4GGFC

Crystal structure of mn2+ bound calprotectin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 108
sequence length 108
chains with identical sequence L, T, V
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfC00
1UHIA 3LLEA 2KQ6A 3GK1A 2KYFA 1B8LA 1NX3A 2CNPA 2FOTA 2M3WA 2K61A 2TN4A 2JZIA 3I5FB 4GNKB 1L7ZA 3TUYC 2OTGB 1W7IB 3DVMA 4NDBA 4D1EA 1MR8A 4GPLB 4XJKA 2K2AA 1KQMB 3SG5A 2KDHA 2NZ0A 3WNXB 2ZNDA 1XFWO 1S5GZ 1EH2A 2L98A 1H4BA 2ISDA 3TS5B 1QTXA 3O4YA 1S26D 3DVJA 3EVVA 1N2DA 1LVCD 5AFPA 4A4BA 2OS8B 3TZ1A 2KHNA 2QACA 4IL1A 4N1GA 1YUUA 1HQVA 1CMFA 2KBIA 1XFZO 4I5NB 5CSIA 2WNDA 1Y1XA 1QX2A 1KFUS 1FI5A 2LUXA 1AVSA 1GGWA 1FW4A 1MF8B 2M9GA 1MXEA 2K7CA 2H61A 2GGZA 3EK4A 2HPSA 4QJ3B 4PCWA 4ETOA 1WRLA 3EK7A 4PE4A 3PM8A 1NX2A 1QXPA 1TCFA 2CXJA 1S3PA 2GV5A 2JULA 2Y4QA 1SCMC 3BUXB 1BF5A 1A2XA 1M39A 2K7OA 1WLMA 2I18A 3I5HC 1IJ6A 4ORAB 2I7AA 2O60A 1E8AA 3CGAA 4BY5A 1ZMZA 5FYXA 1PALA 1J1DA 2KGBC 1PSBA 2L51A 1U5IA 3PN7C 2WCBA 1PVBA 1EG3A 2G2BA 2LVIA 4WQ2A 1DJGA 2ZN9A 4PE7A 3SIAA 3OHMB 1SRAA 1EL4A 4I5LB 5K89A 1CKKA 1J7OA 4JWQA 1K2HA 3EVUA 2KQYA 4GFTA 5F6TA 2LMTA 1DJWA 1BMOA 4BY4A 1DF0A 2SASA 1YR5A 1CFCA 3I5IB 1C7WA 1SR6C 2PSRA 2L5XB 2LP3A 1EG4A 2Q91A 3TDZA 2JC2A 1CLBA 2HQWA 1TNQA 2GGMA 1SCMB 2WCFA 2LNKA 2CCMA 1WRKA 4FQOA 3CR4X 1S1EA 4DUQA 5I8NA 4PHJA 4DIRA 1DGVA 5HLOA 1J55A 4C0JA 1TRFA 1S6JA 1K96A 3O78A 2KBMA 1LA0A 1DJXA 2M29A 4A4CA 2E6WA 3PN7B 4I5KA 5AERA 2M1KB 1IRJA 2LLSA 2LAPA 3BUOB 3NXAA 4MEWA 1QASA 2BBMA 3F45A 3IQOA 3OP0A 3D10A 4ORBB 2SCPA 3ZWHA 4MZKA 1A4PA 2BL0C 2FCDA 1K90D 2PVBA 3CWGA 3NSIA 3EKHA 5D69A 5KU1A 4M2QA 1CTRA 4ZCVA 1IQ3A 3D0YB 1SL8A 3DF0B 2JNXA 1DGUA 3BOWB 1QIWA 4UPGA 4N5XA 4E68A 3VGOA 1TCOB 4NDDA 2BE4A 2CTNA 1F55A 1BR4B 1SKTA 2KSPA 1CDNA 5G08A 2G9BA 2NCOA 1BLQA 1B8RA 1CNPA 3EKJA 2OPOA 3BUNB 1CLMA 5I2QA 2LUCA 1ALWA 3BXKA 1EJ3A 1PULA 4XYNA 3QRXA 1JF2A 4JQ0D 1B1GA 3C1VA 1C7VA 2I2RE 5CSJA 1B7TY 2LM5A 3CR2A 1UHJA 3A4UB 4I5JA 1OOJA 4NQGA 1V1GA 1DMOA 3GK4X 1X02A 1XYDA 3ZNIA 1Y6WA 2LANA 4CFRA 1CFPA 1TNPA 2LVKA 1M63B 1G33A 2MJWB 2WOSA 1QJTA 1YTZC 4DCKA 1BODA 1XFYO 1YRTB 1F71A 3I5GB 1FI6A 1AHRA 1G8IA 1CDPA 1F4OA 1L2OC 1A75A 2PASA 1BT6A 2JT8A 3K21A 1VRKA 2K7DA 5ER5A 1WRZA 1XFVO 3CR5X 1NUBA 2KI4C 1AK8A 3CS1A 2R2IA 5JJGA 2JXLA 2VRGA 4NDCA 1F8HA 3KHEA 3VROA 1R6PA 1JUOA 3TUYB 1NIWA 2Y5IA 1RTP1 2RGIA 1QV0A 2JOJA 1NX1A 4TNCA 2KAVA 2NLNA 2PALA 2LP2A 3PALA 1SY9A 2AMIA 2F2OA 4AOMA 4YGDB 1SPYA 3BUMB 1CFDA 2L2EA 2M97A 4FTGA 4N1FA 1PK0D 1NSHA 1SCVA 3RLZA 1HT9A 4OVNF 2QPTA 3KO0A 2EC6C 2KAYA 1J7QA 1YUSA 4PE1A 1XFXO 2HF5A 2M1UA 1OMRA 2F3ZA 1RROA 1B4CA 5CSNA 2H61C 1K9UA 4ZCUA 2MLFC 1UHHA 2M7NA 2MLEC 3IF7A 4YRUA 1C07A 1WLZA 2L50A 1XK4A 4XJKB 1K9PA 2M7LA 1TOPA 1J1EA 2KFHA 1K93D 2BKIB 4WQ3A 3SG7A 4QJ5B 1B9AA 2KI4B 1W7JB 5DKRA 1NPQA 1YRUB 4F0ZB 1UURA 1LINA 4PHKA 1K8UA 2EGDA 1IGVA 1MQ1A 2KI6D 2ZNEA 5J3XA 3NSLA 2BCBA 2KNEA 1J7PA 4MRXA 3LL8B 3SJSA 3D0YA 1S6IA 3I5HB 1PSRA 3VRPA 1R2UA 2ZFDA 3FIAA 2F2PA 3A8RA 2BCXA 1PVAA 2KOTA 3SG2A 3SG6A 1KK7Y 2A4JA 1KQVA 1RECA 3EK8A 4YGAA 1QVIY 1SBJA 3BYAA 3LK0A 1XO5A 3FWCA 1TNWA 3PATA 5HKYA 3OB1B 1OSAA 5I2OA 3NSOA 1JWDA 2WCEA 1NX0A 2WC8A 3DVKA 4DRWA 2MAZA 2LHIA 3TDUA 1QIVA 1ZACA 4CFQA 1Y1AA 1OE9B 1SR6B 1ALVA 1MUXA 1OMVA 1U5IB 2LMUA 5DKNA 5CPVA 1BG1A 1KFXL 1RWYA 2D8NA 2ZRSA 1S36A 2E30A 2BECA 1NCZA 3JVTC 1DTLA 1CDLA 1SK6D 4PE0A 4AQJA 1Y1UA 2LE9B 4YGEB 3WHUB 5HYDA 1PRWA 1YVHA 1YVLA 1MHOA 5AXIA 1JC2A 1DF0B 4GAOA 1CM1A 1M45A 1M46A 4MBEA 2Y1MA 3I5FC 1QV1A 3WHTB 3SIBA 1BOCA 2Q4UA 5KTYA 1F70A 1K95A 1QX7A 1WDCC 4HSZA 2FJUB 1TN4A 3CLNA 4OR9B 1DT7B 1FF1A 1LKJA 1Q80A 1DJZA 5ER4X 1KK8C 4R1EA 3VRNA 3HX4A 3PFVA 1DJHA 5AANA 1QLKA 1GGZA 2BL0B 4MN0A 1CDMA 2JPTA 1JBAA 1NCXA 1SL7A 1NP8A 4L9MA 1H8BA 1F54A 2BBNA 2F8PA 1AUIB 1K9KA 1B7TZ 2H2KA 3DVEA 1JFKA 1CFFA 1UHNA 3JTDC 3NSKA 3O2PA 5PALA 3JVTB 2BKHB 1TNXA 3OX6A 1N0YA 1XA5A 1SW8A 1S6CA 3WXAA 1SNLA 3AKAA 2JT3A 1FPWA 1SL9A 2LMVA 5IBWA 4OCIA 1BJFA 2KFGA 2ZRTA 3IQQA 1WDCB 1KSMA 2CT9A 2NCPA 1S5GY 1ZOTB 2B1UA 3RM1A 2MHHA 1IG5A 2LC5A 1KK8B 4P2YB 2JU0A 4PDZA 2MBXA 2JT0A 1D1OA 1UUSA 2JQ6A 2CBLA 2BCAA 2LCPA 2PRUA 1KFUL 1RK9A 3BUWB 2K7BA 1DJIA 1QATA 2ZKMX 1CB1A 4OV2A 1B8CA 1IQ5A 2AAOA 5HKWA 1KCYA 2PMYA 2NXQA 3JTDB 4MRYA 4GGFA 1MXLC 2LLUA 3SG3A 4MZLA 2L4HA 4MSPA 4GUKA 4U8DA 1NCYA 5D7FA 1L2OB 1YURA 3PLFB 5DKQA 2O5GA 2LVJA 3I5IC 1Y0VH 1CLLA 2K2FA 3OB2B 3MSEB 1LA3A 1WY9A 1AJ5A 1DVIA 1RFJA 2JNFA 4GGFC 4C0KA 2K8MB 1BU3A 3BQ3A 2LHLA 3ICBA 1A03A 3VRQA 2EHBA 1F4QA 2F33A 2KYCA 2LLTA 1XVJA 1A75B 2ZN8A 4YGCB 3GOFA 1YX8A 1XK4C 3AKBA 4YGBB 2P6BB 4ORCB 1OZOA 1AP4A 1YUTA 2LV7A 2K0JA 3DF0A 3HCMA 3KF9A 4CIDA 2DOQA 3BOWA 4M2OA 5HLVA 2KAXA 3FS7A 2EC6B 3O6BA 4GBAA 3LK1A 1QLSA 1M31A 1IKUA 2JRFA 1ZFSA 5CSFA 2LVVA 4ICBA 1KWOC 4PHMA 1KK7Z 4YBHB 3GK2A 1ODBA 3PSRA 1QVIZ 5TNCA 3AAJA 1K94A 4GGNA 4DS7A 5BPJA 2AUCA 2HQ8A 4MVFA 1IH0A 4P5OE 4PALA 4USLA 3VRRA 4JPZB 4AQIA 2M49B 4MLWA 2IS9A 1OMDA 1FBVA 3CZTX 1TTXA 3KPXA 3FWBA 5B8IB 5GQQC 2KFFA 4Q04A 1A29A 3SG4A 5KSZA 1MWNA 1G4YR 1KSOA 1UWOA 1NWDA 1OQPA 1UP5A 1B47A 2MA2A 4CPVA 1IJ5A 4PHNA 2V53A 5I2LA 2KI6C 2JXCA 1KFXS 3LCPC 1GJYA 1IWQA 2OTGC 1J7RA 1RJVA 4HRHA 1TIZA 2JWWA 3KEVA 1KWOB 1KQMC 1UHKA 2F3YA 3M0WA 3EVRA 5JOLA 4WRIA 4M2PA 4CLNA 1CMGA 1JF0A 1OZSA 1SYMA 2L4IA 2Y1NA 2MRDA 3H4SE 1CM4A 2M0RA 3OX5A 2KGRA 2WORA 1SMGA 5HKZA 1GQMA 4YI8A 1DJYA 1EXRA 2I94A 3E3RA 1V1FA 2FCEA 3TS5C 2L0PA 3I5GC 2COLB 1LXFC 1AJ4A 4MZJA 5AEQA 1JFJA 3CTNA 1ZUZA 2OS8C 4YI9A 1NYAA 2BE6A 3AAKA 4HRGA 1BR1B 1N65A 4QJ4B 1QX5B 1XFUO 4OKHA 4C0LA 2JTTA 2HETA 2M8UA 4HREE 2JTZA 1JSAA 3TDIA 1YX7A 3DD4A 1QS7A
