4GGFC

Crystal structure of mn2+ bound calprotectin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Molecular basis for manganese sequestration by calprotectin and roles in the innate immune response to invading bacterial pathogens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 41
structure length 108
sequence length 108
chains with identical sequence L, T, V
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggfC00
1SBJA 1A2XA 3TUYB 1XFVO 2AMIA 2DOQA 1KK8C 2KI4B 1S26D 3I5IB 4GGNA 1NCZA 4AQJA 1PVAA 5B8IB 3VRRA 2LP3A 4HRHA 1IJ6A 1QVIY 4XYNA 5HYDA 2MRDA 1G8IA 5AANA 4HREE 2BCAA 4CIDA 3IQQA 5CSJA 2L0PA 4P2YB 1XYDA 1IQ3A 2L98A 2JULA 4L9MA 1DJWA 1L7ZA 1NX1A 1XK4A 2ZN9A 3TUYC 1OOJA 2JQ6A 1R2UA 2G2BA 1S3PA 1YVLA 2KI4C 3I5IC 3PALA 1JWDA 1BLQA 1PSBA 1KFXL 3JVTC 1A29A 1PVBA 1WLMA 2MLEC 2ZKMX 3AAJA 3CR5X 4OKHA 5GQQC 5IBWA 1B47A 1BG1A 1CLBA 1CLLA 2K7BA 1QJTA 1EL4A 1K94A 4ZCUA 1KQVA 2JT3A 1PRWA 5G08A 1ODBA 3AAKA 2M1UA 1CNPA 5HKWA 3GOFA 2I94A 2PASA 1TCOB 2CCMA 3PLFB 2I7AA 2M1KB 1UHIA 2HPSA 2QPTA 1XK4C 3OB2B 2KQ6A 1CDMA 1S36A 1M46A 1DMOA 3K21A 2LVKA 2H61A 5I2OA 2KFGA 1TOPA 3EK8A 1QX2A 2GGMA 5PALA 2KYCA 5CSIA 2CTNA 2KAXA 4OCIA 2BKIB 1DVIA 2JU0A 2AAOA 5KSZA 1D1OA 4F0ZB 1JF2A 2JXCA 2M9GA 2PRUA 2NZ0A 4GPLB 1M31A 1PULA 1B1GA 1Y1XA 3E3RA 1AJ5A 2KSPA 2O5GA 1XFXO 1MUXA 2KFFA 2ZRSA 1FI6A 1RJVA 3SJSA 4CPVA 2L2EA 4NDDA 3EKJA 1R6PA 1BMOA 3I5GB 1F4QA 4I5NB 4TNCA 3SG7A 1AK8A 1LINA 2Y1MA 2H61C 2JT0A 3TZ1A 1OZSA 4JPZB 1CM1A 2M29A 1TCFA 1ZMZA 4MZJA 3SIBA 2M97A 2LHIA 1B7TY 3O78A 1FI5A 1BU3A 1IKUA 2K61A 1QLKA 2JTTA 3LK0A 4MN0A 1KWOB 3EK4A 2F33A 2BBMA 2LUCA 3I5GC 4YGBB 3WHUB 1CFFA 4PE4A 1SY9A 4I5LB 1CDPA 2K7DA 3VRQA 4ETOA 4I5KA 2Y5IA 1ALWA 2IS9A 2KNEA 1FBVA 2LNKA 2Y4QA 3NXAA 3AKAA 1DJHA 2G9BA 4GUKA 1BODA 3I5HB 1KWOC 2MBXA 1Q80A 4WQ2A 1SL9A 1KK7Y 2E30A 1KQMB 1MR8A 1N0YA 1K9UA 1MQ1A 4PE7A 1EXRA 4YI9A 4AQIA 1KFXS 5DKQA 2NXQA 1LA3A 4WQ3A 3DF0A 4PE0A 1JF0A 1OSAA 1B8RA 2GGZA 2CT9A 5I2QA 2FCDA 1Y1AA 3LL8B 1NUBA 2OTGB 3CGAA 1KQMC 3QRXA 2TN4A 4MRYA 1NWDA 3DF0B 1UWOA 3LK1A 1CM4A 4PHNA 2LM5A 3M0WA 1SL8A 5AERA 3HX4A 1JUOA 2JOJA 2SCPA 1JBAA 3I5FB 1Y0VH 1YTZC 2MAZA 1GQMA 1HT9A 1F4OA 3CTNA 2ZN8A 3KF9A 2RGIA 3DVJA 2M49B 4QJ4B 1IWQA 2OTGC 1PALA 3LLEA 3EK7A 1H8BA 1AUIB 3BQ3A 2KI6C 1QXPA 5BPJA 1KCYA 3TS5B 1QX5B 1AJ4A 3BUWB 1KSMA 2BCXA 1L2OB 4GBAA 3PM8A 1CDLA 5ER4X 1J7RA 2KQYA 2KFHA 3A4UB 4OR9B 1N65A 1YX8A 2F3YA 3H4SE 2K7OA 2GV5A 2KHNA 1UHHA 1UHKA 1Y1UA 3FWCA 4UPGA 1FPWA 1SW8A 1DTLA 2K2FA 3TS5C 5DKNA 4PHKA 5AEQA 1L2OC 4GFTA 4GGFA 1HQVA 1S1EA 1IRJA 1K9PA 1A03A 1OMRA 1WY9A 1QVIZ 2MJWB 3A8RA 1ZACA 1C07A 3CR2A 3MSEB 3PATA 2Q91A 1NCXA 4U8DA 1UURA 1SPYA 1YR5A 4BY5A 2HETA 4MLWA 5FYXA 2LVIA 4NDBA 2AUCA 1K2HA 3CLNA 4E68A 2FJUB 1S6JA 2K8MB 2ZNDA 3AKBA 3C1VA 4QJ3B 1MF8B 2EHBA 3IQOA 4ORCB 2OS8B 2LHLA 4A4CA 1F55A 3SIAA 1MWNA 3CS1A 2BE6A 4GAOA 1SRAA 2PVBA 1ZOTB 4YGCB 1FF1A 2ZFDA 3CR4X 3SG3A 3BUOB 2LANA 3CZTX 3DVEA 4P5OE 3WHTB 1K96A 1YVHA 1OMVA 2LE9B 4GGFC 2KAVA 2M0RA 5AFPA 1XA5A 1NYAA 1WLZA 4ZCVA 1MXEA 3KEVA 4JWQA 2FCEA 1ZUZA 2M7NA 4DIRA 1DT7B 4NQGA 2KBMA 2LMVA 1QTXA 1QV1A 2I2RE 1XO5A 3GK1A 2VRGA 3BYAA 3PN7B 1DJIA 1GGZA 2OPOA 3OB1B 4HSZA 1YURA 2F2OA 1LXFC 3SG2A 1U5IA 2JNXA 4FQOA 1IJ5A 4YI8A 4YGEB 1BT6A 1UP5A 3NSKA 2H2KA 5CSNA 4M2QA 2PSRA 1WDCB 4DCKA 2I18A 1U5IB 1UHJA 1J7OA 1J1DA 3VROA 2WCFA 1JSAA 3PN7C 4A4BA 1EJ3A 1S6CA 1B8CA 2LAPA 3DVMA 2L5XB 2COLB 1PSRA 3EVRA 1EG4A 4IL1A 1WDCC 1CLMA 2WORA 4PE1A 2WOSA 1A4PA 1C7WA 3PSRA 1QATA 1IH0A 1MXLC 1EH2A 1G4YR 3OP0A 1AP4A 1M45A 1CB1A 3NSOA 2JPTA 2LMTA 1DJZA 1B7TZ 1S5GY 2K7CA 2WCBA 2L50A 4PDZA 2KYFA 1J55A 1NP8A 1KFUL 2CXJA 1CKKA 2BCBA 1WRKA 1MHOA 3I5HC 3SG4A 1SCMB 2FOTA 4MVFA 1J7PA 2L4HA 2M3WA 4YRUA 3EVVA 3OX6A 1SNLA 1CDNA 1ZFSA 2Y1NA 1QV0A 1AHRA 4ORAB 2NCPA 1B4CA 1TN4A 1YUTA 4N1GA 4PHJA 3VRNA 2K0JA 3PFVA 1VRKA 2LLTA 2LP2A 2LUXA 4JQ0D 2LLUA 3D0YA 4USLA 1KK7Z 3RLZA 2P6BB 4OV2A 2JRFA 1JFJA 1AVSA 2ISDA 4CFQA 2F3ZA 3FWBA 2MLFC 1X02A 2L4IA 2JC2A 2LVVA 3D0YB 1BR1B 1YUSA 4ICBA 3CWGA 3I5FC 3WNXB 1NPQA 4R1EA 1QLSA 1QIWA 1W7JB 2ZRTA 1W7IB 3KPXA 3JTDB 3IF7A 3VRPA 1OE9B 5HKYA 4YGAA 2QACA 5I8NA 1SYMA 3JVTB 3EVUA 4DS7A 1NX2A 1SKTA 1K90D 1OQPA 1RROA 4M2PA 1IQ5A 2WC8A 5F6TA 1SK6D 1SCVA 4CLNA 3GK2A 2KI6D 1DJGA 1QS7A 4GNKB 1IGVA 1SMGA 5AXIA 3JTDC 4C0LA 4CFRA 1BJFA 3LCPC 3VGOA 1RTP1 4MRXA 2O60A 1RFJA 2KOTA 2WCEA 1NX0A 1F8HA 4OVNF 5JOLA 1CMGA 1YRUB 1BOCA 3FIAA 1JC2A 1XFYO 1V1GA 4DRWA 1DGVA 1BR4B 3DVKA 3ZNIA 2JTZA 2KGRA 4HRGA 1K8UA 1TNXA 1GJYA 1M63B 2L51A 4YBHB 5DKRA 3BXKA 4M2OA 2LCPA 1TTXA 4NDCA 1N2DA 1KSOA 3NSLA 2B1UA 1YX7A 2OS8C 1ALVA 4MBEA 1K95A 1J7QA 4N5XA 1C7VA 4ORBB 1F71A 4MZLA 3O2PA 4DUQA 2LC5A 1DF0A 1XFUO 5HKZA 1OMDA 3TDUA 2E6WA 2NLNA 3O6BA 4Q04A 4AOMA 1KFUS 1CFDA 2CNPA 5D7FA 4YGDB 4BY4A 1NSHA 1CFPA 2CBLA 1B9AA 3HCMA 1DF0B 1SR6B 2PALA 2Q4UA 3TDZA 1LKJA 4WRIA 3WXAA 5K89A 2KGBC 5CPVA 5D69A 2M7LA 4PALA 2EGDA 1WRLA 1BF5A 2JT8A 1B8LA 1EG3A 1QASA 2BL0B 1F70A 2F2PA 1XFWO 1DJXA 2ZNEA 1CTRA 3BUNB 2LVJA 2LV7A 1A75A 1TNWA 1XFZO 2BBNA 3DD4A 3KO0A 4I5JA 5J3XA 1SR6C 1QX7A 2V53A 2BECA 1OZOA 1YUUA 1H4BA 4N1FA 2JWWA 2KDHA 1Y6WA 1CFCA 1NX3A 1UUSA 3SG6A 5CSFA 1A75B 4D1EA 3BOWA 1WRZA 2BL0C 3GK4X 4PHMA 1F54A 3ICBA 1NCYA 5I2LA 5HLVA 2HQWA 2PMYA 1PK0D 3OHMB 3BUMB 3SG5A 1SL7A 2KBIA 1TRFA 2D8NA 3TDIA 1K9KA 1QIVA 5KTYA 3BOWB 1DJYA 2BE4A 5JJGA 2HF5A 3BUXB 3F45A 1LA0A 4MEWA 4C0JA 3D10A 1CMFA 1XVJA 1GGWA 2BKHB 1LVCD 2JXLA 1NIWA 3FS7A 5ER5A 1J1EA 2LLSA 4PCWA 1IG5A 5TNCA 1S6IA 3EKHA 4QJ5B 3O4YA 2SASA 2KAYA 2HQ8A 2WNDA 3NSIA 5KU1A 2EC6B 1RK9A 4XJKA 1RECA 4C0KA 3KHEA 1E8AA 2R2IA 1G33A 3ZWHA 2M8UA 1UHNA 2LMUA 2MA2A 1FW4A 1SCMC 1TNQA 2JNFA 1RWYA 4XJKB 1KK8B 2MHHA 1YRTB 2NCOA 1DGUA 4FTGA 1TIZA 1K93D 3OX5A 1S5GZ 3RM1A 1JFKA 2EC6C 4MSPA 2JZIA 2F8PA 1TNPA 2K2AA 4MZKA 1M39A 2A4JA 1V1FA 5HLOA
