE4 A;  2GV5 A;  1YTZ C;  2HF5 A;  1H4B A;  4MRY A;  1KWO C;  3RLZ A;  3OHM B;  2BE4 A;  2NCO A;  1W7I B;  1S26 D;  1PK0 D;  2OTG B;  5D69 A;  5AEQ A;  1DGU A;  2KFF A;  1TN4 A;  2M1U A;  1L2O C;  2LP2 A;  3O6B A;  1OMD A;  3CWG A;  1EG4 A;  1NPQ A;  2K2A A;  3PAT A;  4M2P A;  2F2O A;  2JU0 A;  4DUQ A;  1XVJ A;  3PAL A;  1CFC A;  4ORB B;  4QJ4 B;  2I7A A;  3EK7 A;  1NCY A;  2LV7 A;  1MHO A;  1J1E A;  1J7O A;  4GGN A;  4YBH B;  1EJ3 A;  2IS9 A;  4C0K A;  1WRL A;  4AQI A;  1PUL A;  2BCA A;  3KEV A;  5HLO A;  4HRG A;  1PAL A;  1JWD A;  1K9P A;  1YRU B;  1PRW A;  2LNK A;  2HQ8 A;  1NX0 A;  1YUT A;  2MBX A;  4U8D A;  1F70 A;  3NSO A;  5ER4 X;  3VRO A;  1ALW A;  3PSR A;  1QXP A;  4PE0 A;  1F4Q A;  1SKT A;  2ISD A;  3SG3 A;  3FWB A;  2PAS A;  2CNP A;  2KGB C;  5F6T A;  4D1E A;  3CGA A;  3DVJ A;  1NSH A;  1HQV A;  1QV0 A;  5DKR A;  1TRF A;  2KHN A;  3PFV A;  1WDC C;  2AMI A;  3I5I B;  3SG4 A;  5KSZ A;  1FI5 A;  3DD4 A;  3TUY C;  1KK8 C;  2FOT A;  2KYF A;  4HRE E;  4M2O A;  3TDZ A;  3EVR A;  1QJT A;  2KDH A;  1SR6 C;  1TNP A;  1UP5 A;  2K7B A;  2KI4 B;  2Y4Q A;  3CR2 A;  1S36 A;  1S5G Y;  1GGW A;  4A4C A;  1SBJ A;  1BOD A;  1RFJ A;  4P5O E;  1AUI B;  2KAX A;  1OSA A;  1KCY A;  4PAL A;  2Y1M A;  1SMG A;  2KAY A;  3EK8 A;  2LAP A;  3A4U B;  2LUC A;  1BT6 A;  2WND A;  4HRH A;  1IJ5 A;  2ZFD A;  2LP3 A;  1J7R A;  2FCE A;  3LK1 A;  3NXA A;  2LE9 B;  2F8P A;  3WHU B;  1UUR A;  2MRD A;  3CTN A;  3OB1 B;  3SG5 A;  2EC6 C;  2PVB A;  3O2P A;  1CTR A;  5I2Q A;  3CS1 A;  4BY5 A;  3O4Y A;  4GGF C;  1LA0 A;  1AHR A;  2RGI A;  1NWD A;  2BEC A;  4MZJ A;  1DJX A;  1JFJ A;  2LC5 A;  1XK4 A;  2D8N A;  1ZUZ A;  3CR5 X;  4I5N B;  1RJV A;  1Y0V H;  4AQJ A;  3SIA A;  1SL8 A;  3KF9 A;  1S5G Z;  2LAN A;  2JT0 A;  1GGZ A;  3DVK A;  1DJW A;  2H61 C;  3E3R A;  1QAS A;  5PAL A;  1KSM A;  2LVI A;  1TTX A;  2LHL A;  3GK1 A;  2LVJ A;  1CLB A;  1A29 A;  3SG7 A;  1QLS A;  1UWO A;  1OZO A;  2G2B A;  4YI9 A;  2ZN9 A;  2L98 A;  2LUX A;  1MQ1 A;  1PVB A;  1UHJ A;  5HYD A;  1NCZ A;  3BUM B;  4PCW A;  2MA2 A;  3JTD B;  2JZI A;  2MAZ A;  1QX5 B;  4DCK A;  4PHK A;  5DKQ A;  2WOS A;  1DTL A;  2NXQ A;  1G8I A;  2GGZ A;  4CID A;  1XFU O;  1FBV A;  1KWO B;  2B1U A;  2K7D A;  3KHE A;  4XJK A;  3LCP C;  1UHN A;  1BMO A;  1M46 A;  3TS5 C;  1L2O B;  1AJ5 A;  4XJK B;  1DVI A;  1DGV A;  1EH2 A;  4USL A;  1SYM A;  3DF0 A;  4AOM A;  5HKY A;  3FIA A;  2JXC A;  1C7V A;  4NDD A;  5I8N A;  4GPL B;  5GQQ C;  1OZS A;  1B47 A;  2JUL A;  3DF0 B;  2JC2 A;  1CMF A;  3DVM A;  2KYC A;  1ODB A;  2PMY A;  3BQ3 A;  2BL0 C;  1B8R A;  1M63 B;  2BKH B;  3AKA A;  1MUX A;  4DRW A;  4MSP A;  1S6I A;  2ZRS A;  2KQY A;  1RK9 A;  2F33 A;  2ZKM X;  1EL4 A;  4NDC A;  1SCM C;  4MN0 A;  3LLE A;  1K93 D;  1B8L A;  1QS7 A;  1RRO A;  3KO0 A;  3NSL A;  1K95 A;  2WCF A;  3I5F C;  3O78 A;  5I2O A;  3NSK A;  4FTG A;  4YGC B;  2BBM A;  2BCX A;  3BUO B;  3EK4 A;  4MLW A;  1S6C A;  2P6B B;  2KBI A;  3K21 A;  2LHI A;  1WDC B;  2LM5 A;  5IBW A;  2Y1N A;  1JFK A;  2CTN A;  3TUY B;  2JT3 A;  1KK8 B;  2K7O A;  2KAV A;  2V53 A;  4L9M A;  1SR6 B;  