chains in the Genus database with same CATH superfamily
1UHIA 3LLEA 2KQ6A 3GK1A 2KYFA 1B8LA 1NX3A 2CNPA 2FOTA 2M3WA 2K61A 2TN4A 2JZIA 3I5FB 4GNKB 1L7ZA 2ERBA 3S0DA 3TUYC 2OTGB 1W7IB 3DVMA 4NDBA 4D1EA 1MR8A 4GPLB 4XJKA 2K2AA 1KQMB 3SG5A 2KDHA 2NZ0A 3WNXB 2ZNDA 1IIOA 1XFWO 3NHIA 1S5GZ 1EH2A 2L98A 1H4BA 2ISDA 3TS5B 1QTXA 3O4YA 1S26D 3DVJA 3EVVA 1N2DA 1LVCD 5AFPA 4A4BA 2OS8B 3TZ1A 2KLDA 2KHNA 2QACA 4IL1A 4N1GA 3QMEA 1YUUA 1HQVA 1T14A 1CMFA 2KBIA 1XFZO 4I5NB 5CSIA 1GM0A 2WNDA 1Y1XA 1QX2A 2WCLA 3S0GA 1KFUS 1FI5A 1OOFA 2LUXA 3RZSA 1AVSA 1GGWA 1FW4A 1MF8B 3PJIA 3B87A 2M9GA 1MXEA 2K7CA 2H61A 2GGZA 3EK4A 2HPSA 4QJ3B 4PCWA 3CABA 4ETOA 1WRLA 3EK7A 4PE4A 3PM8A 1NX2A 1QXPA 1TCFA 2CXJA 1S3PA 2GV5A 2JULA 2Y4QA 3OBVA 1SCMC 2FJYA 3BUXB 1BF5A 1A2XA 3NGVA 1M39A 2K7OA 1WLMA 2I18A 2P71A 3I5HC 1IJ6A 3PM2A 4ORAB 1OW4A 2I7AA 2KPHA 2O60A 3DY9A 1E8AA 3CGAA 1DC1A 3D75A 4BY5A 1ZMZA 5FYXA 1PALA 1J1DA 2KGBC 1PSBA 2L51A 1U5IA 3PN7C 3B86A 2WCBA 1PVBA 1EG3A 2G2BA 2LVIA 4WQ2A 1DJGA 2KLEA 2ZN9A 4PE7A 3SIAA 3OHMB 1SRAA 1EL4A 4I5LB 1Z4HA 5K89A 1CKKA 1J7OA 4JWQA 1K2HA 3EVUA 2KQYA 4GFTA 5F6TA 2LMTA 1DJWA 1BMOA 2K60A 5FI6A 1DF0A 2SASA 4BY4A 1YR5A 1CFCA 3I5IB 1C7WA 1SR6C 2PSRA 2L5XB 2LP3A 3BFBA 1EG4A 2Q91A 3L4LA 2JC2A 3TDZA 1CLBA 2HQWA 1TNQA 2GGMA 1SCMB 2WCFA 2LNKA 2CCMA 1WRKA 5D3OA 4FQOA 3CR4X 1S1EA 4DUQA 5I8NA 4PHJA 4DIRA 1DGVA 5HLOA 1J55A 4C0JA 1Z2CB 1TRFA 1S6JA 1K96A 3O78A 2KBMA 1LA0A 1DJXA 2M29A 4A4CA 2E6WA 3PN7B 4I5KA 5AERA 2M1KB 1IRJA 2LLSA 2LAPA 3BUOB 3NXAA 4MEWA 1OOHA 1QASA 2BBMA 3F45A 3IQOA 3D10A 3OP0A 4ORBB 2SCPA 3VB1A 3ZWHA 4MZKA 5I94A 1A4PA 2BL0C 2FCDA 1K90D 2PVBA 3CWGA 3NSIA 3EG5B 5FI2A 3EKHA 2WC6A 3FE9A 5D69A 5KU1A 4M2QA 1CTRA 4ZCVA 1IQ3A 3D0YB 1SL8A 3DF0B 2JNXA 1DGUA 3BOWB 1QIWA 1TUJA 2QEHA 3O4XA 3CYZA 4UPGA 4N5XA 4E68A 3VGOA 1TCOB 4NDDA 4OZDA 2BE4A 2CTNA 1F55A 1BR4B 1SKTA 2KSPA 1CDNA 2PQLA 5G08A 2G9BA 2NCOA 1BLQA 3UO9A 1B8RA 1CNPA 3EKJA 3L47A 2OPOA 3BUNB 1CLMA 5I2QA 2LUCA 1ALWA 3BXKA 1EJ3A 1PULA 4XYNA 3QRXA 1JF2A 3R1OA 4JQ0D 1B1GA 3C1VA 1C7VA 2I2RE 5CSJA 1B7TY 2LM5A 1SSEB 3CR2A 1UHJA 3A4UB 4I5JA 1OOJA 4NQGA 1V1GA 5HL1A 3CZ1A 3GK4X 1DMOA 1X02A 3BFAA 1XYDA 3ZNIA 1Y6WA 2LANA 4CFRA 4FQTA 1CFPA 1TNPA 2LVKA 1M63B 1G33A 3BFHA 2MJWB 2QEVA 2WOSA 3D77A 1QJTA 1YTZC 4DCKA 1BODA 1XFYO 1YRTB 1F71A 3I5GB 1FI6A 1AHRA 1G8IA 1CDPA 1F4OA 1L2OC 3SS5A 1A75A 2PASA 1BT6A 2JT8A 3K21A 1VRKA 2K7DA 5ER5A 1WRZA 1XFVO 1TUZA 3CR5X 4F7FA 1NUBA 4JD9A 1TWOA 2KI4C 3UNWA 3CS1A 1AK8A 2R2IA 5JJGA 2JXLA 2VRGA 4NDCA 1F8HA 3KHEA 3VROA 1R6PA 1JUOA 3TUYB 3OGNA 1NIWA 2Y5IA 1RTP1 2RGIA 1QV0A 2JOJA 1NX1A 4TNCA 2KAVA 2NLNA 2PALA 2LP2A 3PALA 1SY9A 2AMIA 2F2OA 4AOMA 4YGDB 1SPYA 2L2CA 3BUMB 1CFDA 2L2EA 2M97A 4FTGA 4N1FA 1PK0D 1NSHA 1SCVA 3RLZA 1HT9A 4OVNF 2QPTA 3KO0A 2EC6C 3D73A 1LS8A 2KAYA 1YUSA 1J7QA 4PE1A 1XFXO 2HF5A 2M1UA 1OMRA 2F3ZA 3S0EA 1RROA 1B4CA 3DYEA 2H61C 1K9UA 5CSNA 4ZCUA 2MLFC 1UHHA 2M7NA 2MLEC 3IF7A 4YRUA 1C07A 1WLZA 2L50A 1XK4A 4XJKB 1K9PA 2M7LA 1TOPA 1J1EA 3SS4A 2KFHA 1K93D 2BKIB 1W9ZA 4WQ3A 3IVTA 4JKTA 3SG7A 4QJ5B 1B9AA 2KI4B 1W7JB 5DKRA 1NPQA 1YRUB 4F0ZB 1UURA 1LINA 4PHKA 1BG1A 1K8UA 5EL2A 2EGDA 1IGVA 1MQ1A 2KI6D 2ZNEA 5J3XA 3NSLA 2BCBA 2KNEA 1J7PA 4MRXA 3LL8B 3SJSA 3D0YA 1S6IA 3I5HB 1PSRA 3VRPA 1R2UA 2ZFDA 3FIAA 2F2PA 3A8RA 4INXA 2BCXA 1PVAA 2KOTA 3SG2A 3SG6A 1KK7Y 2A4JA 2H8VA 1KQVA 3D74A 1RECA 3EK8A 4YGAA 1QVIY 1ORGA 1SBJA 3BYAA 3LK0A 2WCJA 1XO5A 2GTEA 3FWCA 1TNWA 3PATA 5HKYA 3OB1B 1OSAA 5I2OA 3NSOA 1JWDA 2WCEA 1NX0A 2WC8A 3DVKA 4DRWA 2MAZA 2QDIA 2LHIA 3TDUA 1QIVA 1ZACA 4CFQA 1DELA 1Y1AA 1OE9B 1SR6B 1ALVA 1MUXA 1OMVA 1U5IB 2LMUA 3DXLA 5CPVA 5DKNA 1KFXL 1RWYA 3Q8IA 2D8NA 3B7AA 2ZRSA 1S36A 2E30A 2BECA 1NCZA 3JVTC 1DTLA 1CDLA 1SK6D 4PE0A 4AQJA 1Y1UA 2LE9B 4YGEB 3WHUB 5HYDA 1PRWA 1YVHA 1YVLA 1MHOA 5AXIA 1JC2A 1DF0B 4GAOA 1CM1A 3V2LA 1M45A 1M46A 4MBEA 2Y1MA 3I5FC 1QV1A 3WHTB 3SIBA 1BOCA 2Q4UA 5KTYA 1F70A 1K95A 1QX7A 1WDCC 4HSZA 4KYNA 2FJUB 1TN4A 3CLNA 4PT1A 1P28A 4OR9B 4INWA 1DT7B 1FF1A 1LKJA 1Q80A 1DJZA 5ER4X 1KK8C 2WC5A 4R1EA 3VRNA 3HX4A 3PFVA 1DJHA 5AANA 1QLKA 1GGZA 2BL0B 4MN0A 3BJHA 1CDMA 2JPTA 3D78A 1NCXA 1SL7A 1JBAA 1NP8A 4L9MA 1H8BA 1F54A 2BBNA 2F8PA 1AUIB 1K9KA 1B7TZ 2H2KA 3DVEA 1JFKA 1CFFA 1UHNA 3JTDC 3NSKA 3O2PA 5PALA 3JVTB 2BKHB 1TNXA 3OX6A 1N0YA 1XA5A 1XFRA 1SW8A 3NHTA 1S6CA 3WXAA 2BNXA 1SNLA 3AKAA 2JT3A 1FPWA 1SL9A 2LMVA 5IBWA 4OCIA 1BJFA 2KFGA 3SS3A 2ZRTA 3IQQA 1WDCB 2JPOA 1KSMA 2CT9A 2NCPA 1S5GY 1ZOTB 2B1UA 3RM1A 2MHHA 1IG5A 2LC5A 1KK8B 4P2YB 2JU0A 4PDZA 2MBXA 2JT0A 1D1OA 1UUSA 2JQ6A 2CBLA 3S0FA 2BCAA 2LCPA 2PRUA 1KFUL 1RK9A 3BUWB 2K7BA 1DJIA 1QATA 2ZKMX 3N7HA 1CB1A 5DICA 4OV2A 1B8CA 1IQ5A 2AAOA 5HKWA 1KCYA 3K1EA 2PMYA 2NXQA 3JTDB 4MRYA 1QWVA 4GGFA 1MXLC 2LLUA 3SG3A 4MZLA 2L4HA 4MSPA 4GUKA 4U8DA 1NCYA 5D7FA 1L2OB 1YURA 3FE8A 3CZ0A 3DZTA 3PLFB 1C3ZA 2O5GA 5DKQA 2LVJA 3I5IC 1Y0VH 1CLLA 2K2FA 3OB2B 3R1PA 3MSEB 1LA3A 2QEBA 1WY9A 3L4AA 1AJ5A 1DQEA 1DVIA 1RFJA 2JNFA 4GGFC 4C0KA 3CZ2A 3B6XA 2K8MB 1BU3A 3BQ3A 2LHLA 3D76A 3ICBA 1A03A 3R72A 2EHBA 1F4QA 2F33A 2KYCA 2LLTA 2WCHA 1XVJA 3VRQA 1A75B 2ZN8A 4YGCB 3GOFA 1YX8A 1XK4C 1DEKA 3AKBA 4YGBB 