1HQVA

Structure of apoptosis-linked protein alg-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
178
Chain Sequence
PGPGGGPGPAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROGRAMMED CELL DEATH PROTEIN 6
publication title Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 64
structure length 178
sequence length 181
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1hqvA00
1KFXL 2LLSA 1DJZA 3LK1A 2D8NA 5DKNA 1QATA 5KTYA 1Y0VH 4R1EA 2G9BA 5D7FA 3DVMA 1K8UA 1PALA 1GQMA 2LVIA 3PSRA 1SL8A 3DVJA 1QASA 1EH2A 2M7NA 1Y1AA 5AEQA 1S3PA 1L7ZA 1R6PA 1W7JB 2KQYA 3OB1B 4M2OA 1KK7Z 1WLMA 5ER4X 1B8LA 1DF0B 3VRPA 2ZNEA 3KPXA 3BUWB 4A4CA 2H61A 4Q04A 4PE7A 1QIWA 4E68A 1TN4A 2JULA 1IG5A 1GJYA 1NCYA 1M46A 1ALVA 1SW8A 3AKAA 2NCOA 3EKJA 5HLOA 3RLZA 2AAOA 4GAOA 1OZOA 1YTZC 4ETOA 3WHTB 4DCKA 3WNXB 1AK8A 3I5IB 1S36A 1TCOB 4NQGA 1KFUL 2WCEA 2JT8A 1YRTB 4DS7A 1PVAA 2M7LA 1BU3A 4OVNF 1IWQA 1XO5A 1K94A 2KFGA 1ZACA 3CGAA 4QJ3B 1B9AA 1OMDA 1XVJA 4JQ0D 5PALA 2SCPA 1CMFA 1CFPA 1A75A 2KI6D 4CFRA 1K9PA 3O78A 4ORCB 4TNCA 4C0KA 1IGVA 5JJGA 1F55A 4MBEA 1JC2A 1XFWO 2BE6A 2HQ8A 1NX3A 3BXKA 2K7OA 1WRLA 1NWDA 5CSNA 3DVKA 5AXIA 2HPSA 1QLKA 1L2OC 3EK4A 4AOMA 1XYDA 2KBMA 3SG4A 5KSZA 1JWDA 2M0RA 2CTNA 3CR5X 1BT6A 2GV5A 2G2BA 3CZTX 2CNPA 2KGRA 1DMOA 1BLQA 1BJFA 1C7VA 1PSBA 1B8CA 1J7PA 1L2OB 1OQPA 2LVVA 1NIWA 5TNCA 1DJWA 1SR6C 2WNDA 4MN0A 1IJ5A 2NXQA 1J55A 3DF0A 3E3RA 3SIAA 1TNQA 2JRFA 2JT0A 4YGBB 1J7QA 1UHNA 2BCXA 1QX2A 3EVUA 5KU1A 4I5LB 1SR6B 1R2UA 1SCVA 1TCFA 1OMVA 1YUTA 1QJTA 2ZN8A 4PCWA 2KI6C 1XK4A 1S26D 1SRAA 2JOJA 1M39A 3FIAA 3TS5C 1MQ1A 3ZWHA 4ORBB 2L4IA 1SPYA 1SK6D 4MRXA 1GGWA 5CSFA 1AJ5A 2JXCA 2PRUA 3CR4X 2LV7A 3TS5B 3BOWB 2M97A 4BY5A 1B4CA 3DVEA 1K9KA 3SJSA 2KQ6A 1B7TZ 4MLWA 1MF8B 3LCPC 4HSZA 1XK4C 1Y1XA 4YGAA 3JTDC 1YR5A 2MLEC 3DF0B 1LKJA 3GOFA 2JZIA 3EVVA 4ORAB 