1AHRA

Calmodulin mutant with a two residue deletion in the central helix
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ahrA00
2AMIA 4CIDA 2FCDA 3OX6A 1SYMA 1WDCB 1A29A 5AXIA 5KSZA 2OTGC 4AQIA 2QPTA 1KK7Y 4I5LB 3SG7A 2V53A 1CLLA 1RJVA 2GV5A 2ZNEA 3TS5B 2HQWA 4M2PA 2JXCA 1A75B 2WCEA 1K90D 1SL9A 1WY9A 1PALA 2HF5A 2KQYA 4YI9A 1IWQA 2M97A 1B1GA 1IG5A 2KQ6A 1ALVA 2LCPA 5DKNA 4PHNA 2JULA 2Y1MA 5HKWA 1QVIY 1AUIB 5HKZA 4GGFC 1BODA 1H8BA 2SCPA 3CS1A 2ZRTA 1S6JA 1IQ5A 3HX4A 2KAVA 4PHMA 1QIWA 1ZOTB 1S36A 2AUCA 4PE7A 2LMVA 1RECA 2L98A 2WCBA 4M2QA 4QJ5B 1C7VA 1UUSA 3CR4X 1QV0A 1YUTA 2L0PA 1QASA 4N1GA 1SR6C 1XFXO 1JFJA 1J55A 3BOWA 1DGUA 4PDZA 3EVUA 1QX5B 4L9MA 2OTGB 3GK2A 1DF0B 4JQ0D 1X02A 2BBMA 2MRDA 3I5GC 4DS7A 1A2XA 1OSAA 1MR8A 1LVCD 3BUXB 2MAZA 2LNKA 3WHTB 2NZ0A 5AANA 3CR2A 2H2KA 1XFUO 1NX3A 3LCPC 2ZRSA 5JOLA 3EVRA 4AOMA 2JNFA 3TDZA 2MJWB 1R6PA 1BT6A 3O4YA 1FBVA 2KSPA 4MZLA 1NYAA 2JC2A 2KFFA 3PSRA 2WOSA 2KBMA 1YX8A 4MSPA 4D1EA 1UHKA 3K21A 3SIAA 3KHEA 2M1KB 3VGOA 1SK6D 4A4CA 1J7PA 1SCVA 1LA0A 3PN7B 1AK8A 2M49B 2PVBA 1BU3A 1DJWA 1WLMA 2DOQA 2Y5IA 4P2YB 2KYFA 2LAPA 3EKHA 1IJ6A 1G4YR 1SR6B 2PALA 2CT9A 3SJSA 3EK8A 2F8PA 2KFGA 4GAOA 1VRKA 4C0LA 1IJ5A 1F4QA 3SG5A 1J7RA 1S1EA 1KFUS 3FIAA 3I5GB 3D0YB 3IF7A 1ODBA 3NSIA 1B7TY 2QACA 1NCZA 1B9AA 2KDHA 2MBXA 1WDCC 1XYDA 1YUUA 3O2PA 3OB1B 1MUXA 2KOTA 3BOWB 4HSZA 2KNEA 2K7BA 1XK4C 1OZSA 1WLZA 3TS5C 1BMOA 1UWOA 2K7OA 5CSJA 4XJKA 1NX0A 2LC5A 1EXRA 3FS7A 4ETOA 1QLKA 1K95A 1OMVA 4HRHA 1CDLA 1SRAA 2BKHB 1AJ4A 2KAYA 1JFKA 5I2QA 2Q91A 1U5IA 2M8UA 3VROA 1XFZO 4CFRA 1MQ1A 2G2BA 4TNCA 1Y1UA 5F6TA 3DD4A 1DGVA 1MHOA 1FW4A 2MA2A 2CTNA 4ORAB 4MVFA 1YX7A 5FYXA 4PHJA 1SY9A 3ICBA 1TN4A 3OHMB 3E3RA 1GGZA 1B8CA 1TOPA 1Y1AA 1KK7Z 2IS9A 4NQGA 5D7FA 2H61C 5I2LA 4MBEA 2HETA 1K96A 3TZ1A 1NWDA 1K93D 4QJ3B 1K94A 1CFFA 3FWBA 4C0KA 2ISDA 4OR9B 1J7QA 2FOTA 5D69A 2I18A 3NSLA 1OQPA 1Y0VH 4N5XA 5GQQC 1LINA 4YRUA 1CMGA 2I2RE 2BCXA 1NPQA 1EL4A 1YURA 2JPTA 2PASA 3CWGA 1BOCA 1KQMC 1DVIA 1KFXL 2WC8A 2M0RA 4OCIA 1CLMA 2LLTA 3DF0B 5ER4X 1KCYA 4USLA 2FCEA 1FI5A 2JU0A 2AAOA 4YGAA 2LUCA 2B1UA 1KSMA 1YVLA 3PN7C 3AAKA 3BUNB 3PM8A 5KTYA 2WCFA 4JPZB 1LKJA 3DVMA 4ORCB 1J1DA 3EKJA 2KI4C 1TRFA 2ZN9A 2LVKA 2MLFC 3KO0A 2FJUB 4WRIA 1U5IB 1WRZA 5DKRA 1DMOA 1L2OB 1JUOA 1OZOA 1OE9B 3RM1A 3TDIA 2KI6C 1M45A 1XA5A 1BR1B 3SG6A 2E6WA 1B47A 1TNPA 1JF0A 1Y6WA 2JQ6A 1CDPA 1DJGA 1KWOC 1SL8A 3O6BA 5HKYA 1RWYA 2EC6B 1M31A 1PSRA 2M1UA 3A4UB 1XFWO 1M39A 2LMUA 1LA3A 5ER5A 1KQMB 1KK8B 1UHNA 2LUXA 1QS7A 4GUKA 2JRFA 1NX1A 1G33A 2LVJA 2KYCA 4CFQA 1QV1A 1PK0D 3LLEA 2COLB 4YI8A 3WNXB 2L51A 4HREE 1CFCA 1W7JB 4DCKA 3AKAA 4WQ2A 1YRTB 3CZTX 3LL8B 5HLVA 1ZUZA 2ZNDA 1V1FA 2KI4B 2CCMA 4FQOA 1UURA 4F0ZB 1SMGA 2RGIA 1B7TZ 1PSBA 1M63B 1YVHA 1N0YA 1EG3A 1OOJA 3CLNA 1AVSA 1L7ZA 3GOFA 3DVJA 3SG3A 1H4BA 2CBLA 3PLFB 4IL1A 1NUBA 1QTXA 4PE1A 1F8HA 3D10A 2E30A 1DJYA 3LK1A 2PRUA 1KWOB 1WRLA 3CR5X 1ZFSA 1SCMB 1XFYO 1XO5A 2JT8A 1NX2A 2LLUA 1CNPA 1V1GA 2L50A 4P5OE 1EJ3A 1J7OA 3OX5A 4PE4A 1Q80A 1M46A 2Y4QA 2KHNA 1ZACA 5G08A 5KU1A 1CMFA 1S5GY 2K8MB 4M2OA 5TNCA 3GK4X 2G9BA 1S26D 3AAJA 1RFJA 4PE0A 4CLNA 3JVTC 1A75A 1K9PA 4C0JA 1A4PA 2JT3A 5K89A 3TUYC 2F3YA 1J1EA 2Q4UA 1B4CA 2L2EA 1IH0A 1C07A 2LM5A 3EK7A 1KSOA 1FI6A 2CNPA 4E68A 1DJIA 1QX2A 2LHIA 4R1EA 1DT7B 1TCOB 1PVAA 1CM1A 2LLSA 5B8IB 2BCBA 1NSHA 4ZCUA 1IQ3A 3EK4A 5AERA 2I7AA 2LV7A 2M7NA 3JTDC 2HPSA 1K8UA 1K9UA 2VRGA 3BUMB 1DJXA 1DJZA 3OB2B 2MLEC 2OPOA 1ALWA 1IRJA 1L2OC 2HQ8A 2NXQA 1BF5A 1UP5A 1N2DA 4OVNF 1IGVA 1CFPA 1F71A 1F70A 1F54A 4GGNA 3KPXA 5CSFA 1QATA 1F55A 4MRXA 1DF0A 2KFHA 4ZCVA 3TDUA 2EC6C 1JC2A 3I5FB 2M9GA 3AKBA 5HLOA 3ZNIA 2P6BB 1CLBA 3BUOB 1SW8A 5JJGA 3JVTB 5I8NA 1QVIZ 4MZKA 3I5IC 2BE4A 2MHHA 1C7WA 3TUYB 2LHLA 4PCWA 1KK8C 1FPWA 2JXLA 3F45A 3PFVA 2A4JA 3BYAA 5HYDA 4ORBB 1JSAA 2BECA 3VRPA 1N65A 1MXEA 2CXJA 1AJ5A 1OMRA 4XJKB 4N1FA 4GGFA 1RTP1 4YGEB 2NCOA 2KGBC 1KFUL 3JTDB 1MWNA 4OV2A 2LP3A 2NLNA 1A03A 3SIBA 1CB1A 2M7LA 1F4OA 2PSRA 3SG4A 3HCMA 1XFVO 1IKUA 3CGAA 1R2UA 2TN4A 2ZN8A 1UHIA 2JOJA 2OS8C 4YGBB 1GGWA 1PVBA 2K7DA 4FTGA 1NP8A 1Y1XA 1YTZC 2F2PA 3WXAA 2KGRA 1UHJA 1CDMA 2BL0C 3NXAA 1NIWA 2KBIA 1BG1A 1SCMC 2SASA 1CTRA 3D0YA 3EVVA 4MN0A 5DKQA 2LVVA 4WQ3A 2GGZA 2K2AA 2KI6D 2K2FA 3OP0A 3FWCA 4JWQA 1EG4A 1YR5A 4AQJA 2M3WA 1K9KA 2M29A 5AFPA 2ZFDA 3I5IB 5CPVA 5CSNA 4BY4A 1S6CA 3PATA 1DTLA 1MF8B 3BXKA 2L5XB 1PRWA 3DVKA 1D1OA 2WNDA 1CM4A 1HQVA 3RLZA 3LK0A 1FF1A 2LMTA 3C1VA 4GBAA 1JWDA 2K61A 4DRWA 1TTXA 1QX7A 3IQQA 1E8AA 1JF2A 1SKTA 4I5KA 1ZMZA 4PHKA 1SNLA 1YUSA 1QIVA 1QLSA 2K0JA 4I5NB 4MZJA 1GJYA 1TNXA 1UHHA 1NCYA 4PALA 1AHRA 1OMDA 2JT0A 1K2HA 1SL7A 2OS8B 2L4IA 2LANA 2BBNA 1SPYA 1LXFC 3CTNA 4MRYA 5PALA 2BL0B 5AEQA 1QXPA 4NDBA 1S5GZ 1W7IB 2JTZA 3DVEA 3NSOA 1GQMA 4HRGA 2GGMA 2LE9B 4ICBA 1B8RA 1KFXS 3GK1A 5IBWA 4YGDB 1EH2A 1JBAA 2F2OA 4UPGA 1HT9A 1TIZA 1B8LA 1S3PA 5J3XA 4DUQA 1NCXA 3VRNA 4NDDA 1XK4A 2I94A 2JWWA 3I5FC 4MEWA 1YRUB 4A4BA 2WORA 4Q04A 1PULA 3I5HC 1G8IA 1RROA 1TNWA 2JZIA 3H4SE 3O78A 3NSKA 2L4HA 1MXLC 5CSIA 2PMYA 1RK9A 3QRXA 1AP4A 2BCAA 4YGCB 4YBHB 2BE6A 2O5GA 1CFDA 3DF0A 1S6IA 3SG2A 2JTTA 1BLQA 2K7CA 2Y1NA 3IQOA 4DIRA 1WRKA 1KQVA 5I2OA 2O60A 1XVJA 1BJFA 3VRRA 4QJ4B 3WHUB 2R2IA 2LVIA 4XYNA 4GPLB 2KAXA 2NCPA 2ZKMX 2JNXA 2F33A 1SBJA 2H61A 3M0WA 3PALA 4NDCA 1CDNA 3ZWHA 2F3ZA 4BY5A 2LP2A 4CPVA 2BKIB 3A8RA 4GNKB 1QJTA 3BUWB 1CKKA 1TNQA 4OKHA 2D8NA 3KF9A 1BR4B 3BQ3A 3I5HB 1DJHA 2EGDA 4GFTA 3VRQA 4I5JA 5BPJA 2EHBA 4U8DA 3MSEB 3KEVA 1TCFA 4MLWA