2P6BB 4ORCB 1OZOA 1AP4A 1C3YA 1YUTA 2LV7A 2K0JA 3FE6A 3DF0A 3HCMA 3KF9A 4CIDA 2DOQA 3BOWA 3S0AA 4M2OA 2QEOA 5HLVA 2KAXA 3FS7A 2EC6B 3O6BA 4GBAA 3LK1A 1QLSA 1M31A 1IKUA 2L5YA 2JRFA 2P70A 1ZFSA 3R1VA 2WCKA 2YGUA 5CSFA 2LVVA 4ICBA 1KWOC 4PHMA 1KK7Z 4YBHB 3GK2A 1ODBA 3PSRA 1QVIZ 5TNCA 3AAJA 1K94A 4GGNA 4DS7A 5BPJA 2AUCA 2HQ8A 4MVFA 1IH0A 4P5OE 4PALA 4USLA 3VRRA 4JPZB 4AQIA 2M49B 4MLWA 2IS9A 3B88A 1OMDA 1FBVA 3CZTX 1TTXA 3KPXA 3FWBA 5B8IB 3CDNA 5GQQC 2KFFA 5FI7A 4Q04A 1A29A 3SG4A 5KSZA 1MWNA 1G4YR 1KSOA 1UWOA 1NWDA 1OQPA 1UP5A 1B47A 2MA2A 2PYQA 4CPVA 1IJ5A 4PHNA 2V53A 5I2LA 2KI6C 2JXCA 1KFXS 3LCPC 1GJYA 1IWQA 2OTGC 1J7RA 1RJVA 4HRHA 1TIZA 2JWWA 3KEVA 4IJ7A 1KWOB 1KQMC 1UHKA 2F3YA 3M0WA 3EVRA 5JOLA 4WRIA 4M2PA 4CLNA 1CMGA 1JF0A 1OZSA 1SYMA 2L4IA 2Y1NA 3S0BA 2MRDA 3H4SE 1CM4A 1OOIX 2M0RA 3OX5A 2KGRA 2WORA 1SMGA 5HKZA 1GQMA 4YI8A 1DJYA 1EXRA 2I94A 3E3RA 1V1FA 2FCEA 3TS5C 2L0PA 3I5GC 2COLB 1LXFC 1AJ4A 4MZJA 5AEQA 1JFJA 3CTNA 1ZUZA 2OS8C 4YI9A 1NYAA 2BE6A 3AAKA 4HRGA 1BR1B 1N65A 4QJ4B 1QX5B 1XFUO 2BAPA 4OKHA 4C0LA 2WCMA 2JTTA 2HETA 2M8UA 4HREE 2JTZA 1JSAA 3TDIA 1YX7A 3DD4A 1OOGA 1QS7A
chains in the Genus database with same CATH topology
1UHIA 3LLEA 2KQ6A 3GK1A 2KYFA 1B8LA 1NX3A 2CNPA 2FOTA 2M3WA 2K61A 2TN4A 2JZIA 3I5FB 4GNKB 1L7ZA 3TUYC 2OTGB 1W7IB 3DVMA 4NDBA 4D1EA 1MR8A 4GPLB 4XJKA 2K2AA 1KQMB 3SG5A 2KDHA 2NZ0A 3WNXB 2ZNDA 1XFWO 1S5GZ 1EH2A 2L98A 1H4BA 2ISDA 3TS5B 1QTXA 3O4YA 1S26D 3DVJA 3EVVA 1N2DA 1LVCD 5AFPA 4A4BA 2OS8B 3TZ1A 2KHNA 2QACA 4IL1A 4N1GA 1YUUA 1HQVA 1CMFA 2KBIA 1XFZO 4I5NB 5CSIA 2WNDA 1Y1XA 1QX2A 1KFUS 1FI5A 2LUXA 1AVSA 1GGWA 1FW4A 1MF8B 2M9GA 1MXEA 2K7CA 2H61A 2GGZA 3EK4A 2HPSA 4QJ3B 4PCWA 4ETOA 1WRLA 3EK7A 4PE4A 3PM8A 1NX2A 1QXPA 1TCFA 2CXJA 1S3PA 2GV5A 2JULA 2Y4QA 1SCMC 3BUXB 1BF5A 1A2XA 1M39A 2K7OA 1WLMA 2I18A 3I5HC 1IJ6A 4ORAB 2I7AA 2O60A 1E8AA 3CGAA 4BY5A 1ZMZA 5FYXA 1PALA 1J1DA 2KGBC 1PSBA 2L51A 1U5IA 3PN7C 2WCBA 1PVBA 1EG3A 2G2BA 2LVIA 4WQ2A 1DJGA 2ZN9A 4PE7A 3SIAA 3OHMB 1SRAA 1EL4A 4I5LB 5K89A 1CKKA 1J7OA 4JWQA 1K2HA 3EVUA 2KQYA 4GFTA 5F6TA 2LMTA 1DJWA 1BMOA 4BY4A 1DF0A 2SASA 1YR5A 1CFCA 3I5IB 1C7WA 1SR6C 2PSRA 2L5XB 2LP3A 1EG4A 2Q91A 3TDZA 2JC2A 1CLBA 2HQWA 1TNQA 2GGMA 1SCMB 2WCFA 2LNKA 2CCMA 1WRKA 4FQOA 3CR4X 1S1EA 4DUQA 5I8NA 4PHJA 4DIRA 1DGVA 5HLOA 1J55A 4C0JA 1TRFA 1S6JA 1K96A 3O78A 2KBMA 1LA0A 1DJXA 2M29A 4A4CA 2E6WA 3PN7B 4I5KA 5AERA 2M1KB 1IRJA 2LLSA 2LAPA 3BUOB 3NXAA 4MEWA 1QASA 2BBMA 3F45A 3IQOA 3OP0A 3D10A 4ORBB 2SCPA 3ZWHA 4MZKA 1A4PA 2BL0C 2FCDA 1K90D 2PVBA 3CWGA 3NSIA 3EKHA 5D69A 5KU1A 4M2QA 1CTRA 4ZCVA 1IQ3A 3D0YB 1SL8A 3DF0B 2JNXA 1DGUA 3BOWB 1QIWA 4UPGA 4N5XA 4E68A 3VGOA 1TCOB 4NDDA 2BE4A 2CTNA 1F55A 1BR4B 1SKTA 2KSPA 1CDNA 5G08A 2G9BA 2NCOA 1BLQA 1B8RA 1CNPA 3EKJA 2OPOA 3BUNB 1CLMA 5I2QA 2LUCA 1ALWA 3BXKA 1EJ3A 1PULA 4XYNA 3QRXA 1JF2A 4JQ0D 1B1GA 3C1VA 1C7VA 2I2RE 5CSJA 1B7TY 2LM5A 3CR2A 1UHJA 3A4UB 4I5JA 1OOJA 4NQGA 1V1GA 1DMOA 3GK4X 1X02A 1XYDA 3ZNIA 1Y6WA 2LANA 4CFRA 1CFPA 1TNPA 2LVKA 1M63B 1G33A 2MJWB 2WOSA 1QJTA 1YTZC 4DCKA 1BODA 1XFYO 1YRTB 1F71A 3I5GB 1FI6A 1AHRA 1G8IA 1CDPA 1F4OA 1L2OC 1A75A 2PASA 1BT6A 2JT8A 3K21A 1VRKA 2K7DA 5ER5A 1WRZA 1XFVO 3CR5X 1NUBA 2KI4C 1AK8A 3CS1A 2R2IA 5JJGA 2JXLA 2VRGA 4NDCA 1F8HA 3KHEA 3VROA 1R6PA 1JUOA 3TUYB 1NIWA 2Y5IA 1RTP1 2RGIA 1QV0A 2JOJA 1NX1A 4TNCA 2KAVA 2NLNA 2PALA 2LP2A 3PALA 1SY9A 2AMIA 2F2OA 4AOMA 4YGDB 1SPYA 3BUMB 1CFDA 2L2EA 2M97A 4FTGA 4N1FA 1PK0D 1NSHA 1SCVA 3RLZA 1HT9A 4OVNF 2QPTA 3KO0A 2EC6C 2KAYA 1J7QA 1YUSA 4PE1A 1XFXO 2HF5A 2M1UA 1OMRA 2F3ZA 1RROA 1B4CA 5CSNA 2H61C 1K9UA 4ZCUA 2MLFC 1UHHA 2M7NA 2MLEC 3IF7A 4YRUA 1C07A 1WLZA 2L50A 1XK4A 4XJKB 1K9PA 2M7LA 1TOPA 1J1EA 2KFHA 1K93D 2BKIB 4WQ3A 3SG7A 4QJ5B 1B9AA 2KI4B 1W7JB 5DKRA 1NPQA 1YRUB 4F0ZB 1UURA 1LINA 4PHKA 1K8UA 2EGDA 1IGVA 1MQ1A 2KI6D 2ZNEA 5J3XA 3NSLA 2BCBA 2KNEA 1J7PA 4MRXA 3LL8B 3SJSA 3D0YA 1S6IA 3I5HB 1PSRA 3VRPA 1R2UA 2ZFDA 3FIAA 2F2PA 3A8RA 2BCXA 1PVAA 2KOTA 3SG2A 3SG6A 1KK7Y 2A4JA 1KQVA 1RECA 3EK8A 4YGAA 1QVIY 1SBJA 3BYAA 3LK0A 1XO5A 3FWCA 1TNWA 3PATA 5HKYA 3OB1B 1OSAA 5I2OA 3NSOA 1JWDA 2WCEA 1NX0A 2WC8A 3DVKA 4DRWA 2MAZA 2LHIA 3TDUA 1QIVA 1ZACA 4CFQA 1Y1AA 1OE9B 1SR6B 1ALVA 1MUXA 1OMVA 1U5IB 2LMUA 5DKNA 5CPVA 1BG1A 1KFXL 1RWYA 2D8NA 2ZRSA 1S36A 2E30A 2BECA 1NCZA 3JVTC 1DTLA 1CDLA 1SK6D 4PE0A 4AQJA 1Y1UA 2LE9B 4YGEB 3WHUB 5HYDA 1PRWA 1YVHA 1YVLA 1MHOA 5AXIA 1JC2A 1DF0B 4GAOA 1CM1A 1M45A 1M46A 4MBEA 2Y1MA 3I5FC 1QV1A 3WHTB 3SIBA 1BOCA 2Q4UA 5KTYA 1F70A 1K95A 1QX7A 1WDCC 4HSZA 2FJUB 1TN4A 3CLNA 4OR9B 1DT7B 1FF1A 1LKJA 1Q80A 1DJZA 5ER4X 1KK8C 4R1EA 3VRNA 3HX4A 3PFVA 1DJHA 5AANA 1QLKA 1GGZA 2BL0B 4MN0A 1CDMA 2JPTA 1JBAA 1NCXA 1SL7A 1NP8A 4L9MA 1H8BA 1F54A 2BBNA 2F8PA 1AUIB 1K9KA 1B7TZ 2H2KA 3DVEA 1JFKA 1CFFA 1UHNA 3JTDC 3NSKA 3O2PA 5PALA 3JVTB 2BKHB 1TNXA 3OX6A 1N0YA 1XA5A 1SW8A 1S6CA 3WXAA 1SNLA 3AKAA 2JT3A 1FPWA 1SL9A 2LMVA 5IBWA 4OCIA 1BJFA 2KFGA 2ZRTA 3IQQA 1WDCB 1KSMA 2CT9A 2NCPA 1S5GY 1ZOTB 2B1UA 3RM1A 2MHHA 1IG5A 2LC5A 1KK8B 4P2YB 2JU0A 4PDZA 2MBXA 2JT0A 1D1OA 1UUSA 2JQ6A 2CBLA 2BCAA 2LCPA 2PRUA 1KFUL 1RK9A 3BUWB 2K7BA 1DJIA 1QATA 2ZKMX 1CB1A 4OV2A 1B8CA 1IQ5A 2AAOA 5HKWA 1KCYA 2PMYA 2NXQA 3JTDB 4MRYA 4GGFA 1MXLC 2LLUA 3SG3A 4MZLA 2L4HA 4MSPA 4GUKA 4U8DA 1NCYA 5D7FA 1L2OB 1YURA 3PLFB 5DKQA 2O5GA 2LVJA 3I5IC 1Y0VH 1CLLA 2K2FA 3OB2B 3MSEB 1LA3A 1WY9A 