1AHRA

Calmodulin mutant with a two residue deletion in the central helix
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
146
structure length
146
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding.
pubmed doi rcsb
molecule keywords CALMODULIN
molecule tags Calcium-binding protein
source organism Gallus gallus
total genus 45
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ahrA00
1KFXL 4CFRA 1J7QA 3WNXB 5CSFA 1SL7A 1QJTA 1SRAA 2HF5A 2K8MB 2WORA 1PVBA 1Y0VH 1AJ5A 1GJYA 3I5IC 1L2OB 2HQWA 1EH2A 3VRNA 5J3XA 2M1KB 2K0JA 2QACA 2OS8C 4YRUA 1SMGA 2H2KA 1KFUS 1RWYA 2H61C 1GGWA 3CLNA 1LA3A 2KGRA 2KOTA 1S6JA 1S5GZ 1AJ4A 4A4BA 2WC8A 4GNKB 4AQIA 1KWOC 4JQ0D 2M1UA 2LP3A 4MVFA 1W7JB 2ZRTA 2Y1NA 4MBEA 2EC6C 1TCFA 1B8LA 2K2FA 2V53A 3D0YA 3RLZA 1RK9A 5KSZA 1JF0A 1NSHA 3CR5X 1F70A 1H8BA 2JTZA 1LKJA 1Y1UA 2BCAA 3SIAA 3KO0A 3ZNIA 1N2DA 2KAXA 5BPJA 1JC2A 3I5GC 1DF0A 2LVIA 3KEVA 2MJWB 4YBHB 1QV1A 1DJYA 1QXPA 5HKYA 2LLUA 3CGAA 3LL8B 5CSIA 4ZCUA 1UUSA 1J55A 2JC2A 1NP8A 5DKNA 5CSJA 4CFQA 2MBXA 2GGMA 2NZ0A 2LNKA 3FIAA 4YGBB 2ZN8A 4YGCB 2L98A 1CDLA 5I2QA 3C1VA 3TDIA 3DD4A 1A29A 3BOWA 1S1EA 4M2PA 1TNXA 1YTZC 1BODA 2JXLA 4XJKB 4IL1A 1UHKA 1PRWA 1QATA 2G2BA 4D1EA 3AKAA 2BCBA 1FF1A 4MZJA 3VRRA 5D69A 3CZTX 2KYCA 1YX7A 1BLQA 1DGUA 4MZLA 1FPWA 2FCDA 1TTXA 1SBJA 1OMDA 1B7TY 3ZWHA 2LAPA 1C7WA 2F3ZA 1K90D 4GGFA 1F55A 3O4YA 1UWOA 3OX5A 1OMRA 2CCMA 3EKHA 3BUOB 2JPTA 1EG3A 1DJZA 1ALVA 2K7BA 4PCWA 3I5HB 1QV0A 2JQ6A 1OOJA 1J1DA 3EK8A 1QIWA 1U5IA 5B8IB 1M45A 1PULA 1SW8A 1RJVA 3PSRA 1S6CA 2OTGC 4AOMA 4Q04A 1CDPA 2TN4A 1DT7B 1SL8A 2ZFDA 1IG5A 4PDZA 1AVSA 4L9MA 4MN0A 4PE7A 3O2PA 1VRKA 1ZOTB 3FWCA 1TRFA 1EG4A 1GQMA 1S5GY 1PVAA 1J7OA 1KFUL 1XK4C 1YUUA 2CNPA 1WLMA 1B4CA 2H61A 3OP0A 3O78A 1WDCC 3BUWB 2EHBA 1D1OA 1ZMZA 3RM1A 1QVIY 2M7LA 3FWBA 5ER4X 1K9PA 2Q4UA 2L4HA 1LA0A 3CR4X 1XFYO 1NX2A 3I5HC 4OCIA 2EC6B 2CBLA 2KI6C 1EXRA 1SCMB 1AUIB 4NQGA 1YVLA 1AP4A 2AMIA 1F4QA 1PSRA 2WCFA 1YX8A 4JPZB 3SG3A 4WRIA 1BOCA 1NCXA 2K2AA 3H4SE 4DIRA 3DVMA 1UURA 3A4UB 1MUXA 2MRDA 2PVBA 3LK0A 1YR5A 3KPXA 3PN7B 4C0LA 4DUQA 3I5GB 2COLB 1SK6D 1BR1B 1L7ZA 2JNXA 3M0WA 1K95A 2NXQA 3A8RA 4MZKA 4TNCA 1CLBA 1UP5A 1QLSA 3VGOA 3PM8A 1MWNA 2LVJA 4PHJA 1Y1XA 2KBMA 1OZSA 4YI9A 1G8IA 3EK7A 3E3RA 2KI4C 2NLNA 1F54A 5CSNA 1A4PA 3NSKA 2I2RE 1SCMC 4AQJA 2KBIA 3PALA 3CR2A 1J7PA 1KQMB 1NX3A 2F8PA 1NWDA 2JXCA 4XYNA 1K2HA 2LVVA 1IGVA 1A2XA 2CXJA 1NCYA 2B1UA 3VRQA 2KFFA 4DCKA 1H4BA 1DVIA 5HKWA 3DF0B 3AAJA 2WCEA 4GUKA 1EJ3A 2PRUA 3PN7C 2R2IA 1V1GA 1AHRA 2A4JA 1CM4A 2NCPA 2E6WA 4MRXA 1B8RA 1DGVA 2JU0A 3NXAA 4PHNA 1BG1A 1FBVA 3CS1A 2LLSA 2L2EA 1LVCD 2JOJA 4OKHA 5AEQA 1XA5A 2K61A 2M49B 1M63B 2PASA 4MEWA 2SASA 2BKIB 3SJSA 4PE4A 1K9KA 4FTGA 3TDZA 3TS5B 2L5XB 1YRUB 4C0JA 4CIDA 1JUOA 2OTGB 4PALA 3OX6A 4XJKA 1S6IA 2O5GA 1YURA 3GOFA 1SNLA 2Y1MA 4I5NB 1KQMC 1CFFA 4E68A 1NYAA 4I5KA 3GK4X 1M39A 2O60A 4I5LB 3NSOA 1M31A 4DRWA 2FJUB 2KSPA 1XK4A 5HLVA 5HYDA 3AAKA 4F0ZB 1WDCB 1MF8B 5FYXA 2WOSA 1J1EA 3LK1A 1K96A 2JT3A 1KK7Y 1UHNA 1SPYA 3FS7A 2M8UA 2FCEA 2D8NA 3PFVA 3BUNB 1KK8B 3IF7A 1B9AA 4N5XA 1SL9A 1X02A 5AXIA 2BECA 1XFZO 1CFPA 4HSZA 2I94A 1QX5B 5I2LA 1B47A 3K21A 1XYDA 2M29A 3TS5C 1FW4A 1IJ6A 2BBMA 2I7AA 5AERA 2CTNA 4I5JA 1HT9A 5TNCA 3SG7A 2QPTA 3GK1A 2ZNDA 5HLOA 1QASA 1HQVA 1LXFC 1IH0A 1JFKA 3BXKA 2BCXA 1OZOA 1F71A 5DKQA 2KHNA 2CT9A 2MA2A 4WQ2A 4U8DA 1Q80A 3O6BA 1DMOA 2KNEA 3IQOA 1RROA 5D7FA 2G9BA 4HREE 4M2OA 1TNWA 1F4OA 1JBAA 2F2PA 1IKUA 3HX4A 2M9GA 4HRGA 1S3PA 2MAZA 1YRTB 1CMFA 1N0YA 1CMGA 1IRJA 1KK8C 2KI4B 3D10A 1BT6A 1WRLA 4GGNA 1NX1A 3KHEA 4QJ3B 4C0KA 3DVEA 1PK0D 5GQQC 3ICBA 1TCOB 1OSAA 2KAVA 2F3YA 4A4CA 2LUXA 2L51A 2F2OA 2PSRA 5IBWA 1CKKA 3BUMB 5PALA 1KSOA 1F8HA 3I5FB 3LCPC 1B1GA 5KU1A 1RTP1 2E30A 4N1FA 1G4YR 4JWQA 4QJ4B 1FI5A 1WLZA 3OB2B 2MLFC 3IQQA 1UHJA 2KFGA 1DJGA 4GAOA 3QRXA 3TDUA 4PHKA 4MRYA 1KQVA 2KGBC 5AFPA 2KFHA 1RFJA 1NX0A 2LANA 2JZIA 2BE4A 3TUYB 1A03A 1BR4B 2JTTA 3HCMA 2BL0B 1ZACA 3TZ1A 1B8CA 1M46A 2LE9B 2RGIA 4P2YB 1R2UA 2KQYA 4OR9B 4BY5A 1GGZA 3WHTB 2WNDA 3NSLA 4GBAA 2ZKMX 4UPGA 1QX7A 2P6BB 2Y4QA 2LCPA 1MQ1A 3NSIA 4OVNF 4PHMA 4YGEB 2EGDA 3WHUB 1JSAA 3JVTB 5G08A 1XFVO 1CM1A 1IQ3A 2AUCA 1YUSA 1NUBA 3DVKA 2M3WA 3SG2A 2JNFA 1JFJA 1FI6A 1DJHA 3DF0A 1QIVA 1QTXA 1NPQA 2IS9A 4NDCA 2JRFA 1QS7A 1UHHA 2LMUA 2BE6A 3I5FC 2L0PA 4YGDB 2LVKA 2KYFA 1E8AA 3PATA 3OHMB 2BKHB 3SIBA 1MHOA 1G33A 1PALA 5KTYA 4YGAA 3VRPA 4DS7A 1SKTA 3AKBA 5I8NA 1QVIZ 2HPSA 3KF9A 2HQ8A 2LV7A 3D0YB 3TUYC 4ETOA 2JWWA 2K7DA 1DJIA 1K8UA 1Y1AA 1OE9B 2BL0C 2KI6D 2DOQA 1CFCA 1OQPA 2L50A 2LHLA 2ZRSA 1R6PA 1SCVA 4NDBA 2I18A 5ER5A 2M97A 1XO5A 1WY9A 1KFXS 1PSBA 1QX2A 2GGZA 3LLEA 3JVTC 1CDMA 1L2OC 1S36A 1DF0B 1KCYA 4NDDA 1A75A 1XFXO 1WRZA 1A75B 1K94A 3EVUA 4ZCVA 3SG5A 2KQ6A 1ZFSA 3EVRA 3BYAA 2LP2A 2ISDA 3SG4A 1S26D 1XFWO 5I2OA 1TNPA 4YI8A 1OMVA 3EK4A 2GV5A 1MXEA 1C07A 1CLMA 1CDNA 1XFUO 1UHIA 2Q91A 2WCBA 4M2QA 4PE1A 3BOWB 1CB1A 3JTDB 1K9UA 2K7OA 1ZUZA 2M0RA 3DVJA 2NCOA 4MSPA 1DJWA 4ICBA 4WQ3A 1WRKA 4USLA 2KAYA 4PE0A 1CFDA 3PLFB 1YVHA 5K89A 4CLNA 1V1FA 2LUCA 1ALWA 1IQ5A 1BMOA 3VROA 1XVJA 1J7RA 1IWQA 1W7IB 2VRGA 2LHIA 2LM5A 2MLEC 1SR6B 3OB1B 1BJFA 3BQ3A 1TN4A 4HRHA 4OV2A 4CPVA 2JULA 1SYMA 1CNPA 1KSMA 1IJ5A 1LINA 1ODBA 1BU3A 3BUXB 1U5IB 2HETA 1AK8A 2PALA 4GPLB 1DTLA 2LC5A 3MSEB 5JJGA 1JWDA 3EKJA 5CPVA 2LMVA 3JTDC 1NIWA 4BY4A 2F33A 3CWGA 2PMYA 1K93D 2KDHA 2MHHA 4P5OE 1QLKA 1JF2A 4ORBB 3I5IB 5F6TA 1DJXA 2LLTA 1SY9A 3CTNA 1TNQA 1TOPA 2OS8B 2JT8A 5JOLA 3SG6A 2JT0A 2ZN9A 1CLLA 1NCZA 3F45A 4MLWA 2ZNEA 1MR8A 3EVVA 5AANA 4FQOA 2BBNA 4GGFC 2FOTA 2LMTA 1EL4A 4ORAB 1SR6C 3GK2A 1KWOB 4N1GA 1B7TZ 1TIZA 4R1EA 2M7NA 2K7CA 2SCPA 2Y5IA 1KK7Z 1CTRA 1N65A 1MXLC 1RECA 2L4IA 4GFTA 1Y6WA 4QJ5B 1BF5A 3WXAA 1C7VA 1YUTA 2AAOA 4ORCB 5HKZA 5DKRA 2OPOA