1GGZA 4ZCUA 1CB1A 4YI9A 1DJHA 3AAKA 1SL9A 1EJ3A 1KSMA 2Y4QA 2L50A 5JOLA 4XJKA 1FF1A 1B8RA 1QS7A 2OTGC 4N5XA 3JTDB 5HLVA 2EC6C 2JQ6A 3VROA 3D0YA 1CMGA 2KGBC 2K8MB 2SASA 4FQOA 2OS8C 1WRKA 2ZN9A 1K9UA 3LLEA 1NP8A 1FI6A 2MRDA 1J7OA 3BYAA 2OTGB 1YVHA 2KOTA 2E6WA 3OB2B 2EC6B 5G08A 5HKZA 1JFJA 3VGOA 1J1DA 3EVRA 1KCYA 4USLA 2JWWA 5AFPA 1KK7Y 1F71A 1M45A 5CSJA 1VRKA 4CIDA 1JBAA 4MVFA 1QX7A 4PE0A 3IQQA 1ZUZA 3D10A 3A4UB 2V53A 4WQ3A 2LP3A 3SG7A 1IRJA 2I94A 4P5OE 1F4OA 2HETA 1K93D 2MBXA 4YGEB 3NSKA 1UHKA 1CDMA 2CXJA 1JF2A 1AJ4A 3AKBA 1CLMA 1LA3A 2JTZA 3CTNA 1SMGA 1NPQA 2IS9A 2LNKA 4UPGA 4MZKA 2MA2A 1JFKA 1W7IB 1U5IB 1FBVA 1J7RA 4PHKA 1DTLA 1UURA 3CWGA 2LLTA 2L51A 1B47A 4M2PA 5B8IB 4GBAA 1ZOTB 1BR1B 2WOSA 3MSEB 4MEWA 2KFFA 4DUQA 1OOJA 1ALWA 1NCXA 1CLLA 2F2OA 4PALA 3WXAA 1BOCA 1AP4A 3OHMB 1CDLA 2M1UA 3GK1A 4GGNA 1YX8A 1QV1A 2H61C 1KQVA 2PMYA 3QRXA 1H8BA 1YVLA 3FWCA 3PM8A 5D69A 1QV0A 1M63B 1F54A 4CPVA 2KAVA 1YUSA 1K90D 2ZKMX 4JWQA 4D1EA 1S6CA 4GFTA 3SG6A 3NXAA 3HX4A 3ZNIA 2BCBA 2NZ0A 1RROA 5FYXA 1F4QA 2BE4A 4I5KA 2F2PA 4CFQA 4C0LA 1NYAA 3O2PA 3LK0A 4YGDB 1C07A 4DIRA 1OMRA 2A4JA 4OCIA 2LM5A 2LMTA 2PVBA 1JUOA 1XFYO 2M29A 3PLFB 1M31A 2TN4A 4BY4A 2KDHA 2ZRSA 4QJ4B 3OX6A 1HQVA 1FI5A 2JNFA 1G8IA 2K2FA 1KSOA 2KHNA 1UUSA 2BL0C 2EGDA 3BQ3A 2CT9A 5DKQA 2HQWA 1TIZA 1F70A 1B1GA 2P6BB 5AANA 2FJUB 2KAYA 3PN7C 4ICBA 3ICBA 2RGIA 1WY9A 1A75B 2LMUA 1A4PA 1MXEA 2BL0B 1AHRA 3WHUB 1BG1A 1Y6WA 2ZFDA 5CPVA 3EK7A 4OV2A 2I2RE 1JSAA 4XYNA 3PN7B 3TZ1A 2QPTA 1AUIB 3KHEA 2CBLA 1OSAA 5GQQC 3BUNB 1PK0D 1V1GA 4OR9B 5I2LA 2FCEA 2ZNDA 2LVKA 3NSLA 3TUYC 3VRRA 2WCFA 4PHNA 1C7WA 1N0YA 1MXLC 1RK9A 5DKRA 3VRQA 3BUXB 5I2OA 5I2QA 1B7TY 2LANA 1CDPA 1LXFC 5HYDA 4YGCB 4WQ2A 3TUYB 2M1KB 3FWBA 4U8DA 2LCPA 1NX1A 4HRHA 4PHMA 2EHBA 3LL8B 1Q80A 2LP2A 2QACA 3NSIA 2L5XB 3PALA 1X02A 4ZCVA 1WDCC 1DT7B 2Q91A 1S6IA 