chains in the Genus database with same CATH superfamily
1SBJA 1A2XA 3TUYB 1XFVO 2AMIA 2DOQA 3S0DA 1KK8C 2KI4B 1S26D 3I5IB 4GGNA 1NCZA 4AQJA 1PVAA 5B8IB 3VRRA 1XFRA 2LP3A 4HRHA 1IJ6A 1QVIY 3BFAA 4XYNA 5HYDA 2MRDA 1G8IA 5AANA 4HREE 2BCAA 4CIDA 3IQQA 5CSJA 2L0PA 4P2YB 1XYDA 3QMEA 2L98A 4FQTA 1IQ3A 2JULA 4L9MA 1DJWA 1L7ZA 1DELA 1LS8A 1NX1A 1XK4A 2ZN9A 3TUYC 1OOJA 2JQ6A 1R2UA 2WC6A 3SG2A 2G2BA 1S3PA 1YVLA 2KI4C 3I5IC 3PALA 1JWDA 1BLQA 1PSBA 1KFXL 1T14A 1A29A 1PVBA 1WLMA 2MLEC 2ZKMX 3AAJA 3CR5X 3JVTC 4OKHA 5GQQC 1B47A 5IBWA 1BG1A 1CLBA 1CLLA 2K7BA 1QJTA 1EL4A 1K94A 4ZCUA 1KQVA 2JT3A 1PRWA 5G08A 1ODBA 3AAKA 3R1PA 2M1UA 1CNPA 5HKWA 3GOFA 5I94A 2I94A 2PASA 1TCOB 2CCMA 3PLFB 2I7AA 2M1KB 1UHIA 2HPSA 2QPTA 1XK4C 3UNWA 3OB2B 5EL2A 2KQ6A 3DYEA 1CDMA 1S36A 3FE9A 1M46A 1DMOA 3K21A 2LVKA 2H61A 5I2OA 2KFGA 1TOPA 3EK8A 1QX2A 2GGMA 5PALA 2KYCA 5CSIA 1DC1A 2CTNA 2KAXA 4OCIA 2BKIB 1DVIA 2JU0A 2AAOA 5KSZA 1D1OA 4F0ZB 1JF2A 2JXCA 2M9GA 2PRUA 2NZ0A 4GPLB 1M31A 1PULA 1B1GA 1Y1XA 3E3RA 1AJ5A 2KSPA 2O5GA 1XFXO 1MUXA 2KFFA 2ZRSA 1FI6A 1RJVA 3SJSA 3R1OA 4CPVA 2L2EA 4NDDA 3EKJA 1R6PA 4JKTA 1BMOA 3I5GB 1OOFA 1F4QA 3L4AA 4I5NB 4TNCA 3SG7A 1AK8A 1LINA 2Y1MA 3NHTA 3D73A 4INWA 2QEHA 2H61C 2JT0A 3TZ1A 3D75A 1OZSA 4JPZB 1CM1A 2M29A 1DEKA 1TCFA 1ZMZA 2K60A 3L4LA 4MZJA 3CZ1A 3SIBA 1Z4HA 2M97A 2LHIA 1B7TY 3O78A 3SS3A 1FI5A 1BU3A 1IKUA 2K61A 1QLKA 2JTTA 3LK0A 4MN0A 1KWOB 3EK4A 2F33A 2BBMA 2LUCA 3CYZA 3I5GC 4YGBB 3WHUB 1CFFA 4PE4A 3O4XA 1SY9A 4I5LB 1CDPA 2K7DA 3VRQA 4ETOA 4I5KA 2Y5IA 1ALWA 2IS9A 2KNEA 1FBVA 2LNKA 2Y4QA 3NXAA 3Q8IA 3AKAA 1DJHA 2G9BA 4GUKA 1BODA 2YGUA 3I5HB 1KWOC 2FJYA 2MBXA 1Q80A 4WQ2A 1SL9A 2H8VA 1KK7Y 2E30A 1KQMB 3BJHA 2WCHA 1MR8A 1N0YA 1K9UA 1MQ1A 4PE7A 3FE6A 1EXRA 4KYNA 4YI9A 3SS5A 4AQIA 1KFXS 5DKQA 2NXQA 3OGNA 1LA3A 4WQ3A 3DF0A 4PE0A 1JF0A 1OSAA 3DXLA 1B8RA 2GGZA 2CT9A 5I2QA 2FCDA 1Y1AA 3LL8B 4JD9A 1NUBA 2OTGB 2WCJA 3CGAA 1KQMC 3QRXA 2TN4A 4MRYA 1NWDA 3DF0B 1UWOA 3LK1A 1CM4A 4PHNA 2LM5A 3M0WA 1SL8A 5AERA 3HX4A 1JUOA 2JOJA 2SCPA 1JBAA 3I5FB 3S0BA 1Y0VH 1YTZC 2MAZA 1GQMA 1HT9A 1F4OA 3CTNA 2ZN8A 3EG5B 3RZSA 3KF9A 2RGIA 3DVJA 2M49B 4QJ4B 1IWQA 2OTGC 1ORGA 1PALA 3LLEA 3EK7A 1H8BA 1AUIB 3BQ3A 2KI6C 1QXPA 3CZ2A 5BPJA 4PT1A 1KCYA 3TS5B 1QX5B 1AJ4A 3BUWB 1OW4A 1KSMA 2BCXA 1L2OB 3B7AA 4GBAA 3PM8A 1CDLA 5ER4X 1J7RA 2KQYA 2KFHA 3A4UB 4OR9B 1N65A 1YX8A 1QWVA 2F3YA 3S0FA 3H4SE 2K7OA 2GV5A 2KHNA 1UHHA 1UHKA 1Y1UA 3FWCA 4UPGA 1FPWA 1SW8A 1DTLA 2K2FA 3TS5C 5DKNA 3D74A 4PHKA 5AEQA 1L2OC 3N7HA 4GFTA 4GGFA 1HQVA 1S1EA 1IRJA 1K9PA 1A03A 1OMRA 1WY9A 1QVIZ 2MJWB 3A8RA 5FI6A 1ZACA 1TUJA 3CR2A 1P28A 3MSEB 3PATA 2Q91A 1NCXA 1C07A 4U8DA 1UURA 1SPYA 1YR5A 4BY5A 2HETA 4MLWA 5FYXA 2LVIA 4NDBA 2AUCA 2WCMA 1K2HA 3CLNA 4E68A 2FJUB 1S6JA 2K8MB 2ZNDA 3AKBA 3C1VA 4QJ3B 1GM0A 1MF8B 2EHBA 3IQOA 4ORCB 2OS8B 2KLDA 2L2CA 2LHLA 3CDNA 3SIAA 4A4CA 1F55A 1MWNA 1SSEB 5HL1A 1TWOA 3CS1A 3OBVA 5DICA 2BE6A 4GAOA 1SRAA 2PVBA 1ZOTB 4YGCB 3VB1A 1FF1A 2ZFDA 3CR4X 3SG3A 3BUOB 2LANA 3CZTX 3DVEA 4P5OE 3WHTB 1K96A 1YVHA 1OMVA 2LE9B 4GGFC 2KAVA 2M0RA 5AFPA 1XA5A 1NYAA 1WLZA 4ZCVA 1MXEA 3KEVA 4JWQA 2FCEA 3S0GA 3UO9A 1ZUZA 2M7NA 3BFBA 4DIRA 1DT7B 4NQGA 2KBMA 2LMVA 1OOHA 1QTXA 1QV1A 2KPHA 3D77A 2I2RE 1XO5A 3GK1A 2VRGA 3BYAA 3PN7B 1DJIA 1GGZA 2OPOA 3OB1B 4HSZA 1TUZA 1YURA 1LXFC 2F2OA 1U5IA 2JNXA 4FQOA 1IJ5A 2QEBA 4YI8A 1BT6A 4YGEB 1C3YA 1UP5A 3NSKA 2H2KA 5CSNA 4M2QA 2PSRA 2WCKA 3CZ0A 1WDCB 4DCKA 2I18A 1U5IB 1UHJA 1J7OA 1J1DA 3VROA 2WCFA 1JSAA 3PN7C 4A4BA 1EJ3A 1S6CA 1B8CA 4OZDA 2P71A 2LAPA 3DVMA 2L5XB 2WC5A 5FI2A 2COLB 1PSRA 3EVRA 1EG4A 4IL1A 1WDCC 1CLMA 2WORA 3PJIA 4PE1A 2WOSA 3S0AA 1A4PA 1C7WA 3PSRA 1QATA 1IH0A 1MXLC 1EH2A 1G4YR 3OP0A 1AP4A 1M45A 1CB1A 2PYQA 3NSOA 1Z2CB 2JPTA 2LMTA 1DJZA 1B7TZ 1S5GY 2K7CA 2WCBA 2L50A 4PDZA 2KYFA 1J55A 1NP8A 1KFUL 2CXJA 1CKKA 3L47A 2BCBA 1WRKA 1MHOA 3I5HC 2ERBA 3SG4A 1SCMB 2FOTA 4MVFA 1J7PA 3D76A 3V2LA 2L4HA 2M3WA 4YRUA 3EVVA 3OX6A 1SNLA 1CDNA 1ZFSA 2Y1NA 1QV0A 1AHRA 4ORAB 2NCPA 2KLEA 1B4CA 1TN4A 1YUTA 4N1GA 4PHJA 3VRNA 3PM2A 2K0JA 3PFVA 1VRKA 2LLTA 2LP2A 2LUXA 4JQ0D 2LLUA 3D0YA 4USLA 1KK7Z 3RLZA 2P6BB 1C3ZA 3FE8A 2L5YA 4OV2A 2JRFA 1JFJA 1AVSA 2ISDA 4CFQA 2F3ZA 3FWBA 2MLFC 1X02A 2L4IA 2JC2A 2LVVA 3D0YB 1BR1B 1YUSA 4ICBA 3D78A 3CWGA 3I5FC 3R72A 3WNXB 1NPQA 4R1EA 1QLSA 1QIWA 4INXA 1IIOA 1W7JB 2ZRTA 4F7FA 1W7IB 3KPXA 3JTDB 3IF7A 3VRPA 1OE9B 3NGVA 5HKYA 4YGAA 2QACA 5I8NA 1SYMA 3B6XA 3JVTB 3EVUA 4DS7A 2BAPA 1NX2A 1SKTA 1K90D 1OQPA 1RROA 4M2PA 1IQ5A 2WC8A 5F6TA 1SK6D 1SCVA 4CLNA 3GK2A 2KI6D 1DJGA 1QS7A 4GNKB 1IGVA 1SMGA 5AXIA 3JTDC 4C0LA 4CFRA 1BJFA 3LCPC 2QDIA 3VGOA 1RTP1 4MRXA 2O60A 1RFJA 2KOTA 2WCEA 1NX0A 1F8HA 2JPOA 4OVNF 5JOLA 1CMGA 1YRUB 3S0EA 1OOIX 1BOCA 3FIAA 2WCLA 1XFYO 3R1VA 1JC2A 1V1GA 4DRWA 1DGVA 1BR4B 3DVKA 3ZNIA 1W9ZA 2JTZA 2KGRA 4HRGA 1K8UA 1TNXA 1GJYA 1M63B 2L51A 4YBHB 5DKRA 3BXKA 4M2OA 2LCPA 1TTXA 4NDCA 1N2DA 1KSOA 3NSLA 2B1UA 1YX7A 2OS8C 1ALVA 4MBEA 1K95A 1J7QA 4N5XA 1C7VA 