chains in the Genus database with same CATH superfamily
1KFXL 4CFRA 1J7QA 3WNXB 1P28A 1QWVA 5CSFA 1SL7A 1OOHA 2QEVA 1QJTA 1SRAA 2HF5A 2K8MB 3CABA 5HL1A 2WORA 1PVBA 1DC1A 1Y0VH 1AJ5A 1GJYA 3I5IC 1L2OB 2HQWA 1EH2A 3VRNA 5J3XA 2M1KB 2K0JA 2QACA 2OS8C 4YRUA 2WCLA 1SMGA 2H2KA 1KFUS 1RWYA 2H61C 3SS5A 4KYNA 1GGWA 3CLNA 1LA3A 2KGRA 2GTEA 2KOTA 3S0DA 1S6JA 3V2LA 1S5GZ 1AJ4A 4A4BA 2WC8A 3R1PA 4GNKB 4AQIA 1KWOC 4JQ0D 1TUZA 2M1UA 2LP3A 4MVFA 1W7JB 2ZRTA 2Y1NA 4MBEA 2EC6C 1TCFA 1B8LA 2K2FA 2V53A 3D0YA 3RLZA 1RK9A 2BAPA 5KSZA 1JF0A 1NSHA 3CR5X 3B6XA 3CDNA 1F70A 1OOFA 1H8BA 2JTZA 1LKJA 1Y1UA 2BCAA 3IVTA 3SIAA 3PM2A 3KO0A 3ZNIA 1N2DA 3DZTA 1LS8A 2KAXA 2P70A 5BPJA 1JC2A 3I5GC 1DF0A 2LVIA 5I94A 3KEVA 4JD9A 2MJWB 4YBHB 1QV1A 1DJYA 1QXPA 5HKYA 2LLUA 3CGAA 3LL8B 5CSIA 4ZCUA 1UUSA 1J55A 2JC2A 1NP8A 5DKNA 5CSJA 4CFQA 2MBXA 2GGMA 2NZ0A 2LNKA 3FIAA 4YGBB 1OOIX 3O4XA 2ZN8A 4YGCB 2L98A 1CDLA 5I2QA 3C1VA 3TDIA 3DD4A 1A29A 3BOWA 1S1EA 4M2PA 1TNXA 1YTZC 3L47A 1BODA 2JXLA 4XJKB 4IL1A 1UHKA 1PRWA 1QATA 2G2BA 4D1EA 3AKAA 2BCBA 1FF1A 4MZJA 3VRRA 3S0EA 5D69A 3CZTX 2KYCA 1YX7A 1BLQA 1DGUA 4FQTA 1ORGA 2WCHA 4MZLA 1FPWA 2FCDA 1TTXA 1SBJA 1OMDA 1B7TY 3ZWHA 2LAPA 1C7WA 2F3ZA 1K90D 4GGFA 1F55A 3O4YA 1UWOA 3OX5A 1OMRA 2CCMA 3EKHA 3BUOB 2JPTA 1EG3A 1DJZA 1ALVA 2FJYA 2K7BA 4PCWA 3I5HB 1QV0A 2JQ6A 1OOJA 1J1DA 3EK8A 1QIWA 1U5IA 5B8IB 1M45A 1PULA 1SW8A 1RJVA 3PSRA 4PT1A 2YGUA 1S6CA 2OTGC 4AOMA 3S0FA 4Q04A 1CDPA 3DYEA 2TN4A 1DT7B 1SL8A 2ZFDA 3NGVA 2PQLA 1IG5A 3FE8A 4PDZA 1AVSA 4L9MA 4MN0A 4PE7A 3O2PA 1VRKA 1ZOTB 3FWCA 1TRFA 1EG4A 1GQMA 1S5GY 3L4AA 1PVAA 3CZ0A 1KFUL 1XK4C 1J7OA 1YUUA 2CNPA 1WLMA 1B4CA 2H61A 3OP0A 3O78A 1WDCC 3BUWB 2EHBA 1D1OA 1ZMZA 3RM1A 1QVIY 2M7LA 3FWBA 5ER4X 1K9PA 2Q4UA 2L4HA 1LA0A 3CR4X 1XFYO 1NX2A 1IIOA 3I5HC 4OCIA 2EC6B 2CBLA 2KI6C 1EXRA 3DXLA 1SCMB 1AUIB 4NQGA 1YVLA 1AP4A 2AMIA 1F4QA 1PSRA 2WCFA 2WCKA 1YX8A 4JPZB 3SG3A 4WRIA 1BOCA 1NCXA 2K2AA 3H4SE 4DIRA 3DVMA 1UURA 2WCJA 3A4UB 3L4LA 1MUXA 3NHTA 2MRDA 2PVBA 3LK0A 1YR5A 3KPXA 3PN7B 4C0LA 4DUQA 3I5GB 2COLB 1SK6D 1BR1B 1L7ZA 2JNXA 3D74A 3M0WA 1K95A 2NXQA 3A8RA 4MZKA 4TNCA 3OBVA 1CLBA 1UP5A 1QLSA 3VGOA 3PM8A 2KLEA 1MWNA 2LVJA 4PHJA 1Y1XA 2KBMA 1OZSA 4YI9A 4NDCA 1G8IA 3EK7A 3E3RA 2KI4C 2NLNA 3S0GA 1F54A 1W9ZA 3B87A 5CSNA 1A4PA 3NSKA 2I2RE 1SCMC 3N7HA 4AQJA 2KBIA 2L2CA 3PALA 3CR2A 1J7PA 1KQMB 1NX3A 2F8PA 1NWDA 2JXCA 4XYNA 1K2HA 2LVVA 1IGVA 1A2XA 1TWOA 2CXJA 3B88A 1NCYA 2B1UA 3VRQA 2KFFA 4DCKA 1H4BA 1DVIA 3OGNA 5HKWA 3DF0B 3AAJA 2WCEA 4GUKA 3VB1A 1EJ3A 2PRUA 3PN7C 5FI6A 2R2IA 1V1GA 1AHRA 2A4JA 1CM4A 2NCPA 2E6WA 4MRXA 1B8RA 1DGVA 2JU0A 2QEHA 3NXAA 4PHNA 1FBVA 1BG1A 3CS1A 2LLSA 3BJHA 2WCMA 3BFAA 2L2EA 1LVCD 2JOJA 4OKHA 5AEQA 1XA5A 2K61A 2M49B 5FI2A 1M63B 2PASA 4MEWA 2SASA 2BKIB 3SJSA 4PE4A 2L5YA 1K9KA 4FTGA 3TDZA 3TS5B 2KPHA 2L5XB 1YRUB 4C0JA 4CIDA 1JUOA 2OTGB 4PALA 3OX6A 2ERBA 4XJKA 1S6IA 2O5GA 1YURA 3GOFA 1SNLA 2Y1MA 4I5NB 1KQMC 1CFFA 4E68A 1NYAA 4I5KA 3GK4X 1M39A 2O60A 4I5LB 3NSOA 3S0AA 1M31A 1DEKA 2FJUB 2KSPA 4DRWA 3RZSA 1XK4A 5HLVA 5HYDA 3AAKA 4F0ZB 1WDCB 1MF8B 3FE6A 5FYXA 2WOSA 1J1EA 3LK1A 1K96A 2JT3A 1KK7Y 1UHNA 1SPYA 3FS7A 2M8UA 2FCEA 2D8NA 3PFVA 3BUNB 1KK8B 2BNXA 1OW4A 1B9AA 3IF7A 4N5XA 1SL9A 3PJIA 1X02A 5AXIA 2BECA 1XFZO 1CFPA 4HSZA 2I94A 1QX5B 5I2LA 1B47A 3K21A 1XYDA 2M29A 3TS5C 1FW4A 1IJ6A 2BBMA 5FI7A 2I7AA 5AERA 2CTNA 3CZ1A 4I5JA 1HT9A 5TNCA 3SG7A 2QPTA 3GK1A 2ZNDA 5HLOA 1QASA 1HQVA 1LXFC 1IH0A 1JFKA 3R1VA 3BXKA 2BCXA 1OZOA 1OOGA 3BFHA 4INWA 1F71A 5DKQA 2KHNA 2CT9A 2MA2A 4WQ2A 4U8DA 1Q80A 3O6BA 3S0BA 1DMOA 2KNEA 3IQOA 1RROA 5D7FA 2G9BA 4HREE 4M2OA 1TNWA 1F4OA 1JBAA 2F2PA 1IKUA 3HX4A 2M9GA 4HRGA 1S3PA 2MAZA 1YRTB 2QEOA 1CMFA 2QDIA 1N0YA 1CMGA 1IRJA 1KK8C 2KI4B 3D10A 1BT6A 1WRLA 4IJ7A 4GGNA 1NX1A 3KHEA 4QJ3B 4C0KA 3D76A 3DVEA 1PK0D 5GQQC 3ICBA 1TCOB 1OSAA 2KAVA 2F3YA 4A4CA 2LUXA 2L51A 1GM0A 2F2OA 2PSRA 5IBWA 3R1OA 2WC6A 1CKKA 3BUMB 5PALA 1KSOA 1F8HA 3I5FB 3LCPC 1B1GA 5KU1A 1RTP1 2E30A 4N1FA 1G4YR 2KLDA 4JWQA 4QJ4B 1WLZA 3OB2B 2MLFC 3IQQA 1FI5A 1UHJA 2KFGA 1DJGA 4GAOA 3QRXA 3TDUA 4PHKA 4MRYA 2H8VA 2KGBC 4OZDA 1KQVA 5AFPA 2KFHA 1RFJA 1NX0A 2LANA 2JZIA 2BE4A 3TUYB 1A03A 1BR4B 2JTTA 3HCMA 2BL0B 1ZACA 3TZ1A 1B8CA 1M46A 2LE9B 2RGIA 3D78A 4P2YB 1R2UA 2KQYA 4OR9B 4BY5A 1GGZA 3WHTB 2WNDA 2QEBA 3NSLA 4GBAA 2ZKMX 4UPGA 3UNWA 1QX7A 2P6BB 2Y4QA 2LCPA 1MQ1A 3NSIA 4OVNF 4PHMA 4YGEB 2EGDA 3WHUB 1JSAA 3JVTB 5G08A 1XFVO 1CM1A 1IQ3A 1TUJA 2AUCA 1YUSA 1NUBA 3DVKA 2M3WA 3SG2A 2JNFA 1JFJA 1FI6A 1DJHA 3DF0A 1QIVA 1QTXA 1NPQA 1DQEA 2IS9A 2JRFA 1QS7A 1UHHA 2LMUA 2BE6A 3FE9A 2L0PA 3I5FC 2LVKA 2KYFA 1E8AA 3PATA 4YGDB 3OHMB 2BKHB 3SIBA 3UO9A 1MHOA 1G33A 1PALA 5KTYA 4YGAA 3VRPA 4DS7A 1SKTA 1Z4HA 3AKBA 1QVIZ 5I8NA 2HPSA 3KF9A 2HQ8A 2LV7A 3D0YB 4INXA 3TUYC 4ETOA 1SSEB 2JWWA 2K7DA 1DJIA 1K8UA 1Y1AA 1OE9B 2BL0C 2KI6D 2DOQA 1CFCA 1OQPA 2L50A 2LHLA 2ZRSA 4F7FA 1R6PA 1SCVA 4NDBA 2I18A 5ER5A 2M97A 1XO5A 2WC5A 1WY9A 1KFXS 5DICA 1PSBA 1QX2A 2GGZA 3LLEA 3JVTC 1CDMA 1L2OC 