1M39 A;  4ICB A;  4ETO A;  2KI6 D;  4YGA A;  1LIN A;  1L7Z A;  1B9A A;  2LVV A;  3QRX A;  3I5G C;  1TNQ A;  1NCX A;  1N65 A;  4N1G A;  2HET A;  1CDN A;  1ZOT B;  2AUC A;  2JTT A;  3ZWH A;  1MXE A;  4OV2 A;  1CKK A;  1ZAC A;  2A4J A;  1OOJ A;  3GK4 X;  1MXL C;  2SAS A;  1QX2 A;  2WCE A;  1K94 A;  5DKN A;  1XYD A;  2K0J A;  1EXR A;  2G9B A;  5G08 A;  1AK8 A;  2M1K B;  2LMT A;  3LL8 B;  4GGF A;  2BKI B;  2EC6 B;  2WC8 A;  3SG6 A;  5K89 A;  1G33 A;  2M3W A;  4UPG A;  4M2Q A;  3PLF B;  2JNF A;  4BY4 A;  1Q80 A;  2CT9 A;  2JOJ A;  4N5X A;  3OX6 A;  1R6P A;  1UUS A;  2F3Z A;  1BLQ A;  1BOC A;  1QVI Y;  4TNC A;  1M45 A;  1A4P A;  3WHT B;  1KFX L;  1NUB A;  2PSR A;  1WRK A;  1JBA A;  3VRP A;  1SRA A;  1A03 A;  2EGD A;  2WCB A;  3CLN A;  4MBE A;  4N1F A;  4OR9 B;  1KSO A;  1S6J A;  1IH0 A;  2MJW B;  1YVL A;  1V1F A;  3M0W A;  2GGM A;  1OE9 B;  2JT8 A;  2I94 A;  2QAC A;  3I5H C;  5ER5 A;  1WRZ A;  1TCF A;  4GFT A;  2CXJ A;  1XFW O;  2BCB A;  1XFY O;  1SL9 A;  3ZNI A;  1IWQ A;  1QV1 A;  1DMO A;  1RTP 1;  3FS7 A;  1K90 D;  1S1E A;  2MLE C;  1OMV A;  1JC2 A;  4YGE B;  1B1G A;  2CBL A;  1BF5 A;  4FQO A;  5D7F A;  3DVE A;  2KGR A;  1MWN A;  4PE1 A;  1QVI Z;  5KTY A;  1NX3 A;  2LMV A;  3VRN A;  1W7J B;  1AJ4 A;  1ZFS A;  3IQO A;  1DJH A;  2OS8 C;  4CFR A;  1JSA A;  3TS5 B;  1CM1 A;  1U5I A;  1YUR A;  1PSR A;  1YRT B;  1CDM A;  1QAT A;  2O60 A;  5TNC A;  5J3X A;  2K61 A;  2DOQ A;  1CFF A;  5AAN A;  1G4Y R;  5KU1 A;  1LKJ A;  1FW4 A;  1U5I B;  2PAL A;  1XA5 A;  5AXI A;  1LVC D;  4MZL A;  1KFX S;  3RM1 A;  3TDI A;  3IQQ A;  5AER A;  1B4C A;  3SG2 A;  2CCM A;  1DJZ A;  1IG5 A;  2BL0 B;  4MEW A;  4OVN F;  1J55 A;  4CLN A;  2OPO A;  1OMR A;  2LMU A;  1E8A A;  1SCM B;  1YUU A;  2KFG A;  1YX7 A;  1LA3 A;  1GQM A;  2R2I A;  1F54 A;  4DS7 A;  3I5F B;  5I2L A;  1FPW A;  3WXA A;  3JVT C;  3OB2 B;  2TN4 A;  3SJS A;  2JWW A;  4JWQ A;  4ORA B;  1XFZ O;  1K8U A;  2M8U A;  2L2E A;  4YGB B;  2JPT A;  3EKJ A;  1KFU L;  4QJ3 B;  4PDZ A;  3TDU A;  1SPY A;  2K8M B;  1DJY A;  2M7N A;  2NCP A;  5AFP A;  1UHH A;  4PHM A;  4P2Y B;  3A8R A;  3EVV A;  3OP0 A;  1IRJ A;  1CDL A;  1TIZ A;  2F2P A;  4DIR A;  2ZND A;  1KQV A;  2LCP A;  3I5G B;  2AAO A;  4PHJ A;  2I18 A;  1J7P A;  1Y1U A;  1PSB A;  2KBM A;  4YGD B;  1KQM C;  4WQ2 A;  1KK7 Z;  2NZ0 A;  1BU3 A;  2KSP A;  1A2X A;  1CFD A;  1C7W A;  2ZNE A;  1F55 A;  1CDP A;  2JQ6 A;  1SY9 A;  1IQ5 A;  2M97 A;  3PN7 C;  2JTZ A;  5CSJ A;  1YR5 A;  2NLN A;  1H8B A;  1NX2 A;  1DJI A;  2KFH A;  1UHI A;  1BR1 B;  2EHB A;  2BBN A;  1CLL A;  3VRQ A;  2PRU A;  5B8I B;  1KFU S;  1R2U A;  1TCO B;  1XFX O;  1ZMZ A;  2K2F A;  4MVF A;  4WQ3 A;  2H2K A;  4PHN A;  4C0L A;  1CMG A;  2QPT A;  1QLK A;  3D0Y A;  3MSE B;  3AKB A;  3I5H B;  3EKH A;  2F3Y A;  1NX1 A;  2MLF C;  1QTX A;  1CNP A;  4WRI A;  2LLS A;  1REC A;  3D0Y B;  3WNX B;  2L5X B;  1BG1 A;  3BYA A;  2L51 A;  2L50 A;  4IL1 A;  2JRF A;  4PE7 A;  1Y6W A;  3H4S E;  2OTG C;  4XYN A;  1DT7 B;  1AP4 A;  1Y1A A;  4NDB A;  2H61 A;  2M7L A;  1TOP A;  2E6W A;  1DJG A;  3EVU A;  4CPV A;  1F8H A;  4GAO A;  1F4O