4ORBB 1F71A 4MZLA 3O2PA 5D3OA 4DUQA 2LC5A 1DF0A 1XFUO 5HKZA 1OMDA 2P70A 2E6WA 2NLNA 3O6BA 4Q04A 3TDUA 4AOMA 3SS4A 1KFUS 1CFDA 2CNPA 5D7FA 4YGDB 4BY4A 1NSHA 1CFPA 2CBLA 1B9AA 2QEVA 3HCMA 1DF0B 1SR6B 2PALA 2Q4UA 3TDZA 1LKJA 4WRIA 3WXAA 5K89A 2KGBC 5CPVA 5D69A 2M7LA 2QEOA 3CABA 4PALA 2EGDA 1WRLA 1BF5A 2JT8A 1B8LA 1EG3A 3B88A 1QASA 2BL0B 1F70A 3IVTA 2F2PA 1XFWO 1DJXA 2ZNEA 1CTRA 3BUNB 3DY9A 2LVJA 2LV7A 1A75A 1TNWA 1XFZO 2BBNA 3DD4A 2BNXA 3KO0A 4I5JA 5J3XA 1SR6C 1QX7A 2V53A 2BECA 1OZOA 1OOGA 1YUUA 3BFHA 1H4BA 4N1FA 2JWWA 2KDHA 1Y6WA 1CFCA 1NX3A 1UUSA 5FI7A 3SG6A 5CSFA 1A75B 4D1EA 3BOWA 1WRZA 2BL0C 3GK4X 4PHMA 4IJ7A 1F54A 3ICBA 1NCYA 5I2LA 5HLVA 2HQWA 2PMYA 1DQEA 3K1EA 1PK0D 3OHMB 3BUMB 3SG5A 1SL7A 2KBIA 1TRFA 2D8NA 3B87A 3TDIA 1K9KA 1QIVA 5KTYA 3BOWB 1DJYA 2BE4A 5JJGA 2HF5A 3BUXB 3F45A 1LA0A 4MEWA 4C0JA 3D10A 1CMFA 1XVJA 1GGWA 2BKHB 3NHIA 1LVCD 2JXLA 1NIWA 3FS7A 5ER5A 1J1EA 2LLSA 4PCWA 1IG5A 5TNCA 1S6IA 3EKHA 4QJ5B 3O4YA 2SASA 2KAYA 2HQ8A 2WNDA 3DZTA 3NSIA 5KU1A 2EC6B 1RK9A 4XJKA 1RECA 4C0KA 3KHEA 1E8AA 2R2IA 1G33A 3ZWHA 2M8UA 1UHNA 2LMUA 2MA2A 1FW4A 1SCMC 1TNQA 2JNFA 1RWYA 4XJKB 1KK8B 2MHHA 2GTEA 1YRTB 2NCOA 1DGUA 4FTGA 1TIZA 1K93D 2PQLA 3OX5A 1S5GZ 3B86A 3RM1A 1JFKA 2EC6C 4MSPA 2JZIA 2F8PA 1TNPA 2K2AA 4MZKA 1M39A 2A4JA 1V1FA 5HLOA
chains in the Genus database with same CATH topology
1SBJA 1A2XA 3TUYB 1XFVO 2AMIA 2DOQA 1KK8C 2KI4B 1S26D 3I5IB 4GGNA 1NCZA 4AQJA 1PVAA 5B8IB 3VRRA 2LP3A 4HRHA 1IJ6A 1QVIY 4XYNA 5HYDA 2MRDA 1G8IA 5AANA 4HREE 2BCAA 4CIDA 3IQQA 5CSJA 2L0PA 4P2YB 1XYDA 1IQ3A 2L98A 2JULA 4L9MA 1DJWA 1L7ZA 1NX1A 1XK4A 2ZN9A 3TUYC 1OOJA 2JQ6A 1R2UA 2G2BA 1S3PA 1YVLA 2KI4C 3I5IC 3PALA 1JWDA 1BLQA 1PSBA 1KFXL 3JVTC 1A29A 1PVBA 1WLMA 2MLEC 2ZKMX 3AAJA 3CR5X 4OKHA 5GQQC 5IBWA 1B47A 1BG1A 1CLBA 1CLLA 2K7BA 1QJTA 1EL4A 1K94A 4ZCUA 1KQVA 2JT3A 1PRWA 5G08A 1ODBA 3AAKA 2M1UA 1CNPA 5HKWA 3GOFA 2I94A 2PASA 1TCOB 2CCMA 3PLFB 2I7AA 2M1KB 1UHIA 2HPSA 2QPTA 1XK4C 3OB2B 2KQ6A 1CDMA 1S36A 1M46A 1DMOA 3K21A 2LVKA 2H61A 5I2OA 2KFGA 1TOPA 3EK8A 1QX2A 2GGMA 5PALA 2KYCA 5CSIA 2CTNA 2KAXA 4OCIA 2BKIB 1DVIA 2JU0A 2AAOA 5KSZA 1D1OA 4F0ZB 1JF2A 2JXCA 2M9GA 2PRUA 2NZ0A 4GPLB 1M31A 1PULA 1B1GA 1Y1XA 3E3RA 1AJ5A 2KSPA 2O5GA 1XFXO 1MUXA 2KFFA 2ZRSA 1FI6A 1RJVA 3SJSA 4CPVA 2L2EA 4NDDA 3EKJA 1R6PA 1BMOA 3I5GB 1F4QA 4I5NB 4TNCA 3SG7A 1AK8A 1LINA 2Y1MA 2H61C 2JT0A 3TZ1A 1OZSA 4JPZB 1CM1A 2M29A 1TCFA 1ZMZA 4MZJA 3SIBA 2M97A 2LHIA 1B7TY 3O78A 1FI5A 1BU3A 1IKUA 2K61A 1QLKA 2JTTA 3LK0A 4MN0A 1KWOB 3EK4A 2F33A 2BBMA 2LUCA 3I5GC 4YGBB 3WHUB 1CFFA 4PE4A 1SY9A 4I5LB 1CDPA 2K7DA 3VRQA 4ETOA 4I5KA 2Y5IA 1ALWA 2IS9A 2KNEA 1FBVA 2LNKA 2Y4QA 3NXAA 3AKAA 1DJHA 2G9BA 4GUKA 1BODA 3I5HB 1KWOC 2MBXA 1Q80A 4WQ2A 1SL9A 1KK7Y 2E30A 1KQMB 1MR8A 1N0YA 1K9UA 1MQ1A 4PE7A 1EXRA 4YI9A 4AQIA 1KFXS 5DKQA 2NXQA 1LA3A 4WQ3A 3DF0A 4PE0A 1JF0A 1OSAA 1B8RA 2GGZA 2CT9A 5I2QA 2FCDA 1Y1AA 3LL8B 1NUBA 2OTGB 3CGAA 1KQMC 3QRXA 2TN4A 4MRYA 1NWDA 3DF0B 1UWOA 3LK1A 1CM4A 4PHNA 2LM5A 3M0WA 1SL8A 5AERA 3HX4A 1JUOA 2JOJA 2SCPA 1JBAA 3I5FB 1Y0VH 1YTZC 2MAZA 1GQMA 1HT9A 1F4OA 3CTNA 2ZN8A 3KF9A 2RGIA 3DVJA 2M49B 4QJ4B 1IWQA 2OTGC 1PALA 3LLEA 3EK7A 1H8BA 1AUIB 3BQ3A 2KI6C 1QXPA 5BPJA 1KCYA 3TS5B 1QX5B 1AJ4A 3BUWB 1KSMA 2BCXA 1L2OB 4GBAA 3PM8A 1CDLA 5ER4X 1J7RA 2KQYA 2KFHA 3A4UB 4OR9B 1N65A 1YX8A 2F3YA 3H4SE 2K7OA 2GV5A 2KHNA 1UHHA 1UHKA 1Y1UA 3FWCA 4UPGA 1FPWA 1SW8A 1DTLA 2K2FA 3TS5C 5DKNA 4PHKA 5AEQA 1L2OC 4GFTA 4GGFA 1HQVA 1S1EA 1IRJA 1K9PA 1A03A 1OMRA 1WY9A 1QVIZ 2MJWB 3A8RA 1ZACA 1C07A 3CR2A 3MSEB 3PATA 2Q91A 1NCXA 4U8DA 1UURA 1SPYA 1YR5A 4BY5A 2HETA 4MLWA 5FYXA 2LVIA 4NDBA 2AUCA 1K2HA 3CLNA 4E68A 2FJUB 1S6JA 2K8MB 2ZNDA 3AKBA 3C1VA 4QJ3B 1MF8B 2EHBA 3IQOA 4ORCB 2OS8B 2LHLA 4A4CA 1F55A 3SIAA 1MWNA 3CS1A 2BE6A 4GAOA 1SRAA 2PVBA 1ZOTB 4YGCB 1FF1A 2ZFDA 3CR4X 3SG3A 3BUOB 2LANA 3CZTX 3DVEA 4P5OE 3WHTB 1K96A 1YVHA 1OMVA 2LE9B 4GGFC 2KAVA 2M0RA 5AFPA 1XA5A 1NYAA 1WLZA 4ZCVA 1MXEA 3KEVA 4JWQA 2FCEA 1ZUZA 2M7NA 4DIRA 1DT7B 4NQGA 2KBMA 2LMVA 1QTXA 1QV1A 2I2RE 1XO5A 3GK1A 2VRGA 3BYAA 3PN7B 1DJIA 1GGZA 2OPOA 3OB1B 4HSZA 1YURA 2F2OA 1LXFC 3SG2A 1U5IA 2JNXA 4FQOA 1IJ5A 4YI8A 4YGEB 1BT6A 1UP5A 3NSKA 2H2KA 5CSNA 4M2QA 2PSRA 1WDCB 4DCKA 2I18A 1U5IB 1UHJA 1J7OA 1J1DA 3VROA 2WCFA 1JSAA 3PN7C 4A4BA 1EJ3A 1S6CA 1B8CA 2LAPA 3DVMA 2L5XB 2COLB 1PSRA 3EVRA 1EG4A 4IL1A 1WDCC 1CLMA 2WORA 4PE1A 2WOSA 1A4PA 1C7WA 3PSRA 1QATA 1IH0A 1MXLC 1EH2A 1G4YR 3OP0A 1AP4A 1M45A 1CB1A 3NSOA 2JPTA 2LMTA 1DJZA 1B7TZ 1S5GY 2K7CA 2WCBA 2L50A 4PDZA 2KYFA 1J55A 1NP8A 1KFUL 2CXJA 1CKKA 2BCBA 1WRKA 1MHOA 3I5HC 3SG4A 1SCMB 2FOTA 4MVFA 1J7PA 2L4HA 2M3WA 4YRUA 3EVVA 3OX6A 1SNLA 1CDNA 1ZFSA 2Y1NA 1QV0A 1AHRA 4ORAB 2NCPA 1B4CA 1TN4A 1YUTA 4N1GA 4PHJA 3VRNA 2K0JA 3PFVA 1VRKA 2LLTA 2LP2A 2LUXA 4JQ0D 2LLUA 3D0YA 4USLA 1KK7Z 3RLZA 2P6BB 4OV2A 2JRFA 1JFJA 1AVSA 2ISDA 4CFQA 2F3ZA 3FWBA 2MLFC 1X02A 2L4IA 2JC2A 2LVVA 3D0YB 1BR1B 1YUSA 4ICBA 3CWGA 3I5FC 3WNXB 1NPQA 4R1EA 1QLSA 1QIWA 1W7JB 2ZRTA 1W7IB 3KPXA 3JTDB 3IF7A 3VRPA 1OE9B 5HKYA 4YGAA 2QACA 5I8NA 1SYMA 3JVTB 3EVUA 4DS7A 1NX2A 1SKTA 1K90D 1OQPA 1RROA 4M2PA 1IQ5A 2WC8A 5F6TA 1SK6D 1SCVA 4CLNA 3GK2A 2KI6D 1DJGA 1QS7A 4GNKB 1IGVA 1SMGA 5AXIA 3JTDC 4C0LA 4CFRA 1BJFA 3LCPC 3VGOA 1RTP1 4MRXA 2O60A 1RFJA 2KOTA 2WCEA 1NX0A 1F8HA 4OVNF 5JOLA 1CMGA 1YRUB 1BOCA 3FIAA 1JC2A 1XFYO 1V1GA 4DRWA 1DGVA 1BR4B 3DVKA 3ZNIA 2JTZA 