1AJ5A 1DVIA 1RFJA 2JNFA 4GGFC 4C0KA 2K8MB 1BU3A 3BQ3A 2LHLA 3ICBA 1A03A 3VRQA 2EHBA 1F4QA 2F33A 2KYCA 2LLTA 1XVJA 1A75B 2ZN8A 4YGCB 3GOFA 1YX8A 1XK4C 3AKBA 4YGBB 2P6BB 4ORCB 1OZOA 1AP4A 1YUTA 2LV7A 2K0JA 3DF0A 3HCMA 3KF9A 4CIDA 2DOQA 3BOWA 4M2OA 5HLVA 2KAXA 3FS7A 2EC6B 3O6BA 4GBAA 3LK1A 1QLSA 1M31A 1IKUA 2JRFA 1ZFSA 5CSFA 2LVVA 4ICBA 1KWOC 4PHMA 1KK7Z 4YBHB 3GK2A 1ODBA 3PSRA 1QVIZ 5TNCA 3AAJA 1K94A 4GGNA 4DS7A 5BPJA 2AUCA 2HQ8A 4MVFA 1IH0A 4P5OE 4PALA 4USLA 3VRRA 4JPZB 4AQIA 2M49B 4MLWA 2IS9A 1OMDA 1FBVA 3CZTX 1TTXA 3KPXA 3FWBA 5B8IB 5GQQC 2KFFA 4Q04A 1A29A 3SG4A 5KSZA 1MWNA 1G4YR 1KSOA 1UWOA 1NWDA 1OQPA 1UP5A 1B47A 2MA2A 4CPVA 1IJ5A 4PHNA 2V53A 5I2LA 2KI6C 2JXCA 1KFXS 3LCPC 1GJYA 1IWQA 2OTGC 1J7RA 1RJVA 4HRHA 1TIZA 2JWWA 3KEVA 1KWOB 1KQMC 1UHKA 2F3YA 3M0WA 3EVRA 5JOLA 4WRIA 4M2PA 4CLNA 1CMGA 1JF0A 1OZSA 1SYMA 2L4IA 2Y1NA 2MRDA 3H4SE 1CM4A 2M0RA 3OX5A 2KGRA 2WORA 1SMGA 5HKZA 1GQMA 4YI8A 1DJYA 1EXRA 2I94A 3E3RA 1V1FA 2FCEA 3TS5C 2L0PA 3I5GC 2COLB 1LXFC 1AJ4A 4MZJA 5AEQA 1JFJA 3CTNA 1ZUZA 2OS8C 4YI9A 1NYAA 2BE6A 3AAKA 4HRGA 1BR1B 1N65A 4QJ4B 1QX5B 1XFUO 4OKHA 4C0LA 2JTTA 2HETA 2M8UA 4HREE 2JTZA 1JSAA 3TDIA 1YX7A 3DD4A 1QS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHI A;  3LLE A;  2KQ6 A;  3GK1 A;  2KYF A;  1B8L A;  1NX3 A;  2CNP A;  2FOT A;  2M3W A;  2K61 A;  2TN4 A;  2JZI A;  3I5F B;  4GNK B;  1L7Z A;  3TUY C;  2OTG B;  1W7I B;  3DVM A;  4NDB A;  4D1E A;  1MR8 A;  4GPL B;  4XJK A;  2K2A A;  1KQM B;  3SG5 A;  2KDH A;  2NZ0 A;  3WNX B;  2ZND A;  1XFW O;  1S5G Z;  1EH2 A;  2L98 A;  1H4B A;  2ISD A;  3TS5 B;  1QTX A;  3O4Y A;  1S26 D;  3DVJ A;  3EVV A;  1N2D A;  1LVC D;  5AFP A;  4A4B A;  2OS8 B;  3TZ1 A;  2KHN A;  2QAC A;  4IL1 A;  4N1G A;  1YUU A;  1HQV A;  1CMF A;  2KBI A;  1XFZ O;  4I5N B;  5CSI A;  2WND A;  1Y1X A;  1QX2 A;  1KFU S;  1FI5 A;  2LUX A;  1AVS A;  1GGW A;  1FW4 A;  1MF8 B;  2M9G A;  1MXE A;  2K7C A;  2H61 A;  2GGZ A;  3EK4 A;  2HPS A;  4QJ3 B;  4PCW A;  4ETO A;  1WRL A;  3EK7 A;  4PE4 A;  3PM8 A;  1NX2 A;  1QXP A;  1TCF A;  2CXJ A;  1S3P A;  2GV5 A;  2JUL A;  2Y4Q A;  1SCM C;  3BUX B;  1BF5 A;  1A2X A;  1M39 A;  2K7O A;  1WLM A;  2I18 A;  3I5H C;  1IJ6 A;  4ORA B;  2I7A A;  2O60 A;  1E8A A;  3CGA A;  4BY5 A;  1ZMZ A;  5FYX A;  1PAL A;  1J1D A;  2KGB C;  1PSB A;  2L51 A;  1U5I A;  3PN7 C;  2WCB A;  1PVB A;  1EG3 A;  2G2B A;  2LVI A;  4WQ2 A;  1DJG A;  2ZN9 A;  4PE7 A;  3SIA A;  3OHM B;  1SRA A;  1EL4 A;  4I5L B;  5K89 A;  1CKK A;  1J7O A;  4JWQ A;  1K2H A;  3EVU A;  2KQY A;  4GFT A;  5F6T A;  2LMT A;  1DJW A;  1BMO A;  4BY4 A;  1DF0 A;  2SAS A;  1YR5 A;  1CFC A;  3I5I B;  1C7W A;  1SR6 C;  2PSR A;  2L5X B;  2LP3 A;  1EG4 A;  2Q91 A;  3TDZ A;  2JC2 A;  1CLB A;  2HQW A;  1TNQ A;  2GGM A;  1SCM B;  2WCF A;  2LNK A;  2CCM A;  1WRK A;  4FQO A;  3CR4 X;  1S1E A;  4DUQ A;  5I8N A;  4PHJ A;  4DIR A;  1DGV A;  5HLO A;  1J55 A;  4C0J A;  1TRF A;  1S6J A;  1K96 A;  3O78 A;  2KBM A;  1LA0 A;  1DJX A;  2M29 A;  4A4C A;  2E6W A;  3PN7 B;  4I5K A;  5AER A;  2M1K B;  1IRJ A;  2LLS A;  2LAP A;  3BUO B;  3NXA A;  4MEW A;  1QAS A;  2BBM A;  3F45 A;  3IQO A;  3OP0 A;  3D10 A;  4ORB B;  2SCP A;  3ZWH A;  4MZK A;  1A4P A;  2BL0 C;  2FCD A;  1K90 D;  2PVB A;  3CWG A;  3NSI A;  3EKH A;  5D69 A;  5KU1 A;  4M2Q A;  1CTR A;  4ZCV A;  1IQ3 A;  3D0Y B;  1SL8 A;  3DF0 B;  2JNX A;  1DGU A;  3BOW B;  1QIW A;  4UPG A;  4N5X A;  4E68 A;  3VGO A;  1TCO B;  4NDD A;  2BE4 A;  2CTN A;  1F55 A;  1BR4 B;  1SKT A;  2KSP A;  1CDN A;  5G08 A;  2G9B A;  2NCO A;  1BLQ A;  1B8R A;  1CNP A;  3EKJ A;  2OPO A;  3BUN B;  1CLM A;  5I2Q A;  2LUC A;  1ALW A;  3BXK A;  1EJ3 A;  1PUL A;  4XYN A;  3QRX A;  1JF2 A;  4JQ0 D;  1B1G A;  3C1V A;  1C7V A;  2I2R E;  5CSJ A;  1B7T Y;  2LM5 A;  3CR2 A;  1UHJ A;  3A4U B;  4I5J A;  1OOJ A;  4NQG A;  1V1G A;  1DMO A;  3GK4 X;  1X02 A;  1XYD A;  3ZNI A;  1Y6W A;  2LAN A;  4CFR A;  1CFP A;  1TNP A;  2LVK A;  1M63 B;  1G33 A;  2MJW B;  2WOS A;  1QJT A;  1YTZ C;  4DCK A;  1BOD A;  1XFY O;  1YRT B;  1F71 A;  3I5G B;  1FI6 A;  1AHR A;  1G8I A;  1CDP A;  1F4O A;  1L2O C;  1A75 A;  2PAS A;  1BT6 A;  2JT8 A;  3K21 A;  1VRK A;  2K7D A;  5ER5 A;  1WRZ A;  1XFV O;  3CR5 X;  1NUB A;  2KI4 C;  1AK8 A;  3CS1 A;  2R2I A;  5JJG A;  2JXL A;  2VRG A;  4NDC A;  1F8H A;  3KHE A;  3VRO A;  1R6P A;  1JUO A;  3TUY B;  1NIW A;  2Y5I A;  1RTP 1;  2RGI A;  1QV0 A;  2JOJ A;  1NX1 A;  4TNC A;  2KAV A;  2NLN A;  2PAL A;  2LP2 A;  3PAL A;  1SY9 A;  2AMI A;  2F2O A;  4AOM A;  4YGD B;  1SPY A;  3BUM B;  1CFD A;  2L2E A;  2M97 A;  4FTG A;  4N1F A;  1PK0 D;  1NSH A;  1SCV A;  3RLZ A;  1HT9 A;  4OVN F;  2QPT A;  3KO0 A;  2EC6 C;  2KAY A;  1J7Q A;  1YUS A;  4PE1 A;  1XFX O;  2HF5 A;  2M1U A;  1OMR A;  2F3Z A;  1RRO A;  1B4C A;  5CSN A;  2H61 C;  1K9U A;  4ZCU A;  2MLF C;  1UHH A;  2M7N A;  2MLE C;  3IF7 A;  4YRU A;  1C07 A;  1WLZ A;  2L50 A;  1XK4 A;  4XJK B;  1K9P A;  2M7L A;  1TOP A;  1J1E A;  2KFH A;  1K93 D;  2BKI B;  4WQ3 A;  3SG7 A;  4QJ5 B;  1B9A A;  2KI4 B;  1W7J B;  5DKR A;  1NPQ A;  1YRU B;  4F0Z B;  1UUR A;  1LIN A;  4PHK A;  1K8U A;  2EGD A;  1IGV A;  1MQ1 A;  2KI6 D;  2ZNE A;  5J3X A;  3NSL A;  2BCB A;  2KNE A;  1J7P A;  4MRX A;  3LL8 B;  3SJS A;  3D0Y A;  1S6I A;  3I5H B;  1PSR A;  3VRP A;  1R2U A;  2ZFD A;  3FIA A;  2F2P A;  