A;  4GUK A;  2KI6 C;  2Y5I A;  3F45 A;  1SL7 A;  1WLZ A;  2FJU B;  3BXK A;  4OKH A;  1EG3 A;  1X02 A;  2OS8 B;  1GJY A;  2SCP A;  3NSI A;  3ICB A;  4I5J A;  5CSN A;  5CPV A;  5BPJ A;  2LLU A;  1HT9 A;  2M29 A;  3HX4 A;  3VRR A;  4YRU A;  4I5K A;  1SNL A;  2L4H A;  2JXL A;  4GBA A;  3OX5 A;  3AAJ A;  1J1D A;  3BUN B;  1K96 A;  3CZT X;  1CM4 A;  2COL B;  2FCD A;  2Q4U A;  1RWY A;  1BJF A;  3IF7 A;  3I5I C;  1S3P A;  3C1V A;  4NQG A;  4YI8 A;  4Q04 A;  1NIW A;  1QIW A;  2E30 A;  3HCM A;  2KI4 C;  4JQ0 D;  4E68 A;  1DF0 A;  3JVT B;  3VGO A;  2K7C A;  1IJ6 A;  1N2D A;  1LXF C;  3CR4 X;  5JOL A;  2LLT A;  1JUO A;  1DF0 B;  1SCV A;  1MF8 B;  2M0R A;  1D1O A;  2ZRT A;  4GNK B;  1Y1X A;  4ORC B;  1FI6 A;  2KNE A;  3BOW A;  1J7Q A;  4R1E A;  5HLV A;  1QX7 A;  1QIV A;  1PVA A;  3BOW B;  1VRK A;  2KOT A;  3BUX B;  1AVS A;  4CFQ A;  1NP8 A;  1XO5 A;  1K9U A;  1CFP A;  1KK7 Y;  1TNW A;  3TZ1 A;  2L4I A;  1IQ3 A;  1SK6 D;  4MRX A;  4JPZ B;  2Q91 A;  2O5G A;  1K2H A;  1B7T Y;  5CSI A;  4ZCV A;  4I5L B;  1KQM B;  1BR4 B;  2HPS A;  1YUS A;  5FYX A;  3KPX A;  1MR8 A;  1JF2 A;  2LVK A;  1CB1 A;  1N0Y A;  1SW8 A;  3FWC A;  1TNX A;  1F71 A;  1UHK A;  2MHH A;  3D10 A;  4A4B A;  1XK4 C;  2I2R E;  1B8C A;  3PN7 B;  1XFV O;  2M9G A;  3BUW B;  1IKU A;  3SIB A;  1K9K A;  1CLM A;  5HKZ A;  1M31 A; 
#chains in the Genus database with same CATH topology
 1A75 A;  1YX8 A;  5JJG A;  4C0J A;  1FF1 A;  2QEV A;  3GOF A;  5CSF A;  1WLM A;  1IGV A;  4ZCU A;  1A75 B;  2QEH A;  2WOR A;  1WY9 A;  1JF0 A;  2KQ6 A;  4OCI A;  2BE6 A;  1C07 A;  1OQP A;  2L0P A;  1NYA A;  3PM8 A;  4QJ5 B;  5HKW A;  3R1V A;  3CZ1 A;  4HSZ A;  2VRG A;  2HQW A;  3AAK A;  2M49 B;  2ZN8 A;  3JTD C;  4F0Z B;  3LK0 A;  1B7T Z;  3GK2 A;  4MZK A;  1V1G A;  1YVH A;  2JNX A;  1ALV A;  4PE4 A;  2GV5 A;  1YTZ C;  1OW4 A;  2HF5 A;  1H4B A;  4MRY A;  1KWO C;  3RLZ A;  3OHM B;  2PQL A;  2BE4 A;  2NCO A;  1W7I B;  1S26 D;  1PK0 D;  2OTG B;  5D69 A;  5AEQ A;  1DGU A;  2KFF A;  1TN4 A;  2M1U A;  1L2O C;  4OZD A;  2LP2 A;  3O6B A;  1OMD A;  3CWG A;  1EG4 A;  1NPQ A;  2K2A A;  3PAT A;  4M2P A;  3B7A A;  2F2O A;  2JU0 A;  3FE9 A;  4DUQ A;  1XVJ A;  3NHI A;  3PAL A;  1CFC A;  4ORB B;  4QJ4 B;  2I7A A;  3EK7 A;  1NCY A;  2LV7 A;  1MHO A;  1J1E A;  1J7O A;  4GGN A;  4YBH B;  1EJ3 A;  2IS9 A;  4C0K A;  1WRL A;  4AQI A;  1PUL A;  2BCA A;  3KEV A;  5HLO A;  3R1O A;  4HRG A;  1PAL A;  1JWD A;  1K9P A;  1YRU B;  2YGU A;  1PRW A;  2LNK A;  2HQ8 A;  1NX0 A;  1YUT A;  2MBX A;  4U8D A;  3S0D A;  5I94 A;  1F70 A;  1GM0 A;  3NSO A;  5ER4 X;  1IIO A;  3VRO A;  1ALW A;  3PSR A;  1QXP A;  4PE0 A;  1F4Q A;  1SKT A;  2ISD A;  1P28 A;  3FWB A;  2PAS A;  2CNP A;  2KGB C;  3SG3 A;  5F6T A;  4D1E A;  3CGA A;  3DVJ A;  1NSH A;  1HQV A;  1QV0 A;  5DKR A;  1TRF A;  2KHN A;  3PFV A;  1WDC C;  2AMI A;  3I5I B;  3SG4 A;  5KSZ A;  1FI5 A;  3DD4 A;  3TUY C;  1KK8 C;  2FOT A;  2KYF A;  4HRE E;  4M2O A;  3TDZ A;  3EVR A;  1QJT A;  2KDH A;  1SR6 C;  1TNP A;  1UP5 A;  2K7B A;  2KI4 B;  2Y4Q A;  3CR2 A;  3B6X A;  1S36 A;  1S5G Y;  1GGW A;  4A4C A;  1SBJ A;  