chains in the Genus database with same CATH superfamily
2AMIA 1DELA 2FCDA 3OX6A 1SYMA 4CIDA 1WDCB 1A29A 5AXIA 5KSZA 2OTGC 4AQIA 2QPTA 1KK7Y 4I5LB 3SG7A 2V53A 1CLLA 1RJVA 2GV5A 2ZNEA 3TS5B 2HQWA 2WCLA 2FJYA 3BJHA 4M2PA 2JXCA 1A75B 2WCEA 1K90D 1SL9A 1WY9A 1PALA 2HF5A 2KQYA 4YI9A 1IWQA 2M97A 1B1GA 1IG5A 4INWA 2KQ6A 1ALVA 2LCPA 5DKNA 2KPHA 4PHNA 2JULA 2Y1MA 5HKWA 3D73A 1QVIY 1AUIB 5HKZA 4GGFC 1BODA 5FI2A 1H8BA 2SCPA 3CS1A 3RZSA 2ZRTA 1S6JA 1IQ5A 3HX4A 1TUZA 2KAVA 4PHMA 1QIWA 1ZOTB 1S36A 2AUCA 3D76A 4PE7A 2LMVA 1RECA 2L98A 2WCBA 4M2QA 4QJ5B 1DC1A 1UUSA 3CR4X 1C7VA 1QV0A 1YUTA 2L0PA 1QASA 4N1GA 2WCMA 1SR6C 3Q8IA 1XFXO 1JFJA 1J55A 3BOWA 1DGUA 4PDZA 3EVUA 1QX5B 4L9MA 2OTGB 3SS5A 3GK2A 1DF0B 4JQ0D 1X02A 2BBMA 2MRDA 3B87A 3I5GC 4DS7A 1A2XA 1DEKA 1OSAA 1MR8A 1LVCD 3BUXB 2MAZA 2LNKA 3WHTB 2ERBA 2NZ0A 5AANA 3CR2A 2H2KA 1XFUO 1NX3A 3DY9A 3LCPC 2ZRSA 5JOLA 3EVRA 4AOMA 2JNFA 3TDZA 2MJWB 1R6PA 1BT6A 3O4YA 1FBVA 2KSPA 4MZLA 1NYAA 2JC2A 2KFFA 3PSRA 2WOSA 2KBMA 1OW4A 1YX8A 4MSPA 4D1EA 1UHKA 3K21A 3SIAA 3KHEA 2M1KB 3VGOA 1SK6D 4A4CA 1OOIX 1J7PA 1SCVA 1LA0A 3IVTA 3PN7B 1AK8A 2M49B 2PVBA 1BU3A 1DJWA 1WLMA 2DOQA 2Y5IA 4P2YB 2KYFA 2LAPA 3EKHA 1IJ6A 1G4YR 1SR6B 2PALA 3D74A 2CT9A 4KYNA 3SJSA 3EK8A 2F8PA 2KFGA 4GAOA 1VRKA 4C0LA 1IJ5A 1F4QA 3SG5A 1J7RA 1S1EA 1KFUS 3FIAA 3I5GB 3D0YB 3IF7A 1ODBA 1ORGA 3NSIA 1B7TY 2QACA 2H8VA 1NCZA 1B9AA 4JKTA 2KDHA 3R1PA 2MBXA 5I94A 4F7FA 1WDCC 1XYDA 1YUUA 3O2PA 3OB1B 1MUXA 2KOTA 4FQTA 3BOWB 4HSZA 2KNEA 2WCHA 2K7BA 1XK4C 1OZSA 2P70A 1WLZA 3PM2A 1BMOA 3TS5C 1UWOA 2K7OA 5CSJA 4XJKA 1NX0A 2LC5A 1EXRA 3FS7A 4ETOA 1QLKA 2JPOA 1K95A 1OMVA 4HRHA 1CDLA 1SRAA 2BKHB 1AJ4A 3EG5B 2KAYA 1JFKA 3B6XA 3DYEA 5I2QA 2Q91A 1U5IA 2M8UA 3VROA 1XFZO 4CFRA 1MQ1A 2G2BA 4TNCA 1Y1UA 1GM0A 5F6TA 3DD4A 1DGVA 1XFRA 1MHOA 1FW4A 2MA2A 2CTNA 4ORAB 4MVFA 1YX7A 5FYXA 4PHJA 1SY9A 3ICBA 3BFHA 1TN4A 1Z4HA 2PYQA 3OHMB 3E3RA 1GGZA 1B8CA 1TOPA 1Y1AA 1KK7Z 2IS9A 4NQGA 5D7FA 2H61C 5I2LA 2QDIA 4MBEA 2HETA 1K96A 1LS8A 3TZ1A 1NWDA 1K93D 4QJ3B 2PQLA 1K94A 1CFFA 3FWBA 4INXA 2ISDA 4OR9B 3S0BA 4C0KA 1J7QA 2FOTA 5D69A 2I18A 3NSLA 1OQPA 1Y0VH 3CABA 4N5XA 3D78A 1SSEB 5GQQC 1LINA 4YRUA 1CMGA 2I2RE 2BCXA 1NPQA 3DXLA 1EL4A 2WCKA 1YURA 2JPTA 2PASA 3CWGA 1BOCA 1KQMC 1DVIA 1KFXL 2WC8A 3FE9A 2M0RA 4OCIA 1CLMA 2LLTA 3DF0B 5ER4X 1KCYA 4USLA 2FCEA 1FI5A 2JU0A 2AAOA 4YGAA 2LUCA 2B1UA 1KSMA 1YVLA 2GTEA 3PN7C 3AAKA 3BUNB 3PM8A 5KTYA 2WCFA 4JPZB 1LKJA 3DVMA 4ORCB 1J1DA 3EKJA 2KI4C 1TRFA 2ZN9A 2LVKA 2MLFC 1QWVA 4PT1A 3KO0A 1W9ZA 2FJUB 4WRIA 3R1VA 1U5IB 1WRZA 5DKRA 1DMOA 1L2OB 1JUOA 1OZOA 1OE9B 3NHIA 3RM1A 3TDIA 2KI6C 3S0GA 1M45A 1XA5A 1BR1B 3SG6A 2E6WA 2WCJA 1B47A 1TNPA 1JF0A 1Y6WA 3OBVA 1C3ZA 2JQ6A 5D3OA 1CDPA 1DJGA 1KWOC 1SL8A 3O6BA 5HKYA 1RWYA 2EC6B 1M31A 1PSRA 2QEHA 2M1UA 3A4UB 1XFWO 1M39A 2LMUA 1LA3A 5ER5A 1KQMB 1KK8B 1UHNA 2LUXA 1QS7A 4GUKA 2JRFA 1NX1A 1G33A 2LVJA 2KYCA 3UNWA 4CFQA 1QV1A 5HL1A 1PK0D 3LLEA 2COLB 4YI8A 3WNXB 2L51A 4HREE 1CFCA 1W7JB 3R1OA 4DCKA 3AKAA 2QEOA 4WQ2A 1YRTB 3CZTX 3LL8B 5HLVA 1ZUZA 2ZNDA 1V1FA 2KI4B 3B86A 2CCMA 4FQOA 1UURA 3DZTA 4F0ZB 1SMGA 2RGIA 1B7TZ 1PSBA 1M63B 1YVHA 1N0YA 1EG3A 1OOJA 3CLNA 1AVSA 1L7ZA 3CZ0A 3DVJA 3GOFA 3SG3A 1H4BA 2CBLA 3PLFB 4IL1A 1NUBA 3S0EA 1QTXA 3R72A 4PE1A 1F8HA 3D10A 2E30A 1DJYA 3LK1A 2PRUA 3PJIA 1KWOB 1WRLA 3CR5X 1ZFSA 1SCMB 1XFYO 1XO5A 2JT8A 1NX2A 2LLUA 3S0FA 1Z2CB 1CNPA 1V1GA 2L50A 4P5OE 1EJ3A 3QMEA 1J7OA 3OX5A 4PE4A 1Q80A 1M46A 2Y4QA 2KHNA 3NGVA 1TWOA 1ZACA 2L5YA 5G08A 5KU1A 1CMFA 1S5GY 2K8MB 3UO9A 4M2OA 3FE6A 5TNCA 3GK4X 2G9BA 1S26D 3AAJA 1RFJA 4PE0A 4CLNA 3JVTC 1A75A 1K9PA 4C0JA 1A4PA 2JT3A 5K89A 3TUYC 2F3YA 1J1EA 3CYZA 2Q4UA 3CZ2A 1B4CA 4JD9A 2L2EA 1IH0A 1C07A 2LM5A 3EK7A 1KSOA 1FI6A 2CNPA 4E68A 1DJIA 1QX2A 1OOHA 2LHIA 4R1EA 1DT7B 2WC6A 1TCOB 1IIOA 3CDNA 1PVAA 1CM1A 2LLSA 5B8IB 2BCBA 1NSHA 2YGUA 4ZCUA 1IQ3A 3EK4A 5AERA 2I7AA 2LV7A 2M7NA 3JTDC 2HPSA 1K8UA 1K9UA 2VRGA 3O4XA 3BUMB 1DJXA 1DJZA 3OB2B 2MLEC 2OPOA 1ALWA 1IRJA 1L2OC 2HQ8A 2NXQA 1BF5A 1UP5A 1N2DA 4OVNF 1IGVA 1CFPA 1F71A 1F70A 1F54A 4GGNA 3KPXA 5CSFA 1QATA 1T14A 1F55A 3N7HA 1C3YA 4MRXA 1DF0A 2KFHA 4ZCVA 2QEVA 2EC6C 3TDUA 2WC5A 5FI7A 1JC2A 3I5FB 2M9GA 3AKBA 5HLOA 3ZNIA 2P6BB 1CLBA 3BUOB 1SW8A 5JJGA 3JVTB 3B88A 5I8NA 1QVIZ 2QEBA 4MZKA 3I5IC 2BE4A 2MHHA 1C7WA 5DICA 3TUYB 2LHLA 4PCWA 1KK8C 1FPWA 2JXLA 3F45A 3PFVA 2A4JA 3BYAA 5HYDA 4ORBB 1JSAA 2BECA 5EL2A 1N65A 3VRPA 1MXEA 2L2CA 3S0DA 2CXJA 1AJ5A 1OMRA 1P28A 4XJKB 4N1FA 4GGFA 1RTP1 4YGEB 2NCOA 2KGBC 1KFUL 3JTDB 1MWNA 4OV2A 2LP3A 2NLNA 1A03A 3SIBA 1CB1A 2M7LA 1F4OA 2PSRA 3SG4A 3HCMA 1XFVO 1IKUA 3CGAA 1R2UA 2TN4A 2ZN8A 1UHIA 2JOJA 2OS8C 4YGBB 1GGWA 1PVBA 2K7DA 4FTGA 1NP8A 1Y1XA 1YTZC 2F2PA 3WXAA 2KGRA 1UHJA 1CDMA 2BL0C 3NXAA 2BNXA 1NIWA 2KBIA 2KLEA 1BG1A 1SCMC 2SASA 1CTRA 3D0YA 3EVVA 3NHTA 4MN0A 5DKQA 2LVVA 3FE8A 2GGZA 2K2AA 2KI6D 2K2FA 3OP0A 4WQ3A 3FWCA 3L47A 4JWQA 1EG4A 3D77A 1YR5A 4AQJA 2M3WA 1K9KA 2M29A 5AFPA 2ZFDA 3I5IB 5CPVA 5CSNA 4BY4A 1S6CA 3PATA 1DTLA 1MF8B 3B7AA 2L5XB 3BXKA 1PRWA 3DVKA 1D1OA 2WNDA 1CM4A 1HQVA 3RLZA 3LK0A 1FF1A 2LMTA 3C1VA 4GBAA 5FI6A 1JWDA 2K61A 3K1EA 4DRWA 3V2LA 1TTXA 1QX7A 3IQQA 1E8AA 1JF2A 3OGNA 1SKTA 1TUJA 4I5KA 1ZMZA 4PHKA 1SNLA 