2KGRA 4HRGA 1K8UA 1TNXA 1GJYA 1M63B 2L51A 4YBHB 5DKRA 3BXKA 4M2OA 2LCPA 1TTXA 4NDCA 1N2DA 1KSOA 3NSLA 2B1UA 1YX7A 2OS8C 1ALVA 4MBEA 1K95A 1J7QA 4N5XA 1C7VA 4ORBB 1F71A 4MZLA 3O2PA 4DUQA 2LC5A 1DF0A 1XFUO 5HKZA 1OMDA 3TDUA 2E6WA 2NLNA 3O6BA 4Q04A 4AOMA 1KFUS 1CFDA 2CNPA 5D7FA 4YGDB 4BY4A 1NSHA 1CFPA 2CBLA 1B9AA 3HCMA 1DF0B 1SR6B 2PALA 2Q4UA 3TDZA 1LKJA 4WRIA 3WXAA 5K89A 2KGBC 5CPVA 5D69A 2M7LA 4PALA 2EGDA 1WRLA 1BF5A 2JT8A 1B8LA 1EG3A 1QASA 2BL0B 1F70A 2F2PA 1XFWO 1DJXA 2ZNEA 1CTRA 3BUNB 2LVJA 2LV7A 1A75A 1TNWA 1XFZO 2BBNA 3DD4A 3KO0A 4I5JA 5J3XA 1SR6C 1QX7A 2V53A 2BECA 1OZOA 1YUUA 1H4BA 4N1FA 2JWWA 2KDHA 1Y6WA 1CFCA 1NX3A 1UUSA 3SG6A 5CSFA 1A75B 4D1EA 3BOWA 1WRZA 2BL0C 3GK4X 4PHMA 1F54A 3ICBA 1NCYA 5I2LA 5HLVA 2HQWA 2PMYA 1PK0D 3OHMB 3BUMB 3SG5A 1SL7A 2KBIA 1TRFA 2D8NA 3TDIA 1K9KA 1QIVA 5KTYA 3BOWB 1DJYA 2BE4A 5JJGA 2HF5A 3BUXB 3F45A 1LA0A 4MEWA 4C0JA 3D10A 1CMFA 1XVJA 1GGWA 2BKHB 1LVCD 2JXLA 1NIWA 3FS7A 5ER5A 1J1EA 2LLSA 4PCWA 1IG5A 5TNCA 1S6IA 3EKHA 4QJ5B 3O4YA 2SASA 2KAYA 2HQ8A 2WNDA 3NSIA 5KU1A 2EC6B 1RK9A 4XJKA 1RECA 4C0KA 3KHEA 1E8AA 2R2IA 1G33A 3ZWHA 2M8UA 1UHNA 2LMUA 2MA2A 1FW4A 1SCMC 1TNQA 2JNFA 1RWYA 4XJKB 1KK8B 2MHHA 1YRTB 2NCOA 1DGUA 4FTGA 1TIZA 1K93D 3OX5A 1S5GZ 3RM1A 1JFKA 2EC6C 4MSPA 2JZIA 2F8PA 1TNPA 2K2AA 4MZKA 1M39A 2A4JA 1V1FA 5HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  1A2X A;  3TUY B;  1XFV O;  2AMI A;  2DOQ A;  1KK8 C;  2KI4 B;  1S26 D;  3I5I B;  4GGN A;  1NCZ A;  4AQJ A;  1PVA A;  5B8I B;  3VRR A;  2LP3 A;  4HRH A;  1IJ6 A;  1QVI Y;  4XYN A;  5HYD A;  2MRD A;  1G8I A;  5AAN A;  4HRE E;  2BCA A;  4CID A;  3IQQ A;  5CSJ A;  2L0P A;  4P2Y B;  1XYD A;  1IQ3 A;  2L98 A;  2JUL A;  4L9M A;  1DJW A;  1L7Z A;  1NX1 A;  1XK4 A;  2ZN9 A;  3TUY C;  1OOJ A;  2JQ6 A;  1R2U A;  2G2B A;  1S3P A;  1YVL A;  2KI4 C;  3I5I C;  3PAL A;  1JWD A;  1BLQ A;  1PSB A;  1KFX L;  3JVT C;  1A29 A;  1PVB A;  1WLM A;  2MLE C;  2ZKM X;  3AAJ A;  3CR5 X;  4OKH A;  5GQQ C;  5IBW A;  1B47 A;  1BG1 A;  1CLB A;  1CLL A;  2K7B A;  1QJT A;  1EL4 A;  1K94 A;  4ZCU A;  1KQV A;  2JT3 A;  1PRW A;  5G08 A;  1ODB A;  3AAK A;  2M1U A;  1CNP A;  5HKW A;  3GOF A;  2I94 A;  2PAS A;  1TCO B;  2CCM A;  3PLF B;  2I7A A;  2M1K B;  1UHI A;  2HPS A;  2QPT A;  1XK4 C;  3OB2 B;  2KQ6 A;  1CDM A;  1S36 A;  1M46 A;  1DMO A;  3K21 A;  2LVK A;  2H61 A;  5I2O A;  2KFG A;  1TOP A;  3EK8 A;  1QX2 A;  2GGM A;  5PAL A;  2KYC A;  5CSI A;  2CTN A;  2KAX A;  4OCI A;  2BKI B;  1DVI A;  2JU0 A;  2AAO A;  5KSZ A;  1D1O A;  4F0Z B;  1JF2 A;  2JXC A;  2M9G A;  2PRU A;  2NZ0 A;  4GPL B;  1M31 A;  1PUL A;  1B1G A;  1Y1X A;  3E3R A;  1AJ5 A;  2KSP A;  2O5G A;  1XFX O;  1MUX A;  2KFF A;  2ZRS A;  1FI6 A;  1RJV A;  3SJS A;  4CPV A;  2L2E A;  4NDD A;  3EKJ A;  1R6P A;  1BMO A;  3I5G B;  1F4Q A;  4I5N B;  4TNC A;  3SG7 A;  1AK8 A;  1LIN A;  2Y1M A;  2H61 C;  2JT0 A;  3TZ1 A;  1OZS A;  4JPZ B;  1CM1 A;  2M29 A;  1TCF A;  1ZMZ A;  4MZJ A;  3SIB A;  2M97 A;  2LHI A;  1B7T Y;  3O78 A;  1FI5 A;  1BU3 A;  1IKU A;  2K61 A;  1QLK A;  2JTT A;  3LK0 A;  4MN0 A;  1KWO B;  3EK4 A;  2F33 A;  2BBM A;  2LUC A;  3I5G C;  4YGB B;  3WHU B;  1CFF A;  4PE4 A;  1SY9 A;  4I5L B;  1CDP A;  2K7D A;  3VRQ A;  4ETO A;  4I5K A;  2Y5I A;  1ALW A;  2IS9 A;  2KNE A;  1FBV A;  2LNK A;  2Y4Q A;  3NXA A;  3AKA A;  1DJH A;  2G9B A;  4GUK A;  1BOD A;  3I5H B;  1KWO C;  2MBX A;  1Q80 A;  4WQ2 A;  1SL9 A;  1KK7 Y;  2E30 A;  1KQM B;  1MR8 A;  1N0Y A;  1K9U A;  1MQ1 A;  4PE7 A;  1EXR A;  4YI9 A;  4AQI A;  1KFX S;  5DKQ A;  2NXQ A;  1LA3 A;  4WQ3 A;  3DF0 A;  4PE0 A;  1JF0 A;  1OSA A;  1B8R A;  2GGZ A;  2CT9 A;  5I2Q A;  2FCD A;  1Y1A A;  3LL8 B;  1NUB A;  2OTG B;  3CGA A;  1KQM C;  3QRX A;  2TN4 A;  4MRY A;  1NWD A;  3DF0 B;  1UWO A;  3LK1 A;  1CM4 A;  4PHN A;  2LM5 A;  3M0W A;  1SL8 A;  5AER A;  3HX4 A;  1JUO A;  2JOJ A;  2SCP A;  1JBA A;  3I5F B;  1Y0V H;  1YTZ C;  2MAZ A;  1GQM A;  1HT9 A;  1F4O A;  3CTN A;  2ZN8 A;  3KF9 A;  2RGI A;  3DVJ A;  2M49 B;  4QJ4 B;  1IWQ A;  2OTG C;  1PAL A;  3LLE A;  3EK7 A;  1H8B A;  1AUI B;  3BQ3 A;  2KI6 C;  1QXP A;  5BPJ A;  1KCY A;  3TS5 B;  1QX5 B;  1AJ4 A;  3BUW B;  1KSM A;  2BCX A;  1L2O B;  4GBA A;  3PM8 A;  1CDL A;  5ER4 X;  1J7R A;  2KQY A;  2KFH A;  3A4U B;  4OR9 B;  1N65 A;  1YX8 A;  2F3Y A;  3H4S E;  2K7O A;  2GV5 A;  2KHN A;  1UHH A;  1UHK A;  1Y1U A;  3FWC A;  4UPG A;  1FPW A;  1SW8 A;  1DTL A;  2K2F A;  3TS5 C;  5DKN A;  4PHK A;  5AEQ A;  1L2O C;  4GFT A;  4GGF A;  1HQV A;  1S1E A;  1IRJ A;  1K9P A;  1A03 A;  1OMR A;  1WY9 A;  1QVI Z;  2MJW B;  3A8R A;  1ZAC A;  1C07 A;  3CR2 A;  3MSE B;  3PAT A;  2Q91 A;  1NCX A;  4U8D A;  1UUR A;  1SPY A;  1YR5 A;  4BY5 A;  2HET A;  4MLW A;  5FYX A;  2LVI A;  4NDB A;  2AUC A;  1K2H A;  3CLN A;  4E68 A;  2FJU B;  1S6J A;  2K8M B;  2ZND A;  3AKB A;  3C1V A;  4QJ3 B;  1MF8 B;  2EHB A;  3IQO A;  4ORC B;  2OS8 B;  2LHL A;  4A4C A;  1F55 A;  3SIA A;  1MWN A;  3CS1 A;  2BE6 A;  4GAO A;  1SRA A;  2PVB A;  1ZOT B;  4YGC B;  1FF1 A;  2ZFD A;  3CR4 X;  3SG3 A;  3BUO B;  2LAN A;  3CZT X;  3DVE A;  4P5O E;  3WHT B;  1K96 A;  1YVH A;  1OMV A;  2LE9 B;  4GGF C;  2KAV A;  2M0R A;  5AFP A;  1XA5 A;  1NYA A;  1WLZ A;  4ZCV A;  1MXE A;  3KEV A;  4JWQ A;  2FCE A;  1ZUZ A;  2M7N A;  4DIR A;  1DT7 B;  4NQG A;  2KBM A;  2LMV A;  1QTX A;  1QV1 A;  2I2R