5FI2 A;  4F7F A;  1RFJ A;  1BOD A;  1DQE A;  1Z4H A;  1AUI B;  4P5O E;  2KAX A;  1OSA A;  1KCY A;  4PAL A;  2Y1M A;  1SMG A;  2KAY A;  3EK8 A;  2LAP A;  3A4U B;  2LUC A;  1BT6 A;  2WND A;  4HRH A;  1IJ5 A;  2ZFD A;  2LP3 A;  1J7R A;  2FCE A;  3LK1 A;  3NXA A;  2LE9 B;  2F8P A;  2K60 A;  1UUR A;  3UNW A;  3WHU B;  2MRD A;  3CTN A;  3OB1 B;  3SG5 A;  2EC6 C;  2PVB A;  3O2P A;  1CTR A;  2BAP A;  5I2Q A;  3CS1 A;  4BY5 A;  3O4Y A;  4GGF C;  1LA0 A;  1AHR A;  2RGI A;  2P71 A;  1NWD A;  2BEC A;  4MZJ A;  1DJX A;  2L5Y A;  1JFJ A;  2LC5 A;  1XK4 A;  2D8N A;  3NGV A;  1ZUZ A;  3CR5 X;  4I5N B;  1RJV A;  1Y0V H;  4AQJ A;  3SIA A;  1SL8 A;  3KF9 A;  3DY9 A;  1S5G Z;  2LAN A;  2JT0 A;  1GGZ A;  3DVK A;  1DJW A;  2H61 C;  3E3R A;  1QAS A;  5PAL A;  1KSM A;  2LVI A;  3DZT A;  1TTX A;  2LHL A;  3GK1 A;  2LVJ A;  4INX A;  1A29 A;  2BNX A;  3SG7 A;  1CLB A;  1QLS A;  1UWO A;  1OZO A;  2G2B A;  4YI9 A;  2ZN9 A;  5HL1 A;  2L98 A;  2LUX A;  1MQ1 A;  3IVT A;  1PVB A;  1UHJ A;  5HYD A;  1NCZ A;  3BUM B;  4PCW A;  3UO9 A;  2MA2 A;  3JTD B;  2JZI A;  2MAZ A;  1QX5 B;  4DCK A;  4PHK A;  5FI7 A;  2QDI A;  3CDN A;  5DKQ A;  2WOS A;  1DTL A;  2NXQ A;  1G8I A;  2GGZ A;  3S0E A;  4CID A;  1XFU O;  3PM2 A;  1FBV A;  1KWO B;  2B1U A;  2K7D A;  3KHE A;  4JD9 A;  4XJK A;  3LCP C;  1UHN A;  1BMO A;  3R1P A;  1M46 A;  3SS4 A;  3TS5 C;  1L2O B;  1AJ5 A;  3CAB A;  4XJK B;  1DVI A;  1DGV A;  1EH2 A;  4USL A;  1SYM A;  3DF0 A;  4AOM A;  5HKY A;  3S0A A;  3FIA A;  2JXC A;  3OGN A;  1C7V A;  4NDD A;  5I8N A;  4GPL B;  5GQQ C;  3CZ0 A;  1OZS A;  1B47 A;  2JUL A;  3DF0 B;  2JC2 A;  1CMF A;  3DVM A;  2KYC A;  1ODB A;  2PMY A;  3BQ3 A;  2BL0 C;  1B8R A;  1M63 B;  2BKH B;  2QEB A;  1MUX A;  2WC6 A;  3AKA A;  4MSP A;  4DRW A;  1S6I A;  2ZRS A;  2KQY A;  1RK9 A;  2F33 A;  2ZKM X;  1EL4 A;  4NDC A;  1SCM C;  4MN0 A;  3LLE A;  1K93 D;  1B8L A;  1QS7 A;  1RRO A;  3KO0 A;  3NSL A;  1K95 A;  2WCF A;  3I5F C;  2H8V A;  3O78 A;  3NSK A;  4FTG A;  5I2O A;  4YGC B;  3S0F A;  3B88 A;  2BBM A;  2BCX A;  3BUO B;  3EK4 A;  4MLW A;  1S6C A;  2WC5 A;  3EG5 B;  2P6B B;  2KBI A;  3K21 A;  2LHI A;  1WDC B;  2LM5 A;  5IBW A;  1DEL A;  1JFK A;  2Y1N A;  2CTN A;  3TUY B;  2JT3 A;  1KK8 B;  2K7O A;  2KAV A;  2V53 A;  4L9M A;  1SR6 B;  1M39 A;  4ICB A;  1QWV A;  4ETO A;  2KI6 D;  4YGA A;  1LIN A;  1L7Z A;  1B9A A;  2LVV A;  3QRX A;  3I5G C;  1TNQ A;  1NCX A;  1N65 A;  4N1G A;  2HET A;  1CDN A;  1ZOT B;  2AUC A;  2JTT A;  3ZWH A;  1MXE A;  4OV2 A;  1CKK A;  1ZAC A;  2A4J A;  1OOJ A;  3GK4 X;  3SS5 A;  1MXL C;  2SAS A;  1QX2 A;  2WCE A;  1K94 A;  5DKN A;  3S0G A;  1XYD A;  2K0J A;  1EXR A;  2G9B A;  5G08 A;  1AK8 A;  2M1K B;  2WCJ A;  2LMT A;  3LL8 B;  4GGF A;  2JPO A;  1XFR A;  2BKI B;  2EC6 B;  2WC8 A;  3SG6 A;  5K89 A;  3BFA A;  1G33 A;  1DEK A;  3D77 A;  2M3W A;  3BFH A;  4UPG A;  3D78 A;  4M2Q A;  3PLF B;  2JNF A;  4INW A;  1Q80 A;  3SS3 A;  4BY4 A;  2PYQ A;  3L4A A;  1ORG A;  2CT9 A;  2JOJ A;  4N5X A;  3OX6 A;  1R6P A;  1UUS A;  2F3Z A;  1BLQ A;  1BOC A;  1QVI Y;  4TNC A;  1M45 A;  1A4P A;  3WHT B;  1KFX L;  