1YUSA 1QIVA 1QLSA 1OOFA 2K0JA 4I5NB 4MZJA 1GJYA 1TNXA 1UHHA 3L4LA 1NCYA 3S0AA 4PALA 1AHRA 1OMDA 1DQEA 1OOGA 2JT0A 1K2HA 1SL7A 2OS8B 2L4IA 2LANA 2BBNA 1SPYA 1LXFC 3CTNA 2K60A 4MRYA 3L4AA 5PALA 2BL0B 5AEQA 3SS3A 1QXPA 4NDBA 1S5GZ 1W7IB 2JTZA 3DVEA 3NSOA 1GQMA 4HRGA 2GGMA 2LE9B 4ICBA 1B8RA 1KFXS 3GK1A 3SS4A 5IBWA 4YGDB 1EH2A 1JBAA 2F2OA 4UPGA 1HT9A 1TIZA 2P71A 1B8LA 1S3PA 5J3XA 4DUQA 1NCXA 3VRNA 4NDDA 1XK4A 2I94A 2KLDA 2JWWA 3I5FC 4MEWA 1YRUB 4A4BA 2WORA 4Q04A 1PULA 3I5HC 1G8IA 1RROA 1TNWA 2JZIA 3H4SE 3CZ1A 3O78A 3NSKA 2L4HA 1MXLC 5CSIA 2PMYA 1RK9A 3QRXA 1AP4A 2BCAA 4YGCB 4YBHB 2BE6A 2O5GA 1CFDA 3DF0A 1S6IA 3SG2A 2JTTA 1BLQA 2K7CA 2Y1NA 3IQOA 4DIRA 1WRKA 1KQVA 5I2OA 2O60A 1XVJA 1BJFA 3VRRA 2BAPA 4QJ4B 3WHUB 2R2IA 2LVIA 4XYNA 4GPLB 3BFBA 2KAXA 2NCPA 2ZKMX 2JNXA 2F33A 3VB1A 1SBJA 2H61A 3M0WA 3PALA 4NDCA 1CDNA 3ZWHA 2F3ZA 3BFAA 4BY5A 2LP2A 4CPVA 2BKIB 3A8RA 4GNKB 1QJTA 3BUWB 3D75A 1CKKA 1TNQA 4OKHA 2D8NA 3KF9A 1BR4B 3BQ3A 3I5HB 1DJHA 2EGDA 4GFTA 3VRQA 4I5JA 4IJ7A 5BPJA 4OZDA 2EHBA 4U8DA 3MSEB 3KEVA 1TCFA 4MLWA
chains in the Genus database with same CATH topology
2AMIA 4CIDA 2FCDA 3OX6A 1SYMA 1WDCB 1A29A 5AXIA 5KSZA 2OTGC 4AQIA 2QPTA 1KK7Y 4I5LB 3SG7A 2V53A 1CLLA 1RJVA 2GV5A 2ZNEA 3TS5B 2HQWA 4M2PA 2JXCA 1A75B 2WCEA 1K90D 1SL9A 1WY9A 1PALA 2HF5A 2KQYA 4YI9A 1IWQA 2M97A 1B1GA 1IG5A 2KQ6A 1ALVA 2LCPA 5DKNA 4PHNA 2JULA 2Y1MA 5HKWA 1QVIY 1AUIB 5HKZA 4GGFC 1BODA 1H8BA 2SCPA 3CS1A 2ZRTA 1S6JA 1IQ5A 3HX4A 2KAVA 4PHMA 1QIWA 1ZOTB 1S36A 2AUCA 4PE7A 2LMVA 1RECA 2L98A 2WCBA 4M2QA 4QJ5B 1C7VA 1UUSA 3CR4X 1QV0A 1YUTA 2L0PA 1QASA 4N1GA 1SR6C 1XFXO 1JFJA 1J55A 3BOWA 1DGUA 4PDZA 3EVUA 1QX5B 4L9MA 2OTGB 3GK2A 1DF0B 4JQ0D 1X02A 2BBMA 2MRDA 3I5GC 4DS7A 1A2XA 1OSAA 1MR8A 1LVCD 3BUXB 2MAZA 2LNKA 3WHTB 2NZ0A 5AANA 3CR2A 2H2KA 1XFUO 1NX3A 3LCPC 2ZRSA 5JOLA 3EVRA 4AOMA 2JNFA 3TDZA 2MJWB 1R6PA 1BT6A 3O4YA 1FBVA 2KSPA 4MZLA 1NYAA 2JC2A 2KFFA 3PSRA 2WOSA 2KBMA 1YX8A 4MSPA 4D1EA 1UHKA 3K21A 3SIAA 3KHEA 2M1KB 3VGOA 1SK6D 4A4CA 1J7PA 1SCVA 1LA0A 3PN7B 1AK8A 2M49B 2PVBA 1BU3A 1DJWA 1WLMA 2DOQA 2Y5IA 4P2YB 2KYFA 2LAPA 3EKHA 1IJ6A 1G4YR 1SR6B 2PALA 2CT9A 3SJSA 3EK8A 2F8PA 2KFGA 4GAOA 1VRKA 4C0LA 1IJ5A 1F4QA 3SG5A 1J7RA 1S1EA 1KFUS 3FIAA 3I5GB 3D0YB 3IF7A 1ODBA 3NSIA 1B7TY 2QACA 1NCZA 1B9AA 2KDHA 2MBXA 1WDCC 1XYDA 1YUUA 3O2PA 3OB1B 1MUXA 2KOTA 3BOWB 4HSZA 2KNEA 2K7BA 1XK4C 1OZSA 1WLZA 3TS5C 1BMOA 1UWOA 2K7OA 5CSJA 4XJKA 1NX0A 2LC5A 1EXRA 3FS7A 4ETOA 1QLKA 1K95A 1OMVA 4HRHA 1CDLA 1SRAA 2BKHB 1AJ4A 2KAYA 1JFKA 5I2QA 2Q91A 1U5IA 2M8UA 3VROA 1XFZO 4CFRA 1MQ1A 2G2BA 4TNCA 1Y1UA 5F6TA 3DD4A 1DGVA 1MHOA 1FW4A 2MA2A 2CTNA 4ORAB 4MVFA 1YX7A 5FYXA 4PHJA 1SY9A 3ICBA 1TN4A 3OHMB 3E3RA 1GGZA 1B8CA 1TOPA 1Y1AA 1KK7Z 2IS9A 4NQGA 5D7FA 2H61C 5I2LA 4MBEA 2HETA 1K96A 3TZ1A 1NWDA 1K93D 4QJ3B 1K94A 1CFFA 3FWBA 4C0KA 2ISDA 4OR9B 1J7QA 2FOTA 5D69A 2I18A 3NSLA 1OQPA 1Y0VH 4N5XA 5GQQC 1LINA 4YRUA 1CMGA 2I2RE 2BCXA 1NPQA 1EL4A 1YURA 2JPTA 2PASA 3CWGA 1BOCA 1KQMC 1DVIA 1KFXL 2WC8A 2M0RA 4OCIA 1CLMA 2LLTA 3DF0B 5ER4X 1KCYA 4USLA 2FCEA 1FI5A 2JU0A 2AAOA 4YGAA 2LUCA 2B1UA 1KSMA 1YVLA 3PN7C 3AAKA 3BUNB 3PM8A 5KTYA 2WCFA 4JPZB 1LKJA 3DVMA 4ORCB 1J1DA 3EKJA 2KI4C 1TRFA 2ZN9A 2LVKA 2MLFC 3KO0A 2FJUB 4WRIA 1U5IB 1WRZA 5DKRA 1DMOA 1L2OB 1JUOA 1OZOA 1OE9B 3RM1A 3TDIA 2KI6C 1M45A 1XA5A 1BR1B 3SG6A 2E6WA 1B47A 1TNPA 1JF0A 1Y6WA 2JQ6A 1CDPA 1DJGA 1KWOC 1SL8A 3O6BA 5HKYA 1RWYA 2EC6B 1M31A 1PSRA 2M1UA 3A4UB 1XFWO 1M39A 2LMUA 1LA3A 5ER5A 1KQMB 1KK8B 1UHNA 2LUXA 1QS7A 4GUKA 2JRFA 1NX1A 1G33A 2LVJA 2KYCA 4CFQA 1QV1A 1PK0D 3LLEA 2COLB 4YI8A 3WNXB 2L51A 4HREE 1CFCA 1W7JB 4DCKA 3AKAA 4WQ2A 1YRTB 3CZTX 3LL8B 5HLVA 1ZUZA 2ZNDA 1V1FA 2KI4B 2CCMA 4FQOA 1UURA 4F0ZB 1SMGA 2RGIA 1B7TZ 1PSBA 1M63B 1YVHA 1N0YA 1EG3A 1OOJA 3CLNA 1AVSA 1L7ZA 3GOFA 3DVJA 3SG3A 1H4BA 2CBLA 3PLFB 4IL1A 1NUBA 1QTXA 4PE1A 1F8HA 3D10A 2E30A 1DJYA 3LK1A 2PRUA 1KWOB 1WRLA 3CR5X 1ZFSA 1SCMB 1XFYO 1XO5A 2JT8A 1NX2A 2LLUA 1CNPA 1V1GA 2L50A 4P5OE 1EJ3A 1J7OA 3OX5A 4PE4A 1Q80A 1M46A 2Y4QA 2KHNA 1ZACA 5G08A 5KU1A 1CMFA 1S5GY 2K8MB 4M2OA 5TNCA 3GK4X 2G9BA 1S26D 3AAJA 1RFJA 4PE0A 4CLNA 3JVTC 1A75A 1K9PA 4C0JA 1A4PA 2JT3A 5K89A 3TUYC 2F3YA 1J1EA 2Q4UA 1B4CA 2L2EA 1IH0A 1C07A 2LM5A 3EK7A 1KSOA 1FI6A 2CNPA 4E68A 1DJIA 1QX2A 2LHIA 4R1EA 1DT7B 1TCOB 1PVAA 1CM1A 2LLSA 5B8IB 2BCBA 1NSHA 4ZCUA 1IQ3A 3EK4A 5AERA 2I7AA 2LV7A 2M7NA 3JTDC 2HPSA 1K8UA 1K9UA 2VRGA 3BUMB 1DJXA 1DJZA 3OB2B 2MLEC 2OPOA 1ALWA 1IRJA 1L2OC 2HQ8A 2NXQA 1BF5A 1UP5A 1N2DA 4OVNF 1IGVA 1CFPA 1F71A 1F70A 1F54A 4GGNA 3KPXA 5CSFA 1QATA 1F55A 4MRXA 1DF0A 2KFHA 4ZCVA 3TDUA 2EC6C 1JC2A 3I5FB 2M9GA 3AKBA 5HLOA 3ZNIA 2P6BB 1CLBA 3BUOB 1SW8A 5JJGA 3JVTB 5I8NA 1QVIZ 4MZKA 3I5IC 2BE4A 2MHHA 1C7WA 3TUYB 2LHLA 4PCWA 1KK8C 1FPWA 2JXLA 3F45A 3PFVA 2A4JA 3BYAA 5HYDA 4ORBB 1JSAA 2BECA 3VRPA 1N65A 1MXEA 2CXJA 1AJ5A 1OMRA 4XJKB 4N1FA 4GGFA 1RTP1 4YGEB 2NCOA 2KGBC 1KFUL 3JTDB 1MWNA 4OV2A 2LP3A 2NLNA 1A03A 3SIBA 1CB1A 2M7LA 1F4OA 2PSRA 3SG4A 3HCMA 1XFVO 1IKUA 3CGAA 1R2UA 2TN4A 2ZN8A 1UHIA 2JOJA 2OS8C 4YGBB 1GGWA 1PVBA 2K7DA 4FTGA 1NP8A 1Y1XA 1YTZC 2F2PA 3WXAA 2KGRA 1UHJA 1CDMA 2BL0C 3NXAA 1NIWA 2KBIA 1BG1A 1SCMC 2SASA 1CTRA 3D0YA 3EVVA 4MN0A 5DKQA 2LVVA 4WQ3A 2GGZA 2K2AA 2KI6D 2K2FA 3OP0A 3FWCA 4JWQA 1EG4A 1YR5A 4AQJA 2M3WA 1K9KA 2M29A 5AFPA 2ZFDA 3I5IB 5CPVA 5CSNA 4BY4A 1S6CA 3PATA 