4GGFC

Crystal structure of mn2+ bound calprotectin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 41
structure length 108
sequence length 108
chains with identical sequence L, T, V
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfC00
2LHLA 2NLNA 1S36A 1ODBA 1S6IA 2KYFA 5AEQA 1YUTA 2L2EA 5JJGA 1NWDA 2I2RE 5HKYA 1B9AA 3OB1B 1BLQA 2GV5A 4DUQA 1XVJA 1DJXA 1YR5A 2PVBA 5ER4X 2K7DA 2H61A 4XJKB 1TNWA 2SASA 1DF0A 1B7TZ 3BUMB 1KQVA 1F4OA 1DJZA 1QX2A 2M97A 2JZIA 1Q80A 4MLWA 2M3WA 4ZCUA 4P2YB 2ZKMX 3PALA 4OR9B 2BCAA 2JXLA 5GQQC 4PHKA 5CSNA 1GGWA 1OQPA 1XFUO 1JFJA 2LVJA 1CFDA 1QIVA 1CDMA 1CB1A 2LVVA 1FI5A 3DF0A 2KFHA 3I5IC 1XFXO 1QATA 2JPTA 1WRLA 4GUKA 1UWOA 2WC8A 1PULA 1F54A 1NYAA 1QVIY 2K7CA 1S5GY 1B8LA 3OX5A 2FCEA 1L7ZA 4CFQA 1DTLA 4DIRA 1NCXA 2KI4C 2EC6C 5I2OA 3H4SE 2LLUA 2NXQA 3VROA 1K96A 2L51A 2LVKA 4ORBB 1IJ5A 2E6WA 1MXLC 3PSRA 1QX7A 3TDIA 1AVSA 2LNKA 4YRUA 2I7AA 3CS1A 1OE9B 2WNDA 1IH0A 1J55A 1MHOA 2KBIA 5FYXA 3JVTB 2KI6C 1CMGA 3KPXA 4CIDA 1NCZA 2BKIB 1XK4C 1NP8A 1CLBA 1J7RA 1DVIA 4HRHA 2LUCA 2E30A 3VRPA 1IGVA 4PHMA 4MN0A 4QJ3B 2LMUA 2OTGC 1K9UA 1IKUA 3I5IB 1M39A 2WOSA 1SKTA 3A8RA 1NX2A 3BOWB 1QLSA 1X02A 2QACA 2L98A 2NCOA 3CR5X 1EXRA 1QLKA 3LLEA 3OHMB 2L0PA 2H61C 3IF7A 1OSAA 4I5NB 3KO0A 1IQ5A 3HCMA 5JOLA 3VRRA 1K9KA 2EC6B 2KQYA 1SL8A 2F8PA 1BMOA 2ZFDA 1V1FA 3O2PA 4IL1A 4DRWA 2WORA 2L4IA 2JTTA 2A4JA 2WCEA 2OS8C 1IG5A 2DOQA 2MRDA 2B1UA 1LA3A 1M46A 2MHHA 3TS5B 1A29A 5HLVA 1FPWA 4FQOA 4F0ZB 4NDBA 2F2OA 1IQ3A 2JC2A 1ALVA 2M8UA 3EKHA 5HKZA 1AUIB 1JF0A 3EVVA 1B7TY 1TCOB 2MAZA 1PVBA 1DT7B 1BODA 1EL4A 2BE4A 1QX5B 5G08A 4I5KA 4MVFA 2TN4A 2BBMA 4MZJA 4N1GA 1XFVO 4PE1A 1OZOA 3JTDB 3PM8A 1E8AA 2FOTA 3SIAA 2LMVA 2OTGB 1C07A 5I2LA 4BY5A 3WNXB 4ICBA 1YVLA 4C0KA 2NCPA 1PRWA 3F45A 4A4CA 3FIAA 1ALWA 1Y0VH 1HT9A 3PN7C 4CFRA 1KFUL 1SMGA 1SW8A 3ZNIA 4D1EA 3TUYC 1CDPA 1XK4A 2BL0C 3HX4A 4YI8A 4M2OA 1VRKA 1WDCB 1TRFA 1DF0B 4MBEA 3MSEB 2LVIA 2Q91A 3VGOA 3GK2A 1M45A 3OB2B 3SG7A 2KNEA 1S3PA 2MLFC 4YGDB 2QPTA 2O5GA 1U5IA 2LCPA 1KWOB 1YURA 2EHBA 3O6BA 1A75B 2JTZA 3KHEA 5I2QA 4NDDA 1ZFSA 2LP3A 1MXEA 4PE4A 1QJTA 1CKKA 2PASA 2KOTA 3I5GB 4ZCVA 1M31A 1D1OA 3DF0B 3LL8B 3BUXB 1S26D 2H2KA 2R2IA 2JOJA 1SCMB 4OKHA 1QV0A 1SPYA 1TOPA 2F3ZA 1A75A 1JFKA 3CR4X 1NPQA 4OV2A 2EGDA 1BR1B 3NSKA 1NX3A 3WHUB 4QJ4B 5D69A 1QTXA 3PFVA 3TZ1A 2Y1NA 3CGAA 2K61A 3SG4A 1WRZA 1CDLA 1YX8A 1TCFA 4UPGA 3K21A 2BL0B 1RTP1 2ZN9A 1CFFA 4PALA 1L2OC 2HQWA 1KQMC 4HSZA 1S6JA 2PSRA 1CNPA 2LLTA 1XFZO 3OP0A 1BOCA 2KHNA 1SL7A 4MZKA 3EK8A 2K0JA 1C7VA 1OOJA 2LC5A 5DKQA 2MLEC 1KFUS 3TDUA 1QS7A 2LMTA 1HQVA 1NX1A 1B8RA 1KK8C 2Y1MA 2JNFA 1KFXL 2JXCA 1QV1A 3FS7A 1F70A 3AAJA 4M2PA 4Q04A 5HKWA 4N1FA 1EG4A 1AJ5A 2JNXA 2LP2A 1YX7A 2V53A 1DGVA 5CPVA 2CBLA 3NSOA 1NX0A 3EK4A 2M1KB 1C7WA 1DJYA 1CFPA 2KYCA 3I5HC 1FBVA 3ZWHA 1PSBA 1XFWO 3EK7A 4DS7A 1G33A 1B1GA 1QASA 3CZTX 4PHJA 4YGEB 3EVUA 3NXAA 1N0YA 2KQ6A 2OPOA 5HYDA 3EKJA 1EJ3A 1SCVA 3GOFA 1RROA 4ETOA 1NIWA 2LUXA 3BQ3A 4NQGA 2F33A 1UURA 1J1DA 1KSOA 1KQMB 1SBJA 3DD4A 1UUSA 3DVKA 3DVMA 3FWCA 1DJHA 1Y1UA 1S6CA 2LM5A 1A4PA 2KI4B 3LCPC 1GGZA 3VRQA 1GQMA 1SR6C 4JPZB 4PCWA 2MA2A 1KK8B 1B47A 1YRTB 4CPVA 1JSAA 2CXJA 4MZLA 3M0WA 3AAKA 4ORAB 2K7BA 3CLNA 1DGUA 5F6TA 3ICBA 1OMRA 1UHHA 3KEVA 3WHTB 2BCXA 1SK6D 1BU3A 1K93D 1KFXS 1WLMA 5K89A 1YUUA 2KFFA 1N65A 1ZOTB 1ZUZA 2LV7A 2SCPA 1B8CA 1EG3A 1SL9A 1XA5A 2JT3A 3D0YA 3SIBA 3WXAA 5HLOA 1LINA 1K94A 1MR8A 2Q4UA 2HETA 3CTNA 4BY4A 4GGNA 4AQJA 1IRJA 1TNXA 1PALA 4PE0A 2K2FA 3D10A 4YI9A 5KTYA 2PRUA 2LAPA 2GGMA 3DVEA 1AK8A 1U5IB 1BF5A 4MSPA 4MEWA 1NCYA 3CR2A 2KFGA 4WQ3A 3AKAA 1JF2A 1SR6B 2JRFA 2BE6A 5TNCA 1OZSA 2M9GA 1LXFC 4QJ5B 4JQ0D 4L9MA 2LHIA 2OS8B 4C0LA 1G4YR 1KSMA 1TNQA 3PLFB 1S1EA 1TN4A 1YTZC 1F8HA 1NSHA 5D7FA 2BCBA 1M63B 1A03A 1K9PA 1H8BA 1QIWA 2WCBA 1GJYA 2D8NA 3IQQA 4YGCB 3NSIA 2I94A 2FJUB 5DKNA 2ZRSA 1TIZA 4I5LB 4FTGA 2WCFA 1CLMA 2AMIA 3LK1A 4GFTA 2LE9B 3QRXA 2FCDA 3BYAA 1YUSA 1K90D 2P6BB 1UHKA 4ORCB 3PN7B 1J7OA 3O4YA 2L50A 4GGFC 3TUYB 1WRKA 2AAOA 1V1GA 4JWQA 1FF1A 1CDNA 4OVNF 4CLNA 2JQ6A 5J3XA 1PSRA 2GGZA 2F2PA 2COLB 3BUNB 1JBAA 4PHNA 1DJGA 1BJFA 3JVTC 2KI6D 2G9BA 1CM4A 2JT0A 4XJKA 1K8UA 4YGAA 4AQIA 2JWWA 1OMDA 1XYDA 1R6PA 2BECA 1LVCD 2ISDA 3SG5A 5KSZA 1SRAA 1W7JB 4M2QA 2PMYA 2CT9A 2M1UA 4WQ2A 2M7LA 1EH2A 2LANA 2JULA 1FW4A 1N2DA 1RK9A 1J7PA 1XO5A 2KAYA 2KSPA 2Y4QA 4TNCA 4NDCA 2O60A 4R1EA 2AUCA 2KAXA 2HF5A 3FWBA 4A4BA 1F55A 3O78A 2CTNA 1RECA 2I18A 1RWYA 2ZRTA 2MBXA 4E68A 1JC2A 2ZNEA 5CSJA 1R2UA 2HPSA 2L5XB 5PALA 1XFYO 1PK0D 4PE7A 1Y1XA 2F3YA 2JT8A 3OX6A 1AP4A 2KDHA 4YBHB 3TS5C 2L4HA 2BBNA 1L2OB 1AJ4A 5AERA 1KK7Y 3LK0A 3EVRA 1UHJA 1K95A 1WLZA 1G8IA 3BUOB 2MJWB 4P5OE 1YVHA 4OCIA 2BKHB 3BUWB 3AKBA 4GAOA 2ZNDA 3IQOA 1W7IB 2KGBC 1UP5A 3TDZA 3GK4X 2HQ8A 2IS9A 4GGFA 1DJIA 2CCMA 2M0RA 2M7NA 3JTDC 4MRYA 3CWGA 3I5FC 1QVIZ 1Y1AA 1S5GZ 1BT6A 1J1EA 5IBWA 2ZN8A 3D0YB 3DVJA 1B4CA 1MUXA 2KGRA 1Y6WA 2JU0A 1YRUB 4WRIA 1WY9A 4U8DA 3SG2A 2NZ0A 1JUOA 1H4BA 1OMVA 1SYMA 2KBMA 2G2BA 2K2AA 2CNPA 3SG3A 2M29A 1BR4B 1LA0A 1WDCC 2Y5IA 1MF8B 1TTXA 3I5HB 1F4QA 4PDZA 1AHRA 3RM1A 5AFPA 2K7OA 1J7QA 1K2HA 5CSFA 3BXKA 1NUBA 5AANA 3GK1A 1F71A 4USLA 1QXPA 1KK7Z 5BPJA 4YGBB 1CMFA 1DJWA 4AOMA 3BOWA 1SY9A 4I5JA 1KWOC 1PVAA 1SNLA 4HREE 1CFCA 1KCYA 5I8NA 4XYNA 1TNPA 2K8MB 2LLSA 3NSLA 3PATA 4N5XA 3VRNA 3SG6A 4DCKA 5KU1A 3I5GC 4GNKB 3C1VA 4GBAA 1MQ1A 2M49B 4MRXA 3SJSA 1IWQA 2VRGA 1JWDA 3RLZA 1LKJA 1ZACA 1CLLA 3E3RA 1RFJA 4GPLB 1SCMC 3I5FB 1ZMZA 1RJVA 1BG1A 5AXIA 3KF9A 1CTRA 5CSIA 1IJ6A 5DKRA 5ER5A 5B8IB 1CM1A 4C0JA 1DMOA 2PALA 1UHNA 1A2XA 3A4UB 4HRGA 1FI6A 2KAVA 1UHIA 2RGIA 1MWNA