3A8R A;  2BCX A;  1PVA A;  2KOT A;  3SG2 A;  3SG6 A;  1KK7 Y;  2A4J A;  1KQV A;  1REC A;  3EK8 A;  4YGA A;  1QVI Y;  1SBJ A;  3BYA A;  3LK0 A;  1XO5 A;  3FWC A;  1TNW A;  3PAT A;  5HKY A;  3OB1 B;  1OSA A;  5I2O A;  3NSO A;  1JWD A;  2WCE A;  1NX0 A;  2WC8 A;  3DVK A;  4DRW A;  2MAZ A;  2LHI A;  3TDU A;  1QIV A;  1ZAC A;  4CFQ A;  1Y1A A;  1OE9 B;  1SR6 B;  1ALV A;  1MUX A;  1OMV A;  1U5I B;  2LMU A;  5DKN A;  5CPV A;  1BG1 A;  1KFX L;  1RWY A;  2D8N A;  2ZRS A;  1S36 A;  2E30 A;  2BEC A;  1NCZ A;  3JVT C;  1DTL A;  1CDL A;  1SK6 D;  4PE0 A;  4AQJ A;  1Y1U A;  2LE9 B;  4YGE B;  3WHU B;  5HYD A;  1PRW A;  1YVH A;  1YVL A;  1MHO A;  5AXI A;  1JC2 A;  1DF0 B;  4GAO A;  1CM1 A;  1M45 A;  1M46 A;  4MBE A;  2Y1M A;  3I5F C;  1QV1 A;  3WHT B;  3SIB A;  1BOC A;  2Q4U A;  5KTY A;  1F70 A;  1K95 A;  1QX7 A;  1WDC C;  4HSZ A;  2FJU B;  1TN4 A;  3CLN A;  4OR9 B;  1DT7 B;  1FF1 A;  1LKJ A;  1Q80 A;  1DJZ A;  5ER4 X;  1KK8 C;  4R1E A;  3VRN A;  3HX4 A;  3PFV A;  1DJH A;  5AAN A;  1QLK A;  1GGZ A;  2BL0 B;  4MN0 A;  1CDM A;  2JPT A;  1JBA A;  1NCX A;  1SL7 A;  1NP8 A;  4L9M A;  1H8B A;  1F54 A;  2BBN A;  2F8P A;  1AUI B;  1K9K A;  1B7T Z;  2H2K A;  3DVE A;  1JFK A;  1CFF A;  1UHN A;  3JTD C;  3NSK A;  3O2P A;  5PAL A;  3JVT B;  2BKH B;  1TNX A;  3OX6 A;  1N0Y A;  1XA5 A;  1SW8 A;  1S6C A;  3WXA A;  1SNL A;  3AKA A;  2JT3 A;  1FPW A;  1SL9 A;  2LMV A;  5IBW A;  4OCI A;  1BJF A;  2KFG A;  2ZRT A;  3IQQ A;  1WDC B;  1KSM A;  2CT9 A;  2NCP A;  1S5G Y;  1ZOT B;  2B1U A;  3RM1 A;  2MHH A;  1IG5 A;  2LC5 A;  1KK8 B;  4P2Y B;  2JU0 A;  4PDZ A;  2MBX A;  2JT0 A;  1D1O A;  1UUS A;  2JQ6 A;  2CBL A;  2BCA A;  2LCP A;  2PRU A;  1KFU L;  1RK9 A;  3BUW B;  2K7B A;  1DJI A;  1QAT A;  2ZKM X;  1CB1 A;  4OV2 A;  1B8C A;  1IQ5 A;  2AAO A;  5HKW A;  1KCY A;  2PMY A;  2NXQ A;  3JTD B;  4MRY A;  4GGF A;  1MXL C;  2LLU A;  3SG3 A;  4MZL A;  2L4H A;  4MSP A;  4GUK A;  4U8D A;  1NCY A;  5D7F A;  1L2O B;  1YUR A;  3PLF B;  5DKQ A;  2O5G A;  2LVJ A;  3I5I C;  1Y0V H;  1CLL A;  2K2F A;  3OB2 B;  3MSE B;  1LA3 A;  1WY9 A;  1AJ5 A;  1DVI A;  1RFJ A;  2JNF A;  4GGF C;  4C0K A;  2K8M B;  1BU3 A;  3BQ3 A;  2LHL A;  3ICB A;  1A03 A;  3VRQ A;  2EHB A;  1F4Q A;  2F33 A;  2KYC A;  2LLT A;  1XVJ A;  1A75 B;  2ZN8 A;  4YGC B;  3GOF A;  1YX8 A;  1XK4 C;  3AKB A;  4YGB B;  2P6B B;  4ORC B;  1OZO A;  1AP4 A;  1YUT A;  2LV7 A;  2K0J A;  3DF0 A;  3HCM A;  3KF9 A;  4CID A;  2DOQ A;  3BOW A;  4M2O A;  5HLV A;  2KAX A;  3FS7 A;  2EC6 B;  3O6B A;  4GBA A;  3LK1 A;  1QLS A;  1M31 A;  1IKU A;  2JRF A;  1ZFS A;  5CSF A;  2LVV A;  4ICB A;  1KWO C;  4PHM A;  1KK7 Z;  4YBH B;  3GK2 A;  1ODB A;  3PSR A;  1QVI Z;  5TNC A;  3AAJ A;  1K94 A;  4GGN A;  4DS7 A;  5BPJ A;  2AUC A;  2HQ8 A;  4MVF A;  1IH0 A;  4P5O E;  4PAL A;  4USL A;  3VRR A;  4JPZ B;  4AQI A;  2M49 B;  4MLW A;  2IS9 A;  1OMD A;  1FBV A;  3CZT X;  1TTX A;  3KPX A;  3FWB A;  5B8I B;  5GQQ C;  2KFF A;  4Q04 A;  1A29 A;  3SG4 A;  5KSZ A;  1MWN A;  1G4Y R;  1KSO A;  1UWO A;  1NWD A;  1OQP A;  1UP5 A;  1B47 A;  2MA2 A;  4CPV A;  1IJ5 A;  4PHN A;  2V53 A;  5I2L A;  2KI6 C;  2JXC A;  1KFX S;  3LCP C;  1GJY A;  1IWQ A;  2OTG C;  1J7R A;  1RJV A;  4HRH A;  1TIZ A;  2JWW A;  3KEV A;  1KWO B;  1KQM C;  1UHK A;  2F3Y A;  3M0W A;  3EVR A;  5JOL A;  4WRI A;  4M2P A;  4CLN A;  1CMG A;  1JF0 A;  1OZS A;  1SYM A;  2L4I A;  2Y1N A;  2MRD A;  3H4S E;  1CM4 A;  2M0R A;  3OX5 A;  2KGR A;  2WOR A;  1SMG A;  5HKZ A;  1GQM A;  4YI8 A;  1DJY A;  1EXR A;  2I94 A;  3E3R A;  1V1F A;  2FCE A;  3TS5 C;  2L0P A;  3I5G C;  2COL B;  1LXF C;  1AJ4 A;  4MZJ A;  5AEQ A;  1JFJ A;  3CTN A;  1ZUZ A;  2OS8 C;  4YI9 A;  1NYA A;  2BE6 A;  3AAK A;  4HRG A;  1BR1 B;  1N65 A;  4QJ4 B;  1QX5 B;  1XFU O;  4OKH A;  4C0L A;  2JTT A;  2HET A;  2M8U A;  4HRE E;  2JTZ A;  1JSA A;  3TDI A;  1YX7 A;  3DD4 A;  1QS7 A; 
#chains in the Genus database with same CATH topology
 1UHI A;  3LLE A;  2KQ6 A;  3GK1 A;  2KYF A;  1B8L A;  1NX3 A;  2CNP A;  2FOT A;  2M3W A;  2K61 A;  2TN4 A;  2JZI A;  3I5F B;  4GNK B;  1L7Z A;  2ERB A;  3S0D A;  3TUY C;  2OTG B;  1W7I B;  3DVM A;  4NDB A;  4D1E A;  1MR8 A;  4GPL B;  4XJK A;  2K2A A;  1KQM B;  3SG5 A;  2KDH A;  2NZ0 A;  3WNX B;  2ZND A;  1IIO A;  1XFW O;  3NHI A;  1S5G Z;  1EH2 A;  2L98 A;  1H4B A;  2ISD A;  3TS5 B;  1QTX A;  3O4Y A;  1S26 D;  3DVJ A;  3EVV A;  1N2D A;  1LVC D;  5AFP A;  4A4B A;  2OS8 B;  3TZ1 A;  2KLD A;  2KHN A;  2QAC A;  4IL1 A;  4N1G A;  3QME A;  1YUU A;  1HQV A;  1T14 A;  1CMF A;  2KBI A;  1XFZ O;  4I5N B;  5CSI A;  1GM0 A;  2WND A;  1Y1X A;  1QX2 A;  2WCL A;  3S0G A;  1KFU S;  1FI5 A;  1OOF A;  2LUX A;  3RZS A;  1AVS A;  1GGW A;  1FW4 A;  1MF8 B;  3PJI A;  3B87 A;  2M9G A;  1MXE A;  2K7C A;  2H61 A;  2GGZ A;  3EK4 A;  2HPS A;  4QJ3 B;  4PCW A;  3CAB A;  4ETO A;  1WRL A;  3EK7 A;  4PE4 A;  3PM8 A;  1NX2 A;  1QXP A;  1TCF A;  2CXJ A;  1S3P A;  2GV5 A;  2JUL A;  2Y4Q A;  3OBV A;  1SCM C;  2FJY A;  3BUX B;  1BF5 A;  1A2X A;  3NGV A;  1M39 A;  2K7O A;  1WLM A;  2I18 A;  2P71 A;  3I5H C;  1IJ6 A;  3PM2 A;  4ORA B;  1OW4 A;  2I7A A;  2KPH A;  2O60 A;  3DY9 A;  1E8A A;  3CGA A;  1DC1 A;  3D75 A;  4BY5 A;  1ZMZ A;  5FYX A;  1PAL A;  1J1D A;  2KGB C;  1PSB A;  2L51 A;  1U5I A;  3PN7 C;  3B86 A;  2WCB A;  1PVB A;  1EG3 