1DTLA 1MF8B 3BXKA 2L5XB 1PRWA 3DVKA 1D1OA 2WNDA 1CM4A 1HQVA 3RLZA 3LK0A 1FF1A 2LMTA 3C1VA 4GBAA 1JWDA 2K61A 4DRWA 1TTXA 1QX7A 3IQQA 1E8AA 1JF2A 1SKTA 4I5KA 1ZMZA 4PHKA 1SNLA 1YUSA 1QIVA 1QLSA 2K0JA 4I5NB 4MZJA 1GJYA 1TNXA 1UHHA 1NCYA 4PALA 1AHRA 1OMDA 2JT0A 1K2HA 1SL7A 2OS8B 2L4IA 2LANA 2BBNA 1SPYA 1LXFC 3CTNA 4MRYA 5PALA 2BL0B 5AEQA 1QXPA 4NDBA 1S5GZ 1W7IB 2JTZA 3DVEA 3NSOA 1GQMA 4HRGA 2GGMA 2LE9B 4ICBA 1B8RA 1KFXS 3GK1A 5IBWA 4YGDB 1EH2A 1JBAA 2F2OA 4UPGA 1HT9A 1TIZA 1B8LA 1S3PA 5J3XA 4DUQA 1NCXA 3VRNA 4NDDA 1XK4A 2I94A 2JWWA 3I5FC 4MEWA 1YRUB 4A4BA 2WORA 4Q04A 1PULA 3I5HC 1G8IA 1RROA 1TNWA 2JZIA 3H4SE 3O78A 3NSKA 2L4HA 1MXLC 5CSIA 2PMYA 1RK9A 3QRXA 1AP4A 2BCAA 4YGCB 4YBHB 2BE6A 2O5GA 1CFDA 3DF0A 1S6IA 3SG2A 2JTTA 1BLQA 2K7CA 2Y1NA 3IQOA 4DIRA 1WRKA 1KQVA 5I2OA 2O60A 1XVJA 1BJFA 3VRRA 4QJ4B 3WHUB 2R2IA 2LVIA 4XYNA 4GPLB 2KAXA 2NCPA 2ZKMX 2JNXA 2F33A 1SBJA 2H61A 3M0WA 3PALA 4NDCA 1CDNA 3ZWHA 2F3ZA 4BY5A 2LP2A 4CPVA 2BKIB 3A8RA 4GNKB 1QJTA 3BUWB 1CKKA 1TNQA 4OKHA 2D8NA 3KF9A 1BR4B 3BQ3A 3I5HB 1DJHA 2EGDA 4GFTA 3VRQA 4I5JA 5BPJA 2EHBA 4U8DA 3MSEB 3KEVA 1TCFA 4MLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMI A;  4CID A;  2FCD A;  3OX6 A;  1SYM A;  1WDC B;  1A29 A;  5AXI A;  5KSZ A;  2OTG C;  4AQI A;  2QPT A;  1KK7 Y;  4I5L B;  3SG7 A;  2V53 A;  1CLL A;  1RJV A;  2GV5 A;  2ZNE A;  3TS5 B;  2HQW A;  4M2P A;  2JXC A;  1A75 B;  2WCE A;  1K90 D;  1SL9 A;  1WY9 A;  1PAL A;  2HF5 A;  2KQY A;  4YI9 A;  1IWQ A;  2M97 A;  1B1G A;  1IG5 A;  2KQ6 A;  1ALV A;  2LCP A;  5DKN A;  4PHN A;  2JUL A;  2Y1M A;  5HKW A;  1QVI Y;  1AUI B;  5HKZ A;  4GGF C;  1BOD A;  1H8B A;  2SCP A;  3CS1 A;  2ZRT A;  1S6J A;  1IQ5 A;  3HX4 A;  2KAV A;  4PHM A;  1QIW A;  1ZOT B;  1S36 A;  2AUC A;  4PE7 A;  2LMV A;  1REC A;  2L98 A;  2WCB A;  4M2Q A;  4QJ5 B;  1C7V A;  1UUS A;  3CR4 X;  1QV0 A;  1YUT A;  2L0P A;  1QAS A;  4N1G A;  1SR6 C;  1XFX O;  1JFJ A;  1J55 A;  3BOW A;  1DGU A;  4PDZ A;  3EVU A;  1QX5 B;  4L9M A;  2OTG B;  3GK2 A;  1DF0 B;  4JQ0 D;  1X02 A;  2BBM A;  2MRD A;  3I5G C;  4DS7 A;  1A2X A;  1OSA A;  1MR8 A;  1LVC D;  3BUX B;  2MAZ A;  2LNK A;  3WHT B;  2NZ0 A;  5AAN A;  3CR2 A;  2H2K A;  1XFU O;  1NX3 A;  3LCP C;  2ZRS A;  5JOL A;  3EVR A;  4AOM A;  2JNF A;  3TDZ A;  2MJW B;  1R6P A;  1BT6 A;  3O4Y A;  1FBV A;  2KSP A;  4MZL A;  1NYA A;  2JC2 A;  2KFF A;  3PSR A;  2WOS A;  2KBM A;  1YX8 A;  4MSP A;  4D1E A;  1UHK A;  3K21 A;  3SIA A;  3KHE A;  2M1K B;  3VGO A;  1SK6 D;  4A4C A;  1J7P A;  1SCV A;  1LA0 A;  3PN7 B;  1AK8 A;  2M49 B;  2PVB A;  1BU3 A;  1DJW A;  1WLM A;  2DOQ A;  2Y5I A;  4P2Y B;  2KYF A;  2LAP A;  3EKH A;  1IJ6 A;  1G4Y R;  1SR6 B;  2PAL A;  2CT9 A;  3SJS A;  3EK8 A;  2F8P A;  2KFG A;  4GAO A;  1VRK A;  4C0L A;  1IJ5 A;  1F4Q A;  3SG5 A;  1J7R A;  1S1E A;  1KFU S;  3FIA A;  3I5G B;  3D0Y B;  3IF7 A;  1ODB A;  3NSI A;  1B7T Y;  2QAC A;  1NCZ A;  1B9A A;  2KDH A;  2MBX A;  1WDC C;  1XYD A;  1YUU A;  3O2P A;  3OB1 B;  1MUX A;  2KOT A;  3BOW B;  4HSZ A;  2KNE A;  2K7B A;  1XK4 C;  1OZS A;  1WLZ A;  3TS5 C;  1BMO A;  1UWO A;  2K7O A;  5CSJ A;  4XJK A;  1NX0 A;  2LC5 A;  1EXR A;  3FS7 A;  4ETO A;  1QLK A;  1K95 A;  1OMV A;  4HRH A;  1CDL A;  1SRA A;  2BKH B;  1AJ4 A;  2KAY A;  1JFK A;  5I2Q A;  2Q91 A;  1U5I A;  2M8U A;  3VRO A;  1XFZ O;  4CFR A;  1MQ1 A;  2G2B A;  4TNC A;  1Y1U A;  5F6T A;  3DD4 A;  1DGV A;  1MHO A;  1FW4 A;  2MA2 A;  2CTN A;  4ORA B;  4MVF A;  1YX7 A;  5FYX A;  4PHJ A;  1SY9 A;  3ICB A;  1TN4 A;  3OHM B;  3E3R A;  1GGZ A;  1B8C A;  1TOP A;  1Y1A A;  1KK7 Z;  2IS9 A;  4NQG A;  5D7F A;  2H61 C;  5I2L A;  4MBE A;  2HET A;  1K96 A;  3TZ1 A;  1NWD A;  1K93 D;  4QJ3 B;  1K94 A;  1CFF A;  3FWB A;  4C0K A;  2ISD A;  4OR9 B;  1J7Q A;  2FOT A;  5D69 A;  2I18 A;  3NSL A;  1OQP A;  1Y0V H;  4N5X A;  5GQQ C;  1LIN A;  4YRU A;  1CMG A;  2I2R E;  2BCX A;  1NPQ A;  1EL4 A;  1YUR A;  2JPT A;  2PAS A;  3CWG A;  1BOC A;  1KQM C;  1DVI A;  1KFX L;  2WC8 A;  2M0R A;  4OCI A;  1CLM A;  2LLT A;  3DF0 B;  5ER4 X;  1KCY A;  4USL A;  2FCE A;  1FI5 A;  2JU0 A;  2AAO A;  4YGA A;  2LUC A;  2B1U A;  1KSM A;  1YVL A;  3PN7 C;  3AAK A;  3BUN B;  3PM8 A;  5KTY A;  2WCF A;  4JPZ B;  1LKJ A;  3DVM A;  4ORC B;  1J1D A;  3EKJ A;  2KI4 C;  1TRF A;  2ZN9 A;  2LVK A;  2MLF C;  3KO0 A;  2FJU B;  4WRI A;  1U5I B;  1WRZ A;  5DKR A;  1DMO A;  1L2O B;  1JUO A;  1OZO A;  1OE9 B;  3RM1 A;  3TDI A;  2KI6 C;  1M45 A;  1XA5 A;  1BR1 B;  3SG6 A;  2E6W A;  1B47 A;  1TNP A;  1JF0 A;  1Y6W A;  2JQ6 A;  1CDP A;  1DJG A;  1KWO C;  1SL8 A;  3O6B A;  5HKY A;  1RWY A;  2EC6 B;  1M31 A;  1PSR A;  2M1U A;  3A4U B;  1XFW O;  1M39 A;  2LMU A;  1LA3 A;  5ER5 A;  1KQM B;  1KK8 B;  1UHN A;  2LUX A;  1QS7 A;  4GUK A;  2JRF A;  1NX1 A;  1G33 A;  2LVJ A;  2KYC A;  4CFQ A;  1QV1 A;  1PK0 D;  3LLE A;  2COL B;  4YI8 A;  3WNX B;  2L51 A;  4HRE E;  1CFC A;  1W7J B;  4DCK A;  3AKA A;  4WQ2 A;  1YRT B;  3CZT X;  3LL8 B;  5HLV A;  1ZUZ A;  2ZND A;  1V1F A;  2KI4 B;  2CCM A;  4FQO A;  1UUR A;  4F0Z B;  1SMG A;  2RGI A;  1B7T Z;  1PSB A;  1M63 B;  1YVH A;  1N0Y A;  1EG3 A;  1OOJ A;  3CLN A;  1AVS A;  1L7Z A;  3GOF A;  3DVJ A;  3SG3 A;  1H4B A;  2CBL A;  3PLF B;  4IL1 A;  1NUB A;  1QTX A;  4PE1 A;  1F8H A;  3D10 A;  2E30 A;  1DJY A;  3LK1 A;  2PRU A;  1KWO B;  