1S36A 1DF0B 1KCYA 4NDDA 1A75A 1XFXO 1WRZA 1A75B 1K94A 3EVUA 4ZCVA 3SG5A 2KQ6A 1ZFSA 3EVRA 1DELA 3BYAA 2LP2A 3QMEA 2ISDA 3SG4A 1S26D 1XFWO 5I2OA 1TNPA 4YI8A 1OMVA 3EK4A 2GV5A 1MXEA 1C07A 1CLMA 3R72A 3SS4A 1CDNA 1XFUO 1UHIA 2Q91A 2WCBA 4M2QA 4PE1A 3BOWB 2P71A 3SS3A 5D3OA 3DY9A 1CB1A 3JTDB 2K60A 1K9UA 2K7OA 1ZUZA 2M0RA 3DVJA 5EL2A 2NCOA 3BFBA 1T14A 4MSPA 1DJWA 4ICBA 4WQ3A 1WRKA 3Q8IA 4USLA 3NHIA 2KAYA 4PE0A 1CFDA 3B7AA 1YVHA 3PLFB 5K89A 3D73A 4CLNA 1C3YA 1V1FA 2LUCA 1ALWA 1IQ5A 1BMOA 3VROA 1XVJA 1J7RA 1IWQA 1W7IB 2VRGA 2LHIA 2LM5A 4JKTA 2MLEC 1SR6B 3D77A 1BJFA 3BQ3A 1TN4A 3OB1B 4HRHA 4OV2A 4CPVA 2JULA 3EG5B 1SYMA 1CNPA 2PYQA 1KSMA 1IJ5A 1Z2CB 1LINA 1ODBA 1BU3A 3BUXB 1U5IB 2HETA 1AK8A 2PALA 4GPLB 1DTLA 2LC5A 3MSEB 5JJGA 1JWDA 3EKJA 1C3ZA 2LMVA 3CYZA 1NIWA 3JTDC 2F33A 2JPOA 3CWGA 5CPVA 4BY4A 2PMYA 1K93D 2KDHA 2MHHA 4P5OE 1QLKA 1JF2A 4ORBB 3I5IB 5F6TA 1DJXA 1XFRA 2LLTA 1SY9A 3B86A 3CTNA 1TNQA 1TOPA 2OS8B 2JT8A 5JOLA 3SG6A 2JT0A 2ZN9A 1CLLA 1NCZA 3F45A 4MLWA 2ZNEA 1MR8A 3EVVA 5AANA 4FQOA 3K1EA 2BBNA 4GGFC 2FOTA 2LMTA 1EL4A 4ORAB 3CZ2A 1SR6C 3GK2A 1KWOB 4N1GA 1B7TZ 1TIZA 4R1EA 2M7NA 2K7CA 2SCPA 2Y5IA 1KK7Z 1CTRA 1N65A 1MXLC 1RECA 2L4IA 4GFTA 1Y6WA 4QJ5B 1BF5A 3WXAA 1C7VA 1YUTA 2AAOA 4ORCB 5HKZA 5DKRA 3D75A 2OPOA
chains in the Genus database with same CATH topology
1KFXL 4CFRA 1J7QA 3WNXB 5CSFA 1SL7A 1QJTA 1SRAA 2HF5A 2K8MB 2WORA 1PVBA 1Y0VH 1AJ5A 1GJYA 3I5IC 1L2OB 2HQWA 1EH2A 3VRNA 5J3XA 2M1KB 2K0JA 2QACA 2OS8C 4YRUA 1SMGA 2H2KA 1KFUS 1RWYA 2H61C 1GGWA 3CLNA 1LA3A 2KGRA 2KOTA 1S6JA 1S5GZ 1AJ4A 4A4BA 2WC8A 4GNKB 4AQIA 1KWOC 4JQ0D 2M1UA 2LP3A 4MVFA 1W7JB 2ZRTA 2Y1NA 4MBEA 2EC6C 1TCFA 1B8LA 2K2FA 2V53A 3D0YA 3RLZA 1RK9A 5KSZA 1JF0A 1NSHA 3CR5X 1F70A 1H8BA 2JTZA 1LKJA 1Y1UA 2BCAA 3SIAA 3KO0A 3ZNIA 1N2DA 2KAXA 5BPJA 1JC2A 3I5GC 1DF0A 2LVIA 3KEVA 2MJWB 4YBHB 1QV1A 1DJYA 1QXPA 5HKYA 2LLUA 3CGAA 3LL8B 5CSIA 4ZCUA 1UUSA 1J55A 2JC2A 1NP8A 5DKNA 5CSJA 4CFQA 2MBXA 2GGMA 2NZ0A 2LNKA 3FIAA 4YGBB 2ZN8A 4YGCB 2L98A 1CDLA 5I2QA 3C1VA 3TDIA 3DD4A 1A29A 3BOWA 1S1EA 4M2PA 1TNXA 1YTZC 1BODA 2JXLA 4XJKB 4IL1A 1UHKA 1PRWA 1QATA 2G2BA 4D1EA 3AKAA 2BCBA 1FF1A 4MZJA 3VRRA 5D69A 3CZTX 2KYCA 1YX7A 1BLQA 1DGUA 4MZLA 1FPWA 2FCDA 1TTXA 1SBJA 1OMDA 1B7TY 3ZWHA 2LAPA 1C7WA 2F3ZA 1K90D 4GGFA 1F55A 3O4YA 1UWOA 3OX5A 1OMRA 2CCMA 3EKHA 3BUOB 2JPTA 1EG3A 1DJZA 1ALVA 2K7BA 4PCWA 3I5HB 1QV0A 2JQ6A 1OOJA 1J1DA 3EK8A 1QIWA 1U5IA 5B8IB 1M45A 1PULA 1SW8A 1RJVA 3PSRA 1S6CA 2OTGC 4AOMA 4Q04A 1CDPA 2TN4A 1DT7B 1SL8A 2ZFDA 1IG5A 4PDZA 1AVSA 4L9MA 4MN0A 4PE7A 3O2PA 1VRKA 1ZOTB 3FWCA 1TRFA 1EG4A 1GQMA 1S5GY 1PVAA 1J7OA 1KFUL 1XK4C 1YUUA 2CNPA 1WLMA 1B4CA 2H61A 3OP0A 3O78A 1WDCC 3BUWB 2EHBA 1D1OA 1ZMZA 3RM1A 1QVIY 2M7LA 3FWBA 5ER4X 1K9PA 2Q4UA 2L4HA 1LA0A 3CR4X 1XFYO 1NX2A 3I5HC 4OCIA 2EC6B 2CBLA 2KI6C 1EXRA 1SCMB 1AUIB 4NQGA 1YVLA 1AP4A 2AMIA 1F4QA 1PSRA 2WCFA 1YX8A 4JPZB 3SG3A 4WRIA 1BOCA 1NCXA 2K2AA 3H4SE 4DIRA 3DVMA 1UURA 3A4UB 1MUXA 2MRDA 2PVBA 3LK0A 1YR5A 3KPXA 3PN7B 4C0LA 4DUQA 3I5GB 2COLB 1SK6D 1BR1B 1L7ZA 2JNXA 3M0WA 1K95A 2NXQA 3A8RA 4MZKA 4TNCA 1CLBA 1UP5A 1QLSA 3VGOA 3PM8A 1MWNA 2LVJA 4PHJA 1Y1XA 2KBMA 1OZSA 4YI9A 1G8IA 3EK7A 3E3RA 2KI4C 2NLNA 1F54A 5CSNA 1A4PA 3NSKA 2I2RE 1SCMC 4AQJA 2KBIA 3PALA 3CR2A 1J7PA 1KQMB 1NX3A 2F8PA 1NWDA 2JXCA 4XYNA 1K2HA 2LVVA 1IGVA 1A2XA 2CXJA 1NCYA 2B1UA 3VRQA 2KFFA 4DCKA 1H4BA 1DVIA 5HKWA 3DF0B 3AAJA 2WCEA 4GUKA 1EJ3A 2PRUA 3PN7C 2R2IA 1V1GA 1AHRA 2A4JA 1CM4A 2NCPA 2E6WA 4MRXA 1B8RA 1DGVA 2JU0A 3NXAA 4PHNA 1BG1A 1FBVA 3CS1A 2LLSA 2L2EA 1LVCD 2JOJA 4OKHA 5AEQA 1XA5A 2K61A 2M49B 1M63B 2PASA 4MEWA 2SASA 2BKIB 3SJSA 4PE4A 1K9KA 4FTGA 3TDZA 3TS5B 2L5XB 1YRUB 4C0JA 4CIDA 1JUOA 2OTGB 4PALA 3OX6A 4XJKA 1S6IA 2O5GA 1YURA 3GOFA 1SNLA 2Y1MA 4I5NB 1KQMC 1CFFA 4E68A 1NYAA 4I5KA 3GK4X 1M39A 2O60A 4I5LB 3NSOA 1M31A 4DRWA 2FJUB 2KSPA 1XK4A 5HLVA 5HYDA 3AAKA 4F0ZB 1WDCB 1MF8B 5FYXA 2WOSA 1J1EA 3LK1A 1K96A 2JT3A 1KK7Y 1UHNA 1SPYA 3FS7A 2M8UA 2FCEA 2D8NA 3PFVA 3BUNB 1KK8B 3IF7A 1B9AA 4N5XA 1SL9A 1X02A 5AXIA 2BECA 1XFZO 1CFPA 4HSZA 2I94A 1QX5B 5I2LA 1B47A 3K21A 1XYDA 2M29A 3TS5C 1FW4A 1IJ6A 2BBMA 2I7AA 5AERA 2CTNA 4I5JA 1HT9A 5TNCA 3SG7A 2QPTA 3GK1A 2ZNDA 5HLOA 1QASA 1HQVA 1LXFC 1IH0A 1JFKA 3BXKA 2BCXA 1OZOA 1F71A 5DKQA 2KHNA 2CT9A 2MA2A 4WQ2A 4U8DA 1Q80A 3O6BA 1DMOA 2KNEA 3IQOA 1RROA 5D7FA 2G9BA 4HREE 4M2OA 1TNWA 1F4OA 1JBAA 2F2PA 1IKUA 3HX4A 2M9GA 4HRGA 1S3PA 2MAZA 1YRTB 1CMFA 1N0YA 1CMGA 1IRJA 1KK8C 2KI4B 3D10A 1BT6A 1WRLA 4GGNA 1NX1A 3KHEA 4QJ3B 4C0KA 3DVEA 1PK0D 5GQQC 3ICBA 1TCOB 1OSAA 2KAVA 2F3YA 4A4CA 2LUXA 2L51A 2F2OA 2PSRA 5IBWA 1CKKA 3BUMB 5PALA 1KSOA 1F8HA 3I5FB 3LCPC 1B1GA 5KU1A 1RTP1 2E30A 4N1FA 1G4YR 4JWQA 4QJ4B 1FI5A 1WLZA 3OB2B 2MLFC 3IQQA 1UHJA 2KFGA 1DJGA 4GAOA 3QRXA 3TDUA 4PHKA 4MRYA 1KQVA 2KGBC 5AFPA 2KFHA 1RFJA 1NX0A 2LANA 2JZIA 2BE4A 3TUYB 1A03A 1BR4B 2JTTA 3HCMA 2BL0B 1ZACA 3TZ1A 1B8CA 1M46A 2LE9B 2RGIA 4P2YB 1R2UA 2KQYA 4OR9B 4BY5A 1GGZA 3WHTB 2WNDA 3NSLA 4GBAA 2ZKMX 4UPGA 1QX7A 2P6BB 2Y4QA 2LCPA 1MQ1A 3NSIA 4OVNF 4PHMA 4YGEB 2EGDA 3WHUB 1JSAA 3JVTB 5G08A 1XFVO 1CM1A 1IQ3A 2AUCA 1YUSA 1NUBA 3DVKA 2M3WA 3SG2A 2JNFA 1JFJA 1FI6A 1DJHA 3DF0A 1QIVA 1QTXA 1NPQA 2IS9A 4NDCA 2JRFA 1QS7A 1UHHA 2LMUA 2BE6A 3I5FC 2L0PA 4YGDB 2LVKA 2KYFA 1E8AA 3PATA 3OHMB 2BKHB 3SIBA 1MHOA 1G33A 1PALA 5KTYA 4YGAA 3VRPA 4DS7A 1SKTA 3AKBA 5I8NA 1QVIZ 2HPSA 3KF9A 2HQ8A 