E;  1XO5 A;  3GK1 A;  2VRG A;  3BYA A;  3PN7 B;  1DJI A;  1GGZ A;  2OPO A;  3OB1 B;  4HSZ A;  1YUR A;  2F2O A;  1LXF C;  3SG2 A;  1U5I A;  2JNX A;  4FQO A;  1IJ5 A;  4YI8 A;  4YGE B;  1BT6 A;  1UP5 A;  3NSK A;  2H2K A;  5CSN A;  4M2Q A;  2PSR A;  1WDC B;  4DCK A;  2I18 A;  1U5I B;  1UHJ A;  1J7O A;  1J1D A;  3VRO A;  2WCF A;  1JSA A;  3PN7 C;  4A4B A;  1EJ3 A;  1S6C A;  1B8C A;  2LAP A;  3DVM A;  2L5X B;  2COL B;  1PSR A;  3EVR A;  1EG4 A;  4IL1 A;  1WDC C;  1CLM A;  2WOR A;  4PE1 A;  2WOS A;  1A4P A;  1C7W A;  3PSR A;  1QAT A;  1IH0 A;  1MXL C;  1EH2 A;  1G4Y R;  3OP0 A;  1AP4 A;  1M45 A;  1CB1 A;  3NSO A;  2JPT A;  2LMT A;  1DJZ A;  1B7T Z;  1S5G Y;  2K7C A;  2WCB A;  2L50 A;  4PDZ A;  2KYF A;  1J55 A;  1NP8 A;  1KFU L;  2CXJ A;  1CKK A;  2BCB A;  1WRK A;  1MHO A;  3I5H C;  3SG4 A;  1SCM B;  2FOT A;  4MVF A;  1J7P A;  2L4H A;  2M3W A;  4YRU A;  3EVV A;  3OX6 A;  1SNL A;  1CDN A;  1ZFS A;  2Y1N A;  1QV0 A;  1AHR A;  4ORA B;  2NCP A;  1B4C A;  1TN4 A;  1YUT A;  4N1G A;  4PHJ A;  3VRN A;  2K0J A;  3PFV A;  1VRK A;  2LLT A;  2LP2 A;  2LUX A;  4JQ0 D;  2LLU A;  3D0Y A;  4USL A;  1KK7 Z;  3RLZ A;  2P6B B;  4OV2 A;  2JRF A;  1JFJ A;  1AVS A;  2ISD A;  4CFQ A;  2F3Z A;  3FWB A;  2MLF C;  1X02 A;  2L4I A;  2JC2 A;  2LVV A;  3D0Y B;  1BR1 B;  1YUS A;  4ICB A;  3CWG A;  3I5F C;  3WNX B;  1NPQ A;  4R1E A;  1QLS A;  1QIW A;  1W7J B;  2ZRT A;  1W7I B;  3KPX A;  3JTD B;  3IF7 A;  3VRP A;  1OE9 B;  5HKY A;  4YGA A;  2QAC A;  5I8N A;  1SYM A;  3JVT B;  3EVU A;  4DS7 A;  1NX2 A;  1SKT A;  1K90 D;  1OQP A;  1RRO A;  4M2P A;  1IQ5 A;  2WC8 A;  5F6T A;  1SK6 D;  1SCV A;  4CLN A;  3GK2 A;  2KI6 D;  1DJG A;  1QS7 A;  4GNK B;  1IGV A;  1SMG A;  5AXI A;  3JTD C;  4C0L A;  4CFR A;  1BJF A;  3LCP C;  3VGO A;  1RTP 1;  4MRX A;  2O60 A;  1RFJ A;  2KOT A;  2WCE A;  1NX0 A;  1F8H A;  4OVN F;  5JOL A;  1CMG A;  1YRU B;  1BOC A;  3FIA A;  1JC2 A;  1XFY O;  1V1G A;  4DRW A;  1DGV A;  1BR4 B;  3DVK A;  3ZNI A;  2JTZ A;  2KGR A;  4HRG A;  1K8U A;  1TNX A;  1GJY A;  1M63 B;  2L51 A;  4YBH B;  5DKR A;  3BXK A;  4M2O A;  2LCP A;  1TTX A;  4NDC A;  1N2D A;  1KSO A;  3NSL A;  2B1U A;  1YX7 A;  2OS8 C;  1ALV A;  4MBE A;  1K95 A;  1J7Q A;  4N5X A;  1C7V A;  4ORB B;  1F71 A;  4MZL A;  3O2P A;  4DUQ A;  2LC5 A;  1DF0 A;  1XFU O;  5HKZ A;  1OMD A;  3TDU A;  2E6W A;  2NLN A;  3O6B A;  4Q04 A;  4AOM A;  1KFU S;  1CFD A;  2CNP A;  5D7F A;  4YGD B;  4BY4 A;  1NSH A;  1CFP A;  2CBL A;  1B9A A;  3HCM A;  1DF0 B;  1SR6 B;  2PAL A;  2Q4U A;  3TDZ A;  1LKJ A;  4WRI A;  3WXA A;  5K89 A;  2KGB C;  5CPV A;  5D69 A;  2M7L A;  4PAL A;  2EGD A;  1WRL A;  1BF5 A;  2JT8 A;  1B8L A;  1EG3 A;  1QAS A;  2BL0 B;  1F70 A;  2F2P A;  1XFW O;  1DJX A;  2ZNE A;  1CTR A;  3BUN B;  2LVJ A;  2LV7 A;  1A75 A;  1TNW A;  1XFZ O;  2BBN A;  3DD4 A;  3KO0 A;  4I5J A;  5J3X A;  1SR6 C;  1QX7 A;  2V53 A;  2BEC A;  1OZO A;  1YUU A;  1H4B A;  4N1F A;  2JWW A;  2KDH A;  1Y6W A;  1CFC A;  1NX3 A;  1UUS A;  3SG6 A;  5CSF A;  1A75 B;  4D1E A;  3BOW A;  1WRZ A;  2BL0 C;  3GK4 X;  4PHM A;  1F54 A;  3ICB A;  1NCY A;  5I2L A;  5HLV A;  2HQW A;  2PMY A;  1PK0 D;  3OHM B;  3BUM B;  3SG5 A;  1SL7 A;  2KBI A;  1TRF A;  2D8N A;  3TDI A;  1K9K A;  1QIV A;  5KTY A;  3BOW B;  1DJY A;  2BE4 A;  5JJG A;  2HF5 A;  3BUX B;  3F45 A;  1LA0 A;  4MEW A;  4C0J A;  3D10 A;  1CMF A;  1XVJ A;  1GGW A;  2BKH B;  1LVC D;  2JXL A;  1NIW A;  3FS7 A;  5ER5 A;  1J1E A;  2LLS A;  4PCW A;  1IG5 A;  5TNC A;  1S6I A;  3EKH A;  4QJ5 B;  3O4Y A;  2SAS A;  2KAY A;  2HQ8 A;  2WND A;  3NSI A;  5KU1 A;  2EC6 B;  1RK9 A;  4XJK A;  1REC A;  4C0K A;  3KHE A;  1E8A A;  2R2I A;  1G33 A;  3ZWH A;  2M8U A;  1UHN A;  2LMU A;  2MA2 A;  1FW4 A;  1SCM C;  1TNQ A;  2JNF A;  1RWY A;  4XJK B;  1KK8 B;  2MHH A;  1YRT B;  2NCO A;  1DGU A;  4FTG A;  1TIZ A;  1K93 D;  3OX5 A;  1S5G Z;  3RM1 A;  1JFK A;  2EC6 C;  4MSP A;  2JZI A;  2F8P A;  1TNP A;  2K2A A;  4MZK A;  1M39 A;  2A4J A;  1V1F A;  5HLO A; 
#chains in the Genus database with same CATH topology
 1SBJ A;  1A2X A;  3TUY B;  1XFV O;  2AMI A;  2DOQ A;  3S0D A;  1KK8 C;  2KI4 B;  1S26 D;  3I5I B;  4GGN A;  1NCZ A;  4AQJ A;  1PVA A;  5B8I B;  3VRR A;  1XFR A;  2LP3 A;  4HRH A;  1IJ6 A;  1QVI Y;  3BFA A;  4XYN A;  5HYD A;  2MRD A;  1G8I A;  5AAN A;  4HRE E;  2BCA A;  4CID A;  3IQQ A;  5CSJ A;  2L0P A;  4P2Y B;  1XYD A;  3QME A;  2L98 A;  4FQT A;  1IQ3 A;  2JUL A;  4L9M A;  1DJW A;  1L7Z A;  1DEL A;  1LS8 A;  1NX1 A;  1XK4 A;  2ZN9 A;  3TUY C;  1OOJ A;  2JQ6 A;  1R2U A;  2WC6 A;  3SG2 A;  2G2B A;  1S3P A;  1YVL A;  2KI4 C;  3I5I C;  3PAL A;  1JWD A;  1BLQ A;  1PSB A;  1KFX L;  1T14 A;  1A29 A;  1PVB A;  1WLM A;  2MLE C;  2ZKM X;  3AAJ A;  3CR5 X;  3JVT C;  4OKH A;  5GQQ C;  1B47 A;  5IBW A;  1BG1 A;  1CLB A;  1CLL A;  2K7B A;  1QJT A;  1EL4 A;  1K94 A;  4ZCU A;  1KQV A;  2JT3 A;  1PRW A;  5G08 A;  1ODB A;  3AAK A;  3R1P A;  2M1U A;  1CNP A;  5HKW A;  3GOF A;  5I94 A;  2I94 A;  2PAS A;  1TCO B;  2CCM A;  3PLF B;  2I7A A;  2M1K B;  1UHI A;  2HPS A;  2QPT A;  1XK4 C;  3UNW A;  3OB2 B;  5EL2 A;  2KQ6 A;  3DYE A;  1CDM A;  1S36 A;  3FE9 A;  1M46 A;  1DMO A;  3K21 A;  2LVK A;  2H61 A;  5I2O A;  2KFG A;  1TOP A;  3EK8 A;  1QX2 A;  2GGM A;  5PAL A;  2KYC A;  5CSI A;  1DC1 A;  2CTN A;  2KAX A;  4OCI A;  2BKI B;  1DVI A;  2JU0 A;  