1WRL A;  3CR5 X;  1ZFS A;  1SCM B;  1XFY O;  1XO5 A;  2JT8 A;  1NX2 A;  2LLU A;  1CNP A;  1V1G A;  2L50 A;  4P5O E;  1EJ3 A;  1J7O A;  3OX5 A;  4PE4 A;  1Q80 A;  1M46 A;  2Y4Q A;  2KHN A;  1ZAC A;  5G08 A;  5KU1 A;  1CMF A;  1S5G Y;  2K8M B;  4M2O A;  5TNC A;  3GK4 X;  2G9B A;  1S26 D;  3AAJ A;  1RFJ A;  4PE0 A;  4CLN A;  3JVT C;  1A75 A;  1K9P A;  4C0J A;  1A4P A;  2JT3 A;  5K89 A;  3TUY C;  2F3Y A;  1J1E A;  2Q4U A;  1B4C A;  2L2E A;  1IH0 A;  1C07 A;  2LM5 A;  3EK7 A;  1KSO A;  1FI6 A;  2CNP A;  4E68 A;  1DJI A;  1QX2 A;  2LHI A;  4R1E A;  1DT7 B;  1TCO B;  1PVA A;  1CM1 A;  2LLS A;  5B8I B;  2BCB A;  1NSH A;  4ZCU A;  1IQ3 A;  3EK4 A;  5AER A;  2I7A A;  2LV7 A;  2M7N A;  3JTD C;  2HPS A;  1K8U A;  1K9U A;  2VRG A;  3BUM B;  1DJX A;  1DJZ A;  3OB2 B;  2MLE C;  2OPO A;  1ALW A;  1IRJ A;  1L2O C;  2HQ8 A;  2NXQ A;  1BF5 A;  1UP5 A;  1N2D A;  4OVN F;  1IGV A;  1CFP A;  1F71 A;  1F70 A;  1F54 A;  4GGN A;  3KPX A;  5CSF A;  1QAT A;  1F55 A;  4MRX A;  1DF0 A;  2KFH A;  4ZCV A;  3TDU A;  2EC6 C;  1JC2 A;  3I5F B;  2M9G A;  3AKB A;  5HLO A;  3ZNI A;  2P6B B;  1CLB A;  3BUO B;  1SW8 A;  5JJG A;  3JVT B;  5I8N A;  1QVI Z;  4MZK A;  3I5I C;  2BE4 A;  2MHH A;  1C7W A;  3TUY B;  2LHL A;  4PCW A;  1KK8 C;  1FPW A;  2JXL A;  3F45 A;  3PFV A;  2A4J A;  3BYA A;  5HYD A;  4ORB B;  1JSA A;  2BEC A;  3VRP A;  1N65 A;  1MXE A;  2CXJ A;  1AJ5 A;  1OMR A;  4XJK B;  4N1F A;  4GGF A;  1RTP 1;  4YGE B;  2NCO A;  2KGB C;  1KFU L;  3JTD B;  1MWN A;  4OV2 A;  2LP3 A;  2NLN A;  1A03 A;  3SIB A;  1CB1 A;  2M7L A;  1F4O A;  2PSR A;  3SG4 A;  3HCM A;  1XFV O;  1IKU A;  3CGA A;  1R2U A;  2TN4 A;  2ZN8 A;  1UHI A;  2JOJ A;  2OS8 C;  4YGB B;  1GGW A;  1PVB A;  2K7D A;  4FTG A;  1NP8 A;  1Y1X A;  1YTZ C;  2F2P A;  3WXA A;  2KGR A;  1UHJ A;  1CDM A;  2BL0 C;  3NXA A;  1NIW A;  2KBI A;  1BG1 A;  1SCM C;  2SAS A;  1CTR A;  3D0Y A;  3EVV A;  4MN0 A;  5DKQ A;  2LVV A;  4WQ3 A;  2GGZ A;  2K2A A;  2KI6 D;  2K2F A;  3OP0 A;  3FWC A;  4JWQ A;  1EG4 A;  1YR5 A;  4AQJ A;  2M3W A;  1K9K A;  2M29 A;  5AFP A;  2ZFD A;  3I5I B;  5CPV A;  5CSN A;  4BY4 A;  1S6C A;  3PAT A;  1DTL A;  1MF8 B;  3BXK A;  2L5X B;  1PRW A;  3DVK A;  1D1O A;  2WND A;  1CM4 A;  1HQV A;  3RLZ A;  3LK0 A;  1FF1 A;  2LMT A;  3C1V A;  4GBA A;  1JWD A;  2K61 A;  4DRW A;  1TTX A;  1QX7 A;  3IQQ A;  1E8A A;  1JF2 A;  1SKT A;  4I5K A;  1ZMZ A;  4PHK A;  1SNL A;  1YUS A;  1QIV A;  1QLS A;  2K0J A;  4I5N B;  4MZJ A;  1GJY A;  1TNX A;  1UHH A;  1NCY A;  4PAL A;  1AHR A;  1OMD A;  2JT0 A;  1K2H A;  1SL7 A;  2OS8 B;  2L4I A;  2LAN A;  2BBN A;  1SPY A;  1LXF C;  3CTN A;  4MRY A;  5PAL A;  2BL0 B;  5AEQ A;  1QXP A;  4NDB A;  1S5G Z;  1W7I B;  2JTZ A;  3DVE A;  3NSO A;  1GQM A;  4HRG A;  2GGM A;  2LE9 B;  4ICB A;  1B8R A;  1KFX S;  3GK1 A;  5IBW A;  4YGD B;  1EH2 A;  1JBA A;  2F2O A;  4UPG A;  1HT9 A;  1TIZ A;  1B8L A;  1S3P A;  5J3X A;  4DUQ A;  1NCX A;  3VRN A;  4NDD A;  1XK4 A;  2I94 A;  2JWW A;  3I5F C;  4MEW A;  1YRU B;  4A4B A;  2WOR A;  4Q04 A;  1PUL A;  3I5H C;  1G8I A;  1RRO A;  1TNW A;  2JZI A;  3H4S E;  3O78 A;  3NSK A;  2L4H A;  1MXL C;  5CSI A;  2PMY A;  1RK9 A;  3QRX A;  1AP4 A;  2BCA A;  4YGC B;  4YBH B;  2BE6 A;  2O5G A;  1CFD A;  3DF0 A;  1S6I A;  3SG2 A;  2JTT A;  1BLQ A;  2K7C A;  2Y1N A;  3IQO A;  4DIR A;  1WRK A;  1KQV A;  5I2O A;  2O60 A;  1XVJ A;  1BJF A;  3VRR A;  4QJ4 B;  3WHU B;  2R2I A;  2LVI A;  4XYN A;  4GPL B;  2KAX A;  2NCP A;  2ZKM X;  2JNX A;  2F33 A;  1SBJ A;  2H61 A;  3M0W A;  3PAL A;  4NDC A;  1CDN A;  3ZWH A;  2F3Z A;  4BY5 A;  2LP2 A;  4CPV A;  2BKI B;  3A8R A;  4GNK B;  1QJT A;  3BUW B;  1CKK A;  1TNQ A;  4OKH A;  2D8N A;  3KF9 A;  1BR4 B;  3BQ3 A;  3I5H B;  1DJH A;  2EGD A;  4GFT A;  3VRQ A;  4I5J A;  5BPJ A;  2EHB A;  4U8D A;  3MSE B;  3KEV A;  1TCF A;  4MLW A; 
#chains in the Genus database with same CATH topology
 2AMI A;  1DEL A;  2FCD A;  3OX6 A;  1SYM A;  4CID A;  1WDC B;  1A29 A;  5AXI A;  5KSZ A;  2OTG C;  4AQI A;  2QPT A;  1KK7 Y;  4I5L B;  3SG7 A;  2V53 A;  1CLL A;  1RJV A;  2GV5 A;  2ZNE A;  3TS5 B;  2HQW A;  2WCL A;  2FJY A;  3BJH A;  4M2P A;  2JXC A;  1A75 B;  2WCE A;  1K90 D;  1SL9 A;  1WY9 A;  1PAL A;  2HF5 A;  2KQY A;  4YI9 A;  1IWQ A;  2M97 A;  1B1G A;  1IG5 A;  4INW A;  2KQ6 A;  1ALV A;  2LCP A;  5DKN A;  2KPH A;  4PHN A;  2JUL A;  2Y1M A;  5HKW A;  3D73 A;  1QVI Y;  1AUI B;  5HKZ A;  4GGF C;  1BOD A;  5FI2 A;  1H8B A;  2SCP A;  3CS1 A;  3RZS A;  2ZRT A;  1S6J A;  1IQ5 A;  3HX4 A;  1TUZ A;  2KAV A;  4PHM A;  1QIW A;  1ZOT B;  1S36 A;  2AUC A;  3D76 A;  4PE7 A;  2LMV A;  1REC A;  2L98 A;  2WCB A;  4M2Q A;  4QJ5 B;  1DC1 A;  1UUS A;  3CR4 X;  1C7V A;  1QV0 A;  1YUT A;  2L0P A;  1QAS A;  4N1G A;  2WCM A;  1SR6 C;  3Q8I A;  1XFX O;  1JFJ A;  1J55 A;  3BOW A;  1DGU A;  4PDZ A;  3EVU A;  1QX5 B;  4L9M A;  2OTG B;  3SS5 A;  3GK2 A;  1DF0 B;  4JQ0 D;  1X02 A;  2BBM A;  2MRD A;  3B87 A;  3I5G C;  4DS7 A;  1A2X A;  1DEK A;  1OSA A;  1MR8 A;  1LVC D;  3BUX B;  2MAZ A;  2LNK A;  3WHT B;  2ERB A;  2NZ0 A;  5AAN A;  3CR2 A;  2H2K A;  1XFU O;  1NX3 A;  3DY9 A;  3LCP C;  2ZRS A;  5JOL A;  3EVR A;  4AOM A;  2JNF A;  3TDZ A;  2MJW B;  1R6P A;  1BT6 A;  3O4Y A;  1FBV A;  2KSP A;  4MZL A;  1NYA A;  2JC2 A;  2KFF A;  3PSR A;  2WOS A;  2KBM A;  1OW4 