chains in the Genus database with same CATH superfamily
2LHLA 2WCMA 1DEKA 2NLNA 1GM0A 4OZDA 1S36A 1ODBA 1S6IA 2KYFA 5AEQA 1YUTA 2L2EA 5JJGA 1NWDA 2I2RE 5HKYA 1B9AA 5I94A 3OB1B 1BLQA 2GV5A 4DUQA 1XVJA 1DJXA 1YR5A 2GTEA 2PVBA 5ER4X 2K7DA 2H61A 4XJKB 1TNWA 2SASA 1DF0A 1B7TZ 3BUMB 1KQVA 3DY9A 1F4OA 1DJZA 1Z4HA 1QX2A 2M97A 2JZIA 1Q80A 4MLWA 4JKTA 2M3WA 4ZCUA 3S0GA 4P2YB 2L2CA 2KLEA 2ZKMX 3PALA 4OR9B 2BCAA 2JXLA 5GQQC 4PHKA 5CSNA 1GGWA 1OQPA 1XFUO 1JFJA 2LVJA 1CFDA 1QIVA 1CDMA 1CB1A 2LVVA 1FI5A 3DF0A 1DELA 2KFHA 1XFXO 1QATA 2JPOA 1WRLA 2JPTA 3I5IC 1UWOA 2WC8A 1PULA 4GUKA 1F54A 1NYAA 1QVIY 2K7CA 1S5GY 1ORGA 1B8LA 2WCHA 3OX5A 2FCEA 1L7ZA 4CFQA 1DTLA 4DIRA 3K1EA 1NCXA 2KI4C 2EC6C 5I2OA 3H4SE 2LLUA 1TUJA 3B88A 2NXQA 3VROA 1K96A 2L51A 2LVKA 4ORBB 1IJ5A 2E6WA 1MXLC 3S0EA 3PSRA 1QX7A 3TDIA 1AVSA 2LNKA 4YRUA 1OOFA 2I7AA 3CS1A 1OE9B 3R72A 2WNDA 1IH0A 1J55A 1MHOA 2KBIA 5FYXA 3JVTB 2KI6C 1CMGA 3KPXA 3L4AA 1C3ZA 1DC1A 4CIDA 1NCZA 2BKIB 1XK4C 1NP8A 1CLBA 1J7RA 1DVIA 4HRHA 2LUCA 2E30A 3VRPA 1IGVA 4PHMA 3VRRA 4MN0A 3VB1A 4QJ3B 2LMUA 1SSEB 1K9UA 2OTGC 1IKUA 3I5IB 1M39A 2WOSA 3SS4A 3S0FA 1SKTA 3A8RA 1NX2A 3BOWB 1QLSA 1X02A 2QACA 2L98A 2NCOA 3CR5X 1EXRA 1QLKA 3LLEA 3OHMB 2L0PA 2H61C 3IF7A 1OSAA 4I5NB 3KO0A 1IQ5A 3HCMA 2K60A 4KYNA 5JOLA 3FE6A 1K9KA 2EC6B 2KQYA 1SL8A 2F8PA 1BMOA 2ZFDA 1V1FA 3B86A 3O2PA 4IL1A 2WORA 4DRWA 2L4IA 2JTTA 3RZSA 2A4JA 2WCEA 2OS8C 1IG5A 2DOQA 2MRDA 2B1UA 3L4LA 1LA3A 1M46A 2MHHA 3TS5B 1A29A 5HLVA 1FPWA 4FQOA 4F0ZB 5HL1A 4NDBA 2F2OA 1IQ3A 2JC2A 1ALVA 2M8UA 3EKHA 5HKZA 1AUIB 1JF0A 3EVVA 1B7TY 1TCOB 2MAZA 3DXLA 1PVBA 1DT7B 1BODA 1EL4A 2BE4A 1QX5B 5EL2A 4I5KA 5G08A 4MVFA 2TN4A 2BBMA 4MZJA 4N1GA 1XFVO 4PE1A 1OZOA 3JTDB 3PM8A 1E8AA 2FOTA 3SIAA 2LMVA 2OTGB 1C07A 5I2LA 4BY5A 3WNXB 4ICBA 3NGVA 1YVLA 4C0KA 2NCPA 1PRWA 3F45A 3S0DA 4A4CA 3FIAA 1ALWA 1Y0VH 1HT9A 3PN7C 4CFRA 1KFUL 1SMGA 1SW8A 3ZNIA 4D1EA 3TUYC 1CDPA 1T14A 1XK4A 2BL0C 3HX4A 3BFAA 4M2OA 4YI8A 1VRKA 1WDCB 3S0AA 1TRFA 1DF0B 4MBEA 3MSEB 2LVIA 2Q91A 3VGOA 3GK2A 1M45A 3OB2B 3CZ0A 3SG7A 2KNEA 1S3PA 2MLFC 2BNXA 4YGDB 2QPTA 2O5GA 2QEOA 1U5IA 2BAPA 1KWOB 2LCPA 3D76A 1YURA 2EHBA 2WCJA 3O6BA 1A75B 2JTZA 2KLDA 3KHEA 5I2QA 3Q8IA 4NDDA 3BJHA 5FI6A 1ZFSA 2LP3A 1MXEA 4PE4A 1QJTA 1CKKA 2PASA 2KOTA 3I5GB 4ZCVA 1M31A 1D1OA 3DF0B 3LL8B 3BUXB 1S26D 3BFHA 2H2KA 2R2IA 2JOJA 1SCMB 4OKHA 1QV0A 1SPYA 1TOPA 2F3ZA 1A75A 1JFKA 3CR4X 1NPQA 5FI7A 4OV2A 2EGDA 1BR1B 2QEBA 1NX3A 1TUZA 3NSKA 5D69A 1QTXA 3WHUB 3PFVA 3TZ1A 2Y1NA 4QJ4B 3CGAA 2K61A 3SG4A 1WRZA 1CDLA 1YX8A 1TCFA 4UPGA 3K21A 2BL0B 1RTP1 2ZN9A 1CFFA 4PALA 3SS5A 1L2OC 1IIOA 2HQWA 1KQMC 2L5YA 4HSZA 1S6JA 2PSRA 1CNPA 2LLTA 1XFZO 3OP0A 1BOCA 2KHNA 4FQTA 1SL7A 4MZKA 3EK8A 2K0JA 2WCKA 1C7VA 1OOJA 2LC5A 5DKQA 2MLEC 5FI2A 1KFUS 3TDUA 3BFBA 1QS7A 2LMTA 1HQVA 1NX1A 1B8RA 1KK8C 2Y1MA 2JNFA 1KFXL 2JXCA 1QV1A 5D3OA 3D75A 3FS7A 1F70A 3AAJA 4M2PA 4Q04A 5HKWA 4N1FA 3UO9A 1EG4A 1AJ5A 2JNXA 2LP2A 1YX7A 2V53A 1DGVA 5CPVA 2CBLA 3V2LA 3NSOA 1NX0A 3EK4A 2M1KB 1C7WA 1DJYA 3B7AA 1CFPA 2KYCA 3I5HC 1FBVA 3ZWHA 1PSBA 1XFWO 1P28A 3EK7A 4DS7A 1G33A 1B1GA 1QASA 3CZTX 4PHJA 4YGEB 3EVUA 3NXAA 1N0YA 2KQ6A 2OPOA 5HYDA 3EKJA 1EJ3A 1SCVA 3D78A 1RROA 3GOFA 4ETOA 1NIWA 2LUXA 3BQ3A 4NQGA 5DICA 2F33A 1UURA 1J1DA 1KSOA 1KQMB 1SBJA 3DD4A 1UUSA 3DVKA 3DVMA 2WC6A 2H8VA 3FWCA 1DJHA 1Y1UA 1S6CA 2LM5A 4PT1A 2PQLA 1A4PA 2KI4B 3LCPC 3L47A 1GGZA 3VRQA 1GQMA 1SR6C 4JPZB 4PCWA 3D74A 2MA2A 1KK8B 1B47A 1YRTB 4CPVA 1JSAA 2CXJA 4MZLA 3M0WA 3AAKA 4ORAB 2K7BA 3CLNA 1DGUA 5F6TA 3ICBA 1OMRA 1UHHA 3KEVA 3WHTB 3O4XA 2BCXA 3CZ1A 1SK6D 1BU3A 1K93D 1KFXS 1WLMA 5K89A 1YUUA 2KFFA 1N65A 1ZOTB 1ZUZA 2LV7A 2SCPA 1B8CA 1EG3A 1SL9A 1XA5A 2JT3A 3D0YA 3SIBA 3WXAA 5HLOA 1LINA 1K94A 1MR8A 2Q4UA 2HETA 3CTNA 4BY4A 4GGNA 4AQJA 1IRJA 1TNXA 1PALA 4PE0A 2K2FA 3CZ2A 3D10A 4YI9A 3CDNA 3UNWA 5KTYA 2PRUA 2LAPA 2GGMA 3DVEA 1AK8A 1U5IB 1BF5A 3DYEA 3QMEA 4MSPA 4MEWA 1NCYA 2QEVA 2KFGA 3CR2A 4WQ3A 1OOGA 3AKAA 1JF2A 1SR6B 2JRFA 1XFRA 2BE6A 5TNCA 3D77A 2YGUA 1OZSA 2M9GA 1LXFC 3CABA 4QJ5B 3FE9A 4JQ0D 4L9MA 2LHIA 2OS8B 4C0LA 1G4YR 1KSMA 1TNQA 3PLFB 1S1EA 2WC5A 1TN4A 3SS3A 1DQEA 1YTZC 2QEHA 1F8HA 1NSHA 2PYQA 5D7FA 2BCBA 1M63B 1A03A 1K9PA 1H8BA 1QIWA 2WCBA 1GJYA 2D8NA 3IQQA 4YGCB 3NSIA 2I94A 2FJUB 3B6XA 2ZRSA 1TIZA 4I5LB 5DKNA 4JD9A 4FTGA 2WCFA 1CLMA 2AMIA 3LK1A 4GFTA 2LE9B 2WCLA 3QRXA 1OOIX 2FCDA 3BYAA 3R1VA 1YUSA 1K90D 2P6BB 1UHKA 4ORCB 3PN7B 1J7OA 1LS8A 3O4YA 2L50A 4GGFC 3B87A 3TUYB 1WRKA 2AAOA 1V1GA 4JWQA 1FF1A 3NHIA 1CDNA 4OVNF 4CLNA 2JQ6A 5J3XA 1PSRA 3EG5B 2GGZA 2F2PA 2COLB 3BUNB 1JBAA 4PHNA 1DJGA 1BJFA 3JVTC 2KI6D 2G9BA 3IVTA 1CM4A 2JT0A 4XJKA 1K8UA 4F7FA 2KPHA 1W9ZA 4YGAA 4AQIA 2JWWA 1OMDA 1XYDA 1R6PA 2BECA 1LVCD 2ERBA 2ISDA 3SG5A 1SRAA 5KSZA 2P70A 1W7JB 4M2QA 2PMYA 3PJIA 2CT9A 2M1UA 4WQ2A 2M7LA 1EH2A 2LANA 2JULA 1FW4A 1N2DA 1RK9A 1J7PA 1XO5A 2KAYA 2KSPA 2Y4QA 4TNCA 4NDCA 2O60A 4R1EA 2AUCA 2KAXA 2HF5A 3FWBA 4A4BA 1F55A 3O78A 2CTNA 3R1PA 1RECA 2I18A 1RWYA 2ZRTA 2MBXA 4E68A 1JC2A 1OOHA 2ZNEA 5CSJA 1R2UA 2HPSA 2L5XB 5PALA 1XFYO 1PK0D 4PE7A 1Y1XA 2F3YA 2JT8A 3OX6A 1AP4A 2KDHA 4INXA 4YBHB 3TS5C 