1NUB A;  2PSR A;  1WRK A;  1JBA A;  3VRP A;  1SRA A;  1A03 A;  2EGD A;  2WCB A;  3OBV A;  3CLN A;  4MBE A;  4N1F A;  4OR9 B;  1KSO A;  1S6J A;  1IH0 A;  2MJW B;  1YVL A;  1V1F A;  3M0W A;  2GGM A;  1OE9 B;  2JT8 A;  2I94 A;  2QAC A;  2GTE A;  3I5H C;  5ER5 A;  1WRZ A;  1TCF A;  4GFT A;  2CXJ A;  1TUZ A;  1XFW O;  2BCB A;  1XFY O;  2WCM A;  1SL9 A;  3ZNI A;  1IWQ A;  3CZ2 A;  1QV1 A;  1DMO A;  1RTP 1;  3FS7 A;  1W9Z A;  1K90 D;  1S1E A;  2MLE C;  1OMV A;  1JC2 A;  4FQT A;  4YGE B;  2CBL A;  1B1G A;  1BF5 A;  4KYN A;  4FQO A;  5D3O A;  5D7F A;  5FI6 A;  3DVE A;  2KGR A;  1MWN A;  4PE1 A;  1QVI Z;  5KTY A;  1NX3 A;  2LMV A;  3VRN A;  1W7J B;  1AJ4 A;  1ZFS A;  3IQO A;  1DJH A;  2OS8 C;  4CFR A;  1JSA A;  1OOH A;  1CM1 A;  3TS5 B;  1U5I A;  1YUR A;  1PSR A;  1YRT B;  1CDM A;  1QAT A;  2O60 A;  5TNC A;  5J3X A;  2K61 A;  2DOQ A;  1CFF A;  2FJY A;  1Z2C B;  1G4Y R;  5AAN A;  1LKJ A;  1FW4 A;  1U5I B;  2KLE A;  5KU1 A;  2PAL A;  1XA5 A;  5AXI A;  1LVC D;  4MZL A;  1KFX S;  3RM1 A;  3TDI A;  3IQQ A;  5AER A;  1B4C A;  3SG2 A;  2CCM A;  1DJZ A;  1IG5 A;  2BL0 B;  4MEW A;  4PT1 A;  4OVN F;  1J55 A;  4CLN A;  2OPO A;  1OMR A;  2LMU A;  1E8A A;  3V2L A;  2P70 A;  1SCM B;  1YUU A;  2KFG A;  1YX7 A;  3NHT A;  4JKT A;  1LA3 A;  1GQM A;  2R2I A;  1F54 A;  4DS7 A;  3I5F B;  5I2L A;  1FPW A;  3WXA A;  3JVT C;  3OB2 B;  2TN4 A;  3SJS A;  2JWW A;  4JWQ A;  4ORA B;  1XFZ O;  3DYE A;  1K8U A;  2M8U A;  2L2E A;  4YGB B;  2JPT A;  3EKJ A;  1KFU L;  4QJ3 B;  4PDZ A;  3TDU A;  1SPY A;  2K8M B;  1DJY A;  2M7N A;  2NCP A;  3D76 A;  5AFP A;  1UHH A;  2KLD A;  4PHM A;  4P2Y B;  3A8R A;  3EVV A;  3OP0 A;  1IRJ A;  1CDL A;  1TIZ A;  2F2P A;  4DIR A;  2ZND A;  1KQV A;  2LCP A;  3I5G B;  2AAO A;  4PHJ A;  2ERB A;  5DIC A;  2I18 A;  1J7P A;  1Y1U A;  1PSB A;  2KBM A;  3RZS A;  4YGD B;  1KQM C;  4WQ2 A;  1KK7 Z;  1OOF A;  2NZ0 A;  1BU3 A;  2KSP A;  3R72 A;  1A2X A;  1CFD A;  1C7W A;  2ZNE A;  1F55 A;  1CDP A;  2JQ6 A;  1SY9 A;  1IQ5 A;  2M97 A;  3BJH A;  3PN7 C;  2JTZ A;  5CSJ A;  1SSE B;  1YR5 A;  2NLN A;  3DXL A;  2L2C A;  1H8B A;  1OOI X;  1NX2 A;  1DJI A;  2KFH A;  1UHI A;  1BR1 B;  1TWO A;  2EHB A;  2BBN A;  3FE8 A;  1CLL A;  3VRQ A;  2PRU A;  5B8I B;  1KFU S;  1R2U A;  1TCO B;  1XFX O;  1ZMZ A;  2K2F A;  4MVF A;  4WQ3 A;  2H2K A;  4PHN A;  2WCH A;  4C0L A;  1CMG A;  2QPT A;  1QLK A;  3D0Y A;  3MSE B;  3AKB A;  3I5H B;  5EL2 A;  3EKH A;  2F3Y A;  1NX1 A;  2MLF C;  1QTX A;  1CNP A;  4WRI A;  2LLS A;  1REC A;  3D0Y B;  2KPH A;  2L5X B;  3WNX B;  1BG1 A;  3D73 A;  3BYA A;  2WCL A;  2L51 A;  2L50 A;  4IL1 A;  2JRF A;  4PE7 A;  1Y6W A;  3H4S E;  2OTG C;  4XYN A;  1DT7 B;  1AP4 A;  3FE6 A;  1Y1A A;  4NDB A;  2H61 A;  3QME A;  2M7L A;  1TOP A;  2E6W A;  1DJG A;  1C3Z A;  3EVU A;  4CPV A;  1F8H A;  4GAO A;  1F4O A;  2WCK A;  3D74 A;  4GUK A;  2KI6 C;  2Y5I A;  3F45 A;  1SL7 A;  1WLZ A;  2FJU B;  3BXK A;  4OKH A;  1EG3 A;  1X02 A;  2OS8 B;  1GJY A;  2SCP A;  3K1E A;  3L47 A;  3ICB A;  3NSI A;  4I5J A;  4IJ7 A;  5CPV A;  3B87 A;  5CSN A;  5BPJ A;  2LLU A;  1HT9 A;  2M29 A;  3HX4 