A;  1YX8 A;  4MSP A;  4D1E A;  1UHK A;  3K21 A;  3SIA A;  3KHE A;  2M1K B;  3VGO A;  1SK6 D;  4A4C A;  1OOI X;  1J7P A;  1SCV A;  1LA0 A;  3IVT A;  3PN7 B;  1AK8 A;  2M49 B;  2PVB A;  1BU3 A;  1DJW A;  1WLM A;  2DOQ A;  2Y5I A;  4P2Y B;  2KYF A;  2LAP A;  3EKH A;  1IJ6 A;  1G4Y R;  1SR6 B;  2PAL A;  3D74 A;  2CT9 A;  4KYN A;  3SJS A;  3EK8 A;  2F8P A;  2KFG A;  4GAO A;  1VRK A;  4C0L A;  1IJ5 A;  1F4Q A;  3SG5 A;  1J7R A;  1S1E A;  1KFU S;  3FIA A;  3I5G B;  3D0Y B;  3IF7 A;  1ODB A;  1ORG A;  3NSI A;  1B7T Y;  2QAC A;  2H8V A;  1NCZ A;  1B9A A;  4JKT A;  2KDH A;  3R1P A;  2MBX A;  5I94 A;  4F7F A;  1WDC C;  1XYD A;  1YUU A;  3O2P A;  3OB1 B;  1MUX A;  2KOT A;  4FQT A;  3BOW B;  4HSZ A;  2KNE A;  2WCH A;  2K7B A;  1XK4 C;  1OZS A;  2P70 A;  1WLZ A;  3PM2 A;  1BMO A;  3TS5 C;  1UWO A;  2K7O A;  5CSJ A;  4XJK A;  1NX0 A;  2LC5 A;  1EXR A;  3FS7 A;  4ETO A;  1QLK A;  2JPO A;  1K95 A;  1OMV A;  4HRH A;  1CDL A;  1SRA A;  2BKH B;  1AJ4 A;  3EG5 B;  2KAY A;  1JFK A;  3B6X A;  3DYE A;  5I2Q A;  2Q91 A;  1U5I A;  2M8U A;  3VRO A;  1XFZ O;  4CFR A;  1MQ1 A;  2G2B A;  4TNC A;  1Y1U A;  1GM0 A;  5F6T A;  3DD4 A;  1DGV A;  1XFR A;  1MHO A;  1FW4 A;  2MA2 A;  2CTN A;  4ORA B;  4MVF A;  1YX7 A;  5FYX A;  4PHJ A;  1SY9 A;  3ICB A;  3BFH A;  1TN4 A;  1Z4H A;  2PYQ A;  3OHM B;  3E3R A;  1GGZ A;  1B8C A;  1TOP A;  1Y1A A;  1KK7 Z;  2IS9 A;  4NQG A;  5D7F A;  2H61 C;  5I2L A;  2QDI A;  4MBE A;  2HET A;  1K96 A;  1LS8 A;  3TZ1 A;  1NWD A;  1K93 D;  4QJ3 B;  2PQL A;  1K94 A;  1CFF A;  3FWB A;  4INX A;  2ISD A;  4OR9 B;  3S0B A;  4C0K A;  1J7Q A;  2FOT A;  5D69 A;  2I18 A;  3NSL A;  1OQP A;  1Y0V H;  3CAB A;  4N5X A;  3D78 A;  1SSE B;  5GQQ C;  1LIN A;  4YRU A;  1CMG A;  2I2R E;  2BCX A;  1NPQ A;  3DXL A;  1EL4 A;  2WCK A;  1YUR A;  2JPT A;  2PAS A;  3CWG A;  1BOC A;  1KQM C;  1DVI A;  1KFX L;  2WC8 A;  3FE9 A;  2M0R A;  4OCI A;  1CLM A;  2LLT A;  3DF0 B;  5ER4 X;  1KCY A;  4USL A;  2FCE A;  1FI5 A;  2JU0 A;  2AAO A;  4YGA A;  2LUC A;  2B1U A;  1KSM A;  1YVL A;  2GTE A;  3PN7 C;  3AAK A;  3BUN B;  3PM8 A;  5KTY A;  2WCF A;  4JPZ B;  1LKJ A;  3DVM A;  4ORC B;  1J1D A;  3EKJ A;  2KI4 C;  1TRF A;  2ZN9 A;  2LVK A;  2MLF C;  1QWV A;  4PT1 A;  3KO0 A;  1W9Z A;  2FJU B;  4WRI A;  3R1V A;  1U5I B;  1WRZ A;  5DKR A;  1DMO A;  1L2O B;  1JUO A;  1OZO A;  1OE9 B;  3NHI A;  3RM1 A;  3TDI A;  2KI6 C;  3S0G A;  1M45 A;  1XA5 A;  1BR1 B;  3SG6 A;  2E6W A;  2WCJ A;  1B47 A;  1TNP A;  1JF0 A;  1Y6W A;  3OBV A;  1C3Z A;  2JQ6 A;  5D3O A;  1CDP A;  1DJG A;  1KWO C;  1SL8 A;  3O6B A;  5HKY A;  1RWY A;  2EC6 B;  1M31 A;  1PSR A;  2QEH A;  2M1U A;  3A4U B;  1XFW O;  1M39 A;  2LMU A;  1LA3 A;  5ER5 A;  1KQM B;  1KK8 B;  1UHN A;  2LUX A;  1QS7 A;  4GUK A;  2JRF A;  1NX1 A;  1G33 A;  2LVJ A;  2KYC A;  3UNW A;  4CFQ A;  1QV1 A;  5HL1 A;  1PK0 D;  3LLE A;  2COL B;  4YI8 A;  3WNX B;  2L51 A;  4HRE E;  1CFC A;  1W7J B;  3R1O A;  4DCK A;  3AKA A;  2QEO A;  4WQ2 A;  1YRT B;  3CZT X;  3LL8 B;  5HLV A;  1ZUZ A;  2ZND A;  1V1F A;  2KI4 B;  3B86 A;  2CCM A;  4FQO A;  1UUR A;  3DZT A;  4F0Z B;  1SMG A;  2RGI A;  1B7T Z;  1PSB A;  1M63 B;  1YVH A;  1N0Y A;  1EG3 A;  1OOJ A;  3CLN A;  1AVS A;  1L7Z A;  3CZ0 A;  3DVJ A;  3GOF A;  3SG3 A;  1H4B A;  2CBL A;  3PLF B;  4IL1 A;  1NUB A;  3S0E A;  1QTX A;  3R72 A;  4PE1 A;  1F8H A;  3D10 A;  2E30 A;  1DJY A;  3LK1 A;  2PRU A;  3PJI A;  1KWO B;  1WRL A;  3CR5 X;  1ZFS A;  1SCM B;  1XFY O;  1XO5 A;  2JT8 A;  1NX2 A;  2LLU A;  3S0F A;  1Z2C B;  1CNP A;  1V1G A;  2L50 A;  4P5O E;  1EJ3 A;  3QME A;  1J7O A;  3OX5 A;  4PE4 A;  1Q80 A;  1M46 A;  2Y4Q A;  2KHN A;  3NGV A;  1TWO A;  1ZAC A;  2L5Y A;  5G08 A;  5KU1 A;  1CMF A;  1S5G Y;  2K8M B;  3UO9 A;  4M2O A;  3FE6 A;  5TNC A;  3GK4 X;  2G9B A;  1S26 D;  3AAJ A;  1RFJ A;  4PE0 A;  4CLN A;  3JVT C;  1A75 A;  1K9P A;  4C0J A;  1A4P A;  2JT3 A;  5K89 A;  3TUY C;  2F3Y A;  1J1E A;  3CYZ A;  2Q4U A;  3CZ2 A;  1B4C A;  4JD9 A;  2L2E A;  1IH0 A;  1C07 A;  2LM5 A;  3EK7 A;  1KSO A;  1FI6 A;  2CNP A;  4E68 A;  1DJI A;  1QX2 A;  1OOH A;  2LHI A;  4R1E A;  1DT7 B;  2WC6 A;  1TCO B;  1IIO A;  3CDN A;  1PVA A;  1CM1 A;  2LLS A;  5B8I B;  2BCB A;  1NSH A;  2YGU A;  4ZCU A;  1IQ3 A;  3EK4 A;  5AER A;  2I7A A;  2LV7 A;  2M7N A;  3JTD C;  2HPS A;  1K8U A;  1K9U A;  2VRG A;  3O4X A;  3BUM B;  1DJX A;  1DJZ A;  3OB2 B;  2MLE C;  2OPO A;  1ALW A;  1IRJ A;  1L2O C;  2HQ8 A;  2NXQ A;  1BF5 A;  1UP5 A;  1N2D A;  4OVN F;  1IGV A;  1CFP A;  1F71 A;  1F70 A;  1F54 A;  4GGN A;  3KPX A;  5CSF A;  1QAT A;  1T14 A;  1F55 A;  3N7H A;  1C3Y A;  4MRX A;  1DF0 A;  2KFH A;  4ZCV A;  2QEV A;  2EC6 C;  3TDU A;  2WC5 A;  5FI7 A;  1JC2 A;  3I5F B;  2M9G A;  3AKB A;  5HLO A;  3ZNI A;  2P6B B;  1CLB A;  3BUO B;  1SW8 A;  5JJG A;  3JVT B;  3B88 A;  5I8N A;  1QVI Z;  2QEB A;  4MZK A;  3I5I C;  2BE4 A;  2MHH A;  1C7W A;  5DIC A;  3TUY B;  2LHL A;  4PCW A;  1KK8 C;  1FPW A;  2JXL A;  3F45 A;  3PFV A;  2A4J A;  3BYA A;  5HYD A;  4ORB B;  1JSA A;  2BEC A;  5EL2 A;  1N65 A;  3VRP A;  1MXE A;  2L2C A;  3S0D A;  2CXJ A;  1AJ5 A;  1OMR A;  1P28 A;  4XJK B;  4N1F A;  4GGF A;  1RTP 1;  4YGE B;  2NCO A;  2KGB C;  1KFU L;  3JTD B;  1MWN A;  4OV2 A;  2LP3 A;  2NLN A;  1A03 A;  3SIB A;  1CB1 A;  2M7L A;  1F4O A;  2PSR A;  