2AAO A;  5KSZ A;  1D1O A;  4F0Z B;  1JF2 A;  2JXC A;  2M9G A;  2PRU A;  2NZ0 A;  4GPL B;  1M31 A;  1PUL A;  1B1G A;  1Y1X A;  3E3R A;  1AJ5 A;  2KSP A;  2O5G A;  1XFX O;  1MUX A;  2KFF A;  2ZRS A;  1FI6 A;  1RJV A;  3SJS A;  3R1O A;  4CPV A;  2L2E A;  4NDD A;  3EKJ A;  1R6P A;  4JKT A;  1BMO A;  3I5G B;  1OOF A;  1F4Q A;  3L4A A;  4I5N B;  4TNC A;  3SG7 A;  1AK8 A;  1LIN A;  2Y1M A;  3NHT A;  3D73 A;  4INW A;  2QEH A;  2H61 C;  2JT0 A;  3TZ1 A;  3D75 A;  1OZS A;  4JPZ B;  1CM1 A;  2M29 A;  1DEK A;  1TCF A;  1ZMZ A;  2K60 A;  3L4L A;  4MZJ A;  3CZ1 A;  3SIB A;  1Z4H A;  2M97 A;  2LHI A;  1B7T Y;  3O78 A;  3SS3 A;  1FI5 A;  1BU3 A;  1IKU A;  2K61 A;  1QLK A;  2JTT A;  3LK0 A;  4MN0 A;  1KWO B;  3EK4 A;  2F33 A;  2BBM A;  2LUC A;  3CYZ A;  3I5G C;  4YGB B;  3WHU B;  1CFF A;  4PE4 A;  3O4X A;  1SY9 A;  4I5L B;  1CDP A;  2K7D A;  3VRQ A;  4ETO A;  4I5K A;  2Y5I A;  1ALW A;  2IS9 A;  2KNE A;  1FBV A;  2LNK A;  2Y4Q A;  3NXA A;  3Q8I A;  3AKA A;  1DJH A;  2G9B A;  4GUK A;  1BOD A;  2YGU A;  3I5H B;  1KWO C;  2FJY A;  2MBX A;  1Q80 A;  4WQ2 A;  1SL9 A;  2H8V A;  1KK7 Y;  2E30 A;  1KQM B;  3BJH A;  2WCH A;  1MR8 A;  1N0Y A;  1K9U A;  1MQ1 A;  4PE7 A;  3FE6 A;  1EXR A;  4KYN A;  4YI9 A;  3SS5 A;  4AQI A;  1KFX S;  5DKQ A;  2NXQ A;  3OGN A;  1LA3 A;  4WQ3 A;  3DF0 A;  4PE0 A;  1JF0 A;  1OSA A;  3DXL A;  1B8R A;  2GGZ A;  2CT9 A;  5I2Q A;  2FCD A;  1Y1A A;  3LL8 B;  4JD9 A;  1NUB A;  2OTG B;  2WCJ A;  3CGA A;  1KQM C;  3QRX A;  2TN4 A;  4MRY A;  1NWD A;  3DF0 B;  1UWO A;  3LK1 A;  1CM4 A;  4PHN A;  2LM5 A;  3M0W A;  1SL8 A;  5AER A;  3HX4 A;  1JUO A;  2JOJ A;  2SCP A;  1JBA A;  3I5F B;  3S0B A;  1Y0V H;  1YTZ C;  2MAZ A;  1GQM A;  1HT9 A;  1F4O A;  3CTN A;  2ZN8 A;  3EG5 B;  3RZS A;  3KF9 A;  2RGI A;  3DVJ A;  2M49 B;  4QJ4 B;  1IWQ A;  2OTG C;  1ORG A;  1PAL A;  3LLE A;  3EK7 A;  1H8B A;  1AUI B;  3BQ3 A;  2KI6 C;  1QXP A;  3CZ2 A;  5BPJ A;  4PT1 A;  1KCY A;  3TS5 B;  1QX5 B;  1AJ4 A;  3BUW B;  1OW4 A;  1KSM A;  2BCX A;  1L2O B;  3B7A A;  4GBA A;  3PM8 A;  1CDL A;  5ER4 X;  1J7R A;  2KQY A;  2KFH A;  3A4U B;  4OR9 B;  1N65 A;  1YX8 A;  1QWV A;  2F3Y A;  3S0F A;  3H4S E;  2K7O A;  2GV5 A;  2KHN A;  1UHH A;  1UHK A;  1Y1U A;  3FWC A;  4UPG A;  1FPW A;  1SW8 A;  1DTL A;  2K2F A;  3TS5 C;  5DKN A;  3D74 A;  4PHK A;  5AEQ A;  1L2O C;  3N7H A;  4GFT A;  4GGF A;  1HQV A;  1S1E A;  1IRJ A;  1K9P A;  1A03 A;  1OMR A;  1WY9 A;  1QVI Z;  2MJW B;  3A8R A;  5FI6 A;  1ZAC A;  1TUJ A;  3CR2 A;  1P28 A;  3MSE B;  3PAT A;  2Q91 A;  1NCX A;  1C07 A;  4U8D A;  1UUR A;  1SPY A;  1YR5 A;  4BY5 A;  2HET A;  4MLW A;  5FYX A;  2LVI A;  4NDB A;  2AUC A;  2WCM A;  1K2H A;  3CLN A;  4E68 A;  2FJU B;  1S6J A;  2K8M B;  2ZND A;  3AKB A;  3C1V A;  4QJ3 B;  1GM0 A;  1MF8 B;  2EHB A;  3IQO A;  4ORC B;  2OS8 B;  2KLD A;  2L2C A;  2LHL A;  3CDN A;  3SIA A;  4A4C A;  1F55 A;  1MWN A;  1SSE B;  5HL1 A;  1TWO A;  3CS1 A;  3OBV A;  5DIC A;  2BE6 A;  4GAO A;  1SRA A;  2PVB A;  1ZOT B;  4YGC B;  3VB1 A;  1FF1 A;  2ZFD A;  3CR4 X;  3SG3 A;  3BUO B;  2LAN A;  3CZT X;  3DVE A;  4P5O E;  3WHT B;  1K96 A;  1YVH A;  1OMV A;  2LE9 B;  4GGF C;  2KAV A;  2M0R A;  5AFP A;  1XA5 A;  1NYA A;  1WLZ A;  4ZCV A;  1MXE A;  3KEV A;  4JWQ A;  2FCE A;  3S0G A;  3UO9 A;  1ZUZ A;  2M7N A;  3BFB A;  4DIR A;  1DT7 B;  4NQG A;  2KBM A;  2LMV A;  1OOH A;  1QTX A;  1QV1 A;  2KPH A;  3D77 A;  2I2R E;  1XO5 A;  3GK1 A;  2VRG A;  3BYA A;  3PN7 B;  1DJI A;  1GGZ A;  2OPO A;  3OB1 B;  4HSZ A;  1TUZ A;  1YUR A;  1LXF C;  2F2O A;  1U5I A;  2JNX A;  4FQO A;  1IJ5 A;  2QEB A;  4YI8 A;  1BT6 A;  4YGE B;  1C3Y A;  1UP5 A;  3NSK A;  2H2K A;  5CSN A;  4M2Q A;  2PSR A;  2WCK A;  3CZ0 A;  1WDC B;  4DCK A;  2I18 A;  1U5I B;  1UHJ A;  1J7O A;  1J1D A;  3VRO A;  2WCF A;  1JSA A;  3PN7 C;  4A4B A;  1EJ3 A;  1S6C A;  1B8C A;  4OZD A;  2P71 A;  2LAP A;  3DVM A;  2L5X B;  2WC5 A;  5FI2 A;  2COL B;  1PSR A;  3EVR A;  1EG4 A;  4IL1 A;  1WDC C;  1CLM A;  2WOR A;  3PJI A;  4PE1 A;  2WOS A;  3S0A A;  1A4P A;  1C7W A;  3PSR A;  1QAT A;  1IH0 A;  1MXL C;  1EH2 A;  1G4Y R;  3OP0 A;  1AP4 A;  1M45 A;  1CB1 A;  2PYQ A;  3NSO A;  1Z2C B;  2JPT A;  2LMT A;  1DJZ A;  1B7T Z;  1S5G Y;  2K7C A;  2WCB A;  2L50 A;  4PDZ A;  2KYF A;  1J55 A;  1NP8 A;  1KFU L;  2CXJ A;  1CKK A;  3L47 A;  2BCB A;  1WRK A;  1MHO A;  3I5H C;  2ERB A;  3SG4 A;  1SCM B;  2FOT A;  4MVF A;  1J7P A;  3D76 A;  3V2L A;  2L4H A;  2M3W A;  4YRU A;  3EVV A;  3OX6 A;  1SNL A;  1CDN A;  1ZFS A;  2Y1N A;  1QV0 A;  1AHR A;  4ORA B;  2NCP A;  2KLE A;  1B4C A;  1TN4 A;  1YUT A;  4N1G A;  4PHJ A;  3VRN A;  3PM2 A;  2K0J A;  3PFV A;  1VRK A;  2LLT A;  2LP2 A;  2LUX A;  4JQ0 D;  2LLU A;  3D0Y A;  4USL A;  1KK7 Z;  3RLZ A;  2P6B B;  1C3Z A;  3FE8 A;  2L5Y A;  4OV2 A;  2JRF A;  1JFJ A;  1AVS A;  2ISD A;  4CFQ A;  2F3Z A;  3FWB A;  2MLF C;  1X02 A;  2L4I A;  2JC2 A;  2LVV A;  3D0Y B;  1BR1 B;  1YUS A;  4ICB A;  3D78 A;  3CWG A;  3I5F C;  3R72 A;  3WNX B;  1NPQ A;  4R1E A;  1QLS A;  1QIW A;  4INX A;  1IIO A;  1W7J B;  2ZRT A;  4F7F A;  1W7I B;  3KPX A;  3JTD B;  3IF7 A;  3VRP A;  1OE9 B;  3NGV A;  5HKY A;  4YGA A;  2QAC A;  5I8N A;  1SYM A;  3B6X A;  3JVT B;  3EVU A;  4DS7 A;  2BAP A;  1NX2 A;  1SKT A;  1K90 D;  1OQP A;  1RRO A;  4M2P A;  1IQ5 A;  2WC8 A;  5F6T A;  1SK6 D;  1SCV A;  4CLN