2LV7A 3D0YB 3TUYC 4ETOA 2JWWA 2K7DA 1DJIA 1K8UA 1Y1AA 1OE9B 2BL0C 2KI6D 2DOQA 1CFCA 1OQPA 2L50A 2LHLA 2ZRSA 1R6PA 1SCVA 4NDBA 2I18A 5ER5A 2M97A 1XO5A 1WY9A 1KFXS 1PSBA 1QX2A 2GGZA 3LLEA 3JVTC 1CDMA 1L2OC 1S36A 1DF0B 1KCYA 4NDDA 1A75A 1XFXO 1WRZA 1A75B 1K94A 3EVUA 4ZCVA 3SG5A 2KQ6A 1ZFSA 3EVRA 3BYAA 2LP2A 2ISDA 3SG4A 1S26D 1XFWO 5I2OA 1TNPA 4YI8A 1OMVA 3EK4A 2GV5A 1MXEA 1C07A 1CLMA 1CDNA 1XFUO 1UHIA 2Q91A 2WCBA 4M2QA 4PE1A 3BOWB 1CB1A 3JTDB 1K9UA 2K7OA 1ZUZA 2M0RA 3DVJA 2NCOA 4MSPA 1DJWA 4ICBA 4WQ3A 1WRKA 4USLA 2KAYA 4PE0A 1CFDA 3PLFB 1YVHA 5K89A 4CLNA 1V1FA 2LUCA 1ALWA 1IQ5A 1BMOA 3VROA 1XVJA 1J7RA 1IWQA 1W7IB 2VRGA 2LHIA 2LM5A 2MLEC 1SR6B 3OB1B 1BJFA 3BQ3A 1TN4A 4HRHA 4OV2A 4CPVA 2JULA 1SYMA 1CNPA 1KSMA 1IJ5A 1LINA 1ODBA 1BU3A 3BUXB 1U5IB 2HETA 1AK8A 2PALA 4GPLB 1DTLA 2LC5A 3MSEB 5JJGA 1JWDA 3EKJA 5CPVA 2LMVA 3JTDC 1NIWA 4BY4A 2F33A 3CWGA 2PMYA 1K93D 2KDHA 2MHHA 4P5OE 1QLKA 1JF2A 4ORBB 3I5IB 5F6TA 1DJXA 2LLTA 1SY9A 3CTNA 1TNQA 1TOPA 2OS8B 2JT8A 5JOLA 3SG6A 2JT0A 2ZN9A 1CLLA 1NCZA 3F45A 4MLWA 2ZNEA 1MR8A 3EVVA 5AANA 4FQOA 2BBNA 4GGFC 2FOTA 2LMTA 1EL4A 4ORAB 1SR6C 3GK2A 1KWOB 4N1GA 1B7TZ 1TIZA 4R1EA 2M7NA 2K7CA 2SCPA 2Y5IA 1KK7Z 1CTRA 1N65A 1MXLC 1RECA 2L4IA 4GFTA 1Y6WA 4QJ5B 1BF5A 3WXAA 1C7VA 1YUTA 2AAOA 4ORCB 5HKZA 5DKRA 2OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  4CFR A;  1J7Q A;  3WNX B;  5CSF A;  1SL7 A;  1QJT A;  1SRA A;  2HF5 A;  2K8M B;  2WOR A;  1PVB A;  1Y0V H;  1AJ5 A;  1GJY A;  3I5I C;  1L2O B;  2HQW A;  1EH2 A;  3VRN A;  5J3X A;  2M1K B;  2K0J A;  2QAC A;  2OS8 C;  4YRU A;  1SMG A;  2H2K A;  1KFU S;  1RWY A;  2H61 C;  1GGW A;  3CLN A;  1LA3 A;  2KGR A;  2KOT A;  1S6J A;  1S5G Z;  1AJ4 A;  4A4B A;  2WC8 A;  4GNK B;  4AQI A;  1KWO C;  4JQ0 D;  2M1U A;  2LP3 A;  4MVF A;  1W7J B;  2ZRT A;  2Y1N A;  4MBE A;  2EC6 C;  1TCF A;  1B8L A;  2K2F A;  2V53 A;  3D0Y A;  3RLZ A;  1RK9 A;  5KSZ A;  1JF0 A;  1NSH A;  3CR5 X;  1F70 A;  1H8B A;  2JTZ A;  1LKJ A;  1Y1U A;  2BCA A;  3SIA A;  3KO0 A;  3ZNI A;  1N2D A;  2KAX A;  5BPJ A;  1JC2 A;  3I5G C;  1DF0 A;  2LVI A;  3KEV A;  2MJW B;  4YBH B;  1QV1 A;  1DJY A;  1QXP A;  5HKY A;  2LLU A;  3CGA A;  3LL8 B;  5CSI A;  4ZCU A;  1UUS A;  1J55 A;  2JC2 A;  1NP8 A;  5DKN A;  5CSJ A;  4CFQ A;  2MBX A;  2GGM A;  2NZ0 A;  2LNK A;  3FIA A;  4YGB B;  2ZN8 A;  4YGC B;  2L98 A;  1CDL A;  5I2Q A;  3C1V A;  3TDI A;  3DD4 A;  1A29 A;  3BOW A;  1S1E A;  4M2P A;  1TNX A;  1YTZ C;  1BOD A;  2JXL A;  4XJK B;  4IL1 A;  1UHK A;  1PRW A;  1QAT A;  2G2B A;  4D1E A;  3AKA A;  2BCB A;  1FF1 A;  4MZJ A;  3VRR A;  5D69 A;  3CZT X;  2KYC A;  1YX7 A;  1BLQ A;  1DGU A;  4MZL A;  1FPW A;  2FCD A;  1TTX A;  1SBJ A;  1OMD A;  1B7T Y;  3ZWH A;  2LAP A;  1C7W A;  2F3Z A;  1K90 D;  4GGF A;  1F55 A;  3O4Y A;  1UWO A;  3OX5 A;  1OMR A;  2CCM A;  3EKH A;  3BUO B;  2JPT A;  1EG3 A;  1DJZ A;  1ALV A;  2K7B A;  4PCW A;  3I5H B;  1QV0 A;  2JQ6 A;  1OOJ A;  1J1D A;  3EK8 A;  1QIW A;  1U5I A;  5B8I B;  1M45 A;  1PUL A;  1SW8 A;  1RJV A;  3PSR A;  1S6C A;  2OTG C;  4AOM A;  4Q04 A;  1CDP A;  2TN4 A;  1DT7 B;  1SL8 A;  2ZFD A;  1IG5 A;  4PDZ A;  1AVS A;  4L9M A;  4MN0 A;  4PE7 A;  3O2P A;  1VRK A;  1ZOT B;  3FWC A;  1TRF A;  1EG4 A;  1GQM A;  1S5G Y;  1PVA A;  1J7O A;  1KFU L;  1XK4 C;  1YUU A;  2CNP A;  1WLM A;  1B4C A;  2H61 A;  3OP0 A;  3O78 A;  1WDC C;  3BUW B;  2EHB A;  1D1O A;  1ZMZ A;  3RM1 A;  1QVI Y;  2M7L A;  3FWB A;  5ER4 X;  1K9P A;  2Q4U A;  2L4H A;  1LA0 A;  3CR4 X;  1XFY O;  1NX2 A;  3I5H C;  4OCI A;  2EC6 B;  2CBL A;  2KI6 C;  1EXR A;  1SCM B;  1AUI B;  4NQG A;  1YVL A;  1AP4 A;  2AMI A;  1F4Q A;  1PSR A;  2WCF A;  1YX8 A;  4JPZ B;  3SG3 A;  4WRI A;  1BOC A;  1NCX A;  2K2A A;  3H4S E;  4DIR A;  3DVM A;  1UUR A;  3A4U B;  1MUX A;  2MRD A;  2PVB A;  3LK0 A;  1YR5 A;  3KPX A;  3PN7 B;  4C0L A;  4DUQ A;  3I5G B;  2COL B;  1SK6 D;  1BR1 B;  1L7Z A;  2JNX A;  3M0W A;  1K95 A;  2NXQ A;  3A8R A;  4MZK A;  4TNC A;  1CLB A;  1UP5 A;  1QLS A;  3VGO A;  3PM8 A;  1MWN A;  2LVJ A;  4PHJ A;  1Y1X A;  2KBM A;  1OZS A;  4YI9 A;  1G8I A;  3EK7 A;  3E3R A;  2KI4 C;  2NLN A;  1F54 A;  5CSN A;  1A4P A;  3NSK A;  2I2R E;  1SCM C;  4AQJ A;  2KBI A;  3PAL A;  3CR2 A;  1J7P A;  1KQM B;  1NX3 A;  2F8P A;  1NWD A;  2JXC A;  4XYN A;  1K2H A;  2LVV A;  1IGV A;  1A2X A;  2CXJ A;  1NCY A;  2B1U A;  3VRQ A;  2KFF A;  4DCK A;  1H4B A;  1DVI A;  5HKW A;  3DF0 B;  3AAJ A;  2WCE A;  4GUK A;  1EJ3 A;  2PRU A;  3PN7 C;  2R2I A;  1V1G A;  1AHR A;  2A4J A;  1CM4 A;  2NCP A;  2E6W A;  4MRX A;  1B8R A;  1DGV A;  2JU0 A;  3NXA A;  4PHN A;  1BG1 A;  1FBV A;  3CS1 A;  2LLS A;  2L2E A;  1LVC D;  2JOJ A;  4OKH A;  5AEQ A;  1XA5 A;  2K61 A;  2M49 B;  1M63 B;  2PAS A;  4MEW A;  2SAS A;  2BKI B;  3SJS A;  4PE4 A;  1K9K A;  4FTG A;  3TDZ A;  3TS5 B;  2L5X B;  1YRU B;  4C0J A;  4CID A;  1JUO A;  2OTG B;  4PAL A;  3OX6 A;  4XJK A;  1S6I A;  2O5G A;  1YUR A;  3GOF A;  1SNL A;  2Y1M A;  4I5N B;  1KQM C;  1CFF A;  4E68 A;  1NYA A;  4I5K A;  3GK4 X;  1M39 A;  2O60 A;  4I5L B;  3NSO A;  1M31 A;  4DRW A;  2FJU B;  2KSP A;  1XK4 A;  5HLV A;  5HYD A;  3AAK A;  4F0Z B;  1WDC B;  1MF8 B;  5FYX A;  2WOS A;  1J1E A;  3LK1 A;  1K96 A;  2JT3 A;  1KK7 Y;  1UHN A;  1SPY A;  3FS7 A;  2M8U A;  2FCE A;  2D8N A;  3PFV A;  3BUN B;  1KK8 B;  3IF7 A;  1B9A A;  4N5X A;  1SL9 