A;  2G2B A;  2LVI A;  4WQ2 A;  1DJG A;  2KLE A;  2ZN9 A;  4PE7 A;  3SIA A;  3OHM B;  1SRA A;  1EL4 A;  4I5L B;  1Z4H A;  5K89 A;  1CKK A;  1J7O A;  4JWQ A;  1K2H A;  3EVU A;  2KQY A;  4GFT A;  5F6T A;  2LMT A;  1DJW A;  1BMO A;  2K60 A;  5FI6 A;  1DF0 A;  2SAS A;  4BY4 A;  1YR5 A;  1CFC A;  3I5I B;  1C7W A;  1SR6 C;  2PSR A;  2L5X B;  2LP3 A;  3BFB A;  1EG4 A;  2Q91 A;  3L4L A;  2JC2 A;  3TDZ A;  1CLB A;  2HQW A;  1TNQ A;  2GGM A;  1SCM B;  2WCF A;  2LNK A;  2CCM A;  1WRK A;  5D3O A;  4FQO A;  3CR4 X;  1S1E A;  4DUQ A;  5I8N A;  4PHJ A;  4DIR A;  1DGV A;  5HLO A;  1J55 A;  4C0J A;  1Z2C B;  1TRF A;  1S6J A;  1K96 A;  3O78 A;  2KBM A;  1LA0 A;  1DJX A;  2M29 A;  4A4C A;  2E6W A;  3PN7 B;  4I5K A;  5AER A;  2M1K B;  1IRJ A;  2LLS A;  2LAP A;  3BUO B;  3NXA A;  4MEW A;  1OOH A;  1QAS A;  2BBM A;  3F45 A;  3IQO A;  3D10 A;  3OP0 A;  4ORB B;  2SCP A;  3VB1 A;  3ZWH A;  4MZK A;  5I94 A;  1A4P A;  2BL0 C;  2FCD A;  1K90 D;  2PVB A;  3CWG A;  3NSI A;  3EG5 B;  5FI2 A;  3EKH A;  2WC6 A;  3FE9 A;  5D69 A;  5KU1 A;  4M2Q A;  1CTR A;  4ZCV A;  1IQ3 A;  3D0Y B;  1SL8 A;  3DF0 B;  2JNX A;  1DGU A;  3BOW B;  1QIW A;  1TUJ A;  2QEH A;  3O4X A;  3CYZ A;  4UPG A;  4N5X A;  4E68 A;  3VGO A;  1TCO B;  4NDD A;  4OZD A;  2BE4 A;  2CTN A;  1F55 A;  1BR4 B;  1SKT A;  2KSP A;  1CDN A;  2PQL A;  5G08 A;  2G9B A;  2NCO A;  1BLQ A;  3UO9 A;  1B8R A;  1CNP A;  3EKJ A;  3L47 A;  2OPO A;  3BUN B;  1CLM A;  5I2Q A;  2LUC A;  1ALW A;  3BXK A;  1EJ3 A;  1PUL A;  4XYN A;  3QRX A;  1JF2 A;  3R1O A;  4JQ0 D;  1B1G A;  3C1V A;  1C7V A;  2I2R E;  5CSJ A;  1B7T Y;  2LM5 A;  1SSE B;  3CR2 A;  1UHJ A;  3A4U B;  4I5J A;  1OOJ A;  4NQG A;  1V1G A;  5HL1 A;  3CZ1 A;  3GK4 X;  1DMO A;  1X02 A;  3BFA A;  1XYD A;  3ZNI A;  1Y6W A;  2LAN A;  4CFR A;  4FQT A;  1CFP A;  1TNP A;  2LVK A;  1M63 B;  1G33 A;  3BFH A;  2MJW B;  2QEV A;  2WOS A;  3D77 A;  1QJT A;  1YTZ C;  4DCK A;  1BOD A;  1XFY O;  1YRT B;  1F71 A;  3I5G B;  1FI6 A;  1AHR A;  1G8I A;  1CDP A;  1F4O A;  1L2O C;  3SS5 A;  1A75 A;  2PAS A;  1BT6 A;  2JT8 A;  3K21 A;  1VRK A;  2K7D A;  5ER5 A;  1WRZ A;  1XFV O;  1TUZ A;  3CR5 X;  4F7F A;  1NUB A;  4JD9 A;  1TWO A;  2KI4 C;  3UNW A;  3CS1 A;  1AK8 A;  2R2I A;  5JJG A;  2JXL A;  2VRG A;  4NDC A;  1F8H A;  3KHE A;  3VRO A;  1R6P A;  1JUO A;  3TUY B;  3OGN A;  1NIW A;  2Y5I A;  1RTP 1;  2RGI A;  1QV0 A;  2JOJ A;  1NX1 A;  4TNC A;  2KAV A;  2NLN A;  2PAL A;  2LP2 A;  3PAL A;  1SY9 A;  2AMI A;  2F2O A;  4AOM A;  4YGD B;  1SPY A;  2L2C A;  3BUM B;  1CFD A;  2L2E A;  2M97 A;  4FTG A;  4N1F A;  1PK0 D;  1NSH A;  1SCV A;  3RLZ A;  1HT9 A;  4OVN F;  2QPT A;  3KO0 A;  2EC6 C;  3D73 A;  1LS8 A;  2KAY A;  1YUS A;  1J7Q A;  4PE1 A;  1XFX O;  2HF5 A;  2M1U A;  1OMR A;  2F3Z A;  3S0E A;  1RRO A;  1B4C A;  3DYE A;  2H61 C;  1K9U A;  5CSN A;  4ZCU A;  2MLF C;  1UHH A;  2M7N A;  2MLE C;  3IF7 A;  4YRU A;  1C07 A;  1WLZ A;  2L50 A;  1XK4 A;  4XJK B;  1K9P A;  2M7L A;  1TOP A;  1J1E A;  3SS4 A;  2KFH A;  1K93 D;  2BKI B;  1W9Z A;  4WQ3 A;  3IVT A;  4JKT A;  3SG7 A;  4QJ5 B;  1B9A A;  2KI4 B;  1W7J B;  5DKR A;  1NPQ A;  1YRU B;  4F0Z B;  1UUR A;  1LIN A;  4PHK A;  1BG1 A;  1K8U A;  5EL2 A;  2EGD A;  1IGV A;  1MQ1 A;  2KI6 D;  2ZNE A;  5J3X A;  3NSL A;  2BCB A;  2KNE A;  1J7P A;  4MRX A;  3LL8 B;  3SJS A;  3D0Y A;  1S6I A;  3I5H B;  1PSR A;  3VRP A;  1R2U A;  2ZFD A;  3FIA A;  2F2P A;  3A8R A;  4INX A;  2BCX A;  1PVA A;  2KOT A;  3SG2 A;  3SG6 A;  1KK7 Y;  2A4J A;  2H8V A;  1KQV A;  3D74 A;  1REC A;  3EK8 A;  4YGA A;  1QVI Y;  1ORG A;  1SBJ A;  3BYA A;  3LK0 A;  2WCJ A;  1XO5 A;  2GTE A;  3FWC A;  1TNW A;  3PAT A;  5HKY A;  3OB1 B;  1OSA A;  5I2O A;  3NSO A;  1JWD A;  2WCE A;  1NX0 A;  2WC8 A;  3DVK A;  4DRW A;  2MAZ A;  2QDI A;  2LHI A;  3TDU A;  1QIV A;  1ZAC A;  4CFQ A;  1DEL A;  1Y1A A;  1OE9 B;  1SR6 B;  1ALV A;  1MUX A;  1OMV A;  1U5I B;  2LMU A;  3DXL A;  5CPV A;  5DKN A;  1KFX L;  1RWY A;  3Q8I A;  2D8N A;  3B7A A;  2ZRS A;  1S36 A;  2E30 A;  2BEC A;  1NCZ A;  3JVT C;  1DTL A;  1CDL A;  1SK6 D;  4PE0 A;  4AQJ A;  1Y1U A;  2LE9 B;  4YGE B;  3WHU B;  5HYD A;  1PRW A;  1YVH A;  1YVL A;  1MHO A;  5AXI A;  1JC2 A;  1DF0 B;  4GAO A;  1CM1 A;  3V2L A;  1M45 A;  1M46 A;  4MBE A;  2Y1M A;  3I5F C;  1QV1 A;  3WHT B;  3SIB A;  1BOC A;  2Q4U A;  5KTY A;  1F70 A;  1K95 A;  1QX7 A;  1WDC C;  4HSZ A;  4KYN A;  2FJU B;  1TN4 A;  3CLN A;  4PT1 A;  1P28 A;  4OR9 B;  4INW A;  1DT7 B;  1FF1 A;  1LKJ A;  1Q80 A;  1DJZ A;  5ER4 X;  1KK8 C;  2WC5 A;  4R1E A;  3VRN A;  3HX4 A;  3PFV A;  1DJH A;  5AAN A;  1QLK A;  1GGZ A;  2BL0 B;  4MN0 A;  3BJH A;  1CDM A;  2JPT A;  3D78 A;  1NCX A;  1SL7 A;  1JBA A;  1NP8 A;  4L9M A;  1H8B A;  1F54 A;  2BBN A;  2F8P A;  1AUI B;  1K9K A;  1B7T Z;  2H2K A;  3DVE A;  1JFK A;  1CFF A;  1UHN A;  3JTD C;  3NSK A;  3O2P A;  5PAL A;  3JVT B;  2BKH B;  1TNX A;  3OX6 A;  1N0Y A;  1XA5 A;  1XFR A;  1SW8 A;  3NHT A;  1S6C A;  3WXA A;  2BNX A;  1SNL A;  3AKA A;  2JT3 A;  1FPW A;  1SL9 A;  2LMV A;  5IBW A;  4OCI A;  1BJF A;  2KFG A;  3SS3 A;  2ZRT A;  3IQQ A;  1WDC B;  2JPO A;  1KSM A;  2CT9 A;  2NCP A;  1S5G Y;  1ZOT B;  2B1U A;  3RM1 A;  2MHH A;  1IG5 A;  2LC5 A;  1KK8 B;  4P2Y B;  2JU0 A;  4PDZ A;  2MBX A;  2JT0 A;  1D1O A;  1UUS A;  2JQ6 A;  2CBL A;  3S0F A;  