2L4HA 2BBNA 1L2OB 1AJ4A 5AERA 1KK7Y 3LK0A 3EVRA 1UHJA 1K95A 1WLZA 2QDIA 1G8IA 3BUOB 2MJWB 4P5OE 1YVHA 3NHTA 4IJ7A 4OCIA 2BKHB 3BUWB 3AKBA 4GAOA 2ZNDA 3IQOA 1W7IB 2KGBC 1UP5A 3PM2A 3TDZA 3GK4X 2HQ8A 2IS9A 4GGFA 1DJIA 2CCMA 2M0RA 2M7NA 3JTDC 4MRYA 3CWGA 3I5FC 4INWA 1QVIZ 1Y1AA 3FE8A 1S5GZ 1BT6A 1J1EA 5IBWA 1C3YA 2ZN8A 3D0YB 3DVJA 1B4CA 1MUXA 2KGRA 1Y6WA 2JU0A 1Z2CB 1YRUB 3OBVA 1WY9A 4U8DA 4WRIA 3SG2A 2NZ0A 1JUOA 1H4BA 1OMVA 1SYMA 2KBMA 2G2BA 2K2AA 2CNPA 3SG3A 2M29A 1BR4B 1LA0A 1WDCC 2Y5IA 1MF8B 1TTXA 1OW4A 1F4QA 1QWVA 3I5HB 3OGNA 4PDZA 1AHRA 2P71A 3RM1A 2FJYA 5AFPA 2K7OA 1J7QA 1K2HA 5CSFA 3BXKA 1NUBA 5AANA 1TWOA 3GK1A 3N7HA 1F71A 4USLA 1QXPA 1KK7Z 5BPJA 4YGBB 1CMFA 1DJWA 4AOMA 3BOWA 1SY9A 4I5JA 1KWOC 1PVAA 1SNLA 4HREE 1CFCA 1KCYA 5I8NA 4XYNA 1TNPA 2K8MB 2LLSA 3NSLA 3PATA 4N5XA 3VRNA 3SG6A 3R1OA 4DCKA 5KU1A 3I5GC 4GNKB 3C1VA 4GBAA 1MQ1A 2M49B 4MRXA 3SJSA 1IWQA 2VRGA 3D73A 1JWDA 3RLZA 1LKJA 1ZACA 1CLLA 3E3RA 1RFJA 4GPLB 1SCMC 3I5FB 1ZMZA 1RJVA 1BG1A 3DZTA 5AXIA 3KF9A 1CTRA 5CSIA 1IJ6A 5DKRA 5ER5A 5B8IB 1CM1A 4C0JA 1DMOA 2PALA 1UHNA 1A2XA 3A4UB 3CYZA 4HRGA 3S0BA 1FI6A 2KAVA 1UHIA 2RGIA 1MWNA
chains in the Genus database with same CATH topology
2LHLA 2NLNA 1S36A 1ODBA 1S6IA 2KYFA 5AEQA 1YUTA 2L2EA 5JJGA 1NWDA 2I2RE 5HKYA 1B9AA 3OB1B 1BLQA 2GV5A 4DUQA 1XVJA 1DJXA 1YR5A 2PVBA 5ER4X 2K7DA 2H61A 4XJKB 1TNWA 2SASA 1DF0A 1B7TZ 3BUMB 1KQVA 1F4OA 1DJZA 1QX2A 2M97A 2JZIA 1Q80A 4MLWA 2M3WA 4ZCUA 4P2YB 2ZKMX 3PALA 4OR9B 2BCAA 2JXLA 5GQQC 4PHKA 5CSNA 1GGWA 1OQPA 1XFUO 1JFJA 2LVJA 1CFDA 1QIVA 1CDMA 1CB1A 2LVVA 1FI5A 3DF0A 2KFHA 3I5IC 1XFXO 1QATA 2JPTA 1WRLA 4GUKA 1UWOA 2WC8A 1PULA 1F54A 1NYAA 1QVIY 2K7CA 1S5GY 1B8LA 3OX5A 2FCEA 1L7ZA 4CFQA 1DTLA 4DIRA 1NCXA 2KI4C 2EC6C 5I2OA 3H4SE 2LLUA 2NXQA 3VROA 1K96A 2L51A 2LVKA 4ORBB 1IJ5A 2E6WA 1MXLC 3PSRA 1QX7A 3TDIA 1AVSA 2LNKA 4YRUA 2I7AA 3CS1A 1OE9B 2WNDA 1IH0A 1J55A 1MHOA 2KBIA 5FYXA 3JVTB 2KI6C 1CMGA 3KPXA 4CIDA 1NCZA 2BKIB 1XK4C 1NP8A 1CLBA 1J7RA 1DVIA 4HRHA 2LUCA 2E30A 3VRPA 1IGVA 4PHMA 4MN0A 4QJ3B 2LMUA 2OTGC 1K9UA 1IKUA 3I5IB 1M39A 2WOSA 1SKTA 3A8RA 1NX2A 3BOWB 1QLSA 1X02A 2QACA 2L98A 2NCOA 3CR5X 1EXRA 1QLKA 3LLEA 3OHMB 2L0PA 2H61C 3IF7A 1OSAA 4I5NB 3KO0A 1IQ5A 3HCMA 5JOLA 3VRRA 1K9KA 2EC6B 2KQYA 1SL8A 2F8PA 1BMOA 2ZFDA 1V1FA 3O2PA 4IL1A 4DRWA 2WORA 2L4IA 2JTTA 2A4JA 2WCEA 2OS8C 1IG5A 2DOQA 2MRDA 2B1UA 1LA3A 1M46A 2MHHA 3TS5B 1A29A 5HLVA 1FPWA 4FQOA 4F0ZB 4NDBA 2F2OA 1IQ3A 2JC2A 1ALVA 2M8UA 3EKHA 5HKZA 1AUIB 1JF0A 3EVVA 1B7TY 1TCOB 2MAZA 1PVBA 1DT7B 1BODA 1EL4A 2BE4A 1QX5B 5G08A 4I5KA 4MVFA 2TN4A 2BBMA 4MZJA 4N1GA 1XFVO 4PE1A 1OZOA 3JTDB 3PM8A 1E8AA 2FOTA 3SIAA 2LMVA 2OTGB 1C07A 5I2LA 4BY5A 3WNXB 4ICBA 1YVLA 4C0KA 2NCPA 1PRWA 3F45A 4A4CA 3FIAA 1ALWA 1Y0VH 1HT9A 3PN7C 4CFRA 1KFUL 1SMGA 1SW8A 3ZNIA 4D1EA 3TUYC 1CDPA 1XK4A 2BL0C 3HX4A 4YI8A 4M2OA 1VRKA 1WDCB 1TRFA 1DF0B 4MBEA 3MSEB 2LVIA 2Q91A 3VGOA 3GK2A 1M45A 3OB2B 3SG7A 2KNEA 1S3PA 2MLFC 4YGDB 2QPTA 2O5GA 1U5IA 2LCPA 1KWOB 1YURA 2EHBA 3O6BA 1A75B 2JTZA 3KHEA 5I2QA 4NDDA 1ZFSA 2LP3A 1MXEA 4PE4A 1QJTA 1CKKA 2PASA 2KOTA 3I5GB 4ZCVA 1M31A 1D1OA 3DF0B 3LL8B 3BUXB 1S26D 2H2KA 2R2IA 2JOJA 1SCMB 4OKHA 1QV0A 1SPYA 1TOPA 2F3ZA 1A75A 1JFKA 3CR4X 1NPQA 4OV2A 2EGDA 1BR1B 3NSKA 1NX3A 3WHUB 4QJ4B 5D69A 1QTXA 3PFVA 3TZ1A 2Y1NA 3CGAA 2K61A 3SG4A 1WRZA 1CDLA 1YX8A 1TCFA 4UPGA 3K21A 2BL0B 1RTP1 2ZN9A 1CFFA 4PALA 1L2OC 2HQWA 1KQMC 4HSZA 1S6JA 2PSRA 1CNPA 2LLTA 1XFZO 3OP0A 1BOCA 2KHNA 1SL7A 4MZKA 3EK8A 2K0JA 1C7VA 1OOJA 2LC5A 5DKQA 2MLEC 1KFUS 3TDUA 1QS7A 2LMTA 1HQVA 1NX1A 1B8RA 1KK8C 2Y1MA 2JNFA 1KFXL 2JXCA 1QV1A 3FS7A 1F70A 3AAJA 4M2PA 4Q04A 5HKWA 4N1FA 1EG4A 1AJ5A 2JNXA 2LP2A 1YX7A 2V53A 1DGVA 5CPVA 2CBLA 3NSOA 1NX0A 3EK4A 2M1KB 1C7WA 1DJYA 1CFPA 2KYCA 3I5HC 1FBVA 3ZWHA 1PSBA 1XFWO 3EK7A 4DS7A 1G33A 1B1GA 1QASA 3CZTX 4PHJA 4YGEB 3EVUA 3NXAA 1N0YA 2KQ6A 2OPOA 5HYDA 3EKJA 1EJ3A 1SCVA 3GOFA 1RROA 4ETOA 1NIWA 2LUXA 3BQ3A 4NQGA 2F33A 1UURA 1J1DA 1KSOA 1KQMB 1SBJA 3DD4A 1UUSA 3DVKA 3DVMA 3FWCA 1DJHA 1Y1UA 1S6CA 2LM5A 1A4PA 2KI4B 3LCPC 1GGZA 3VRQA 1GQMA 1SR6C 4JPZB 4PCWA 2MA2A 1KK8B 1B47A 1YRTB 4CPVA 1JSAA 2CXJA 4MZLA 3M0WA 3AAKA 4ORAB 2K7BA 3CLNA 1DGUA 5F6TA 3ICBA 1OMRA 1UHHA 3KEVA 3WHTB 2BCXA 1SK6D 1BU3A 1K93D 1KFXS 1WLMA 5K89A 1YUUA 2KFFA 1N65A 1ZOTB 1ZUZA 2LV7A 2SCPA 1B8CA 1EG3A 1SL9A 1XA5A 2JT3A 3D0YA 3SIBA 3WXAA 5HLOA 1LINA 1K94A 1MR8A 2Q4UA 2HETA 3CTNA 4BY4A 4GGNA 4AQJA 1IRJA 1TNXA 1PALA 4PE0A 2K2FA 3D10A 4YI9A 5KTYA 2PRUA 2LAPA 2GGMA 3DVEA 1AK8A 1U5IB 1BF5A 4MSPA 4MEWA 1NCYA 3CR2A 2KFGA 4WQ3A 3AKAA 1JF2A 1SR6B 2JRFA 2BE6A 5TNCA 1OZSA 2M9GA 1LXFC 4QJ5B 4JQ0D 4L9MA 2LHIA 2OS8B 4C0LA 1G4YR 1KSMA 1TNQA 3PLFB 1S1EA 1TN4A 1YTZC 1F8HA 1NSHA 5D7FA 2BCBA 1M63B 1A03A 1K9PA 1H8BA 1QIWA 2WCBA 1GJYA 2D8NA 3IQQA 4YGCB 3NSIA 2I94A 2FJUB 5DKNA 2ZRSA 1TIZA 4I5LB 4FTGA 2WCFA 1CLMA 2AMIA 3LK1A 4GFTA 2LE9B 3QRXA 2FCDA 3BYAA 1YUSA 1K90D 2P6BB 1UHKA 4ORCB 3PN7B 1J7OA 3O4YA 2L50A 4GGFC 3TUYB 1WRKA 2AAOA 1V1GA 4JWQA 1FF1A 1CDNA 4OVNF 4CLNA 2JQ6A 5J3XA 1PSRA 2GGZA 2F2PA 2COLB 3BUNB 1JBAA 4PHNA 1DJGA 1BJFA 3JVTC 2KI6D 2G9BA 1CM4A 2JT0A 4XJKA 1K8UA 4YGAA 4AQIA 2JWWA 1OMDA 1XYDA 1R6PA 2BECA 1LVCD 2ISDA 3SG5A 5KSZA 1SRAA 1W7JB 4M2QA 2PMYA 2CT9A 2M1UA 4WQ2A 2M7LA 1EH2A 2LANA 2JULA 1FW4A 1N2DA 1RK9A 1J7PA 1XO5A 2KAYA 2KSPA 2Y4QA 4TNCA 4NDCA 2O60A 4R1EA 2AUCA 2KAXA 2HF5A 