3SG4 A;  3HCM A;  1XFV O;  1IKU A;  3CGA A;  1R2U A;  2TN4 A;  2ZN8 A;  1UHI A;  2JOJ A;  2OS8 C;  4YGB B;  1GGW A;  1PVB A;  2K7D A;  4FTG A;  1NP8 A;  1Y1X A;  1YTZ C;  2F2P A;  3WXA A;  2KGR A;  1UHJ A;  1CDM A;  2BL0 C;  3NXA A;  2BNX A;  1NIW A;  2KBI A;  2KLE A;  1BG1 A;  1SCM C;  2SAS A;  1CTR A;  3D0Y A;  3EVV A;  3NHT A;  4MN0 A;  5DKQ A;  2LVV A;  3FE8 A;  2GGZ A;  2K2A A;  2KI6 D;  2K2F A;  3OP0 A;  4WQ3 A;  3FWC A;  3L47 A;  4JWQ A;  1EG4 A;  3D77 A;  1YR5 A;  4AQJ A;  2M3W A;  1K9K A;  2M29 A;  5AFP A;  2ZFD A;  3I5I B;  5CPV A;  5CSN A;  4BY4 A;  1S6C A;  3PAT A;  1DTL A;  1MF8 B;  3B7A A;  2L5X B;  3BXK A;  1PRW A;  3DVK A;  1D1O A;  2WND A;  1CM4 A;  1HQV A;  3RLZ A;  3LK0 A;  1FF1 A;  2LMT A;  3C1V A;  4GBA A;  5FI6 A;  1JWD A;  2K61 A;  3K1E A;  4DRW A;  3V2L A;  1TTX A;  1QX7 A;  3IQQ A;  1E8A A;  1JF2 A;  3OGN A;  1SKT A;  1TUJ A;  4I5K A;  1ZMZ A;  4PHK A;  1SNL A;  1YUS A;  1QIV A;  1QLS A;  1OOF A;  2K0J A;  4I5N B;  4MZJ A;  1GJY A;  1TNX A;  1UHH A;  3L4L A;  1NCY A;  3S0A A;  4PAL A;  1AHR A;  1OMD A;  1DQE A;  1OOG A;  2JT0 A;  1K2H A;  1SL7 A;  2OS8 B;  2L4I A;  2LAN A;  2BBN A;  1SPY A;  1LXF C;  3CTN A;  2K60 A;  4MRY A;  3L4A A;  5PAL A;  2BL0 B;  5AEQ A;  3SS3 A;  1QXP A;  4NDB A;  1S5G Z;  1W7I B;  2JTZ A;  3DVE A;  3NSO A;  1GQM A;  4HRG A;  2GGM A;  2LE9 B;  4ICB A;  1B8R A;  1KFX S;  3GK1 A;  3SS4 A;  5IBW A;  4YGD B;  1EH2 A;  1JBA A;  2F2O A;  4UPG A;  1HT9 A;  1TIZ A;  2P71 A;  1B8L A;  1S3P A;  5J3X A;  4DUQ A;  1NCX A;  3VRN A;  4NDD A;  1XK4 A;  2I94 A;  2KLD A;  2JWW A;  3I5F C;  4MEW A;  1YRU B;  4A4B A;  2WOR A;  4Q04 A;  1PUL A;  3I5H C;  1G8I A;  1RRO A;  1TNW A;  2JZI A;  3H4S E;  3CZ1 A;  3O78 A;  3NSK A;  2L4H A;  1MXL C;  5CSI A;  2PMY A;  1RK9 A;  3QRX A;  1AP4 A;  2BCA A;  4YGC B;  4YBH B;  2BE6 A;  2O5G A;  1CFD A;  3DF0 A;  1S6I A;  3SG2 A;  2JTT A;  1BLQ A;  2K7C A;  2Y1N A;  3IQO A;  4DIR A;  1WRK A;  1KQV A;  5I2O A;  2O60 A;  1XVJ A;  1BJF A;  3VRR A;  2BAP A;  4QJ4 B;  3WHU B;  2R2I A;  2LVI A;  4XYN A;  4GPL B;  3BFB A;  2KAX A;  2NCP A;  2ZKM X;  2JNX A;  2F33 A;  3VB1 A;  1SBJ A;  2H61 A;  3M0W A;  3PAL A;  4NDC A;  1CDN A;  3ZWH A;  2F3Z A;  3BFA A;  4BY5 A;  2LP2 A;  4CPV A;  2BKI B;  3A8R A;  4GNK B;  1QJT A;  3BUW B;  3D75 A;  1CKK A;  1TNQ A;  4OKH A;  2D8N A;  3KF9 A;  1BR4 B;  3BQ3 A;  3I5H B;  1DJH A;  2EGD A;  4GFT A;  3VRQ A;  4I5J A;  4IJ7 A;  5BPJ A;  4OZD A;  2EHB A;  4U8D A;  3MSE B;  3KEV A;  1TCF A;  4MLW A; 
#chains in the Genus database with same CATH homology
 2AMI A;  4CID A;  2FCD A;  3OX6 A;  1SYM A;  1WDC B;  1A29 A;  5AXI A;  5KSZ A;  2OTG C;  4AQI A;  2QPT A;  1KK7 Y;  4I5L B;  3SG7 A;  2V53 A;  1CLL A;  1RJV A;  2GV5 A;  2ZNE A;  3TS5 B;  2HQW A;  4M2P A;  2JXC A;  1A75 B;  2WCE A;  1K90 D;  1SL9 A;  1WY9 A;  1PAL A;  2HF5 A;  2KQY A;  4YI9 A;  1IWQ A;  2M97 A;  1B1G A;  1IG5 A;  2KQ6 A;  1ALV A;  2LCP A;  5DKN A;  4PHN A;  2JUL A;  2Y1M A;  5HKW A;  1QVI Y;  1AUI B;  5HKZ A;  4GGF C;  1BOD A;  1H8B A;  2SCP A;  3CS1 A;  2ZRT A;  1S6J A;  1IQ5 A;  3HX4 A;  2KAV A;  4PHM A;  1QIW A;  1ZOT B;  1S36 A;  2AUC A;  4PE7 A;  2LMV A;  1REC A;  2L98 A;  2WCB A;  4M2Q A;  4QJ5 B;  1C7V A;  1UUS A;  3CR4 X;  1QV0 A;  1YUT A;  2L0P A;  1QAS A;  4N1G A;  1SR6 C;  1XFX O;  1JFJ A;  1J55 A;  3BOW A;  1DGU A;  4PDZ A;  3EVU A;  1QX5 B;  4L9M A;  2OTG B;  3GK2 A;  1DF0 B;  4JQ0 D;  1X02 A;  2BBM A;  2MRD A;  3I5G C;  4DS7 A;  1A2X A;  1OSA A;  1MR8 A;  1LVC D;  3BUX B;  2MAZ A;  2LNK A;  3WHT B;  2NZ0 A;  5AAN A;  3CR2 A;  2H2K A;  1XFU O;  1NX3 A;  3LCP C;  2ZRS A;  5JOL A;  3EVR A;  4AOM A;  2JNF A;  3TDZ A;  2MJW B;  1R6P A;  1BT6 A;  3O4Y A;  1FBV A;  2KSP A;  4MZL A;  1NYA A;  2JC2 A;  2KFF A;  3PSR A;  2WOS A;  2KBM A;  1YX8 A;  4MSP A;  4D1E A;  1UHK A;  3K21 A;  3SIA A;  3KHE A;  2M1K B;  3VGO A;  1SK6 D;  4A4C A;  1J7P A;  1SCV A;  1LA0 A;  3PN7 B;  1AK8 A;  2M49 B;  2PVB A;  1BU3 A;  1DJW A;  1WLM A;  2DOQ A;  2Y5I A;  4P2Y B;  2KYF A;  2LAP A;  3EKH A;  1IJ6 A;  1G4Y R;  1SR6 B;  2PAL A;  2CT9 A;  3SJS A;  3EK8 A;  2F8P A;  2KFG A;  4GAO A;  1VRK A;  4C0L A;  1IJ5 A;  1F4Q A;  3SG5 A;  1J7R A;  1S1E A;  1KFU S;  3FIA A;  3I5G B;  3D0Y B;  3IF7 A;  1ODB A;  3NSI A;  1B7T Y;  2QAC A;  1NCZ A;  1B9A A;  2KDH A;  2MBX A;  1WDC C;  1XYD A;  1YUU A;  3O2P A;  3OB1 B;  1MUX A;  2KOT A;  3BOW B;  4HSZ A;  2KNE A;  2K7B A;  1XK4 C;  1OZS A;  1WLZ A;  3TS5 C;  1BMO A;  1UWO A;  2K7O A;  5CSJ A;  4XJK A;  1NX0 A;  2LC5 A;  1EXR A;  3FS7 A;  4ETO A;  1QLK A;  1K95 A;  1OMV A;  4HRH A;  1CDL A;  1SRA A;  2BKH B;  1AJ4 A;  2KAY A;  1JFK A;  5I2Q A;  2Q91 A;  1U5I A;  2M8U A;  3VRO A;  1XFZ O;  4CFR A;  1MQ1 A;  2G2B A;  4TNC A;  1Y1U A;  5F6T A;  3DD4 A;  1DGV A;  1MHO A;  1FW4 A;  2MA2 A;  2CTN A;  4ORA B;  4MVF A;  1YX7 A;  5FYX A;  4PHJ A;  1SY9 A;  3ICB A;  1TN4 A;  3OHM B;  3E3R A;  1GGZ A;  1B8C A;  1TOP A;  1Y1A A;  1KK7 Z;  2IS9 A;  4NQG A;  5D7F A;  2H61 C;  5I2L A;  4MBE A;  2HET A;  1K96 A;  3TZ1 A;  1NWD A;  1K93 D;  4QJ3 B;  1K94 A;  1CFF A;  3FWB A;  4C0K A;  2ISD A;  4OR9 B;  1J7Q A;  2FOT A;  5D69 A;  2I18 A;  3NSL A;  1OQP A;  1Y0V H;  4N5X A;  5GQQ C;  1LIN A;  4YRU A;  1CMG A;  2I2R E;  2BCX A;  1NPQ A;  