2BCA A;  2LCP A;  2PRU A;  1KFU L;  1RK9 A;  3BUW B;  2K7B A;  1DJI A;  1QAT A;  2ZKM X;  3N7H A;  1CB1 A;  5DIC A;  4OV2 A;  1B8C A;  1IQ5 A;  2AAO A;  5HKW A;  1KCY A;  3K1E A;  2PMY A;  2NXQ A;  3JTD B;  4MRY A;  1QWV A;  4GGF A;  1MXL C;  2LLU A;  3SG3 A;  4MZL A;  2L4H A;  4MSP A;  4GUK A;  4U8D A;  1NCY A;  5D7F A;  1L2O B;  1YUR A;  3FE8 A;  3CZ0 A;  3DZT A;  3PLF B;  1C3Z A;  2O5G A;  5DKQ A;  2LVJ A;  3I5I C;  1Y0V H;  1CLL A;  2K2F A;  3OB2 B;  3R1P A;  3MSE B;  1LA3 A;  2QEB A;  1WY9 A;  3L4A A;  1AJ5 A;  1DQE A;  1DVI A;  1RFJ A;  2JNF A;  4GGF C;  4C0K A;  3CZ2 A;  3B6X A;  2K8M B;  1BU3 A;  3BQ3 A;  2LHL A;  3D76 A;  3ICB A;  1A03 A;  3R72 A;  2EHB A;  1F4Q A;  2F33 A;  2KYC A;  2LLT A;  2WCH A;  1XVJ A;  3VRQ A;  1A75 B;  2ZN8 A;  4YGC B;  3GOF A;  1YX8 A;  1XK4 C;  1DEK A;  3AKB A;  4YGB B;  2P6B B;  4ORC B;  1OZO A;  1AP4 A;  1C3Y A;  1YUT A;  2LV7 A;  2K0J A;  3FE6 A;  3DF0 A;  3HCM A;  3KF9 A;  4CID A;  2DOQ A;  3BOW A;  3S0A A;  4M2O A;  2QEO A;  5HLV A;  2KAX A;  3FS7 A;  2EC6 B;  3O6B A;  4GBA A;  3LK1 A;  1QLS A;  1M31 A;  1IKU A;  2L5Y A;  2JRF A;  2P70 A;  1ZFS A;  3R1V A;  2WCK A;  2YGU A;  5CSF A;  2LVV A;  4ICB A;  1KWO C;  4PHM A;  1KK7 Z;  4YBH B;  3GK2 A;  1ODB A;  3PSR A;  1QVI Z;  5TNC A;  3AAJ A;  1K94 A;  4GGN A;  4DS7 A;  5BPJ A;  2AUC A;  2HQ8 A;  4MVF A;  1IH0 A;  4P5O E;  4PAL A;  4USL A;  3VRR A;  4JPZ B;  4AQI A;  2M49 B;  4MLW A;  2IS9 A;  3B88 A;  1OMD A;  1FBV A;  3CZT X;  1TTX A;  3KPX A;  3FWB A;  5B8I B;  3CDN A;  5GQQ C;  2KFF A;  5FI7 A;  4Q04 A;  1A29 A;  3SG4 A;  5KSZ A;  1MWN A;  1G4Y R;  1KSO A;  1UWO A;  1NWD A;  1OQP A;  1UP5 A;  1B47 A;  2MA2 A;  2PYQ A;  4CPV A;  1IJ5 A;  4PHN A;  2V53 A;  5I2L A;  2KI6 C;  2JXC A;  1KFX S;  3LCP C;  1GJY A;  1IWQ A;  2OTG C;  1J7R A;  1RJV A;  4HRH A;  1TIZ A;  2JWW A;  3KEV A;  4IJ7 A;  1KWO B;  1KQM C;  1UHK A;  2F3Y A;  3M0W A;  3EVR A;  5JOL A;  4WRI A;  4M2P A;  4CLN A;  1CMG A;  1JF0 A;  1OZS A;  1SYM A;  2L4I A;  2Y1N A;  3S0B A;  2MRD A;  3H4S E;  1CM4 A;  1OOI X;  2M0R A;  3OX5 A;  2KGR A;  2WOR A;  1SMG A;  5HKZ A;  1GQM A;  4YI8 A;  1DJY A;  1EXR A;  2I94 A;  3E3R A;  1V1F A;  2FCE A;  3TS5 C;  2L0P A;  3I5G C;  2COL B;  1LXF C;  1AJ4 A;  4MZJ A;  5AEQ A;  1JFJ A;  3CTN A;  1ZUZ A;  2OS8 C;  4YI9 A;  1NYA A;  2BE6 A;  3AAK A;  4HRG A;  1BR1 B;  1N65 A;  4QJ4 B;  1QX5 B;  1XFU O;  2BAP A;  4OKH A;  4C0L A;  2WCM A;  2JTT A;  2HET A;  2M8U A;  4HRE E;  2JTZ A;  1JSA A;  3TDI A;  1YX7 A;  3DD4 A;  1OOG A;  1QS7 A; 
#chains in the Genus database with same CATH homology
 1UHI A;  3LLE A;  2KQ6 A;  3GK1 A;  2KYF A;  1B8L A;  1NX3 A;  2CNP A;  2FOT A;  2M3W A;  2K61 A;  2TN4 A;  2JZI A;  3I5F B;  4GNK B;  1L7Z A;  3TUY C;  2OTG B;  1W7I B;  3DVM A;  4NDB A;  4D1E A;  1MR8 A;  4GPL B;  4XJK A;  2K2A A;  1KQM B;  3SG5 A;  2KDH A;  2NZ0 A;  3WNX B;  2ZND A;  1XFW O;  1S5G Z;  1EH2 A;  2L98 A;  1H4B A;  2ISD A;  3TS5 B;  1QTX A;  3O4Y A;  1S26 D;  3DVJ A;  3EVV A;  1N2D A;  1LVC D;  5AFP A;  4A4B A;  2OS8 B;  3TZ1 A;  2KHN A;  2QAC A;  4IL1 A;  4N1G A;  1YUU A;  1HQV A;  1CMF A;  2KBI A;  1XFZ O;  4I5N B;  5CSI A;  2WND A;  1Y1X A;  1QX2 A;  1KFU S;  1FI5 A;  2LUX A;  1AVS A;  1GGW A;  1FW4 A;  1MF8 B;  2M9G A;  1MXE A;  2K7C A;  2H61 A;  2GGZ A;  3EK4 A;  2HPS A;  4QJ3 B;  4PCW A;  4ETO A;  1WRL A;  3EK7 A;  4PE4 A;  3PM8 A;  1NX2 A;  1QXP A;  1TCF A;  2CXJ A;  1S3P A;  2GV5 A;  2JUL A;  2Y4Q A;  1SCM C;  3BUX B;  1BF5 A;  1A2X A;  1M39 A;  2K7O A;  1WLM A;  2I18 A;  3I5H C;  1IJ6 A;  4ORA B;  2I7A A;  2O60 A;  1E8A A;  3CGA A;  4BY5 A;  1ZMZ A;  5FYX A;  1PAL A;  1J1D A;  2KGB C;  1PSB A;  2L51 A;  1U5I A;  3PN7 C;  2WCB A;  1PVB A;  1EG3 A;  2G2B A;  2LVI A;  4WQ2 A;  1DJG A;  2ZN9 A;  4PE7 A;  3SIA A;  3OHM B;  1SRA A;  1EL4 A;  4I5L B;  5K89 A;  1CKK A;  1J7O A;  4JWQ A;  1K2H A;  3EVU A;  2KQY A;  4GFT A;  5F6T A;  2LMT A;  1DJW A;  1BMO A;  4BY4 A;  1DF0 A;  2SAS A;  1YR5 A;  1CFC A;  3I5I B;  1C7W A;  1SR6 C;  2PSR A;  2L5X B;  2LP3 A;  1EG4 A;  2Q91 A;  3TDZ A;  2JC2 A;  1CLB A;  2HQW A;  1TNQ A;  2GGM A;  1SCM B;  2WCF A;  2LNK A;  2CCM A;  1WRK A;  4FQO A;  3CR4 X;  1S1E A;  4DUQ A;  5I8N A;  4PHJ A;  4DIR A;  1DGV A;  5HLO A;  1J55 A;  4C0J A;  1TRF A;  1S6J A;  1K96 A;  3O78 A;  2KBM A;  1LA0 A;  1DJX A;  2M29 A;  4A4C A;  2E6W A;  3PN7 B;  4I5K A;  5AER A;  2M1K B;  1IRJ A;  2LLS A;  2LAP A;  3BUO B;  3NXA A;  4MEW A;  1QAS A;  2BBM A;  3F45 A;  3IQO A;  3OP0 A;  3D10 A;  4ORB B;  2SCP A;  3ZWH A;  4MZK A;  1A4P A;  2BL0 C;  2FCD A;  1K90 D;  2PVB A;  3CWG A;  3NSI A;  3EKH A;  5D69 A;  5KU1 A;  4M2Q A;  1CTR A;  4ZCV A;  1IQ3 A;  3D0Y B;  1SL8 A;  3DF0 B;  2JNX A;  1DGU A;  3BOW B;  1QIW A;  4UPG A;  4N5X A;  4E68 A;  3VGO A;  1TCO B;  4NDD A;  2BE4 A;  2CTN A;  1F55 A;  1BR4 B;  1SKT A;  2KSP A;  1CDN A;  5G08 A;  2G9B A;  2NCO A;  1BLQ A;  1B8R A;  1CNP A;  3EKJ A;  2OPO A;  3BUN B;  1CLM A;  5I2Q A;  2LUC A;  1ALW A;  3BXK A;  1EJ3 A;  1PUL A;  4XYN A;  3QRX A;  1JF2 A;  4JQ0 D;  1B1G A;  3C1V A;  1C7V A;  2I2R E;  5CSJ A;  1B7T Y;  2LM5 A;  3CR2 A;  1UHJ A;  3A4U B;  4I5J A;  1OOJ A;  4NQG A;  1V1G A;  1DMO A;  3GK4 X;  1X02 A;  1XYD A;  3ZNI A;  1Y6W A;  2LAN A;  4CFR A;  1CFP A;  1TNP A;  2LVK A;  