4AQJA 5IBWA 2KBIA 1CLBA 2O60A 2LMVA 2VRGA 2L98A 1DJXA 1KK8C 1D1OA 4P2YB 3EKHA 2LE9B 3I5FC 2KYFA 1TRFA 1WDCB 1RECA 2JT3A 1TTXA 2Q4UA 1XFXO 3SG5A 1MWNA 1S1EA 2K7BA 1PVBA 2WCBA 1PULA 2LC5A 2L4HA 2NLNA 4MZJA 2Y1NA 1SNLA 3I5FB 3IQOA 1S5GZ 2KAXA 2BKIB 1EL4A 1CNPA 1ZFSA 1QVIZ 5CSIA 1BR4B 1DF0A 1MUXA 2KYCA 2OS8B 1K95A 3TDUA 3A8RA 2K61A 1TNPA 1QTXA 2WC8A 1SL7A 2K0JA 4NDCA 1EXRA 1NCZA 4AQIA 2LUCA 5HKWA 2COLB 1A03A 2M8UA 1V1FA 2WORA 1QIVA 2LAPA 3RM1A 1A29A 1DGVA 4XJKB 2Y1MA 3OP0A 1FW4A 1Y1UA 2BCAA 2JC2A 2AUCA 3D0YB 3TDZA 1CDNA 2F3ZA 3OX5A 1SYMA 3M0WA 2K7DA 2H2KA 2KSPA 4GNKB 1MHOA 2GGMA 1KQMC 1RTP1 2MLFC 2PALA 5I8NA 2LLUA 2JNXA 4PHJA 1SBJA 3H4SE 3NSOA 4L9MA 3CS1A 2HF5A 1KQMB 2JTTA 3F45A 3KEVA 4GPLB 1IQ5A 1G33A 1F8HA 4PE4A 3AAJA 1WRZA 3CLNA 1UHIA 3I5IC 2MAZA 4HREE 4N1FA 1XA5A 4NDBA 1LVCD 4DRWA 2O5GA 1K96A 5K89A 3O4YA 3O6BA 1LINA 3JVTC 4C0JA 1N2DA 2K2AA 3PFVA 1LA0A 1RFJA 2LVJA 2FCDA 4YI8A 2MHHA 1ODBA 1YX7A 4YRUA 2PSRA 4I5NB 4CLNA 4WRIA 2F3YA 2ZRTA 3JVTB 4MZLA 2JPTA 1KFXS 1WLZA 4GUKA 1OE9B 3KO0A 2JU0A 1QXPA 2BBMA 3I5HC 4MSPA 2BKHB 1DGUA 4HRGA 2BBNA 1UP5A 1J1EA 1OZSA 1IJ6A 2BECA 1PRWA 1CFDA 2R2IA 1CFFA 1IH0A 4PE1A 3GK4X 1AVSA 4F0ZB 4YBHB 1NUBA 1IQ3A 1CKKA 3TDIA 3DD4A 3I5HB 2K7CA 4OKHA 4GGFA 3SIBA 2LHIA 2B1UA 2E30A 2M9GA 3C1VA 1SCMC 3BUOB 1TNWA 2MJWB 1NSHA 1FPWA 5ER5A 2OPOA 5F6TA 1BF5A 2FOTA 5HKYA 1DJIA 1UHHA 3FS7A 1CTRA 1K2HA 2KNEA 1NX2A 1RJVA 1SCMB 3BOWA 2PASA 3CR2A 3HCMA 2NCPA 5AERA 1UWOA 1N65A 1YURA 1H4BA 1XFVO 1KFUS 1CFCA 4GGFC 2LHLA 2KFHA 3SG3A 1YUUA 4N1GA 4NDDA 1KWOC 1DVIA 4IL1A 1SY9A 1PSRA 1UHJA 2Y5IA 3BUMB 2DOQA 4A4BA 1MR8A 2KI4C 3I5GC 1KWOB 3KF9A 1DJYA 1EG3A 3SG2A 3K21A 2AMIA 1DJGA 2L0PA 4MRYA 2I7AA 1G4YR 1YRUB 4PDZA 5J3XA 1S5GY 1HT9A 2L2EA 1RWYA 4I5JA 1QVIY 2KI4B 3I5GB 1KK8B 5BPJA 1SKTA 3IF7A 1XFZO 1E8AA 4JPZB 3VRNA 1BMOA 4QJ5B 3PATA 2ISDA 2M3WA 1CM1A 1ZMZA 1QLSA 2CCMA 3EK8A 3GK2A 1IKUA 2M49B 2F33A 1CM4A 1QX5B 1S6JA 2LUXA 4M2QA 1TOPA 4FTGA 1A2XA 1NX0A 1TNXA 1XFUO 2F8PA 2GGZA 2I18A 1EG4A 1U5IA 2JXLA 1BODA 1JF0A