1EL4 A;  1YUR A;  2JPT A;  2PAS A;  3CWG A;  1BOC A;  1KQM C;  1DVI A;  1KFX L;  2WC8 A;  2M0R A;  4OCI A;  1CLM A;  2LLT A;  3DF0 B;  5ER4 X;  1KCY A;  4USL A;  2FCE A;  1FI5 A;  2JU0 A;  2AAO A;  4YGA A;  2LUC A;  2B1U A;  1KSM A;  1YVL A;  3PN7 C;  3AAK A;  3BUN B;  3PM8 A;  5KTY A;  2WCF A;  4JPZ B;  1LKJ A;  3DVM A;  4ORC B;  1J1D A;  3EKJ A;  2KI4 C;  1TRF A;  2ZN9 A;  2LVK A;  2MLF C;  3KO0 A;  2FJU B;  4WRI A;  1U5I B;  1WRZ A;  5DKR A;  1DMO A;  1L2O B;  1JUO A;  1OZO A;  1OE9 B;  3RM1 A;  3TDI A;  2KI6 C;  1M45 A;  1XA5 A;  1BR1 B;  3SG6 A;  2E6W A;  1B47 A;  1TNP A;  1JF0 A;  1Y6W A;  2JQ6 A;  1CDP A;  1DJG A;  1KWO C;  1SL8 A;  3O6B A;  5HKY A;  1RWY A;  2EC6 B;  1M31 A;  1PSR A;  2M1U A;  3A4U B;  1XFW O;  1M39 A;  2LMU A;  1LA3 A;  5ER5 A;  1KQM B;  1KK8 B;  1UHN A;  2LUX A;  1QS7 A;  4GUK A;  2JRF A;  1NX1 A;  1G33 A;  2LVJ A;  2KYC A;  4CFQ A;  1QV1 A;  1PK0 D;  3LLE A;  2COL B;  4YI8 A;  3WNX B;  2L51 A;  4HRE E;  1CFC A;  1W7J B;  4DCK A;  3AKA A;  4WQ2 A;  1YRT B;  3CZT X;  3LL8 B;  5HLV A;  1ZUZ A;  2ZND A;  1V1F A;  2KI4 B;  2CCM A;  4FQO A;  1UUR A;  4F0Z B;  1SMG A;  2RGI A;  1B7T Z;  1PSB A;  1M63 B;  1YVH A;  1N0Y A;  1EG3 A;  1OOJ A;  3CLN A;  1AVS A;  1L7Z A;  3GOF A;  3DVJ A;  3SG3 A;  1H4B A;  2CBL A;  3PLF B;  4IL1 A;  1NUB A;  1QTX A;  4PE1 A;  1F8H A;  3D10 A;  2E30 A;  1DJY A;  3LK1 A;  2PRU A;  1KWO B;  1WRL A;  3CR5 X;  1ZFS A;  1SCM B;  1XFY O;  1XO5 A;  2JT8 A;  1NX2 A;  2LLU A;  1CNP A;  1V1G A;  2L50 A;  4P5O E;  1EJ3 A;  1J7O A;  3OX5 A;  4PE4 A;  1Q80 A;  1M46 A;  2Y4Q A;  2KHN A;  1ZAC A;  5G08 A;  5KU1 A;  1CMF A;  1S5G Y;  2K8M B;  4M2O A;  5TNC A;  3GK4 X;  2G9B A;  1S26 D;  3AAJ A;  1RFJ A;  4PE0 A;  4CLN A;  3JVT C;  1A75 A;  1K9P A;  4C0J A;  1A4P A;  2JT3 A;  5K89 A;  3TUY C;  2F3Y A;  1J1E A;  2Q4U A;  1B4C A;  2L2E A;  1IH0 A;  1C07 A;  2LM5 A;  3EK7 A;  1KSO A;  1FI6 A;  2CNP A;  4E68 A;  1DJI A;  1QX2 A;  2LHI A;  4R1E A;  1DT7 B;  1TCO B;  1PVA A;  1CM1 A;  2LLS A;  5B8I B;  2BCB A;  1NSH A;  4ZCU A;  1IQ3 A;  3EK4 A;  5AER A;  2I7A A;  2LV7 A;  2M7N A;  3JTD C;  2HPS A;  1K8U A;  1K9U A;  2VRG A;  3BUM B;  1DJX A;  1DJZ A;  3OB2 B;  2MLE C;  2OPO A;  1ALW A;  1IRJ A;  1L2O C;  2HQ8 A;  2NXQ A;  1BF5 A;  1UP5 A;  1N2D A;  4OVN F;  1IGV A;  1CFP A;  1F71 A;  1F70 A;  1F54 A;  4GGN A;  3KPX A;  5CSF A;  1QAT A;  1F55 A;  4MRX A;  1DF0 A;  2KFH A;  4ZCV A;  3TDU A;  2EC6 C;  1JC2 A;  3I5F B;  2M9G A;  3AKB A;  5HLO A;  3ZNI A;  2P6B B;  1CLB A;  3BUO B;  1SW8 A;  5JJG A;  3JVT B;  5I8N A;  1QVI Z;  4MZK A;  3I5I C;  2BE4 A;  2MHH A;  1C7W A;  3TUY B;  2LHL A;  4PCW A;  1KK8 C;  1FPW A;  2JXL A;  3F45 A;  3PFV A;  2A4J A;  3BYA A;  5HYD A;  4ORB B;  1JSA A;  2BEC A;  3VRP A;  1N65 A;  1MXE A;  2CXJ A;  1AJ5 A;  1OMR A;  4XJK B;  4N1F A;  4GGF A;  1RTP 1;  4YGE B;  2NCO A;  2KGB C;  1KFU L;  3JTD B;  1MWN A;  4OV2 A;  2LP3 A;  2NLN A;  1A03 A;  3SIB A;  1CB1 A;  2M7L A;  1F4O A;  2PSR A;  3SG4 A;  3HCM A;  1XFV O;  1IKU A;  3CGA A;  1R2U A;  2TN4 A;  2ZN8 A;  1UHI A;  2JOJ A;  2OS8 C;  4YGB B;  1GGW A;  1PVB A;  2K7D A;  4FTG A;  1NP8 A;  1Y1X A;  1YTZ C;  2F2P A;  3WXA A;  2KGR A;  1UHJ A;  1CDM A;  2BL0 C;  3NXA A;  1NIW A;  2KBI A;  1BG1 A;  1SCM C;  2SAS A;  1CTR A;  3D0Y A;  3EVV A;  4MN0 A;  5DKQ A;  2LVV A;  4WQ3 A;  2GGZ A;  2K2A A;  2KI6 D;  2K2F A;  3OP0 A;  3FWC A;  4JWQ A;  1EG4 A;  1YR5 A;  4AQJ A;  2M3W A;  1K9K A;  2M29 A;  5AFP A;  2ZFD A;  3I5I B;  5CPV A;  5CSN A;  4BY4 A;  1S6C A;  3PAT A;  1DTL A;  1MF8 B;  3BXK A;  2L5X B;  1PRW A;  3DVK A;  1D1O A;  2WND A;  1CM4 A;  1HQV A;  3RLZ A;  3LK0 A;  1FF1 A;  2LMT A;  3C1V A;  4GBA A;  1JWD A;  2K61 A;  4DRW A;  1TTX A;  1QX7 A;  3IQQ A;  1E8A A;  1JF2 A;  1SKT A;  4I5K A;  1ZMZ A;  4PHK A;  1SNL A;  1YUS A;  1QIV A;  1QLS A;  2K0J A;  4I5N B;  4MZJ A;  1GJY A;  1TNX A;  1UHH A;  1NCY A;  4PAL A;  1AHR A;  1OMD A;  2JT0 A;  1K2H A;  1SL7 A;  2OS8 B;  2L4I A;  2LAN A;  2BBN A;  1SPY A;  1LXF C;  3CTN A;  4MRY A;  5PAL A;  2BL0 B;  5AEQ A;  1QXP A;  4NDB A;  1S5G Z;  1W7I B;  2JTZ A;  3DVE A;  3NSO A;  1GQM A;  4HRG A;  2GGM A;  2LE9 B;  4ICB A;  1B8R A;  1KFX S;  3GK1 A;  5IBW A;  4YGD B;  1EH2 A;  1JBA A;  2F2O A;  4UPG A;  1HT9 A;  1TIZ A;  1B8L A;  1S3P A;  5J3X A;  4DUQ A;  1NCX A;  3VRN A;  4NDD A;  1XK4 A;  2I94 A;  2JWW A;  3I5F C;  4MEW A;  1YRU B;  4A4B A;  2WOR A;  4Q04 A;  1PUL A;  3I5H C;  1G8I A;  1RRO A;  1TNW A;  2JZI A;  3H4S E;  3O78 A;  3NSK A;  2L4H A;  1MXL C;  5CSI A;  2PMY A;  1RK9 A;  3QRX A;  1AP4 A;  2BCA A;  4YGC B;  4YBH B;  2BE6 A;  2O5G A;  1CFD A;  3DF0 A;  1S6I A;  3SG2 A;  2JTT A;  1BLQ A;  2K7C A;  2Y1N A;  3IQO A;  4DIR A;  1WRK A;  1KQV A;  5I2O A;  2O60 A;  1XVJ A;  1BJF A;  3VRR A;  4QJ4 B;  3WHU B;  2R2I A;  2LVI A;  4XYN A;  4GPL B;  2KAX A;  2NCP A;  2ZKM X;  2JNX A;  2F33 A;  1SBJ A;  2H61 A;  3M0W A;  3PAL A;  4NDC A;  1CDN A;  3ZWH A;  2F3Z A;  4BY5 A;  2LP2 A;  4CPV A;  2BKI B;  3A8R A;  4GNK B;  1QJT A;  3BUW B;  1CKK A;  1TNQ A;  4OKH A;  2D8N A;  3KF9 A;  1BR4 B;  3BQ3 A;  3I5H B;  1DJH A;  2EGD A;  4GFT A;  3VRQ A;  4I5J A;  5BPJ A;  2EHB A;  4U8D A;  3MSE B;  3KEV A;  1TCF A;  4MLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...