A;  1X02 A;  5AXI A;  2BEC A;  1XFZ O;  1CFP A;  4HSZ A;  2I94 A;  1QX5 B;  5I2L A;  1B47 A;  3K21 A;  1XYD A;  2M29 A;  3TS5 C;  1FW4 A;  1IJ6 A;  2BBM A;  2I7A A;  5AER A;  2CTN A;  4I5J A;  1HT9 A;  5TNC A;  3SG7 A;  2QPT A;  3GK1 A;  2ZND A;  5HLO A;  1QAS A;  1HQV A;  1LXF C;  1IH0 A;  1JFK A;  3BXK A;  2BCX A;  1OZO A;  1F71 A;  5DKQ A;  2KHN A;  2CT9 A;  2MA2 A;  4WQ2 A;  4U8D A;  1Q80 A;  3O6B A;  1DMO A;  2KNE A;  3IQO A;  1RRO A;  5D7F A;  2G9B A;  4HRE E;  4M2O A;  1TNW A;  1F4O A;  1JBA A;  2F2P A;  1IKU A;  3HX4 A;  2M9G A;  4HRG A;  1S3P A;  2MAZ A;  1YRT B;  1CMF A;  1N0Y A;  1CMG A;  1IRJ A;  1KK8 C;  2KI4 B;  3D10 A;  1BT6 A;  1WRL A;  4GGN A;  1NX1 A;  3KHE A;  4QJ3 B;  4C0K A;  3DVE A;  1PK0 D;  5GQQ C;  3ICB A;  1TCO B;  1OSA A;  2KAV A;  2F3Y A;  4A4C A;  2LUX A;  2L51 A;  2F2O A;  2PSR A;  5IBW A;  1CKK A;  3BUM B;  5PAL A;  1KSO A;  1F8H A;  3I5F B;  3LCP C;  1B1G A;  5KU1 A;  1RTP 1;  2E30 A;  4N1F A;  1G4Y R;  4JWQ A;  4QJ4 B;  1FI5 A;  1WLZ A;  3OB2 B;  2MLF C;  3IQQ A;  1UHJ A;  2KFG A;  1DJG A;  4GAO A;  3QRX A;  3TDU A;  4PHK A;  4MRY A;  1KQV A;  2KGB C;  5AFP A;  2KFH A;  1RFJ A;  1NX0 A;  2LAN A;  2JZI A;  2BE4 A;  3TUY B;  1A03 A;  1BR4 B;  2JTT A;  3HCM A;  2BL0 B;  1ZAC A;  3TZ1 A;  1B8C A;  1M46 A;  2LE9 B;  2RGI A;  4P2Y B;  1R2U A;  2KQY A;  4OR9 B;  4BY5 A;  1GGZ A;  3WHT B;  2WND A;  3NSL A;  4GBA A;  2ZKM X;  4UPG A;  1QX7 A;  2P6B B;  2Y4Q A;  2LCP A;  1MQ1 A;  3NSI A;  4OVN F;  4PHM A;  4YGE B;  2EGD A;  3WHU B;  1JSA A;  3JVT B;  5G08 A;  1XFV O;  1CM1 A;  1IQ3 A;  2AUC A;  1YUS A;  1NUB A;  3DVK A;  2M3W A;  3SG2 A;  2JNF A;  1JFJ A;  1FI6 A;  1DJH A;  3DF0 A;  1QIV A;  1QTX A;  1NPQ A;  2IS9 A;  4NDC A;  2JRF A;  1QS7 A;  1UHH A;  2LMU A;  2BE6 A;  3I5F C;  2L0P A;  4YGD B;  2LVK A;  2KYF A;  1E8A A;  3PAT A;  3OHM B;  2BKH B;  3SIB A;  1MHO A;  1G33 A;  1PAL A;  5KTY A;  4YGA A;  3VRP A;  4DS7 A;  1SKT A;  3AKB A;  5I8N A;  1QVI Z;  2HPS A;  3KF9 A;  2HQ8 A;  2LV7 A;  3D0Y B;  3TUY C;  4ETO A;  2JWW A;  2K7D A;  1DJI A;  1K8U A;  1Y1A A;  1OE9 B;  2BL0 C;  2KI6 D;  2DOQ A;  1CFC A;  1OQP A;  2L50 A;  2LHL A;  2ZRS A;  1R6P A;  1SCV A;  4NDB A;  2I18 A;  5ER5 A;  2M97 A;  1XO5 A;  1WY9 A;  1KFX S;  1PSB A;  1QX2 A;  2GGZ A;  3LLE A;  3JVT C;  1CDM A;  1L2O C;  1S36 A;  1DF0 B;  1KCY A;  4NDD A;  1A75 A;  1XFX O;  1WRZ A;  1A75 B;  1K94 A;  3EVU A;  4ZCV A;  3SG5 A;  2KQ6 A;  1ZFS A;  3EVR A;  3BYA A;  2LP2 A;  2ISD A;  3SG4 A;  1S26 D;  1XFW O;  5I2O A;  1TNP A;  4YI8 A;  1OMV A;  3EK4 A;  2GV5 A;  1MXE A;  1C07 A;  1CLM A;  1CDN A;  1XFU O;  1UHI A;  2Q91 A;  2WCB A;  4M2Q A;  4PE1 A;  3BOW B;  1CB1 A;  3JTD B;  1K9U A;  2K7O A;  1ZUZ A;  2M0R A;  3DVJ A;  2NCO A;  4MSP A;  1DJW A;  4ICB A;  4WQ3 A;  1WRK A;  4USL A;  2KAY A;  4PE0 A;  1CFD A;  3PLF B;  1YVH A;  5K89 A;  4CLN A;  1V1F A;  2LUC A;  1ALW A;  1IQ5 A;  1BMO A;  3VRO A;  1XVJ A;  1J7R A;  1IWQ A;  1W7I B;  2VRG A;  2LHI A;  2LM5 A;  2MLE C;  1SR6 B;  3OB1 B;  1BJF A;  3BQ3 A;  1TN4 A;  4HRH A;  4OV2 A;  4CPV A;  2JUL A;  1SYM A;  1CNP A;  1KSM A;  1IJ5 A;  1LIN A;  1ODB A;  1BU3 A;  3BUX B;  1U5I B;  2HET A;  1AK8 A;  2PAL A;  4GPL B;  1DTL A;  2LC5 A;  3MSE B;  5JJG A;  1JWD A;  3EKJ A;  5CPV A;  2LMV A;  3JTD C;  1NIW A;  4BY4 A;  2F33 A;  3CWG A;  2PMY A;  1K93 D;  2KDH A;  2MHH A;  4P5O E;  1QLK A;  1JF2 A;  4ORB B;  3I5I B;  5F6T A;  1DJX A;  2LLT A;  1SY9 A;  3CTN A;  1TNQ A;  1TOP A;  2OS8 B;  2JT8 A;  5JOL A;  3SG6 A;  2JT0 A;  2ZN9 A;  1CLL A;  1NCZ A;  3F45 A;  4MLW A;  2ZNE A;  1MR8 A;  3EVV A;  5AAN A;  4FQO A;  2BBN A;  4GGF C;  2FOT A;  2LMT A;  1EL4 A;  4ORA B;  1SR6 C;  3GK2 A;  1KWO B;  4N1G A;  1B7T Z;  1TIZ A;  4R1E A;  2M7N A;  2K7C A;  2SCP A;  2Y5I A;  1KK7 Z;  1CTR A;  1N65 A;  1MXL C;  1REC A;  2L4I A;  4GFT A;  1Y6W A;  4QJ5 B;  1BF5 A;  3WXA A;  1C7V A;  1YUT A;  2AAO A;  4ORC B;  5HKZ A;  5DKR A;  2OPO A; 
#chains in the Genus database with same CATH topology
 1KFX L;  4CFR A;  1J7Q A;  3WNX B;  1P28 A;  1QWV A;  5CSF A;  1SL7 A;  1OOH A;  2QEV A;  1QJT A;  1SRA A;  2HF5 A;  2K8M B;  3CAB A;  5HL1 A;  2WOR A;  1PVB A;  1DC1 A;  1Y0V H;  1AJ5 A;  1GJY A;  3I5I C;  1L2O B;  2HQW A;  1EH2 A;  3VRN A;  5J3X A;  2M1K B;  2K0J A;  2QAC A;  2OS8 C;  4YRU A;  2WCL A;  1SMG A;  2H2K A;  1KFU S;  1RWY A;  2H61 C;  3SS5 A;  4KYN A;  1GGW A;  3CLN A;  1LA3 A;  2KGR A;  2GTE A;  2KOT A;  3S0D A;  1S6J A;  3V2L A;  1S5G Z;  1AJ4 A;  4A4B A;  2WC8 A;  3R1P A;  4GNK B;  4AQI A;  1KWO C;  4JQ0 D;  1TUZ A;  2M1U A;  2LP3 A;  4MVF A;  1W7J B;  2ZRT A;  2Y1N A;  4MBE A;  2EC6 C;  1TCF A;  1B8L A;  2K2F A;  2V53 A;  3D0Y A;  3RLZ A;  1RK9 A;  2BAP A;  5KSZ A;  1JF0 A;  1NSH A;  3CR5 X;  3B6X A;  3CDN A;  1F70 A;  1OOF A;  1H8B A;  2JTZ A;  1LKJ A;  1Y1U A;  2BCA A;  3IVT A;  3SIA A;  3PM2 A;  3KO0 A;  3ZNI A;  1N2D A;  3DZT A;  1LS8 A;  2KAX A;  2P70 A;  5BPJ A;  1JC2 A;  3I5G C;  1DF0 A;  2LVI A;  5I94 A;  3KEV A;  4JD9 A;  2MJW B;  4YBH B;  1QV1 A;  1DJY A;  1QXP A;  5HKY A;  2LLU A;  3CGA A;  3LL8 B;  5CSI A;  4ZCU A;  1UUS A;  1J55 A;  2JC2 A;  1NP8 A;  5DKN A;  5CSJ A;  4CFQ A;  2MBX A;  2GGM A;  2NZ0 A;  2LNK A;  3FIA A;  4YGB B;  1OOI X;  3O4X A;  2ZN8 A;  4YGC B;  2L98 A;  1CDL A;  5I2Q A;  3C1V A;  3TDI