A;  3B86 A;  3VRR A;  1TUJ A;  4YRU A;  4I5K A;  1SNL A;  2L4H A;  3D75 A;  2JXL A;  4GBA A;  3VB1 A;  3OX5 A;  3AAJ A;  1J1D A;  3BUN B;  1K96 A;  3CYZ A;  1CM4 A;  2COL B;  3CZT X;  3L4L A;  2FCD A;  2Q4U A;  1RWY A;  1BJF A;  3IF7 A;  3I5I C;  1S3P A;  3C1V A;  1DC1 A;  4NQG A;  4YI8 A;  4Q04 A;  1LS8 A;  1NIW A;  1QIW A;  2E30 A;  3HCM A;  2KI4 C;  4JQ0 D;  4E68 A;  1DF0 A;  3JVT B;  3VGO A;  2K7C A;  1IJ6 A;  1N2D A;  1LXF C;  3CR4 X;  5JOL A;  2LLT A;  1JUO A;  1DF0 B;  1SCV A;  1T14 A;  1MF8 B;  3O4X A;  2M0R A;  1D1O A;  2ZRT A;  4GNK B;  1Y1X A;  4ORC B;  1C3Y A;  1FI6 A;  2KNE A;  3BOW A;  1J7Q A;  4R1E A;  5HLV A;  1QX7 A;  1QIV A;  3BFB A;  1PVA A;  3BOW B;  1VRK A;  1OOG A;  2KOT A;  3BUX B;  1AVS A;  4CFQ A;  1NP8 A;  1XO5 A;  1K9U A;  1CFP A;  1KK7 Y;  1TNW A;  3TZ1 A;  2L4I A;  1IQ3 A;  1SK6 D;  4MRX A;  4JPZ B;  2Q91 A;  2O5G A;  3S0B A;  1K2H A;  1B7T Y;  5CSI A;  4ZCV A;  2QEO A;  4I5L B;  1KQM B;  1BR4 B;  2HPS A;  1YUS A;  3Q8I A;  5FYX A;  3KPX A;  1MR8 A;  1JF2 A;  2LVK A;  1CB1 A;  1N0Y A;  1SW8 A;  3FWC A;  1TNX A;  1F71 A;  1UHK A;  2MHH A;  3D10 A;  4A4B A;  1XK4 C;  2I2R E;  1B8C A;  3N7H A;  1XFV O;  3PN7 B;  2M9G A;  3BUW B;  1IKU A;  3PJI A;  3SIB A;  1K9K A;  1CLM A;  5HKZ A;  1M31 A; 
#chains in the Genus database with same CATH homology
 1A75 A;  1YX8 A;  5JJG A;  4C0J A;  1FF1 A;  3GOF A;  5CSF A;  1WLM A;  1IGV A;  4ZCU A;  1A75 B;  2WOR A;  1WY9 A;  1JF0 A;  2KQ6 A;  4OCI A;  2BE6 A;  1C07 A;  1OQP A;  2L0P A;  1NYA A;  3PM8 A;  4QJ5 B;  5HKW A;  4HSZ A;  2VRG A;  2HQW A;  3AAK A;  2M49 B;  2ZN8 A;  3JTD C;  4F0Z B;  3LK0 A;  1B7T Z;  3GK2 A;  4MZK A;  1V1G A;  1YVH A;  2JNX A;  1ALV A;  4PE4 A;  2GV5 A;  1YTZ C;  2HF5 A;  1H4B A;  4MRY A;  1KWO C;  3RLZ A;  3OHM B;  2BE4 A;  2NCO A;  1W7I B;  1S26 D;  1PK0 D;  2OTG B;  5D69 A;  5AEQ A;  1DGU A;  2KFF A;  1TN4 A;  2M1U A;  1L2O C;  2LP2 A;  3O6B A;  1OMD A;  3CWG A;  1EG4 A;  1NPQ A;  2K2A A;  3PAT A;  4M2P A;  2F2O A;  2JU0 A;  4DUQ A;  1XVJ A;  3PAL A;  1CFC A;  4ORB B;  4QJ4 B;  2I7A A;  3EK7 A;  1NCY A;  2LV7 A;  1MHO A;  1J1E A;  1J7O A;  4GGN A;  4YBH B;  1EJ3 A;  2IS9 A;  4C0K A;  1WRL A;  4AQI A;  1PUL A;  2BCA A;  3KEV A;  5HLO A;  4HRG A;  1PAL A;  1JWD A;  1K9P A;  1YRU B;  1PRW A;  2LNK A;  2HQ8 A;  1NX0 A;  1YUT A;  2MBX A;  4U8D A;  1F70 A;  3NSO A;  5ER4 X;  3VRO A;  1ALW A;  3PSR A;  1QXP A;  4PE0 A;  1F4Q A;  1SKT A;  2ISD A;  3SG3 A;  3FWB A;  2PAS A;  2CNP A;  2KGB C;  5F6T A;  4D1E A;  3CGA A;  3DVJ A;  1NSH A;  1HQV A;  1QV0 A;  5DKR A;  1TRF A;  2KHN A;  3PFV A;  1WDC C;  2AMI A;  3I5I B;  3SG4 A;  5KSZ A;  1FI5 A;  3DD4 A;  3TUY C;  1KK8 C;  2FOT A;  2KYF A;  4HRE E;  4M2O A;  3TDZ A;  3EVR A;  1QJT A;  2KDH A;  1SR6 C;  1TNP A;  1UP5 A;  2K7B A;  2KI4 B;  2Y4Q A;  3CR2 A;  1S36 A;  1S5G Y;  1GGW A;  4A4C A;  1SBJ A;  1BOD A;  1RFJ A;  4P5O E;  1AUI B;  2KAX A;  1OSA A;  1KCY A;  4PAL A;  2Y1M A;  1SMG A;  2KAY A;  3EK8 A;  2LAP A;  3A4U B;  2LUC A;  1BT6 A;  2WND A;  4HRH A;  1IJ5 A;  2ZFD A;  2LP3 A;  1J7R A;  2FCE A;  3LK1 A;  3NXA A;  2LE9 B;  2F8P A;  3WHU B;  1UUR A;  2MRD A;  3CTN A;  3OB1 B;  3SG5 A;  2EC6 C;  2PVB A;  3O2P A;  1CTR A;  5I2Q A;  3CS1 A;  4BY5 A;  3O4Y A;  4GGF C;  1LA0 A;  1AHR A;  2RGI A;  1NWD A;  2BEC A;  4MZJ A;  1DJX A;  1JFJ A;  2LC5 A;  1XK4 A;  2D8N A;  1ZUZ A;  3CR5 X;  4I5N B;  1RJV A;  1Y0V H;  4AQJ A;  3SIA A;  1SL8 A;  3KF9 A;  1S5G Z;  2LAN A;  2JT0 A;  1GGZ A;  3DVK A;  1DJW A;  2H61 C;  3E3R A;  1QAS A;  5PAL A;  1KSM A;  2LVI A;  1TTX A;  2LHL A;  3GK1 A;  2LVJ A;  1CLB A;  1A29 A;  3SG7 A;  1QLS A;  1UWO A;  1OZO A;  2G2B A;  4YI9 A;  2ZN9 A;  2L98 A;  2LUX A;  1MQ1 A;  1PVB A;  1UHJ A;  5HYD A;  1NCZ A;  3BUM B;  4PCW A;  2MA2 A;  3JTD B;  2JZI A;  2MAZ A;  1QX5 B;  4DCK A;  4PHK A;  5DKQ A;  2WOS A;  1DTL A;  2NXQ A;  1G8I A;  2GGZ A;  4CID A;  1XFU O;  1FBV A;  1KWO B;  2B1U A;  2K7D A;  3KHE A;  4XJK A;  3LCP C;  1UHN A;  1BMO A;  1M46 A;  3TS5 C;  1L2O B;  1AJ5 A;  4XJK B;  1DVI A;  1DGV A;  1EH2 A;  4USL A;  1SYM A;  3DF0 A;  4AOM A;  5HKY A;  3FIA A;  2JXC A;  1C7V A;  4NDD A;  5I8N A;  4GPL B;  5GQQ C;  1OZS A;  1B47 A;  2JUL A;  3DF0 B;  2JC2 A;  1CMF A;  3DVM A;  2KYC A;  1ODB A;  2PMY A;  3BQ3 A;  2BL0 C;  1B8R A;  1M63 B;  2BKH B;  3AKA A;  1MUX A;  4DRW A;  4MSP A;  1S6I A;  2ZRS A;  2KQY A;  1RK9 A;  2F33 A;  2ZKM X;  1EL4 A;  4NDC A;  1SCM C;  4MN0 A;  3LLE A;  1K93 D;  1B8L A;  1QS7 A;  1RRO A;  3KO0 A;  3NSL A;  1K95 A;  2WCF A;  3I5F C;  3O78 A;  5I2O A;  3NSK A;  4FTG A;  4YGC B;  2BBM A;  2BCX A;  3BUO B;  3EK4 A;  4MLW A;  1S6C A;  2P6B B;  2KBI A;  3K21 A;  2LHI A;  1WDC B;  2LM5 A;  5IBW A;  2Y1N A;  1JFK A;  2CTN A;  3TUY B;  2JT3 A;  1KK8 B;  2K7O A;  2KAV A;  2V53 A;  4L9M A;  1SR6 B;  1M39 A;  4ICB A;  4ETO A;  2KI6 D;  4YGA A;  1LIN A;  1L7Z A;  1B9A A;  2LVV A;  3QRX A;  3I5G C;  1TNQ A;  1NCX A;  1N65 A;  4N1G A;  2HET A;  1CDN A;  1ZOT B;  2AUC A;  2JTT A;  3ZWH A;  1MXE A;  4OV2 A;  1CKK A;  1ZAC A;  2A4J A;  1OOJ A;  3GK4 X;  1MXL C;  2SAS A;  1QX2 A;  2WCE A;  1K94 A;  5DKN A;  1XYD A;  2K0J A;  1EXR A;  2G9B A;  5G08 A;  1AK8 A;  2M1K B;  2LMT A;  3LL8 B;  4GGF A;  2BKI B;  2EC6 B;  2WC8 A;  3SG6 A;  5K89 A;  1G33 A;  2M3W A;  4UPG A;  4M2Q A;  3PLF B;  2JNF A;  4BY4 A;  1Q80 A;  2CT9 A;  2JOJ A;  4N5X A;  3OX6 A;  1R6P A;  1UUS A;  2F3Z A;  1BLQ A;  1BOC A;  1QVI Y;  4TNC A;  1M45 A;  1A4P A;  3WHT B;  1KFX L;  1NUB A;  2PSR A;  1WRK A;  1JBA A;  3VRP A;  1SRA A;  1A03 A;  2EGD A;  2WCB A;  3CLN A;  4MBE A;  4N1F A;  4OR9 B;  1KSO A;  1S6J A;  1IH0 A;  2MJW B;  1YVL A;  1V1F A;  3M0W A;  2GGM A;  1OE9 B;  2JT8 A;  2I94 A;  2QAC A;  3I5H C;  5ER5 A;  1WRZ A;  1TCF A;  4GFT A;  2CXJ A;  1XFW O;  2BCB A;  1XFY O;  1SL9 A;  3ZNI A;  1IWQ A;  1QV1 A;  1DMO A;  1RTP 1;  3FS7 A;  1K90 D;  1S1E A;  2MLE C;  1OMV A;  1JC2 A;  4YGE B;  1B1G A;  2CBL A;  1BF5 A;  4FQO A;  5D7F A;  3DVE A;  2KGR A;  1MWN A;  4PE1 A;  1QVI Z;  5KTY A;  1NX3 A;  2LMV A;  3VRN A;  1W7J B;  1AJ4 A;  1ZFS A;  3IQO A;  1DJH A;  2OS8 C;  4CFR A;  1JSA A;  3TS5 B;  1CM1 A;  1U5I A;  1YUR A;  1PSR A;  1YRT B;  1CDM A;  1QAT A;  