3FWBA 4A4BA 1F55A 3O78A 2CTNA 1RECA 2I18A 1RWYA 2ZRTA 2MBXA 4E68A 1JC2A 2ZNEA 5CSJA 1R2UA 2HPSA 2L5XB 5PALA 1XFYO 1PK0D 4PE7A 1Y1XA 2F3YA 2JT8A 3OX6A 1AP4A 2KDHA 4YBHB 3TS5C 2L4HA 2BBNA 1L2OB 1AJ4A 5AERA 1KK7Y 3LK0A 3EVRA 1UHJA 1K95A 1WLZA 1G8IA 3BUOB 2MJWB 4P5OE 1YVHA 4OCIA 2BKHB 3BUWB 3AKBA 4GAOA 2ZNDA 3IQOA 1W7IB 2KGBC 1UP5A 3TDZA 3GK4X 2HQ8A 2IS9A 4GGFA 1DJIA 2CCMA 2M0RA 2M7NA 3JTDC 4MRYA 3CWGA 3I5FC 1QVIZ 1Y1AA 1S5GZ 1BT6A 1J1EA 5IBWA 2ZN8A 3D0YB 3DVJA 1B4CA 1MUXA 2KGRA 1Y6WA 2JU0A 1YRUB 4WRIA 1WY9A 4U8DA 3SG2A 2NZ0A 1JUOA 1H4BA 1OMVA 1SYMA 2KBMA 2G2BA 2K2AA 2CNPA 3SG3A 2M29A 1BR4B 1LA0A 1WDCC 2Y5IA 1MF8B 1TTXA 3I5HB 1F4QA 4PDZA 1AHRA 3RM1A 5AFPA 2K7OA 1J7QA 1K2HA 5CSFA 3BXKA 1NUBA 5AANA 3GK1A 1F71A 4USLA 1QXPA 1KK7Z 5BPJA 4YGBB 1CMFA 1DJWA 4AOMA 3BOWA 1SY9A 4I5JA 1KWOC 1PVAA 1SNLA 4HREE 1CFCA 1KCYA 5I8NA 4XYNA 1TNPA 2K8MB 2LLSA 3NSLA 3PATA 4N5XA 3VRNA 3SG6A 4DCKA 5KU1A 3I5GC 4GNKB 3C1VA 4GBAA 1MQ1A 2M49B 4MRXA 3SJSA 1IWQA 2VRGA 1JWDA 3RLZA 1LKJA 1ZACA 1CLLA 3E3RA 1RFJA 4GPLB 1SCMC 3I5FB 1ZMZA 1RJVA 1BG1A 5AXIA 3KF9A 1CTRA 5CSIA 1IJ6A 5DKRA 5ER5A 5B8IB 1CM1A 4C0JA 1DMOA 2PALA 1UHNA 1A2XA 3A4UB 4HRGA 1FI6A 2KAVA 1UHIA 2RGIA 1MWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHL A;  2NLN A;  1S36 A;  1ODB A;  1S6I A;  2KYF A;  5AEQ A;  1YUT A;  2L2E A;  5JJG A;  1NWD A;  2I2R E;  5HKY A;  1B9A A;  3OB1 B;  1BLQ A;  2GV5 A;  4DUQ A;  1XVJ A;  1DJX A;  1YR5 A;  2PVB A;  5ER4 X;  2K7D A;  2H61 A;  4XJK B;  1TNW A;  2SAS A;  1DF0 A;  1B7T Z;  3BUM B;  1KQV A;  1F4O A;  1DJZ A;  1QX2 A;  2M97 A;  2JZI A;  1Q80 A;  4MLW A;  2M3W A;  4ZCU A;  4P2Y B;  2ZKM X;  3PAL A;  4OR9 B;  2BCA A;  2JXL A;  5GQQ C;  4PHK A;  5CSN A;  1GGW A;  1OQP A;  1XFU O;  1JFJ A;  2LVJ A;  1CFD A;  1QIV A;  1CDM A;  1CB1 A;  2LVV A;  1FI5 A;  3DF0 A;  2KFH A;  3I5I C;  1XFX O;  1QAT A;  2JPT A;  1WRL A;  4GUK A;  1UWO A;  2WC8 A;  1PUL A;  1F54 A;  1NYA A;  1QVI Y;  2K7C A;  1S5G Y;  1B8L A;  3OX5 A;  2FCE A;  1L7Z A;  4CFQ A;  1DTL A;  4DIR A;  1NCX A;  2KI4 C;  2EC6 C;  5I2O A;  3H4S E;  2LLU A;  2NXQ A;  3VRO A;  1K96 A;  2L51 A;  2LVK A;  4ORB B;  1IJ5 A;  2E6W A;  1MXL C;  3PSR A;  1QX7 A;  3TDI A;  1AVS A;  2LNK A;  4YRU A;  2I7A A;  3CS1 A;  1OE9 B;  2WND A;  1IH0 A;  1J55 A;  1MHO A;  2KBI A;  5FYX A;  3JVT B;  2KI6 C;  1CMG A;  3KPX A;  4CID A;  1NCZ A;  2BKI B;  1XK4 C;  1NP8 A;  1CLB A;  1J7R A;  1DVI A;  4HRH A;  2LUC A;  2E30 A;  3VRP A;  1IGV A;  4PHM A;  4MN0 A;  4QJ3 B;  2LMU A;  2OTG C;  1K9U A;  1IKU A;  3I5I B;  1M39 A;  2WOS A;  1SKT A;  3A8R A;  1NX2 A;  3BOW B;  1QLS A;  1X02 A;  2QAC A;  2L98 A;  2NCO A;  3CR5 X;  1EXR A;  1QLK A;  3LLE A;  3OHM B;  2L0P A;  2H61 C;  3IF7 A;  1OSA A;  4I5N B;  3KO0 A;  1IQ5 A;  3HCM A;  5JOL A;  3VRR A;  1K9K A;  2EC6 B;  2KQY A;  1SL8 A;  2F8P A;  1BMO A;  2ZFD A;  1V1F A;  3O2P A;  4IL1 A;  4DRW A;  2WOR A;  2L4I A;  2JTT A;  2A4J A;  2WCE A;  2OS8 C;  1IG5 A;  2DOQ A;  2MRD A;  2B1U A;  1LA3 A;  1M46 A;  2MHH A;  3TS5 B;  1A29 A;  5HLV A;  1FPW A;  4FQO A;  4F0Z B;  4NDB A;  2F2O A;  1IQ3 A;  2JC2 A;  1ALV A;  2M8U A;  3EKH A;  5HKZ A;  1AUI B;  1JF0 A;  3EVV A;  1B7T Y;  1TCO B;  2MAZ A;  1PVB A;  1DT7 B;  1BOD A;  1EL4 A;  2BE4 A;  1QX5 B;  5G08 A;  4I5K A;  4MVF A;  2TN4 A;  2BBM A;  4MZJ A;  4N1G A;  1XFV O;  4PE1 A;  1OZO A;  3JTD B;  3PM8 A;  1E8A A;  2FOT A;  3SIA A;  2LMV A;  2OTG B;  1C07 A;  5I2L A;  4BY5 A;  3WNX B;  4ICB A;  1YVL A;  4C0K A;  2NCP A;  1PRW A;  3F45 A;  4A4C A;  3FIA A;  1ALW A;  1Y0V H;  1HT9 A;  3PN7 C;  4CFR A;  1KFU L;  1SMG A;  1SW8 A;  3ZNI A;  4D1E A;  3TUY C;  1CDP A;  1XK4 A;  2BL0 C;  3HX4 A;  4YI8 A;  4M2O A;  1VRK A;  1WDC B;  1TRF A;  1DF0 B;  4MBE A;  3MSE B;  2LVI A;  2Q91 A;  3VGO A;  3GK2 A;  1M45 A;  3OB2 B;  3SG7 A;  2KNE A;  1S3P A;  2MLF C;  4YGD B;  2QPT A;  2O5G A;  1U5I A;  2LCP A;  1KWO B;  1YUR A;  2EHB A;  3O6B A;  1A75 B;  2JTZ A;  3KHE A;  5I2Q A;  4NDD A;  1ZFS A;  2LP3 A;  1MXE A;  4PE4 A;  1QJT A;  1CKK A;  2PAS A;  2KOT A;  3I5G B;  4ZCV A;  1M31 A;  1D1O A;  3DF0 B;  3LL8 B;  3BUX B;  1S26 D;  2H2K A;  2R2I A;  2JOJ A;  1SCM B;  4OKH A;  1QV0 A;  1SPY A;  1TOP A;  2F3Z A;  1A75 A;  1JFK A;  3CR4 X;  1NPQ A;  4OV2 A;  2EGD A;  1BR1 B;  3NSK A;  1NX3 A;  3WHU B;  4QJ4 B;  5D69 A;  1QTX A;  3PFV A;  3TZ1 A;  2Y1N A;  3CGA A;  2K61 A;  3SG4 A;  1WRZ A;  1CDL A;  1YX8 A;  1TCF A;  4UPG A;  3K21 A;  2BL0 B;  1RTP 1;  2ZN9 A;  1CFF A;  4PAL A;  1L2O C;  2HQW A;  1KQM C;  4HSZ A;  1S6J A;  2PSR A;  1CNP A;  2LLT A;  1XFZ O;  3OP0 A;  1BOC A;  2KHN A;  1SL7 A;  4MZK A;  3EK8 A;  2K0J A;  1C7V A;  1OOJ A;  2LC5 A;  5DKQ A;  2MLE C;  1KFU S;  3TDU A;  1QS7 A;  2LMT A;  1HQV A;  1NX1 A;  1B8R A;  1KK8 C;  2Y1M A;  2JNF A;  1KFX L;  2JXC A;  1QV1 A;  3FS7 A;  1F70 A;  3AAJ A;  4M2P A;  4Q04 A;  5HKW A;  4N1F A;  1EG4 A;  1AJ5 A;  2JNX A;  2LP2 A;  1YX7 A;  2V53 A;  1DGV A;  5CPV A;  2CBL A;  3NSO A;  1NX0 A;  3EK4 A;  2M1K B;  1C7W A;  1DJY A;  1CFP A;  2KYC A;  3I5H C;  1FBV A;  3ZWH A;  1PSB A;  1XFW O;  3EK7 A;  4DS7 A;  1G33 A;  1B1G A;  1QAS A;  3CZT X;  4PHJ A;  4YGE B;  3EVU A;  3NXA A;  1N0Y A;  2KQ6 A;  2OPO A;  5HYD A;  3EKJ A;  1EJ3 A;  1SCV A;  3GOF A;  1RRO A;  4ETO A;  1NIW A;  2LUX A;  3BQ3 A;  4NQG A;  2F33 A;  