chains in the Genus database with same CATH superfamily
1KFXL 2LLSA 1DJZA 3LK1A 2D8NA 5DKNA 1QATA 5KTYA 1Y0VH 4R1EA 3D76A 2G9BA 5D7FA 3DVMA 1K8UA 1PALA 1GQMA 2LVIA 3PSRA 1SL8A 3DVJA 3O4XA 1QASA 3S0EA 1EH2A 2M7NA 1Y1AA 5AEQA 1S3PA 1L7ZA 1R6PA 1W7JB 2KQYA 3OB1B 4M2OA 1KK7Z 1WLMA 5ER4X 3S0AA 1B8LA 1DF0B 3VRPA 2ZNEA 3KPXA 3BUWB 4A4CA 2H61A 4Q04A 4PE7A 1QIWA 4INXA 1OOHA 4E68A 1TN4A 4FQTA 2JULA 1DELA 1GJYA 1IG5A 1NCYA 1M46A 1ALVA 1SW8A 5I94A 3AKAA 2NCOA 3EKJA 5HLOA 4KYNA 2AAOA 3RLZA 4GAOA 5HL1A 1OZOA 1YTZC 4ETOA 3WHTB 4DCKA 3WNXB 1AK8A 4JKTA 3I5IB 1S36A 1TCOB 2ERBA 4NQGA 1KFUL 2WCEA 2JT8A 1YRTB 2KLDA 4DS7A 1PVAA 2M7LA 1BU3A 4OVNF 1IWQA 1XO5A 1K94A 2KFGA 1ZACA 3RZSA 3CGAA 4QJ3B 1B9AA 1OMDA 1XVJA 4JQ0D 5PALA 2SCPA 1CMFA 1CFPA 1A75A 2KI6D 4CFRA 1K9PA 2YGUA 3DXLA 3O78A 4ORCB 4TNCA 4C0KA 1IGVA 5JJGA 2PQLA 4MBEA 1QWVA 1JC2A 1F55A 1XFWO 1OOGA 2BE6A 2HQ8A 1NX3A 3BXKA 3D73A 3NGVA 2K7OA 3R72A 1WRLA 1NWDA 5CSNA 3DVKA 1GM0A 5AXIA 2HPSA 1QLKA 1L2OC 3EK4A 4AOMA 1XYDA 2KBMA 3SG4A 5KSZA 1JWDA 3D74A 2M0RA 2CTNA 3CR5X 1BT6A 2GV5A 2G2BA 3CZTX 1TUZA 2CNPA 2KGRA 1DMOA 1BLQA 1BJFA 1C7VA 1PSBA 1B8CA 1J7PA 1L2OB 1OQPA 2LVVA 1NIWA 5TNCA 1DJWA 1SR6C 2WNDA 4MN0A 1TUJA 1IJ5A 3B88A 1OW4A 2NXQA 3R1PA 1J55A 3DF0A 3E3RA 3SIAA 3S0DA 1TNQA 2JRFA 2JT0A 4YGBB 1J7QA 1UHNA 2BCXA 1QX2A 3EVUA 5KU1A 4I5LB 1SR6B 1R2UA 1SCVA 1TCFA 1OMVA 1YUTA 1QJTA 2ZN8A 4PCWA 2KI6C 1XK4A 1S26D 1SRAA 2JOJA 1M39A 3FIAA 3TS5C 3PM2A 1MQ1A 3Q8IA 3ZWHA 4ORBB 2L4IA 1SPYA 1SK6D 4MRXA 1GGWA 3OGNA 5CSFA 1AJ5A 2JXCA 2PRUA 3CR4X 2LV7A 3TS5B 3BOWB 2M97A 4BY5A 3CZ0A 3DVEA 1B4CA 1K9KA 3SJSA 3FE9A 2KQ6A 1B7TZ 4MLWA 1MF8B 3LCPC 4HSZA 1XK4C 1Y1XA 4YGAA 5FI2A 3JTDC 