A;  3GK2 A;  2KI6 D;  1DJG A;  1QS7 A;  4GNK B;  1IGV A;  1SMG A;  5AXI A;  3JTD C;  4C0L A;  4CFR A;  1BJF A;  3LCP C;  2QDI A;  3VGO A;  1RTP 1;  4MRX A;  2O60 A;  1RFJ A;  2KOT A;  2WCE A;  1NX0 A;  1F8H A;  2JPO A;  4OVN F;  5JOL A;  1CMG A;  1YRU B;  3S0E A;  1OOI X;  1BOC A;  3FIA A;  2WCL A;  1XFY O;  3R1V A;  1JC2 A;  1V1G A;  4DRW A;  1DGV A;  1BR4 B;  3DVK A;  3ZNI A;  1W9Z A;  2JTZ A;  2KGR A;  4HRG A;  1K8U A;  1TNX A;  1GJY A;  1M63 B;  2L51 A;  4YBH B;  5DKR A;  3BXK A;  4M2O A;  2LCP A;  1TTX A;  4NDC A;  1N2D A;  1KSO A;  3NSL A;  2B1U A;  1YX7 A;  2OS8 C;  1ALV A;  4MBE A;  1K95 A;  1J7Q A;  4N5X A;  1C7V A;  4ORB B;  1F71 A;  4MZL A;  3O2P A;  5D3O A;  4DUQ A;  2LC5 A;  1DF0 A;  1XFU O;  5HKZ A;  1OMD A;  2P70 A;  2E6W A;  2NLN A;  3O6B A;  4Q04 A;  3TDU A;  4AOM A;  3SS4 A;  1KFU S;  1CFD A;  2CNP A;  5D7F A;  4YGD B;  4BY4 A;  1NSH A;  1CFP A;  2CBL A;  1B9A A;  2QEV A;  3HCM A;  1DF0 B;  1SR6 B;  2PAL A;  2Q4U A;  3TDZ A;  1LKJ A;  4WRI A;  3WXA A;  5K89 A;  2KGB C;  5CPV A;  5D69 A;  2M7L A;  2QEO A;  3CAB A;  4PAL A;  2EGD A;  1WRL A;  1BF5 A;  2JT8 A;  1B8L A;  1EG3 A;  3B88 A;  1QAS A;  2BL0 B;  1F70 A;  3IVT A;  2F2P A;  1XFW O;  1DJX A;  2ZNE A;  1CTR A;  3BUN B;  3DY9 A;  2LVJ A;  2LV7 A;  1A75 A;  1TNW A;  1XFZ O;  2BBN A;  3DD4 A;  2BNX A;  3KO0 A;  4I5J A;  5J3X A;  1SR6 C;  1QX7 A;  2V53 A;  2BEC A;  1OZO A;  1OOG A;  1YUU A;  3BFH A;  1H4B A;  4N1F A;  2JWW A;  2KDH A;  1Y6W A;  1CFC A;  1NX3 A;  1UUS A;  5FI7 A;  3SG6 A;  5CSF A;  1A75 B;  4D1E A;  3BOW A;  1WRZ A;  2BL0 C;  3GK4 X;  4PHM A;  4IJ7 A;  1F54 A;  3ICB A;  1NCY A;  5I2L A;  5HLV A;  2HQW A;  2PMY A;  1DQE A;  3K1E A;  1PK0 D;  3OHM B;  3BUM B;  3SG5 A;  1SL7 A;  2KBI A;  1TRF A;  2D8N A;  3B87 A;  3TDI A;  1K9K A;  1QIV A;  5KTY A;  3BOW B;  1DJY A;  2BE4 A;  5JJG A;  2HF5 A;  3BUX B;  3F45 A;  1LA0 A;  4MEW A;  4C0J A;  3D10 A;  1CMF A;  1XVJ A;  1GGW A;  2BKH B;  3NHI A;  1LVC D;  2JXL A;  1NIW A;  3FS7 A;  5ER5 A;  1J1E A;  2LLS A;  4PCW A;  1IG5 A;  5TNC A;  1S6I A;  3EKH A;  4QJ5 B;  3O4Y A;  2SAS A;  2KAY A;  2HQ8 A;  2WND A;  3DZT A;  3NSI A;  5KU1 A;  2EC6 B;  1RK9 A;  4XJK A;  1REC A;  4C0K A;  3KHE A;  1E8A A;  2R2I A;  1G33 A;  3ZWH A;  2M8U A;  1UHN A;  2LMU A;  2MA2 A;  1FW4 A;  1SCM C;  1TNQ A;  2JNF A;  1RWY A;  4XJK B;  1KK8 B;  2MHH A;  2GTE A;  1YRT B;  2NCO A;  1DGU A;  4FTG A;  1TIZ A;  1K93 D;  2PQL A;  3OX5 A;  1S5G Z;  3B86 A;  3RM1 A;  1JFK A;  2EC6 C;  4MSP A;  2JZI A;  2F8P A;  1TNP A;  2K2A A;  4MZK A;  1M39 A;  2A4J A;  1V1F A;  5HLO A; 
#chains in the Genus database with same CATH homology
 1SBJ A;  1A2X A;  3TUY B;  1XFV O;  2AMI A;  2DOQ A;  1KK8 C;  2KI4 B;  1S26 D;  3I5I B;  4GGN A;  1NCZ A;  4AQJ A;  1PVA A;  5B8I B;  3VRR A;  2LP3 A;  4HRH A;  1IJ6 A;  1QVI Y;  4XYN A;  5HYD A;  2MRD A;  1G8I A;  5AAN A;  4HRE E;  2BCA A;  4CID A;  3IQQ A;  5CSJ A;  2L0P A;  4P2Y B;  1XYD A;  1IQ3 A;  2L98 A;  2JUL A;  4L9M A;  1DJW A;  1L7Z A;  1NX1 A;  1XK4 A;  2ZN9 A;  3TUY C;  1OOJ A;  2JQ6 A;  1R2U A;  2G2B A;  1S3P A;  1YVL A;  2KI4 C;  3I5I C;  3PAL A;  1JWD A;  1BLQ A;  1PSB A;  1KFX L;  3JVT C;  1A29 A;  1PVB A;  1WLM A;  2MLE C;  2ZKM X;  3AAJ A;  3CR5 X;  4OKH A;  5GQQ C;  5IBW A;  1B47 A;  1BG1 A;  1CLB A;  1CLL A;  2K7B A;  1QJT A;  1EL4 A;  1K94 A;  4ZCU A;  1KQV A;  2JT3 A;  1PRW A;  5G08 A;  1ODB A;  3AAK A;  2M1U A;  1CNP A;  5HKW A;  3GOF A;  2I94 A;  2PAS A;  1TCO B;  2CCM A;  3PLF B;  2I7A A;  2M1K B;  1UHI A;  2HPS A;  2QPT A;  1XK4 C;  3OB2 B;  2KQ6 A;  1CDM A;  1S36 A;  1M46 A;  1DMO A;  3K21 A;  2LVK A;  2H61 A;  5I2O A;  2KFG A;  1TOP A;  3EK8 A;  1QX2 A;  2GGM A;  5PAL A;  2KYC A;  5CSI A;  2CTN A;  2KAX A;  4OCI A;  2BKI B;  1DVI A;  2JU0 A;  2AAO A;  5KSZ A;  1D1O A;  4F0Z B;  1JF2 A;  2JXC A;  2M9G A;  2PRU A;  2NZ0 A;  4GPL B;  1M31 A;  1PUL A;  1B1G A;  1Y1X A;  3E3R A;  1AJ5 A;  2KSP A;  2O5G A;  1XFX O;  1MUX A;  2KFF A;  2ZRS A;  1FI6 A;  1RJV A;  3SJS A;  4CPV A;  2L2E A;  4NDD A;  3EKJ A;  1R6P A;  1BMO A;  3I5G B;  1F4Q A;  4I5N B;  4TNC A;  3SG7 A;  1AK8 A;  1LIN A;  2Y1M A;  2H61 C;  2JT0 A;  3TZ1 A;  1OZS A;  4JPZ B;  1CM1 A;  2M29 A;  1TCF A;  1ZMZ A;  4MZJ A;  3SIB A;  2M97 A;  2LHI A;  1B7T Y;  3O78 A;  1FI5 A;  1BU3 A;  1IKU A;  2K61 A;  1QLK A;  2JTT A;  3LK0 A;  4MN0 A;  1KWO B;  3EK4 A;  2F33 A;  2BBM A;  2LUC A;  3I5G C;  4YGB B;  3WHU B;  1CFF A;  4PE4 A;  1SY9 A;  4I5L B;  1CDP A;  2K7D A;  3VRQ A;  4ETO A;  4I5K A;  2Y5I A;  1ALW A;  2IS9 A;  2KNE A;  1FBV A;  2LNK A;  2Y4Q A;  3NXA A;  3AKA A;  1DJH A;  2G9B A;  4GUK A;  1BOD A;  3I5H B;  1KWO C;  2MBX A;  1Q80 A;  4WQ2 A;  1SL9 A;  1KK7 Y;  2E30 A;  1KQM B;  1MR8 A;  1N0Y A;  1K9U A;  1MQ1 A;  4PE7 A;  1EXR A;  4YI9 A;  4AQI A;  1KFX S;  5DKQ A;  2NXQ A;  1LA3 A;  4WQ3 A;  3DF0 A;  4PE0 A;  1JF0 A;  1OSA A;  1B8R A;  2GGZ A;  2CT9 A;  5I2Q A;  2FCD A;  1Y1A A;  3LL8 B;  1NUB A;  2OTG B;  3CGA A;  1KQM C;  3QRX A;  2TN4 A;  4MRY A;  1NWD A;  3DF0 B;  1UWO A;  3LK1 A;  1CM4 A;  4PHN A;  2LM5 A;  3M0W A;  1SL8 A;  5AER A;  3HX4 A;  1JUO A;  2JOJ A;  2SCP A;  1JBA A;  3I5F B;  1Y0V H;  1YTZ C;  2MAZ A;  1GQM A;  1HT9 A;  1F4O A;  3CTN A;  2ZN8 A;  3KF9 A;  2RGI A;  3DVJ A;  2M49 B;  4QJ4 B;  1IWQ A;  2OTG C;  1PAL A;  