1UUR A;  1J1D A;  1KSO A;  1KQM B;  1SBJ A;  3DD4 A;  1UUS A;  3DVK A;  3DVM A;  3FWC A;  1DJH A;  1Y1U A;  1S6C A;  2LM5 A;  1A4P A;  2KI4 B;  3LCP C;  1GGZ A;  3VRQ A;  1GQM A;  1SR6 C;  4JPZ B;  4PCW A;  2MA2 A;  1KK8 B;  1B47 A;  1YRT B;  4CPV A;  1JSA A;  2CXJ A;  4MZL A;  3M0W A;  3AAK A;  4ORA B;  2K7B A;  3CLN A;  1DGU A;  5F6T A;  3ICB A;  1OMR A;  1UHH A;  3KEV A;  3WHT B;  2BCX A;  1SK6 D;  1BU3 A;  1K93 D;  1KFX S;  1WLM A;  5K89 A;  1YUU A;  2KFF A;  1N65 A;  1ZOT B;  1ZUZ A;  2LV7 A;  2SCP A;  1B8C A;  1EG3 A;  1SL9 A;  1XA5 A;  2JT3 A;  3D0Y A;  3SIB A;  3WXA A;  5HLO A;  1LIN A;  1K94 A;  1MR8 A;  2Q4U A;  2HET A;  3CTN A;  4BY4 A;  4GGN A;  4AQJ A;  1IRJ A;  1TNX A;  1PAL A;  4PE0 A;  2K2F A;  3D10 A;  4YI9 A;  5KTY A;  2PRU A;  2LAP A;  2GGM A;  3DVE A;  1AK8 A;  1U5I B;  1BF5 A;  4MSP A;  4MEW A;  1NCY A;  3CR2 A;  2KFG A;  4WQ3 A;  3AKA A;  1JF2 A;  1SR6 B;  2JRF A;  2BE6 A;  5TNC A;  1OZS A;  2M9G A;  1LXF C;  4QJ5 B;  4JQ0 D;  4L9M A;  2LHI A;  2OS8 B;  4C0L A;  1G4Y R;  1KSM A;  1TNQ A;  3PLF B;  1S1E A;  1TN4 A;  1YTZ C;  1F8H A;  1NSH A;  5D7F A;  2BCB A;  1M63 B;  1A03 A;  1K9P A;  1H8B A;  1QIW A;  2WCB A;  1GJY A;  2D8N A;  3IQQ A;  4YGC B;  3NSI A;  2I94 A;  2FJU B;  5DKN A;  2ZRS A;  1TIZ A;  4I5L B;  4FTG A;  2WCF A;  1CLM A;  2AMI A;  3LK1 A;  4GFT A;  2LE9 B;  3QRX A;  2FCD A;  3BYA A;  1YUS A;  1K90 D;  2P6B B;  1UHK A;  4ORC B;  3PN7 B;  1J7O A;  3O4Y A;  2L50 A;  4GGF C;  3TUY B;  1WRK A;  2AAO A;  1V1G A;  4JWQ A;  1FF1 A;  1CDN A;  4OVN F;  4CLN A;  2JQ6 A;  5J3X A;  1PSR A;  2GGZ A;  2F2P A;  2COL B;  3BUN B;  1JBA A;  4PHN A;  1DJG A;  1BJF A;  3JVT C;  2KI6 D;  2G9B A;  1CM4 A;  2JT0 A;  4XJK A;  1K8U A;  4YGA A;  4AQI A;  2JWW A;  1OMD A;  1XYD A;  1R6P A;  2BEC A;  1LVC D;  2ISD A;  3SG5 A;  5KSZ A;  1SRA A;  1W7J B;  4M2Q A;  2PMY A;  2CT9 A;  2M1U A;  4WQ2 A;  2M7L A;  1EH2 A;  2LAN A;  2JUL A;  1FW4 A;  1N2D A;  1RK9 A;  1J7P A;  1XO5 A;  2KAY A;  2KSP A;  2Y4Q A;  4TNC A;  4NDC A;  2O60 A;  4R1E A;  2AUC A;  2KAX A;  2HF5 A;  3FWB A;  4A4B A;  1F55 A;  3O78 A;  2CTN A;  1REC A;  2I18 A;  1RWY A;  2ZRT A;  2MBX A;  4E68 A;  1JC2 A;  2ZNE A;  5CSJ A;  1R2U A;  2HPS A;  2L5X B;  5PAL A;  1XFY O;  1PK0 D;  4PE7 A;  1Y1X A;  2F3Y A;  2JT8 A;  3OX6 A;  1AP4 A;  2KDH A;  4YBH B;  3TS5 C;  2L4H A;  2BBN A;  1L2O B;  1AJ4 A;  5AER A;  1KK7 Y;  3LK0 A;  3EVR A;  1UHJ A;  1K95 A;  1WLZ A;  1G8I A;  3BUO B;  2MJW B;  4P5O E;  1YVH A;  4OCI A;  2BKH B;  3BUW B;  3AKB A;  4GAO A;  2ZND A;  3IQO A;  1W7I B;  2KGB C;  1UP5 A;  3TDZ A;  3GK4 X;  2HQ8 A;  2IS9 A;  4GGF A;  1DJI A;  2CCM A;  2M0R A;  2M7N A;  3JTD C;  4MRY A;  3CWG A;  3I5F C;  1QVI Z;  1Y1A A;  1S5G Z;  1BT6 A;  1J1E A;  5IBW A;  2ZN8 A;  3D0Y B;  3DVJ A;  1B4C A;  1MUX A;  2KGR A;  1Y6W A;  2JU0 A;  1YRU B;  4WRI A;  1WY9 A;  4U8D A;  3SG2 A;  2NZ0 A;  1JUO A;  1H4B A;  1OMV A;  1SYM A;  2KBM A;  2G2B A;  2K2A A;  2CNP A;  3SG3 A;  2M29 A;  1BR4 B;  1LA0 A;  1WDC C;  2Y5I A;  1MF8 B;  1TTX A;  3I5H B;  1F4Q A;  4PDZ A;  1AHR A;  3RM1 A;  5AFP A;  2K7O A;  1J7Q A;  1K2H A;  5CSF A;  3BXK A;  1NUB A;  5AAN A;  3GK1 A;  1F71 A;  4USL A;  1QXP A;  1KK7 Z;  5BPJ A;  4YGB B;  1CMF A;  1DJW A;  4AOM A;  3BOW A;  1SY9 A;  4I5J A;  1KWO C;  1PVA A;  1SNL A;  4HRE E;  1CFC A;  1KCY A;  5I8N A;  4XYN A;  1TNP A;  2K8M B;  2LLS A;  3NSL A;  3PAT A;  4N5X A;  3VRN A;  3SG6 A;  4DCK A;  5KU1 A;  3I5G C;  4GNK B;  3C1V A;  4GBA A;  1MQ1 A;  2M49 B;  4MRX A;  3SJS A;  1IWQ A;  2VRG A;  1JWD A;  3RLZ A;  1LKJ A;  1ZAC A;  1CLL A;  3E3R A;  1RFJ A;  4GPL B;  1SCM C;  3I5F B;  1ZMZ A;  1RJV A;  1BG1 A;  5AXI A;  3KF9 A;  1CTR A;  5CSI A;  1IJ6 A;  5DKR A;  5ER5 A;  5B8I B;  1CM1 A;  4C0J A;  1DMO A;  2PAL A;  1UHN A;  1A2X A;  3A4U B;  4HRG A;  1FI6 A;  2KAV A;  1UHI A;  2RGI A;  1MWN A; 
#chains in the Genus database with same CATH topology
 2LHL A;  2WCM A;  1DEK A;  2NLN A;  1GM0 A;  4OZD A;  1S36 A;  1ODB A;  1S6I A;  2KYF A;  5AEQ A;  1YUT A;  2L2E A;  5JJG A;  1NWD A;  2I2R E;  5HKY A;  1B9A A;  5I94 A;  3OB1 B;  1BLQ A;  2GV5 A;  4DUQ A;  1XVJ A;  1DJX A;  1YR5 A;  2GTE A;  2PVB A;  5ER4 X;  2K7D A;  2H61 A;  4XJK B;  1TNW A;  2SAS A;  1DF0 A;  1B7T Z;  3BUM B;  1KQV A;  3DY9 A;  1F4O A;  1DJZ A;  1Z4H A;  1QX2 A;  2M97 A;  2JZI A;  1Q80 A;  4MLW A;  4JKT A;  2M3W A;  4ZCU A;  3S0G A;  4P2Y B;  2L2C A;  2KLE A;  2ZKM X;  3PAL A;  4OR9 B;  2BCA A;  2JXL A;  5GQQ C;  4PHK A;  5CSN A;  1GGW A;  1OQP A;  1XFU O;  1JFJ A;  2LVJ A;  1CFD A;  1QIV A;  1CDM A;  1CB1 A;  2LVV A;  1FI5 A;  3DF0 A;  1DEL A;  2KFH A;  1XFX O;  1QAT A;  2JPO A;  1WRL A;  2JPT A;  3I5I C;  1UWO A;  2WC8 A;  1PUL A;  4GUK A;  1F54 A;  1NYA A;  1QVI Y;  2K7C A;  1S5G Y;  1ORG A;  1B8L A;  2WCH A;  3OX5 A;  2FCE A;  1L7Z A;  4CFQ A;  1DTL A;  4DIR A;  3K1E A;  1NCX A;  2KI4 C;  2EC6 C;  5I2O A;  3H4S E;  2LLU A;  1TUJ A;  3B88 A;  2NXQ A;  3VRO A;  1K96 A;  2L51 A;  2LVK A;  4ORB B;  1IJ5 A;  2E6W A;  1MXL C;  3S0E A;  3PSR A;  1QX7 A;  3TDI A;  1AVS A;  2LNK A;  4YRU A;  1OOF A;  2I7A A;  3CS1 A;  1OE9 B;  3R72 A;  2WND A;  1IH0 A;  1J55 A;  1MHO A;  2KBI A;  5FYX A;  3JVT B;  2KI6 C;  1CMG A;  3KPX A;  3L4A A;  1C3Z A;  1DC1 A;  4CID A;  1NCZ A;  2BKI