A;  3DD4 A;  1A29 A;  3BOW A;  1S1E A;  4M2P A;  1TNX A;  1YTZ C;  3L47 A;  1BOD A;  2JXL A;  4XJK B;  4IL1 A;  1UHK A;  1PRW A;  1QAT A;  2G2B A;  4D1E A;  3AKA A;  2BCB A;  1FF1 A;  4MZJ A;  3VRR A;  3S0E A;  5D69 A;  3CZT X;  2KYC A;  1YX7 A;  1BLQ A;  1DGU A;  4FQT A;  1ORG A;  2WCH A;  4MZL A;  1FPW A;  2FCD A;  1TTX A;  1SBJ A;  1OMD A;  1B7T Y;  3ZWH A;  2LAP A;  1C7W A;  2F3Z A;  1K90 D;  4GGF A;  1F55 A;  3O4Y A;  1UWO A;  3OX5 A;  1OMR A;  2CCM A;  3EKH A;  3BUO B;  2JPT A;  1EG3 A;  1DJZ A;  1ALV A;  2FJY A;  2K7B A;  4PCW A;  3I5H B;  1QV0 A;  2JQ6 A;  1OOJ A;  1J1D A;  3EK8 A;  1QIW A;  1U5I A;  5B8I B;  1M45 A;  1PUL A;  1SW8 A;  1RJV A;  3PSR A;  4PT1 A;  2YGU A;  1S6C A;  2OTG C;  4AOM A;  3S0F A;  4Q04 A;  1CDP A;  3DYE A;  2TN4 A;  1DT7 B;  1SL8 A;  2ZFD A;  3NGV A;  2PQL A;  1IG5 A;  3FE8 A;  4PDZ A;  1AVS A;  4L9M A;  4MN0 A;  4PE7 A;  3O2P A;  1VRK A;  1ZOT B;  3FWC A;  1TRF A;  1EG4 A;  1GQM A;  1S5G Y;  3L4A A;  1PVA A;  3CZ0 A;  1KFU L;  1XK4 C;  1J7O A;  1YUU A;  2CNP A;  1WLM A;  1B4C A;  2H61 A;  3OP0 A;  3O78 A;  1WDC C;  3BUW B;  2EHB A;  1D1O A;  1ZMZ A;  3RM1 A;  1QVI Y;  2M7L A;  3FWB A;  5ER4 X;  1K9P A;  2Q4U A;  2L4H A;  1LA0 A;  3CR4 X;  1XFY O;  1NX2 A;  1IIO A;  3I5H C;  4OCI A;  2EC6 B;  2CBL A;  2KI6 C;  1EXR A;  3DXL A;  1SCM B;  1AUI B;  4NQG A;  1YVL A;  1AP4 A;  2AMI A;  1F4Q A;  1PSR A;  2WCF A;  2WCK A;  1YX8 A;  4JPZ B;  3SG3 A;  4WRI A;  1BOC A;  1NCX A;  2K2A A;  3H4S E;  4DIR A;  3DVM A;  1UUR A;  2WCJ A;  3A4U B;  3L4L A;  1MUX A;  3NHT A;  2MRD A;  2PVB A;  3LK0 A;  1YR5 A;  3KPX A;  3PN7 B;  4C0L A;  4DUQ A;  3I5G B;  2COL B;  1SK6 D;  1BR1 B;  1L7Z A;  2JNX A;  3D74 A;  3M0W A;  1K95 A;  2NXQ A;  3A8R A;  4MZK A;  4TNC A;  3OBV A;  1CLB A;  1UP5 A;  1QLS A;  3VGO A;  3PM8 A;  2KLE A;  1MWN A;  2LVJ A;  4PHJ A;  1Y1X A;  2KBM A;  1OZS A;  4YI9 A;  4NDC A;  1G8I A;  3EK7 A;  3E3R A;  2KI4 C;  2NLN A;  3S0G A;  1F54 A;  1W9Z A;  3B87 A;  5CSN A;  1A4P A;  3NSK A;  2I2R E;  1SCM C;  3N7H A;  4AQJ A;  2KBI A;  2L2C A;  3PAL A;  3CR2 A;  1J7P A;  1KQM B;  1NX3 A;  2F8P A;  1NWD A;  2JXC A;  4XYN A;  1K2H A;  2LVV A;  1IGV A;  1A2X A;  1TWO A;  2CXJ A;  3B88 A;  1NCY A;  2B1U A;  3VRQ A;  2KFF A;  4DCK A;  1H4B A;  1DVI A;  3OGN A;  5HKW A;  3DF0 B;  3AAJ A;  2WCE A;  4GUK A;  3VB1 A;  1EJ3 A;  2PRU A;  3PN7 C;  5FI6 A;  2R2I A;  1V1G A;  1AHR A;  2A4J A;  1CM4 A;  2NCP A;  2E6W A;  4MRX A;  1B8R A;  1DGV A;  2JU0 A;  2QEH A;  3NXA A;  4PHN A;  1FBV A;  1BG1 A;  3CS1 A;  2LLS A;  3BJH A;  2WCM A;  3BFA A;  2L2E A;  1LVC D;  2JOJ A;  4OKH A;  5AEQ A;  1XA5 A;  2K61 A;  2M49 B;  5FI2 A;  1M63 B;  2PAS A;  4MEW A;  2SAS A;  2BKI B;  3SJS A;  4PE4 A;  2L5Y A;  1K9K A;  4FTG A;  3TDZ A;  3TS5 B;  2KPH A;  2L5X B;  1YRU B;  4C0J A;  4CID A;  1JUO A;  2OTG B;  4PAL A;  3OX6 A;  2ERB A;  4XJK A;  1S6I A;  2O5G A;  1YUR A;  3GOF A;  1SNL A;  2Y1M A;  4I5N B;  1KQM C;  1CFF A;  4E68 A;  1NYA A;  4I5K A;  3GK4 X;  1M39 A;  2O60 A;  4I5L B;  3NSO A;  3S0A A;  1M31 A;  1DEK A;  2FJU B;  2KSP A;  4DRW A;  3RZS A;  1XK4 A;  5HLV A;  5HYD A;  3AAK A;  4F0Z B;  1WDC B;  1MF8 B;  3FE6 A;  5FYX A;  2WOS A;  1J1E A;  3LK1 A;  1K96 A;  2JT3 A;  1KK7 Y;  1UHN A;  1SPY A;  3FS7 A;  2M8U A;  2FCE A;  2D8N A;  3PFV A;  3BUN B;  1KK8 B;  2BNX A;  1OW4 A;  1B9A A;  3IF7 A;  4N5X A;  1SL9 A;  3PJI A;  1X02 A;  5AXI A;  2BEC A;  1XFZ O;  1CFP A;  4HSZ A;  2I94 A;  1QX5 B;  5I2L A;  1B47 A;  3K21 A;  1XYD A;  2M29 A;  3TS5 C;  1FW4 A;  1IJ6 A;  2BBM A;  5FI7 A;  2I7A A;  5AER A;  2CTN A;  3CZ1 A;  4I5J A;  1HT9 A;  5TNC A;  3SG7 A;  2QPT A;  3GK1 A;  2ZND A;  5HLO A;  1QAS A;  1HQV A;  1LXF C;  1IH0 A;  1JFK A;  3R1V A;  3BXK A;  2BCX A;  1OZO A;  1OOG A;  3BFH A;  4INW A;  1F71 A;  5DKQ A;  2KHN A;  2CT9 A;  2MA2 A;  4WQ2 A;  4U8D A;  1Q80 A;  3O6B A;  3S0B A;  1DMO A;  2KNE A;  3IQO A;  1RRO A;  5D7F A;  2G9B A;  4HRE E;  4M2O A;  1TNW A;  1F4O A;  1JBA A;  2F2P A;  1IKU A;  3HX4 A;  2M9G A;  4HRG A;  1S3P A;  2MAZ A;  1YRT B;  2QEO A;  1CMF A;  2QDI A;  1N0Y A;  1CMG A;  1IRJ A;  1KK8 C;  2KI4 B;  3D10 A;  1BT6 A;  1WRL A;  4IJ7 A;  4GGN A;  1NX1 A;  3KHE A;  4QJ3 B;  4C0K A;  3D76 A;  3DVE A;  1PK0 D;  5GQQ C;  3ICB A;  1TCO B;  1OSA A;  2KAV A;  2F3Y A;  4A4C A;  2LUX A;  2L51 A;  1GM0 A;  2F2O A;  2PSR A;  5IBW A;  3R1O A;  2WC6 A;  1CKK A;  3BUM B;  5PAL A;  1KSO A;  1F8H A;  3I5F B;  3LCP C;  1B1G A;  5KU1 A;  1RTP 1;  2E30 A;  4N1F A;  1G4Y R;  2KLD A;  4JWQ A;  4QJ4 B;  1WLZ A;  3OB2 B;  2MLF C;  3IQQ A;  1FI5 A;  1UHJ A;  2KFG A;  1DJG A;  4GAO A;  3QRX A;  3TDU A;  4PHK A;  4MRY A;  2H8V A;  2KGB C;  4OZD A;  1KQV A;  5AFP A;  2KFH A;  1RFJ A;  1NX0 A;  2LAN A;  2JZI A;  2BE4 A;  3TUY B;  1A03 A;  1BR4 B;  2JTT A;  3HCM A;  2BL0 B;  1ZAC A;  3TZ1 A;  1B8C A;  1M46 A;  2LE9 B;  2RGI A;  3D78 A;  4P2Y B;  1R2U A;  2KQY A;  4OR9 B;  4BY5 A;  1GGZ A;  3WHT B;  2WND A;  2QEB A;  3NSL A;  4GBA A;  2ZKM X;  4UPG A;  3UNW A;  1QX7 A;  2P6B B;  2Y4Q A;  2LCP A;  1MQ1 A;  3NSI A;  4OVN F;  4PHM A;  4YGE B;  2EGD A;  3WHU B;  1JSA A;  3JVT B;  5G08 A;  1XFV O;  1CM1 A;  1IQ3 A;  1TUJ A;  2AUC A;  1YUS A;  1NUB A;  3DVK A;  2M3W A;  3SG2 A;  2JNF A;  1JFJ A;  1FI6 A;  1DJH A;  3DF0 A;  1QIV A;  1QTX A;  1NPQ A;  1DQE A;  2IS9 A;  2JRF A;  1QS7 A;  1UHH A;  2LMU A;  2BE6 A;  3FE9 A;  2L0P A;  3I5F C;  2LVK A;  2KYF A;  1E8A A;  3PAT A;  4YGD B;  3OHM B;  2BKH B;  3SIB A;  3UO9 A;  1MHO A;  1G33 A;  1PAL A;  5KTY A;  4YGA A;  3VRP A;  4DS7 A;  1SKT A;  1Z4H A;  3AKB A;  1QVI Z;  5I8N A;  2HPS A;  3KF9 A;  2HQ8 A;  2LV7 A;  3D0Y B;  4INX A;  3TUY C;  4ETO A;  1SSE B;  2JWW A;  2K7D A;  1DJI A;  1K8U A;  1Y1A A;  1OE9 B;  2BL0 C;  2KI6 D;  2DOQ A;  1CFC A;  1OQP A;  2L50 A;  2LHL A;  2ZRS A;  4F7F A;  1R6P A;  1SCV A;  4NDB A;  2I18 A;  5ER5 A;  2M97 A;  1XO5 A;  2WC5 A;  1WY9 A;  1KFX S;  5DIC A;  1PSB A;  1QX2 A;  2GGZ A;  3LLE A;  3JVT C;  1CDM A;  1L2O C;  1S36 A;  1DF0 B;  1KCY A;  4NDD A;  1A75 A;  1XFX O;  1WRZ A;  1A75 B;  1K94 A;  3EVU A;  4ZCV A;  3SG5 A;  2KQ6 A;  1ZFS A;  3EVR A;  1DEL A;  3BYA A;  2LP2 A;  3QME A;  2ISD A;  3SG4 A;  1S26 D;  1XFW O;  5I2O A;  1TNP A;  4YI8 A;  1OMV A;  3EK4 A;  2GV5 A;  1MXE A;  1C07 A;  1CLM A;  3R72 A;  3SS4 A;  1CDN A;  1XFU O;  1UHI A;  2Q91 A;  2WCB A;  4M2Q A;  4PE1 A;  3BOW B;  2P71 A;  3SS3 A;  5D3O A;  3DY9 A;  1CB1 A;  3JTD B;  2K60 A;  1K9U A;  2K7O A;  1ZUZ A;  2M0R A;  3DVJ A;  5EL2 A;  2NCO A;  3BFB A;  1T14 A;  4MSP A;  1DJW A;  4ICB A;  4WQ3 A;  1WRK A;  3Q8I A;  4USL A;  3NHI A;  2KAY A;  4PE0 A;  1CFD A;  3B7A A;  1YVH A;  3PLF B;  5K89 A;  3D73 A;  4CLN A;  1C3Y A;  1V1F A;  2LUC A;  1ALW A;  1IQ5 A;  1BMO A;  3VRO A;  1XVJ A;  1J7R A;  1IWQ A;  1W7I B;  2VRG A;  2LHI A;  2LM5 A;  4JKT A;  2MLE C;  1SR6 B;  3D77 A;  1BJF A;  3BQ3 A;  1TN4 A;  3OB1 B;  4HRH A;  4OV2 A;  4CPV A;  2JUL A;  3EG5 B;  1SYM A;  1CNP A;  2PYQ A;  1KSM A;  1IJ5 A;  1Z2C B;  1LIN A;  1ODB A;  1BU3 A;  3BUX B;  1U5I B;  2HET A;  1AK8 A;  2PAL A;  4GPL B;  1DTL A;  2LC5 A;  3MSE B;  5JJG A;  1JWD A;  3EKJ A;  1C3Z A;  2LMV A;  3CYZ A;  1NIW A;  3JTD C;  2F33 A;  2JPO A;  3CWG A;  5CPV A;  4BY4 A;  2PMY A;  1K93 D;  2KDH A;  2MHH A;  4P5O E;  1QLK A;  1JF2 A;  4ORB B;  3I5I B;  5F6T A;  1DJX A;  1XFR A;  2LLT A;  1SY9 A;  3B86 A;  3CTN A;  1TNQ A;  1TOP A;  2OS8 B;  2JT8 A;  5JOL A;  3SG6 A;  2JT0 A;  2ZN9 A;  1CLL A;  1NCZ A;  3F45 A;  4MLW A;  2ZNE A;  1MR8 A;  3EVV A;  5AAN A;  4FQO A;  3K1E A;  2BBN A;  4GGF C;  2FOT A;  2LMT A;  1EL4 A;  4ORA B;  3CZ2 A;  1SR6 C;  3GK2 A;  1KWO B;  4N1G A;  1B7T Z;  1TIZ A;  4R1E A;  2M7N A;  2K7C A;  2SCP A;  2Y5I A;  1KK7 Z;  1CTR A;  1N65 A;  1MXL C;  1REC A;  2L4I A;  4GFT A;  1Y6W A;  4QJ5 B;  1BF5 A;  3WXA A;  1C7V A;  1YUT A;  2AAO A;  4ORC B;  5HKZ A;  5DKR A;  3D75 A;  2OPO A; 
#chains in the Genus database with same CATH homology
 1KFX L;  4CFR A;  1J7Q A;  3WNX B;  5CSF A;  1SL7 A;  1QJT A;  1SRA A;  2HF5 A;  2K8M B;  2WOR A;  1PVB A;  1Y0V H;  1AJ5 A;  1GJY A;  3I5I C;  1L2O B;  2HQW A;  1EH2 A;  3VRN A;  5J3X A;  2M1K B;  2K0J A;  2QAC A;  2OS8 C;  4YRU A;  1SMG A;  2H2K A;  1KFU S;  1RWY A;  2H61 C;  1GGW A;  3CLN A;  1LA3 A;  2KGR A;  2KOT A;  1S6J A;  1S5G Z;  1AJ4 A;  4A4B A;  2WC8 A;  4GNK B;  4AQI A;  1KWO C;  4JQ0 D;  2M1U A;  2LP3 A;  4MVF A;  1W7J B;  2ZRT A;  2Y1N A;  4MBE A;  2EC6 C;  1TCF A;  1B8L A;  2K2F A;  2V53 A;  3D0Y A;  3RLZ A;  1RK9 A;  5KSZ A;  1JF0 A;  1NSH A;  3CR5 X;  1F70 A;  1H8B A;  2JTZ A;  1LKJ A;  1Y1U A;  2BCA A;  3SIA A;  3KO0 A;  3ZNI A;  1N2D A;  2KAX A;  5BPJ A;  1JC2 A;  3I5G C;  1DF0 A;  2LVI A;  3KEV A;  2MJW B;  4YBH B;  1QV1 A;  1DJY A;  1QXP A;  5HKY A;  2LLU A;  3CGA A;  3LL8 B;  5CSI A;  4ZCU A;  1UUS A;  1J55 A;  2JC2 A;  1NP8 A;  5DKN A;  5CSJ A;  4CFQ A;  2MBX A;  2GGM A;  2NZ0 A;  2LNK A;  3FIA A;  4YGB B;  2ZN8 A;  4YGC B;  2L98 A;  1CDL A;  5I2Q A;  3C1V A;  3TDI A;  3DD4 A;  1A29 A;  3BOW A;  1S1E A;  4M2P A;  1TNX A;  1YTZ C;  1BOD A;  2JXL A;  4XJK B;  4IL1 A;  1UHK A;  1PRW A;  1QAT A;  2G2B A;  4D1E A;  3AKA A;  2BCB A;  1FF1 A;  4MZJ A;  3VRR A;  5D69 A;  3CZT X;  2KYC A;  1YX7 A;  1BLQ A;  1DGU A;  4MZL A;  1FPW A;  2FCD A;  1TTX A;  1SBJ A;  1OMD A;  1B7T Y;  3ZWH A;  2LAP A;  1C7W A;  2F3Z A;  1K90 D;  4GGF A;  1F55 A;  3O4Y A;  1UWO A;  3OX5 A;  1OMR A;  2CCM A;  3EKH A;  3BUO B;  2JPT A;  1EG3 A;  1DJZ A;  1ALV A;  2K7B A;  4PCW A;  3I5H B;  1QV0 A;  2JQ6 A;  1OOJ A;  1J1D A;  3EK8 A;  1QIW A;  1U5I A;  5B8I B;  1M45 A;  1PUL A;  1SW8 A;  1RJV A;  3PSR A;  1S6C A;  2OTG C;  4AOM A;  4Q04 A;  1CDP A;  2TN4 A;  1DT7 B;  1SL8 A;  2ZFD A;  1IG5 A;  4PDZ A;  1AVS A;  4L9M A;  4MN0 A;  4PE7 A;  3O2P A;  1VRK A;  1ZOT B;  3FWC A;  1TRF A;  1EG4 A;  1GQM A;  1S5G Y;  1PVA A;  1J7O A;  1KFU L;  1XK4 C;  1YUU A;  2CNP A;  1WLM A;  1B4C A;  2H61 A;  3OP0 A;  3O78 A;  1WDC C;  3BUW B;  2EHB A;  1D1O A;  1ZMZ A;  3RM1 A;  1QVI Y;  2M7L A;  3FWB A;  5ER4 X;  1K9P A;  2Q4U A;  2L4H A;  1LA0 A;  3CR4 X;  1XFY O;  1NX2 A;  3I5H C;  4OCI A;  2EC6 B;  2CBL A;  2KI6 C;  1EXR A;  1SCM B;  1AUI B;  4NQG A;  1YVL A;  1AP4 A;  2AMI A;  1F4Q A;  1PSR A;  2WCF A;  1YX8 A;  4JPZ B;  3SG3 A;  4WRI A;  1BOC A;  1NCX A;  2K2A A;  3H4S E;  4DIR A;  3DVM A;  1UUR A;  3A4U B;  1MUX A;  2MRD A;  2PVB A;  3LK0 A;  1YR5 A;  3KPX A;  3PN7 B;  4C0L A;  4DUQ A;  3I5G B;  2COL B;  1SK6 D;  1BR1 B;  1L7Z A;  2JNX A;  3M0W A;  1K95 A;  2NXQ A;  3A8R A;  4MZK A;  4TNC A;  1CLB A;  1UP5 A;  1QLS A;  3VGO A;  3PM8 A;  1MWN A;  2LVJ A;  4PHJ A;  1Y1X A;  2KBM A;  1OZS A;  4YI9 A;  1G8I A;  3EK7 A;  3E3R A;  2KI4 C;  2NLN A;  1F54 A;  5CSN A;  1A4P A;  3NSK A;  2I2R E;  1SCM C;  4AQJ A;  2KBI A;  3PAL A;  3CR2 A;  1J7P A;  1KQM B;  1NX3 A;  2F8P A;  1NWD A;  2JXC A;  4XYN A;  1K2H A;  2LVV A;  1IGV A;  1A2X A;  2CXJ A;  1NCY A;  2B1U A;  3VRQ A;  2KFF A;  4DCK A;  1H4B A;  1DVI A;  5HKW A;  3DF0 B;  3AAJ A;  2WCE A;  4GUK A;  1EJ3 A;  2PRU A;  3PN7 C;  2R2I A;  1V1G A;  1AHR A;  2A4J A;  1CM4 A;  2NCP A;  2E6W A;  4MRX A;  1B8R A;  1DGV A;  2JU0 A;  3NXA A;  4PHN A;  1BG1 A;  1FBV A;  3CS1 A;  2LLS A;  2L2E A;  1LVC D;  2JOJ A;  4OKH A;  5AEQ A;  1XA5 A;  2K61 A;  2M49 B;  1M63 B;  2PAS A;  4MEW A;  2SAS A;  2BKI B;  3SJS A;  4PE4 A;  1K9K A;  4FTG A;  3TDZ A;  3TS5 B;  2L5X B;  1YRU B;  4C0J A;  4CID A;  1JUO A;  2OTG B;  4PAL A;  3OX6 A;  4XJK A;  1S6I A;  2O5G A;  1YUR A;  3GOF A;  1SNL A;  2Y1M A;  4I5N B;  1KQM C;  1CFF A;  4E68 A;  1NYA A;  4I5K A;  3GK4 X;  1M39 A;  2O60 A;  4I5L B;  3NSO A;  1M31 A;  4DRW A;  2FJU B;  2KSP A;  1XK4 A;  5HLV A;  5HYD A;  3AAK A;  4F0Z B;  1WDC B;  1MF8 B;  5FYX A;  2WOS A;  1J1E A;  3LK1 A;  1K96 A;  2JT3 A;  1KK7 Y;  1UHN A;  1SPY A;  3FS7 A;  2M8U A;  2FCE A;  2D8N A;  3PFV A;  3BUN B;  1KK8 B;  3IF7 A;  1B9A A;  4N5X A;  1SL9 A;  1X02 A;  5AXI A;  2BEC A;  1XFZ O;  1CFP A;  4HSZ A;  2I94 A;  1QX5 B;  5I2L A;  1B47 A;  3K21 A;  1XYD A;  2M29 A;  3TS5 C;  1FW4 A;  1IJ6 A;  2BBM A;  2I7A A;  5AER A;  2CTN A;  4I5J A;  1HT9 A;  5TNC A;  3SG7 A;  2QPT A;  3GK1 A;  2ZND A;  5HLO A;  1QAS A;  1HQV A;  1LXF C;  1IH0 A;  1JFK A;  3BXK A;  2BCX A;  1OZO A;  1F71 A;  5DKQ A;  2KHN A;  2CT9 A;  2MA2 A;  4WQ2 A;  4U8D A;  1Q80 A;  3O6B A;  1DMO A;  2KNE A;  3IQO A;  1RRO A;  5D7F A;  2G9B A;  4HRE E;  4M2O A;  1TNW A;  1F4O A;  1JBA A;  2F2P A;  1IKU A;  3HX4 A;  2M9G A;  4HRG A;  1S3P A;  2MAZ A;  1YRT B;  1CMF A;  1N0Y A;  1CMG A;  1IRJ A;  1KK8 C;  2KI4 B;  3D10 A;  1BT6 A;  1WRL A;  4GGN A;  1NX1 A;  3KHE A;  4QJ3 B;  4C0K A;  3DVE A;  1PK0 D;  5GQQ C;  3ICB A;  1TCO B;  1OSA A;  2KAV A;  2F3Y A;  4A4C A;  2LUX A;  2L51 A;  2F2O A;  2PSR A;  5IBW A;  1CKK A;  3BUM B;  5PAL A;  1KSO A;  1F8H A;  3I5F B;  3LCP C;  1B1G A;  5KU1 A;  1RTP 1;  2E30 A;  4N1F A;  1G4Y R;  4JWQ A;  4QJ4 B;  1FI5 A;  1WLZ A;  3OB2 B;  2MLF C;  3IQQ A;  1UHJ A;  2KFG A;  1DJG A;  4GAO A;  3QRX A;  3TDU A;  4PHK A;  4MRY A;  1KQV A;  2KGB C;  5AFP A;  2KFH A;  1RFJ A;  1NX0 A;  2LAN A;  2JZI A;  2BE4 A;  3TUY B;  1A03 A;  1BR4 B;  2JTT A;  3HCM A;  2BL0 B;  1ZAC A;  3TZ1 A;  1B8C A;  1M46 A;  2LE9 B;  2RGI A;  4P2Y B;  1R2U A;  2KQY A;  4OR9 B;  4BY5 A;  1GGZ A;  3WHT B;  2WND A;  3NSL A;  4GBA A;  2ZKM X;  4UPG A;  1QX7 A;  2P6B B;  2Y4Q A;  2LCP A;  1MQ1 A;  3NSI A;  4OVN F;  4PHM A;  4YGE B;  2EGD A;  3WHU B;  1JSA A;  3JVT B;  5G08 A;  1XFV O;  1CM1 A;  1IQ3 A;  2AUC A;  1YUS A;  1NUB A;  3DVK A;  2M3W A;  3SG2 A;  2JNF A;  1JFJ A;  1FI6 A;  1DJH A;  3DF0 A;  1QIV A;  1QTX A;  1NPQ A;  2IS9 A;  4NDC A;  2JRF A;  1QS7 A;  1UHH A;  2LMU A;  2BE6 A;  3I5F C;  2L0P A;  4YGD B;  2LVK A;  2KYF A;  1E8A A;  3PAT A;  3OHM B;  2BKH B;  3SIB A;  1MHO A;  1G33 A;  1PAL A;  5KTY A;  4YGA A;  3VRP A;  4DS7 A;  1SKT A;  3AKB A;  5I8N A;  1QVI Z;  2HPS A;  3KF9 A;  2HQ8 A;  2LV7 A;  3D0Y B;  3TUY C;  4ETO A;  2JWW A;  2K7D A;  1DJI A;  1K8U A;  1Y1A A;  1OE9 B;  2BL0 C;  2KI6 D;  2DOQ A;  1CFC A;  1OQP A;  2L50 A;  2LHL A;  2ZRS A;  1R6P A;  1SCV A;  4NDB A;  2I18 A;  5ER5 A;  2M97 A;  1XO5 A;  1WY9 A;  1KFX S;  1PSB A;  1QX2 A;  2GGZ A;  3LLE A;  3JVT C;  1CDM A;  1L2O C;  1S36 A;  1DF0 B;  1KCY A;  4NDD A;  1A75 A;  1XFX O;  1WRZ A;  1A75 B;  1K94 A;  3EVU A;  4ZCV A;  3SG5 A;  2KQ6 A;  1ZFS A;  3EVR A;  3BYA A;  2LP2 A;  2ISD A;  3SG4 A;  1S26 D;  1XFW O;  5I2O A;  1TNP A;  4YI8 A;  1OMV A;  3EK4 A;  2GV5 A;  1MXE A;  1C07 A;  1CLM A;  1CDN A;  1XFU O;  1UHI A;  2Q91 A;  2WCB A;  4M2Q A;  4PE1 A;  3BOW B;  1CB1 A;  3JTD B;  1K9U A;  2K7O A;  1ZUZ A;  2M0R A;  3DVJ A;  2NCO A;  4MSP A;  1DJW A;  4ICB A;  4WQ3 A;  1WRK A;  4USL A;  2KAY A;  4PE0 A;  1CFD A;  3PLF B;  1YVH A;  5K89 A;  4CLN A;  1V1F A;  2LUC A;  1ALW A;  1IQ5 A;  1BMO A;  3VRO A;  1XVJ A;  1J7R A;  1IWQ A;  1W7I B;  2VRG A;  2LHI A;  2LM5 A;  2MLE C;  1SR6 B;  3OB1 B;  1BJF A;  3BQ3 A;  1TN4 A;  4HRH A;  4OV2 A;  4CPV A;  2JUL A;  1SYM A;  1CNP A;  1KSM A;  1IJ5 A;  1LIN A;  1ODB A;  1BU3 A;  3BUX B;  1U5I B;  2HET A;  1AK8 A;  2PAL A;  4GPL B;  1DTL A;  2LC5 A;  3MSE B;  5JJG A;  1JWD A;  3EKJ A;  5CPV A;  2LMV A;  3JTD C;  1NIW A;  4BY4 A;  2F33 A;  3CWG A;  2PMY A;  1K93 D;  2KDH A;  2MHH A;  4P5O E;  1QLK A;  1JF2 A;  4ORB B;  3I5I B;  5F6T A;  1DJX A;  2LLT A;  1SY9 A;  3CTN A;  1TNQ A;  1TOP A;  2OS8 B;  2JT8 A;  5JOL A;  3SG6 A;  2JT0 A;  2ZN9 A;  1CLL A;  1NCZ A;  3F45 A;  4MLW A;  2ZNE A;  1MR8 A;  3EVV A;  5AAN A;  4FQO A;  2BBN A;  4GGF C;  2FOT A;  2LMT A;  1EL4 A;  4ORA B;  1SR6 C;  3GK2 A;  1KWO B;  4N1G A;  1B7T Z;  1TIZ A;  4R1E A;  2M7N A;  2K7C A;  2SCP A;  2Y5I A;  1KK7 Z;  1CTR A;  1N65 A;  1MXL C;  1REC A;  2L4I A;  4GFT A;  1Y6W A;  4QJ5 B;  1BF5 A;  3WXA A;  1C7V A;  1YUT A;  2AAO A;  4ORC B;  5HKZ A;  5DKR A;  2OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...