1YR5A 2MLEC 3DF0B 1LKJA 3GOFA 2JZIA 3EVVA 4ORAB 1GGZA 4ZCUA 3S0BA 1CB1A 4YI9A 5FI6A 1DJHA 1DQEA 1XFRA 3K1EA 3AAKA 1SL9A 1EJ3A 1KSMA 2Y4QA 2L50A 5JOLA 4XJKA 1FF1A 1B8RA 1QS7A 2OTGC 3EG5B 4N5XA 3JTDB 5HLVA 2EC6C 1OOFA 2JQ6A 3L4AA 3VROA 3D0YA 3SS4A 1CMGA 2KGBC 2K8MB 2SASA 4FQOA 2PYQA 2OS8C 1WRKA 2ZN9A 1K9UA 3LLEA 1NP8A 1FI6A 2MRDA 1J7OA 3BYAA 2OTGB 1YVHA 2KOTA 2E6WA 3OB2B 2EC6B 5G08A 5HKZA 1JFJA 3VGOA 1J1DA 3EVRA 1KCYA 4USLA 2JWWA 5AFPA 1KK7Y 1F71A 1M45A 5CSJA 1VRKA 4CIDA 1JBAA 4MVFA 1QX7A 4PE0A 3IQQA 1ZUZA 3D10A 3A4UB 2V53A 2JPOA 2LP3A 4WQ3A 1IRJA 3SG7A 3S0FA 2I94A 3OBVA 1F4OA 2HETA 1K93D 4P5OE 2MBXA 1OOIX 1LS8A 4YGEB 3NSKA 1UHKA 1CDMA 2CXJA 3NHIA 1JF2A 1AJ4A 3AKBA 1CLMA 1LA3A 2JTZA 2P70A 3CTNA 1SMGA 1NPQA 2IS9A 2LNKA 4UPGA 4MZKA 2MA2A 1JFKA 1W7IB 1U5IB 1FBVA 1J7RA 4PHKA 1DTLA 1UURA 3CWGA 2LLTA 2L51A 1B47A 3FE8A 4M2PA 5B8IB 4GBAA 1ZOTB 1BR1B 2WOSA 3MSEB 4MEWA 2KFFA 4DUQA 1OOJA 1ALWA 1NCXA 1CLLA 2F2OA 4PALA 3WXAA 1BOCA 1AP4A 3OHMB 1CDLA 2M1UA 3CYZA 3GK1A 1YX8A 4GGNA 1QV1A 1IH0A 2H61C 1KQVA 2PMYA 3QRXA 1H8BA 1YVLA 3FWCA 3PM8A 5D69A 1QV0A 1M63B 1F54A 4CPVA 2KAVA 1YUSA 1K90D 2ZKMX 3S0GA 4JWQA 2QEHA 1S6CA 4D1EA 3BFBA 3UNWA 4GFTA 3SG6A 3NXAA 3HX4A 3ZNIA 2BCBA 2NZ0A 3DY9A 1RROA 5FYXA 1F4QA 2BE4A 4I5KA 2F2PA 4CFQA 4C0LA 1NYAA 3O2PA 3LK0A 4YGDB 1C07A 4DIRA 1OMRA 2A4JA 4OCIA 2LM5A 2LMTA 2PVBA 1JUOA 1XFYO 2M29A 3PLFB 1M31A 3R1VA 2TN4A 4BY4A 1DC1A 1ORGA 2P71A 2KDHA 2ZRSA 4QJ4B 3OX6A 1HQVA 1FI5A 2JNFA 1G8IA 2K2FA 1KSOA 2KHNA 1UUSA 2BL0C 2EGDA 3BQ3A 2CT9A 5DKQA 2HQWA 1TIZA 1F70A 1B1GA 2BAPA 2P6BB 5AANA 2FJUB 2KAYA 3PN7C 4ICBA 3ICBA 2RGIA 1WY9A 1A75B 2LMUA 1A4PA 1MXEA 2BL0B 1AHRA 3WHUB 1BG1A 1Y6WA 2K60A 2ZFDA 5CPVA 3EK7A 4OV2A 3BFHA 2I2RE 1JSAA 4XYNA 3B86A 3PN7B 3TZ1A 2QPTA 1AUIB 3KHEA 2CBLA 2QEVA 1OSAA 2GTEA 2BNXA 1PK0D 1V1GA 2KPHA 3BUNB 4JD9A 4OR9B 5GQQC 2FCEA 3NHTA 5FI7A 2ZNDA 2LVKA 3NSLA 3TUYC 3VRRA 2L2CA 2WCFA 1C7WA 1N0YA 1MXLC 1RK9A 3N7HA 4PHNA 3BUXB 5DKRA 3VRQA 5I2OA 3L47A 5I2QA 3DYEA 1B7TY 2LANA 1CDPA 3PJIA 1LXFC 5HYDA 4YGCB 4WQ2A 3TUYB 2M1KB 3FWBA 5I2LA 3BJHA 4U8DA 2LCPA 1NX1A 4HRHA 4PHMA 2EHBA 3LL8B 1Q80A 2LP2A 2QACA 3NSIA 2L5XB 3PALA 1T14A 1X02A 4ZCVA 1WDCC 1DT7B 2Q91A 1S6IA 4AQJA 5IBWA 2KBIA 1CLBA 2O60A 2LMVA 2VRGA 2L98A 1DJXA 1KK8C 1P28A 1D1OA 4P2YB 3EKHA 2LE9B 5DICA 3I5FC 1DEKA 1SSEB 2KYFA 1TRFA 1WDCB 1RECA 2JT3A 1TTXA 2Q4UA 1XFXO 3SG5A 1MWNA 1S1EA 2K7BA 1PVBA 2WCBA 1PULA 2LC5A 2QEOA 2L4HA 2NLNA 4MZJA 2Y1NA 1SNLA 3I5FB 3IQOA 1S5GZ 2KAXA 2BKIB 1EL4A 1CNPA 1ZFSA 1QVIZ 5CSIA 1BR4B 3FE6A 1DF0A 1MUXA 2KYCA 2OS8B 1K95A 3TDUA 3A8RA 2K61A 1TNPA 1QTXA 2WC8A 1SL7A 2K0JA 4NDCA 1EXRA 1NCZA 4AQIA 2LUCA 5HKWA 2COLB 1A03A 2M8UA 1V1FA 2WORA 1QIVA 2LAPA 3RM1A 3B6XA 1A29A 1DGVA 4XJKB 2Y1MA 3OP0A 1FW4A 1Y1UA 3B7AA 2BCAA 2JC2A 2AUCA 3D0YB 3TDZA 1CDNA 2F3ZA 3OX5A 2WCKA 1SYMA 2KLEA 3M0WA 2K7DA 2H2KA 2KSPA 4GNKB 1MHOA 2GGMA 1KQMC 1RTP1 2MLFC 2PALA 5I8NA 3SS5A 3VB1A 2LLUA 2JNXA 4PHJA 1SBJA 4PT1A 2WC6A 3H4SE 3NSOA 4L9MA 3CS1A 2HF5A 1KQMB 2JTTA 3F45A 3KEVA 4GPLB 1IQ5A 1G33A 1F8HA 4PE4A 3AAJA 1WRZA 3CLNA 1UHIA 3I5IC 2MAZA 4HREE 4N1FA 1XA5A 4NDBA 1LVCD 4DRWA 2O5GA 4F7FA 1K96A 5K89A 3O4YA 3O6BA 1LINA 1TWOA 3JVTC 4C0JA 2WCJA 1N2DA 2K2AA 3PFVA 1LA0A 1RFJA 2LVJA 2FCDA 4YI8A 1Z4HA 2MHHA 1ODBA 1YX7A 4YRUA 2PSRA 2QEBA 4I5NB 4CLNA 4WRIA 2F3YA 2ZRTA 3QMEA 3JVTB 4MZLA 2JPTA 1KFXS 1WLZA 4GUKA 1OE9B 3KO0A 2QDIA 2JU0A 1QXPA 2BBMA 3I5HC 4MSPA 2BKHB 1DGUA 4HRGA 2BBNA 1UP5A 3IVTA 1J1EA 1OZSA 1IJ6A 1PRWA 2BECA 1CFDA 2R2IA 2WCMA 3DZTA 1CFFA 4PE1A 3GK4X 1AVSA 4F0ZB 4YBHB 1NUBA 1IQ3A 2L5YA 3TDIA 1CKKA 3DD4A 3I5HB 2K7CA 3D75A 3CDNA 5D3OA 4OKHA 4GGFA 3SIBA 2LHIA 2B1UA 2E30A 2M9GA 3C1VA 1SCMC 3SS3A 3BUOB 1TNWA 2MJWB 1NSHA 1FPWA 5ER5A 