B;  1XK4 C;  1NP8 A;  1CLB A;  1J7R A;  1DVI A;  4HRH A;  2LUC A;  2E30 A;  3VRP A;  1IGV A;  4PHM A;  3VRR A;  4MN0 A;  3VB1 A;  4QJ3 B;  2LMU A;  1SSE B;  1K9U A;  2OTG C;  1IKU A;  3I5I B;  1M39 A;  2WOS A;  3SS4 A;  3S0F A;  1SKT A;  3A8R A;  1NX2 A;  3BOW B;  1QLS A;  1X02 A;  2QAC A;  2L98 A;  2NCO A;  3CR5 X;  1EXR A;  1QLK A;  3LLE A;  3OHM B;  2L0P A;  2H61 C;  3IF7 A;  1OSA A;  4I5N B;  3KO0 A;  1IQ5 A;  3HCM A;  2K60 A;  4KYN A;  5JOL A;  3FE6 A;  1K9K A;  2EC6 B;  2KQY A;  1SL8 A;  2F8P A;  1BMO A;  2ZFD A;  1V1F A;  3B86 A;  3O2P A;  4IL1 A;  2WOR A;  4DRW A;  2L4I A;  2JTT A;  3RZS A;  2A4J A;  2WCE A;  2OS8 C;  1IG5 A;  2DOQ A;  2MRD A;  2B1U A;  3L4L A;  1LA3 A;  1M46 A;  2MHH A;  3TS5 B;  1A29 A;  5HLV A;  1FPW A;  4FQO A;  4F0Z B;  5HL1 A;  4NDB A;  2F2O A;  1IQ3 A;  2JC2 A;  1ALV A;  2M8U A;  3EKH A;  5HKZ A;  1AUI B;  1JF0 A;  3EVV A;  1B7T Y;  1TCO B;  2MAZ A;  3DXL A;  1PVB A;  1DT7 B;  1BOD A;  1EL4 A;  2BE4 A;  1QX5 B;  5EL2 A;  4I5K A;  5G08 A;  4MVF A;  2TN4 A;  2BBM A;  4MZJ A;  4N1G A;  1XFV O;  4PE1 A;  1OZO A;  3JTD B;  3PM8 A;  1E8A A;  2FOT A;  3SIA A;  2LMV A;  2OTG B;  1C07 A;  5I2L A;  4BY5 A;  3WNX B;  4ICB A;  3NGV A;  1YVL A;  4C0K A;  2NCP A;  1PRW A;  3F45 A;  3S0D A;  4A4C A;  3FIA A;  1ALW A;  1Y0V H;  1HT9 A;  3PN7 C;  4CFR A;  1KFU L;  1SMG A;  1SW8 A;  3ZNI A;  4D1E A;  3TUY C;  1CDP A;  1T14 A;  1XK4 A;  2BL0 C;  3HX4 A;  3BFA A;  4M2O A;  4YI8 A;  1VRK A;  1WDC B;  3S0A A;  1TRF A;  1DF0 B;  4MBE A;  3MSE B;  2LVI A;  2Q91 A;  3VGO A;  3GK2 A;  1M45 A;  3OB2 B;  3CZ0 A;  3SG7 A;  2KNE A;  1S3P A;  2MLF C;  2BNX A;  4YGD B;  2QPT A;  2O5G A;  2QEO A;  1U5I A;  2BAP A;  1KWO B;  2LCP A;  3D76 A;  1YUR A;  2EHB A;  2WCJ A;  3O6B A;  1A75 B;  2JTZ A;  2KLD A;  3KHE A;  5I2Q A;  3Q8I A;  4NDD A;  3BJH A;  5FI6 A;  1ZFS A;  2LP3 A;  1MXE A;  4PE4 A;  1QJT A;  1CKK A;  2PAS A;  2KOT A;  3I5G B;  4ZCV A;  1M31 A;  1D1O A;  3DF0 B;  3LL8 B;  3BUX B;  1S26 D;  3BFH A;  2H2K A;  2R2I A;  2JOJ A;  1SCM B;  4OKH A;  1QV0 A;  1SPY A;  1TOP A;  2F3Z A;  1A75 A;  1JFK A;  3CR4 X;  1NPQ A;  5FI7 A;  4OV2 A;  2EGD A;  1BR1 B;  2QEB A;  1NX3 A;  1TUZ A;  3NSK A;  5D69 A;  1QTX A;  3WHU B;  3PFV A;  3TZ1 A;  2Y1N A;  4QJ4 B;  3CGA A;  2K61 A;  3SG4 A;  1WRZ A;  1CDL A;  1YX8 A;  1TCF A;  4UPG A;  3K21 A;  2BL0 B;  1RTP 1;  2ZN9 A;  1CFF A;  4PAL A;  3SS5 A;  1L2O C;  1IIO A;  2HQW A;  1KQM C;  2L5Y A;  4HSZ A;  1S6J A;  2PSR A;  1CNP A;  2LLT A;  1XFZ O;  3OP0 A;  1BOC A;  2KHN A;  4FQT A;  1SL7 A;  4MZK A;  3EK8 A;  2K0J A;  2WCK A;  1C7V A;  1OOJ A;  2LC5 A;  5DKQ A;  2MLE C;  5FI2 A;  1KFU S;  3TDU A;  3BFB A;  1QS7 A;  2LMT A;  1HQV A;  1NX1 A;  1B8R A;  1KK8 C;  2Y1M A;  2JNF A;  1KFX L;  2JXC A;  1QV1 A;  5D3O A;  3D75 A;  3FS7 A;  1F70 A;  3AAJ A;  4M2P A;  4Q04 A;  5HKW A;  4N1F A;  3UO9 A;  1EG4 A;  1AJ5 A;  2JNX A;  2LP2 A;  1YX7 A;  2V53 A;  1DGV A;  5CPV A;  2CBL A;  3V2L A;  3NSO A;  1NX0 A;  3EK4 A;  2M1K B;  1C7W A;  1DJY A;  3B7A A;  1CFP A;  2KYC A;  3I5H C;  1FBV A;  3ZWH A;  1PSB A;  1XFW O;  1P28 A;  3EK7 A;  4DS7 A;  1G33 A;  1B1G A;  1QAS A;  3CZT X;  4PHJ A;  4YGE B;  3EVU A;  3NXA A;  1N0Y A;  2KQ6 A;  2OPO A;  5HYD A;  3EKJ A;  1EJ3 A;  1SCV A;  3D78 A;  1RRO A;  3GOF A;  4ETO A;  1NIW A;  2LUX A;  3BQ3 A;  4NQG A;  5DIC A;  2F33 A;  1UUR A;  1J1D A;  1KSO A;  1KQM B;  1SBJ A;  3DD4 A;  1UUS A;  3DVK A;  3DVM A;  2WC6 A;  2H8V A;  3FWC A;  1DJH A;  1Y1U A;  1S6C A;  2LM5 A;  4PT1 A;  2PQL A;  1A4P A;  2KI4 B;  3LCP C;  3L47 A;  1GGZ A;  3VRQ A;  1GQM A;  1SR6 C;  4JPZ B;  4PCW A;  3D74 A;  2MA2 A;  1KK8 B;  1B47 A;  1YRT B;  4CPV A;  1JSA A;  2CXJ A;  4MZL A;  3M0W A;  3AAK A;  4ORA B;  2K7B A;  3CLN A;  1DGU A;  5F6T A;  3ICB A;  1OMR A;  1UHH A;  3KEV A;  3WHT B;  3O4X A;  2BCX A;  3CZ1 A;  1SK6 D;  1BU3 A;  1K93 D;  1KFX S;  1WLM A;  5K89 A;  1YUU A;  2KFF A;  1N65 A;  1ZOT B;  1ZUZ A;  2LV7 A;  2SCP A;  1B8C A;  1EG3 A;  1SL9 A;  1XA5 A;  2JT3 A;  3D0Y A;  3SIB A;  3WXA A;  5HLO A;  1LIN A;  1K94 A;  1MR8 A;  2Q4U A;  2HET A;  3CTN A;  4BY4 A;  4GGN A;  4AQJ A;  1IRJ A;  1TNX A;  1PAL A;  4PE0 A;  2K2F A;  3CZ2 A;  3D10 A;  4YI9 A;  3CDN A;  3UNW A;  5KTY A;  2PRU A;  2LAP A;  2GGM A;  3DVE A;  1AK8 A;  1U5I B;  1BF5 A;  3DYE A;  3QME A;  4MSP A;  4MEW A;  1NCY A;  2QEV A;  2KFG A;  3CR2 A;  4WQ3 A;  1OOG A;  3AKA A;  1JF2 A;  1SR6 B;  2JRF A;  1XFR A;  2BE6 A;  5TNC A;  3D77 A;  2YGU A;  1OZS A;  2M9G A;  1LXF C;  3CAB A;  4QJ5 B;  3FE9 A;  4JQ0 D;  4L9M A;  2LHI A;  2OS8 B;  4C0L A;  1G4Y R;  1KSM A;  1TNQ A;  3PLF B;  1S1E A;  2WC5 A;  1TN4 A;  3SS3 A;  1DQE A;  1YTZ C;  2QEH A;  1F8H A;  1NSH A;  2PYQ A;  5D7F A;  2BCB A;  1M63 B;  1A03 A;  1K9P A;  1H8B A;  1QIW A;  2WCB A;  1GJY A;  2D8N A;  3IQQ A;  4YGC B;  3NSI A;  2I94 A;  2FJU B;  3B6X A;  2ZRS A;  1TIZ A;  4I5L B;  5DKN A;  4JD9 A;  4FTG A;  2WCF A;  1CLM A;  2AMI A;  3LK1 A;  4GFT A;  2LE9 B;  2WCL A;  3QRX A;  1OOI X;  2FCD A;  3BYA A;  3R1V A;  1YUS A;  1K90 D;  2P6B B;  1UHK A;  4ORC B;  3PN7 B;  1J7O A;  1LS8 A;  3O4Y A;  2L50 A;  4GGF C;  3B87 A;  3TUY B;  1WRK A;  2AAO A;  1V1G A;  4JWQ A;  1FF1 A;  3NHI A;  1CDN A;  4OVN F;  4CLN A;  2JQ6 A;  5J3X A;  1PSR A;  3EG5 B;  2GGZ A;  2F2P