1M63 B;  1G33 A;  2MJW B;  2WOS A;  1QJT A;  1YTZ C;  4DCK A;  1BOD A;  1XFY O;  1YRT B;  1F71 A;  3I5G B;  1FI6 A;  1AHR A;  1G8I A;  1CDP A;  1F4O A;  1L2O C;  1A75 A;  2PAS A;  1BT6 A;  2JT8 A;  3K21 A;  1VRK A;  2K7D A;  5ER5 A;  1WRZ A;  1XFV O;  3CR5 X;  1NUB A;  2KI4 C;  1AK8 A;  3CS1 A;  2R2I A;  5JJG A;  2JXL A;  2VRG A;  4NDC A;  1F8H A;  3KHE A;  3VRO A;  1R6P A;  1JUO A;  3TUY B;  1NIW A;  2Y5I A;  1RTP 1;  2RGI A;  1QV0 A;  2JOJ A;  1NX1 A;  4TNC A;  2KAV A;  2NLN A;  2PAL A;  2LP2 A;  3PAL A;  1SY9 A;  2AMI A;  2F2O A;  4AOM A;  4YGD B;  1SPY A;  3BUM B;  1CFD A;  2L2E A;  2M97 A;  4FTG A;  4N1F A;  1PK0 D;  1NSH A;  1SCV A;  3RLZ A;  1HT9 A;  4OVN F;  2QPT A;  3KO0 A;  2EC6 C;  2KAY A;  1J7Q A;  1YUS A;  4PE1 A;  1XFX O;  2HF5 A;  2M1U A;  1OMR A;  2F3Z A;  1RRO A;  1B4C A;  5CSN A;  2H61 C;  1K9U A;  4ZCU A;  2MLF C;  1UHH A;  2M7N A;  2MLE C;  3IF7 A;  4YRU A;  1C07 A;  1WLZ A;  2L50 A;  1XK4 A;  4XJK B;  1K9P A;  2M7L A;  1TOP A;  1J1E A;  2KFH A;  1K93 D;  2BKI B;  4WQ3 A;  3SG7 A;  4QJ5 B;  1B9A A;  2KI4 B;  1W7J B;  5DKR A;  1NPQ A;  1YRU B;  4F0Z B;  1UUR A;  1LIN A;  4PHK A;  1K8U A;  2EGD A;  1IGV A;  1MQ1 A;  2KI6 D;  2ZNE A;  5J3X A;  3NSL A;  2BCB A;  2KNE A;  1J7P A;  4MRX A;  3LL8 B;  3SJS A;  3D0Y A;  1S6I A;  3I5H B;  1PSR A;  3VRP A;  1R2U A;  2ZFD A;  3FIA A;  2F2P A;  3A8R A;  2BCX A;  1PVA A;  2KOT A;  3SG2 A;  3SG6 A;  1KK7 Y;  2A4J A;  1KQV A;  1REC A;  3EK8 A;  4YGA A;  1QVI Y;  1SBJ A;  3BYA A;  3LK0 A;  1XO5 A;  3FWC A;  1TNW A;  3PAT A;  5HKY A;  3OB1 B;  1OSA A;  5I2O A;  3NSO A;  1JWD A;  2WCE A;  1NX0 A;  2WC8 A;  3DVK A;  4DRW A;  2MAZ A;  2LHI A;  3TDU A;  1QIV A;  1ZAC A;  4CFQ A;  1Y1A A;  1OE9 B;  1SR6 B;  1ALV A;  1MUX A;  1OMV A;  1U5I B;  2LMU A;  5DKN A;  5CPV A;  1BG1 A;  1KFX L;  1RWY A;  2D8N A;  2ZRS A;  1S36 A;  2E30 A;  2BEC A;  1NCZ A;  3JVT C;  1DTL A;  1CDL A;  1SK6 D;  4PE0 A;  4AQJ A;  1Y1U A;  2LE9 B;  4YGE B;  3WHU B;  5HYD A;  1PRW A;  1YVH A;  1YVL A;  1MHO A;  5AXI A;  1JC2 A;  1DF0 B;  4GAO A;  1CM1 A;  1M45 A;  1M46 A;  4MBE A;  2Y1M A;  3I5F C;  1QV1 A;  3WHT B;  3SIB A;  1BOC A;  2Q4U A;  5KTY A;  1F70 A;  1K95 A;  1QX7 A;  1WDC C;  4HSZ A;  2FJU B;  1TN4 A;  3CLN A;  4OR9 B;  1DT7 B;  1FF1 A;  1LKJ A;  1Q80 A;  1DJZ A;  5ER4 X;  1KK8 C;  4R1E A;  3VRN A;  3HX4 A;  3PFV A;  1DJH A;  5AAN A;  1QLK A;  1GGZ A;  2BL0 B;  4MN0 A;  1CDM A;  2JPT A;  1JBA A;  1NCX A;  1SL7 A;  1NP8 A;  4L9M A;  1H8B A;  1F54 A;  2BBN A;  2F8P A;  1AUI B;  1K9K A;  1B7T Z;  2H2K A;  3DVE A;  1JFK A;  1CFF A;  1UHN A;  3JTD C;  3NSK A;  3O2P A;  5PAL A;  3JVT B;  2BKH B;  1TNX A;  3OX6 A;  1N0Y A;  1XA5 A;  1SW8 A;  1S6C A;  3WXA A;  1SNL A;  3AKA A;  2JT3 A;  1FPW A;  1SL9 A;  2LMV A;  5IBW A;  4OCI A;  1BJF A;  2KFG A;  2ZRT A;  3IQQ A;  1WDC B;  1KSM A;  2CT9 A;  2NCP A;  1S5G Y;  1ZOT B;  2B1U A;  3RM1 A;  2MHH A;  1IG5 A;  2LC5 A;  1KK8 B;  4P2Y B;  2JU0 A;  4PDZ A;  2MBX A;  2JT0 A;  1D1O A;  1UUS A;  2JQ6 A;  2CBL A;  2BCA A;  2LCP A;  2PRU A;  1KFU L;  1RK9 A;  3BUW B;  2K7B A;  1DJI A;  1QAT A;  2ZKM X;  1CB1 A;  4OV2 A;  1B8C A;  1IQ5 A;  2AAO A;  5HKW A;  1KCY A;  2PMY A;  2NXQ A;  3JTD B;  4MRY A;  4GGF A;  1MXL C;  2LLU A;  3SG3 A;  4MZL A;  2L4H A;  4MSP A;  4GUK A;  4U8D A;  1NCY A;  5D7F A;  1L2O B;  1YUR A;  3PLF B;  5DKQ A;  2O5G A;  2LVJ A;  3I5I C;  1Y0V H;  1CLL A;  2K2F A;  3OB2 B;  3MSE B;  1LA3 A;  1WY9 A;  1AJ5 A;  1DVI A;  1RFJ A;  2JNF A;  4GGF C;  4C0K A;  2K8M B;  1BU3 A;  3BQ3 A;  2LHL A;  3ICB A;  1A03 A;  3VRQ A;  2EHB A;  1F4Q A;  2F33 A;  2KYC A;  2LLT A;  1XVJ A;  1A75 B;  2ZN8 A;  4YGC B;  3GOF A;  1YX8 A;  1XK4 C;  3AKB A;  4YGB B;  2P6B B;  4ORC B;  1OZO A;  1AP4 A;  1YUT A;  2LV7 A;  2K0J A;  3DF0 A;  3HCM A;  3KF9 A;  4CID A;  2DOQ A;  3BOW A;  4M2O A;  5HLV A;  2KAX A;  3FS7 A;  2EC6 B;  3O6B A;  4GBA A;  3LK1 A;  1QLS A;  1M31 A;  1IKU A;  2JRF A;  1ZFS A;  5CSF A;  2LVV A;  4ICB A;  1KWO C;  4PHM A;  1KK7 Z;  4YBH B;  3GK2 A;  1ODB A;  3PSR A;  1QVI Z;  5TNC A;  3AAJ A;  1K94 A;  4GGN A;  4DS7 A;  5BPJ A;  2AUC A;  2HQ8 A;  4MVF A;  1IH0 A;  4P5O E;  4PAL A;  4USL A;  3VRR A;  4JPZ B;  4AQI A;  2M49 B;  4MLW A;  2IS9 A;  1OMD A;  1FBV A;  3CZT X;  1TTX A;  3KPX A;  3FWB A;  5B8I B;  5GQQ C;  2KFF A;  4Q04 A;  1A29 A;  3SG4 A;  5KSZ A;  1MWN A;  1G4Y R;  1KSO A;  1UWO A;  1NWD A;  1OQP A;  1UP5 A;  1B47 A;  2MA2 A;  4CPV A;  1IJ5 A;  4PHN A;  2V53 A;  5I2L A;  2KI6 C;  2JXC A;  1KFX S;  3LCP C;  1GJY A;  1IWQ A;  2OTG C;  1J7R A;  1RJV A;  4HRH A;  1TIZ A;  2JWW A;  3KEV A;  1KWO B;  1KQM C;  1UHK A;  2F3Y A;  3M0W A;  3EVR A;  5JOL A;  4WRI A;  4M2P A;  4CLN A;  1CMG A;  1JF0 A;  1OZS A;  1SYM A;  2L4I A;  2Y1N A;  2MRD A;  3H4S E;  1CM4 A;  2M0R A;  3OX5 A;  2KGR A;  2WOR A;  1SMG A;  5HKZ A;  1GQM A;  4YI8 A;  1DJY A;  1EXR A;  2I94 A;  3E3R A;  1V1F A;  2FCE A;  3TS5 C;  2L0P A;  3I5G C;  2COL B;  1LXF C;  1AJ4 A;  4MZJ A;  5AEQ A;  1JFJ A;  3CTN A;  1ZUZ A;  2OS8 C;  4YI9 A;  1NYA A;  2BE6 A;  3AAK A;  4HRG A;  1BR1 B;  1N65 A;  4QJ4 B;  1QX5 B;  1XFU O;  4OKH A;  4C0L A;  2JTT A;  2HET A;  2M8U A;  4HRE E;  2JTZ A;  1JSA A;  3TDI A;  1YX7 A;  3DD4 A;  1QS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...