2O60 A;  5TNC A;  5J3X A;  2K61 A;  2DOQ A;  1CFF A;  5AAN A;  1G4Y R;  5KU1 A;  1LKJ A;  1FW4 A;  1U5I B;  2PAL A;  1XA5 A;  5AXI A;  1LVC D;  4MZL A;  1KFX S;  3RM1 A;  3TDI A;  3IQQ A;  5AER A;  1B4C A;  3SG2 A;  2CCM A;  1DJZ A;  1IG5 A;  2BL0 B;  4MEW A;  4OVN F;  1J55 A;  4CLN A;  2OPO A;  1OMR A;  2LMU A;  1E8A A;  1SCM B;  1YUU A;  2KFG A;  1YX7 A;  1LA3 A;  1GQM A;  2R2I A;  1F54 A;  4DS7 A;  3I5F B;  5I2L A;  1FPW A;  3WXA A;  3JVT C;  3OB2 B;  2TN4 A;  3SJS A;  2JWW A;  4JWQ A;  4ORA B;  1XFZ O;  1K8U A;  2M8U A;  2L2E A;  4YGB B;  2JPT A;  3EKJ A;  1KFU L;  4QJ3 B;  4PDZ A;  3TDU A;  1SPY A;  2K8M B;  1DJY A;  2M7N A;  2NCP A;  5AFP A;  1UHH A;  4PHM A;  4P2Y B;  3A8R A;  3EVV A;  3OP0 A;  1IRJ A;  1CDL A;  1TIZ A;  2F2P A;  4DIR A;  2ZND A;  1KQV A;  2LCP A;  3I5G B;  2AAO A;  4PHJ A;  2I18 A;  1J7P A;  1Y1U A;  1PSB A;  2KBM A;  4YGD B;  1KQM C;  4WQ2 A;  1KK7 Z;  2NZ0 A;  1BU3 A;  2KSP A;  1A2X A;  1CFD A;  1C7W A;  2ZNE A;  1F55 A;  1CDP A;  2JQ6 A;  1SY9 A;  1IQ5 A;  2M97 A;  3PN7 C;  2JTZ A;  5CSJ A;  1YR5 A;  2NLN A;  1H8B A;  1NX2 A;  1DJI A;  2KFH A;  1UHI A;  1BR1 B;  2EHB A;  2BBN A;  1CLL A;  3VRQ A;  2PRU A;  5B8I B;  1KFU S;  1R2U A;  1TCO B;  1XFX O;  1ZMZ A;  2K2F A;  4MVF A;  4WQ3 A;  2H2K A;  4PHN A;  4C0L A;  1CMG A;  2QPT A;  1QLK A;  3D0Y A;  3MSE B;  3AKB A;  3I5H B;  3EKH A;  2F3Y A;  1NX1 A;  2MLF C;  1QTX A;  1CNP A;  4WRI A;  2LLS A;  1REC A;  3D0Y B;  3WNX B;  2L5X B;  1BG1 A;  3BYA A;  2L51 A;  2L50 A;  4IL1 A;  2JRF A;  4PE7 A;  1Y6W A;  3H4S E;  2OTG C;  4XYN A;  1DT7 B;  1AP4 A;  1Y1A A;  4NDB A;  2H61 A;  2M7L A;  1TOP A;  2E6W A;  1DJG A;  3EVU A;  4CPV A;  1F8H A;  4GAO A;  1F4O A;  4GUK A;  2KI6 C;  2Y5I A;  3F45 A;  1SL7 A;  1WLZ A;  2FJU B;  3BXK A;  4OKH A;  1EG3 A;  1X02 A;  2OS8 B;  1GJY A;  2SCP A;  3NSI A;  3ICB A;  4I5J A;  5CSN A;  5CPV A;  5BPJ A;  2LLU A;  1HT9 A;  2M29 A;  3HX4 A;  3VRR A;  4YRU A;  4I5K A;  1SNL A;  2L4H A;  2JXL A;  4GBA A;  3OX5 A;  3AAJ A;  1J1D A;  3BUN B;  1K96 A;  3CZT X;  1CM4 A;  2COL B;  2FCD A;  2Q4U A;  1RWY A;  1BJF A;  3IF7 A;  3I5I C;  1S3P A;  3C1V A;  4NQG A;  4YI8 A;  4Q04 A;  1NIW A;  1QIW A;  2E30 A;  3HCM A;  2KI4 C;  4JQ0 D;  4E68 A;  1DF0 A;  3JVT B;  3VGO A;  2K7C A;  1IJ6 A;  1N2D A;  1LXF C;  3CR4 X;  5JOL A;  2LLT A;  1JUO A;  1DF0 B;  1SCV A;  1MF8 B;  2M0R A;  1D1O A;  2ZRT A;  4GNK B;  1Y1X A;  4ORC B;  1FI6 A;  2KNE A;  3BOW A;  1J7Q A;  4R1E A;  5HLV A;  1QX7 A;  1QIV A;  1PVA A;  3BOW B;  1VRK A;  2KOT A;  3BUX B;  1AVS A;  4CFQ A;  1NP8 A;  1XO5 A;  1K9U A;  1CFP A;  1KK7 Y;  1TNW A;  3TZ1 A;  2L4I A;  1IQ3 A;  1SK6 D;  4MRX A;  4JPZ B;  2Q91 A;  2O5G A;  1K2H A;  1B7T Y;  5CSI A;  4ZCV A;  4I5L B;  1KQM B;  1BR4 B;  2HPS A;  1YUS A;  5FYX A;  3KPX A;  1MR8 A;  1JF2 A;  2LVK A;  1CB1 A;  1N0Y A;  1SW8 A;  3FWC A;  1TNX A;  1F71 A;  1UHK A;  2MHH A;  3D10 A;  4A4B A;  1XK4 C;  2I2R E;  1B8C A;  3PN7 B;  1XFV O;  2M9G A;  3BUW B;  1IKU A;  3SIB A;  1K9K A;  1CLM A;  5HKZ A;  1M31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...