3LLE A;  3EK7 A;  1H8B A;  1AUI B;  3BQ3 A;  2KI6 C;  1QXP A;  5BPJ A;  1KCY A;  3TS5 B;  1QX5 B;  1AJ4 A;  3BUW B;  1KSM A;  2BCX A;  1L2O B;  4GBA A;  3PM8 A;  1CDL A;  5ER4 X;  1J7R A;  2KQY A;  2KFH A;  3A4U B;  4OR9 B;  1N65 A;  1YX8 A;  2F3Y A;  3H4S E;  2K7O A;  2GV5 A;  2KHN A;  1UHH A;  1UHK A;  1Y1U A;  3FWC A;  4UPG A;  1FPW A;  1SW8 A;  1DTL A;  2K2F A;  3TS5 C;  5DKN A;  4PHK A;  5AEQ A;  1L2O C;  4GFT A;  4GGF A;  1HQV A;  1S1E A;  1IRJ A;  1K9P A;  1A03 A;  1OMR A;  1WY9 A;  1QVI Z;  2MJW B;  3A8R A;  1ZAC A;  1C07 A;  3CR2 A;  3MSE B;  3PAT A;  2Q91 A;  1NCX A;  4U8D A;  1UUR A;  1SPY A;  1YR5 A;  4BY5 A;  2HET A;  4MLW A;  5FYX A;  2LVI A;  4NDB A;  2AUC A;  1K2H A;  3CLN A;  4E68 A;  2FJU B;  1S6J A;  2K8M B;  2ZND A;  3AKB A;  3C1V A;  4QJ3 B;  1MF8 B;  2EHB A;  3IQO A;  4ORC B;  2OS8 B;  2LHL A;  4A4C A;  1F55 A;  3SIA A;  1MWN A;  3CS1 A;  2BE6 A;  4GAO A;  1SRA A;  2PVB A;  1ZOT B;  4YGC B;  1FF1 A;  2ZFD A;  3CR4 X;  3SG3 A;  3BUO B;  2LAN A;  3CZT X;  3DVE A;  4P5O E;  3WHT B;  1K96 A;  1YVH A;  1OMV A;  2LE9 B;  4GGF C;  2KAV A;  2M0R A;  5AFP A;  1XA5 A;  1NYA A;  1WLZ A;  4ZCV A;  1MXE A;  3KEV A;  4JWQ A;  2FCE A;  1ZUZ A;  2M7N A;  4DIR A;  1DT7 B;  4NQG A;  2KBM A;  2LMV A;  1QTX A;  1QV1 A;  2I2R E;  1XO5 A;  3GK1 A;  2VRG A;  3BYA A;  3PN7 B;  1DJI A;  1GGZ A;  2OPO A;  3OB1 B;  4HSZ A;  1YUR A;  2F2O A;  1LXF C;  3SG2 A;  1U5I A;  2JNX A;  4FQO A;  1IJ5 A;  4YI8 A;  4YGE B;  1BT6 A;  1UP5 A;  3NSK A;  2H2K A;  5CSN A;  4M2Q A;  2PSR A;  1WDC B;  4DCK A;  2I18 A;  1U5I B;  1UHJ A;  1J7O A;  1J1D A;  3VRO A;  2WCF A;  1JSA A;  3PN7 C;  4A4B A;  1EJ3 A;  1S6C A;  1B8C A;  2LAP A;  3DVM A;  2L5X B;  2COL B;  1PSR A;  3EVR A;  1EG4 A;  4IL1 A;  1WDC C;  1CLM A;  2WOR A;  4PE1 A;  2WOS A;  1A4P A;  1C7W A;  3PSR A;  1QAT A;  1IH0 A;  1MXL C;  1EH2 A;  1G4Y R;  3OP0 A;  1AP4 A;  1M45 A;  1CB1 A;  3NSO A;  2JPT A;  2LMT A;  1DJZ A;  1B7T Z;  1S5G Y;  2K7C A;  2WCB A;  2L50 A;  4PDZ A;  2KYF A;  1J55 A;  1NP8 A;  1KFU L;  2CXJ A;  1CKK A;  2BCB A;  1WRK A;  1MHO A;  3I5H C;  3SG4 A;  1SCM B;  2FOT A;  4MVF A;  1J7P A;  2L4H A;  2M3W A;  4YRU A;  3EVV A;  3OX6 A;  1SNL A;  1CDN A;  1ZFS A;  2Y1N A;  1QV0 A;  1AHR A;  4ORA B;  2NCP A;  1B4C A;  1TN4 A;  1YUT A;  4N1G A;  4PHJ A;  3VRN A;  2K0J A;  3PFV A;  1VRK A;  2LLT A;  2LP2 A;  2LUX A;  4JQ0 D;  2LLU A;  3D0Y A;  4USL A;  1KK7 Z;  3RLZ A;  2P6B B;  4OV2 A;  2JRF A;  1JFJ A;  1AVS A;  2ISD A;  4CFQ A;  2F3Z A;  3FWB A;  2MLF C;  1X02 A;  2L4I A;  2JC2 A;  2LVV A;  3D0Y B;  1BR1 B;  1YUS A;  4ICB A;  3CWG A;  3I5F C;  3WNX B;  1NPQ A;  4R1E A;  1QLS A;  1QIW A;  1W7J B;  2ZRT A;  1W7I B;  3KPX A;  3JTD B;  3IF7 A;  3VRP A;  1OE9 B;  5HKY A;  4YGA A;  2QAC A;  5I8N A;  1SYM A;  3JVT B;  3EVU A;  4DS7 A;  1NX2 A;  1SKT A;  1K90 D;  1OQP A;  1RRO A;  4M2P A;  1IQ5 A;  2WC8 A;  5F6T A;  1SK6 D;  1SCV A;  4CLN A;  3GK2 A;  2KI6 D;  1DJG A;  1QS7 A;  4GNK B;  1IGV A;  1SMG A;  5AXI A;  3JTD C;  4C0L A;  4CFR A;  1BJF A;  3LCP C;  3VGO A;  1RTP 1;  4MRX A;  2O60 A;  1RFJ A;  2KOT A;  2WCE A;  1NX0 A;  1F8H A;  4OVN F;  5JOL A;  1CMG A;  1YRU B;  1BOC A;  3FIA A;  1JC2 A;  1XFY O;  1V1G A;  4DRW A;  1DGV A;  1BR4 B;  3DVK A;  3ZNI A;  2JTZ A;  2KGR A;  4HRG A;  1K8U A;  1TNX A;  1GJY A;  1M63 B;  2L51 A;  4YBH B;  5DKR A;  3BXK A;  4M2O A;  2LCP A;  1TTX A;  4NDC A;  1N2D A;  1KSO A;  3NSL A;  2B1U A;  1YX7 A;  2OS8 C;  1ALV A;  4MBE A;  1K95 A;  1J7Q A;  4N5X A;  1C7V A;  4ORB B;  1F71 A;  4MZL A;  3O2P A;  4DUQ A;  2LC5 A;  1DF0 A;  1XFU O;  5HKZ A;  1OMD A;  3TDU A;  2E6W A;  2NLN A;  3O6B A;  4Q04 A;  4AOM A;  1KFU S;  1CFD A;  2CNP A;  5D7F A;  4YGD B;  4BY4 A;  1NSH A;  1CFP A;  2CBL A;  1B9A A;  3HCM A;  1DF0 B;  1SR6 B;  2PAL A;  2Q4U A;  3TDZ A;  1LKJ A;  4WRI A;  3WXA A;  5K89 A;  2KGB C;  5CPV A;  5D69 A;  2M7L A;  4PAL A;  2EGD A;  1WRL A;  1BF5 A;  2JT8 A;  1B8L A;  1EG3 A;  1QAS A;  2BL0 B;  1F70 A;  2F2P A;  1XFW O;  1DJX A;  2ZNE A;  1CTR A;  3BUN B;  2LVJ A;  2LV7 A;  1A75 A;  1TNW A;  1XFZ O;  2BBN A;  3DD4 A;  3KO0 A;  4I5J A;  5J3X A;  1SR6 C;  1QX7 A;  2V53 A;  2BEC A;  1OZO A;  1YUU A;  1H4B A;  4N1F A;  2JWW A;  2KDH A;  1Y6W A;  1CFC A;  1NX3 A;  1UUS A;  3SG6 A;  5CSF A;  1A75 B;  4D1E A;  3BOW A;  1WRZ A;  2BL0 C;  3GK4 X;  4PHM A;  1F54 A;  3ICB A;  1NCY A;  5I2L A;  5HLV A;  2HQW A;  2PMY A;  1PK0 D;  3OHM B;  3BUM B;  3SG5 A;  1SL7 A;  2KBI A;  1TRF A;  2D8N A;  3TDI A;  1K9K A;  1QIV A;  5KTY A;  3BOW B;  1DJY A;  2BE4 A;  5JJG A;  2HF5 A;  3BUX B;  3F45 A;  1LA0 A;  4MEW A;  4C0J A;  3D10 A;  1CMF A;  1XVJ A;  1GGW A;  2BKH B;  1LVC D;  2JXL A;  1NIW A;  3FS7 A;  5ER5 A;  1J1E A;  2LLS A;  4PCW A;  1IG5 A;  5TNC A;  1S6I A;  3EKH A;  4QJ5 B;  3O4Y A;  2SAS A;  2KAY A;  2HQ8 A;  2WND A;  3NSI A;  5KU1 A;  2EC6 B;  1RK9 A;  4XJK A;  1REC A;  4C0K A;  3KHE A;  1E8A A;  2R2I A;  1G33 A;  3ZWH A;  2M8U A;  1UHN A;  2LMU A;  2MA2 A;  1FW4 A;  1SCM C;  1TNQ A;  2JNF A;  1RWY A;  4XJK B;  1KK8 B;  2MHH A;  1YRT B;  2NCO A;  1DGU A;  4FTG A;  1TIZ A;  1K93 D;  3OX5 A;  1S5G Z;  3RM1 A;  1JFK A;  2EC6 C;  4MSP A;  2JZI A;  2F8P A;  1TNP A;  2K2A A;  4MZK A;  1M39 A;  2A4J A;  1V1F A;  5HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...