A;  2COL B;  3BUN B;  1JBA A;  4PHN A;  1DJG A;  1BJF A;  3JVT C;  2KI6 D;  2G9B A;  3IVT A;  1CM4 A;  2JT0 A;  4XJK A;  1K8U A;  4F7F A;  2KPH A;  1W9Z A;  4YGA A;  4AQI A;  2JWW A;  1OMD A;  1XYD A;  1R6P A;  2BEC A;  1LVC D;  2ERB A;  2ISD A;  3SG5 A;  1SRA A;  5KSZ A;  2P70 A;  1W7J B;  4M2Q A;  2PMY A;  3PJI A;  2CT9 A;  2M1U A;  4WQ2 A;  2M7L A;  1EH2 A;  2LAN A;  2JUL A;  1FW4 A;  1N2D A;  1RK9 A;  1J7P A;  1XO5 A;  2KAY A;  2KSP A;  2Y4Q A;  4TNC A;  4NDC A;  2O60 A;  4R1E A;  2AUC A;  2KAX A;  2HF5 A;  3FWB A;  4A4B A;  1F55 A;  3O78 A;  2CTN A;  3R1P A;  1REC A;  2I18 A;  1RWY A;  2ZRT A;  2MBX A;  4E68 A;  1JC2 A;  1OOH A;  2ZNE A;  5CSJ A;  1R2U A;  2HPS A;  2L5X B;  5PAL A;  1XFY O;  1PK0 D;  4PE7 A;  1Y1X A;  2F3Y A;  2JT8 A;  3OX6 A;  1AP4 A;  2KDH A;  4INX A;  4YBH B;  3TS5 C;  2L4H A;  2BBN A;  1L2O B;  1AJ4 A;  5AER A;  1KK7 Y;  3LK0 A;  3EVR A;  1UHJ A;  1K95 A;  1WLZ A;  2QDI A;  1G8I A;  3BUO B;  2MJW B;  4P5O E;  1YVH A;  3NHT A;  4IJ7 A;  4OCI A;  2BKH B;  3BUW B;  3AKB A;  4GAO A;  2ZND A;  3IQO A;  1W7I B;  2KGB C;  1UP5 A;  3PM2 A;  3TDZ A;  3GK4 X;  2HQ8 A;  2IS9 A;  4GGF A;  1DJI A;  2CCM A;  2M0R A;  2M7N A;  3JTD C;  4MRY A;  3CWG A;  3I5F C;  4INW A;  1QVI Z;  1Y1A A;  3FE8 A;  1S5G Z;  1BT6 A;  1J1E A;  5IBW A;  1C3Y A;  2ZN8 A;  3D0Y B;  3DVJ A;  1B4C A;  1MUX A;  2KGR A;  1Y6W A;  2JU0 A;  1Z2C B;  1YRU B;  3OBV A;  1WY9 A;  4U8D A;  4WRI A;  3SG2 A;  2NZ0 A;  1JUO A;  1H4B A;  1OMV A;  1SYM A;  2KBM A;  2G2B A;  2K2A A;  2CNP A;  3SG3 A;  2M29 A;  1BR4 B;  1LA0 A;  1WDC C;  2Y5I A;  1MF8 B;  1TTX A;  1OW4 A;  1F4Q A;  1QWV A;  3I5H B;  3OGN A;  4PDZ A;  1AHR A;  2P71 A;  3RM1 A;  2FJY A;  5AFP A;  2K7O A;  1J7Q A;  1K2H A;  5CSF A;  3BXK A;  1NUB A;  5AAN A;  1TWO A;  3GK1 A;  3N7H A;  1F71 A;  4USL A;  1QXP A;  1KK7 Z;  5BPJ A;  4YGB B;  1CMF A;  1DJW A;  4AOM A;  3BOW A;  1SY9 A;  4I5J A;  1KWO C;  1PVA A;  1SNL A;  4HRE E;  1CFC A;  1KCY A;  5I8N A;  4XYN A;  1TNP A;  2K8M B;  2LLS A;  3NSL A;  3PAT A;  4N5X A;  3VRN A;  3SG6 A;  3R1O A;  4DCK A;  5KU1 A;  3I5G C;  4GNK B;  3C1V A;  4GBA A;  1MQ1 A;  2M49 B;  4MRX A;  3SJS A;  1IWQ A;  2VRG A;  3D73 A;  1JWD A;  3RLZ A;  1LKJ A;  1ZAC A;  1CLL A;  3E3R A;  1RFJ A;  4GPL B;  1SCM C;  3I5F B;  1ZMZ A;  1RJV A;  1BG1 A;  3DZT A;  5AXI A;  3KF9 A;  1CTR A;  5CSI A;  1IJ6 A;  5DKR A;  5ER5 A;  5B8I B;  1CM1 A;  4C0J A;  1DMO A;  2PAL A;  1UHN A;  1A2X A;  3A4U B;  3CYZ A;  4HRG A;  3S0B A;  1FI6 A;  2KAV A;  1UHI A;  2RGI A;  1MWN A; 
#chains in the Genus database with same CATH homology
 2LHL A;  2NLN A;  1S36 A;  1ODB A;  1S6I A;  2KYF A;  5AEQ A;  1YUT A;  2L2E A;  5JJG A;  1NWD A;  2I2R E;  5HKY A;  1B9A A;  3OB1 B;  1BLQ A;  2GV5 A;  4DUQ A;  1XVJ A;  1DJX A;  1YR5 A;  2PVB A;  5ER4 X;  2K7D A;  2H61 A;  4XJK B;  1TNW A;  2SAS A;  1DF0 A;  1B7T Z;  3BUM B;  1KQV A;  1F4O A;  1DJZ A;  1QX2 A;  2M97 A;  2JZI A;  1Q80 A;  4MLW A;  2M3W A;  4ZCU A;  4P2Y B;  2ZKM X;  3PAL A;  4OR9 B;  2BCA A;  2JXL A;  5GQQ C;  4PHK A;  5CSN A;  1GGW A;  1OQP A;  1XFU O;  1JFJ A;  2LVJ A;  1CFD A;  1QIV A;  1CDM A;  1CB1 A;  2LVV A;  1FI5 A;  3DF0 A;  2KFH A;  3I5I C;  1XFX O;  1QAT A;  2JPT A;  1WRL A;  4GUK A;  1UWO A;  2WC8 A;  1PUL A;  1F54 A;  1NYA A;  1QVI Y;  2K7C A;  1S5G Y;  1B8L A;  3OX5 A;  2FCE A;  1L7Z A;  4CFQ A;  1DTL A;  4DIR A;  1NCX A;  2KI4 C;  2EC6 C;  5I2O A;  3H4S E;  2LLU A;  2NXQ A;  3VRO A;  1K96 A;  2L51 A;  2LVK A;  4ORB B;  1IJ5 A;  2E6W A;  1MXL C;  3PSR A;  1QX7 A;  3TDI A;  1AVS A;  2LNK A;  4YRU A;  2I7A A;  3CS1 A;  1OE9 B;  2WND A;  1IH0 A;  1J55 A;  1MHO A;  2KBI A;  5FYX A;  3JVT B;  2KI6 C;  1CMG A;  3KPX A;  4CID A;  1NCZ A;  2BKI B;  1XK4 C;  1NP8 A;  1CLB A;  1J7R A;  1DVI A;  4HRH A;  2LUC A;  2E30 A;  3VRP A;  1IGV A;  4PHM A;  4MN0 A;  4QJ3 B;  2LMU A;  2OTG C;  1K9U A;  1IKU A;  3I5I B;  1M39 A;  2WOS A;  1SKT A;  3A8R A;  1NX2 A;  3BOW B;  1QLS A;  1X02 A;  2QAC A;  2L98 A;  2NCO A;  3CR5 X;  1EXR A;  1QLK A;  3LLE A;  3OHM B;  2L0P A;  2H61 C;  3IF7 A;  1OSA A;  4I5N B;  3KO0 A;  1IQ5 A;  3HCM A;  5JOL A;  3VRR A;  1K9K A;  2EC6 B;  2KQY A;  1SL8 A;  2F8P A;  1BMO A;  2ZFD A;  1V1F A;  3O2P A;  4IL1 A;  4DRW A;  2WOR A;  2L4I A;  2JTT A;  2A4J A;  2WCE A;  2OS8 C;  1IG5 A;  2DOQ A;  2MRD A;  2B1U A;  1LA3 A;  1M46 A;  2MHH A;  3TS5 B;  1A29 A;  5HLV A;  1FPW A;  4FQO A;  4F0Z B;  4NDB A;  2F2O A;  1IQ3 A;  2JC2 A;  1ALV A;  2M8U A;  3EKH A;  5HKZ A;  1AUI B;  1JF0 A;  3EVV A;  1B7T Y;  1TCO B;  2MAZ A;  1PVB A;  1DT7 B;  1BOD A;  1EL4 A;  2BE4 A;  1QX5 B;  5G08 A;  4I5K A;  4MVF A;  2TN4 A;  2BBM A;  4MZJ A;  4N1G A;  1XFV O;  4PE1 A;  1OZO A;  3JTD B;  3PM8 A;  1E8A A;  2FOT A;  3SIA A;  2LMV A;  2OTG B;  1C07 A;  5I2L A;  4BY5 A;  3WNX B;  4ICB A;  1YVL A;  4C0K A;  2NCP A;  1PRW A;  3F45 A;  4A4C A;  3FIA A;  1ALW A;  1Y0V H;  1HT9 A;  3PN7 C;  4CFR A;  1KFU L;  1SMG A;  1SW8 A;  3ZNI A;  4D1E A;  3TUY C;  1CDP A;  1XK4 A;  2BL0 C;  3HX4 A;  4YI8 A;  4M2O A;  1VRK A;  1WDC B;  1TRF A;  1DF0 B;  4MBE A;  3MSE B;  2LVI A;  2Q91 A;  3VGO A;  3GK2 A;  1M45 A;  3OB2 B;  3SG7 A;  2KNE A;  1S3P A;  2MLF C;  4YGD B;  2QPT A;  2O5G A;  1U5I A;  2LCP A;  1KWO B;  1YUR A;  2EHB A;  3O6B A;  1A75 B;  2JTZ A;  3KHE A;  5I2Q A;  4NDD A;  1ZFS A;  2LP3 A;  1MXE A;  4PE4 A;  1QJT A;  1CKK A;  2PAS A;  2KOT A;  3I5G B;  4ZCV A;  1M31 A;  1D1O A;  3DF0 B;  3LL8 B;  3BUX B;  1S26 D;  2H2K A;  2R2I A;  2JOJ A;  1SCM B;  4OKH A;  1QV0 A;  1SPY A;  1TOP A;  2F3Z A;  1A75 A;  1JFK A;  3CR4 X;  1NPQ A;  4OV2 A;  2EGD A;  1BR1 B;  3NSK A;  1NX3 A;  3WHU B;  4QJ4 B;  5D69 A;  1QTX A;  3PFV A;  3TZ1 A;  2Y1N A;  3CGA A;  2K61 A;  3SG4 A;  1WRZ A;  1CDL A;  1YX8 A;  1TCF A;  4UPG A;  3K21 A;  2BL0 B;  1RTP 1;  2ZN9 A;  1CFF A;  4PAL A;  1L2O C;  2HQW A;  1KQM C;  4HSZ A;  1S6J A;  2PSR A;  1CNP A;  2LLT A;  1XFZ O;  3OP0 A;  1BOC A;  2KHN A;  1SL7 A;  4MZK A;  3EK8 A;  2K0J A;  1C7V A;  1OOJ A;  2LC5 A;  5DKQ A;  2MLE C;  1KFU S;  3TDU A;  1QS7 A;  2LMT A;  1HQV A;  1NX1 A;  1B8R A;  1KK8 C;  2Y1M A;  2JNF A;  1KFX L;  2JXC A;  1QV1 A;  3FS7 A;  1F70 A;  3AAJ A;  4M2P A;  4Q04 A;  5HKW A;  4N1F A;  1EG4 A;  1AJ5 A;  2JNX A;  2LP2 A;  1YX7 A;  2V53 A;  1DGV A;  5CPV A;  2CBL A;  3NSO A;  1NX0 A;  3EK4 A;  2M1K B;  1C7W A;  1DJY A;  1CFP A;  2KYC A;  3I5H C;  1FBV A;  3ZWH A;  1PSB A;  1XFW O;  3EK7 A;  4DS7 A;  1G33 A;  1B1G A;  1QAS A;  3CZT X;  4PHJ A;  4YGE B;  3EVU A;  3NXA A;  1N0Y A;  2KQ6 A;  2OPO A;  5HYD A;  3EKJ A;  1EJ3 A;  1SCV A;  3GOF A;  1RRO A;  4ETO A;  1NIW A;  2LUX A;  3BQ3 A;  4NQG A;  2F33 A;  1UUR A;  1J1D A;  1KSO A;  1KQM B;  1SBJ A;  3DD4 A;  1UUS A;  3DVK A;  3DVM A;  3FWC A;  1DJH A;  1Y1U A;  1S6C A;  2LM5 A;  1A4P A;  2KI4 B;  3LCP C;  1GGZ A;  3VRQ A;  1GQM A;  1SR6 C;  4JPZ B;  4PCW A;  2MA2 A;  1KK8 B;  1B47 A;  1YRT B;  4CPV A;  1JSA A;  2CXJ A;  4MZL A;  3M0W A;  3AAK A;  4ORA B;  2K7B A;  3CLN A;  1DGU A;  5F6T A;  3ICB A;  1OMR A;  1UHH A;  3KEV A;  3WHT B;  2BCX A;  1SK6 D;  1BU3 A;  1K93 D;  1KFX S;  1WLM A;  5K89 A;  1YUU A;  2KFF A;  1N65 A;  1ZOT B;  1ZUZ A;  2LV7 A;  2SCP A;  1B8C A;  1EG3 A;  1SL9 A;  1XA5 A;  2JT3 A;  3D0Y A;  3SIB A;  3WXA A;  5HLO A;  1LIN A;  1K94 A;  1MR8 A;  2Q4U A;  2HET A;  3CTN A;  4BY4 A;  4GGN A;  4AQJ A;  1IRJ A;  1TNX A;  1PAL A;  4PE0 A;  2K2F A;  3D10 A;  4YI9 A;  5KTY A;  2PRU A;  2LAP A;  2GGM A;  3DVE A;  1AK8 A;  1U5I B;  1BF5 A;  4MSP A;  4MEW A;  1NCY A;  3CR2 A;  2KFG A;  4WQ3 A;  3AKA A;  1JF2 A;  1SR6 B;  2JRF A;  2BE6 A;  5TNC A;  1OZS A;  2M9G A;  1LXF C;  4QJ5 B;  4JQ0 D;  4L9M A;  2LHI A;  2OS8 B;  4C0L A;  1G4Y R;  1KSM A;  1TNQ A;  3PLF B;  1S1E A;  1TN4 A;  1YTZ C;  1F8H A;  1NSH A;  5D7F A;  2BCB A;  1M63 B;  1A03 A;  1K9P A;  1H8B A;  1QIW A;  2WCB A;  1GJY A;  2D8N A;  3IQQ A;  4YGC B;  3NSI A;  2I94 A;  2FJU B;  5DKN A;  2ZRS A;  1TIZ A;  4I5L B;  4FTG A;  2WCF A;  1CLM A;  2AMI A;  3LK1 A;  4GFT A;  2LE9 B;  3QRX A;  2FCD A;  3BYA A;  1YUS A;  1K90 D;  2P6B B;  1UHK A;  4ORC B;  3PN7 B;  1J7O A;  3O4Y A;  2L50 A;  4GGF C;  3TUY B;  1WRK A;  2AAO A;  1V1G A;  4JWQ A;  1FF1 A;  1CDN A;  4OVN F;  4CLN A;  2JQ6 A;  5J3X A;  1PSR A;  2GGZ A;  2F2P A;  2COL B;  3BUN B;  1JBA A;  4PHN A;  1DJG A;  1BJF A;  3JVT C;  2KI6 D;  2G9B A;  1CM4 A;  2JT0 A;  4XJK A;  1K8U A;  4YGA A;  4AQI A;  2JWW A;  1OMD A;  1XYD A;  1R6P A;  2BEC A;  1LVC D;  2ISD A;  3SG5 A;  5KSZ A;  1SRA A;  1W7J B;  4M2Q A;  2PMY A;  2CT9 A;  2M1U A;  4WQ2 A;  2M7L A;  1EH2 A;  2LAN A;  2JUL A;  1FW4 A;  1N2D A;  1RK9 A;  1J7P A;  1XO5 A;  2KAY A;  2KSP A;  2Y4Q A;  4TNC A;  4NDC A;  2O60 A;  4R1E A;  2AUC A;  2KAX A;  2HF5 A;  3FWB A;  4A4B A;  1F55 A;  3O78 A;  2CTN A;  1REC A;  2I18 A;  1RWY A;  2ZRT A;  2MBX A;  4E68 A;  1JC2 A;  2ZNE A;  5CSJ A;  1R2U A;  2HPS A;  2L5X B;  5PAL A;  1XFY O;  1PK0 D;  4PE7 A;  1Y1X A;  2F3Y A;  2JT8 A;  3OX6 A;  1AP4 A;  2KDH A;  4YBH B;  3TS5 C;  2L4H A;  2BBN A;  1L2O B;  1AJ4 A;  5AER A;  1KK7 Y;  3LK0 A;  3EVR A;  1UHJ A;  1K95 A;  1WLZ A;  1G8I A;  3BUO B;  2MJW B;  4P5O E;  1YVH A;  4OCI A;  2BKH B;  3BUW B;  3AKB A;  4GAO A;  2ZND A;  3IQO A;  1W7I B;  2KGB C;  1UP5 A;  3TDZ A;  3GK4 X;  2HQ8 A;  2IS9 A;  4GGF A;  1DJI A;  2CCM A;  2M0R A;  2M7N A;  3JTD C;  4MRY A;  3CWG A;  3I5F C;  1QVI Z;  1Y1A A;  1S5G Z;  1BT6 A;  1J1E A;  5IBW A;  2ZN8 A;  3D0Y B;  3DVJ A;  1B4C A;  1MUX A;  2KGR A;  1Y6W A;  2JU0 A;  1YRU B;  4WRI A;  1WY9 A;  4U8D A;  3SG2 A;  2NZ0 A;  1JUO A;  1H4B A;  1OMV A;  1SYM A;  2KBM A;  2G2B A;  2K2A A;  2CNP A;  3SG3 A;  2M29 A;  1BR4 B;  1LA0 A;  1WDC C;  2Y5I A;  1MF8 B;  1TTX A;  3I5H B;  1F4Q A;  4PDZ A;  1AHR A;  3RM1 A;  5AFP A;  2K7O A;  1J7Q A;  1K2H A;  5CSF A;  3BXK A;  1NUB A;  5AAN A;  3GK1 A;  1F71 A;  4USL A;  1QXP A;  1KK7 Z;  5BPJ A;  4YGB B;  1CMF A;  1DJW A;  4AOM A;  3BOW A;  1SY9 A;  4I5J A;  1KWO C;  1PVA A;  1SNL A;  4HRE E;  1CFC A;  1KCY A;  5I8N A;  4XYN A;  1TNP A;  2K8M B;  2LLS A;  3NSL A;  3PAT A;  4N5X A;  3VRN A;  3SG6 A;  4DCK A;  5KU1 A;  3I5G C;  4GNK B;  3C1V A;  4GBA A;  1MQ1 A;  2M49 B;  4MRX A;  3SJS A;  1IWQ A;  2VRG A;  1JWD A;  3RLZ A;  1LKJ A;  1ZAC A;  1CLL A;  3E3R A;  1RFJ A;  4GPL B;  1SCM C;  3I5F B;  1ZMZ A;  1RJV A;  1BG1 A;  5AXI A;  3KF9 A;  1CTR A;  5CSI A;  1IJ6 A;  5DKR A;  5ER5 A;  5B8I B;  1CM1 A;  4C0J A;  1DMO A;  2PAL A;  1UHN A;  1A2X A;  3A4U B;  4HRG A;  1FI6 A;  2KAV A;  1UHI A;  2RGI A;  1MWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...