3L4LA 3BFAA 1Z2CB 2OPOA 5F6TA 1BF5A 2FOTA 5HKYA 1DJIA 1UHHA 3FS7A 1CTRA 1K2HA 2KNEA 1NX2A 4IJ7A 1RJVA 1SCMB 3BOWA 2PASA 3CR2A 3HCMA 2NCPA 5AERA 2WCHA 1UWOA 1N65A 1YURA 2H8VA 1W9ZA 1XFVO 1H4BA 1KFUS 4OZDA 1CFCA 4GGFC 2LHLA 2KFHA 3SG3A 3D77A 1YUUA 3R1OA 4N1GA 4NDDA 1C3ZA 1KWOC 3CZ1A 1DVIA 3CABA 3CZ2A 4IL1A 1SY9A 1C3YA 1PSRA 1UHJA 2Y5IA 3BUMB 2DOQA 5EL2A 4A4BA 1MR8A 2KI4C 3I5GC 1KWOB 3KF9A 1IIOA 1DJYA 1EG3A 3SG2A 2WCLA 3K21A 2AMIA 1DJGA 2L0PA 4MRYA 2I7AA 1G4YR 3UO9A 1YRUB 4PDZA 5J3XA 1S5GY 1HT9A 2L2EA 1RWYA 4I5JA 1QVIY 2KI4B 3I5GB 1KK8B 5BPJA 1SKTA 3IF7A 3B87A 1XFZO 3D78A 1E8AA 4JPZB 3VRNA 1BMOA 4QJ5B 3PATA 4INWA 2ISDA 2M3WA 1CM1A 1ZMZA 1QLSA 2CCMA 3EK8A 3GK2A 2FJYA 3V2LA 2M49B 1IKUA 2F33A 1CM4A 1QX5B 1S6JA 2LUXA 4M2QA 1TOPA 4FTGA 1A2XA 1NX0A 1TNXA 1XFUO 2F8PA 2GGZA 2I18A 2WC5A 1EG4A 1U5IA 2JXLA 1BODA 1JF0A
chains in the Genus database with same CATH topology
1KFXL 2LLSA 1DJZA 3LK1A 2D8NA 5DKNA 1QATA 5KTYA 1Y0VH 4R1EA 2G9BA 5D7FA 3DVMA 1K8UA 1PALA 1GQMA 2LVIA 3PSRA 1SL8A 3DVJA 1QASA 1EH2A 2M7NA 1Y1AA 5AEQA 1S3PA 1L7ZA 1R6PA 1W7JB 2KQYA 3OB1B 4M2OA 1KK7Z 1WLMA 5ER4X 1B8LA 1DF0B 3VRPA 2ZNEA 3KPXA 3BUWB 4A4CA 2H61A 4Q04A 4PE7A 1QIWA 4E68A 1TN4A 2JULA 1IG5A 1GJYA 1NCYA 1M46A 1ALVA 1SW8A 3AKAA 2NCOA 3EKJA 5HLOA 3RLZA 2AAOA 4GAOA 1OZOA 1YTZC 4ETOA 3WHTB 4DCKA 3WNXB 1AK8A 3I5IB 1S36A 1TCOB 4NQGA 1KFUL 2WCEA 2JT8A 1YRTB 4DS7A 1PVAA 2M7LA 1BU3A 4OVNF 1IWQA 1XO5A 1K94A 2KFGA 1ZACA 3CGAA 4QJ3B 1B9AA 1OMDA 1XVJA 4JQ0D 5PALA 2SCPA 1CMFA 1CFPA 1A75A 2KI6D 4CFRA 1K9PA 3O78A 4ORCB 4TNCA 4C0KA 1IGVA 5JJGA 1F55A 4MBEA 1JC2A 1XFWO 2BE6A 2HQ8A 1NX3A 3BXKA 2K7OA 1WRLA 1NWDA 5CSNA 3DVKA 5AXIA 2HPSA 1QLKA 1L2OC 3EK4A 4AOMA 1XYDA 2KBMA 3SG4A 5KSZA 1JWDA 2M0RA 2CTNA 3CR5X 1BT6A 2GV5A 2G2BA 3CZTX 2CNPA 2KGRA 1DMOA 1BLQA 1BJFA 1C7VA 1PSBA 1B8CA 1J7PA 1L2OB 1OQPA 2LVVA 1NIWA 5TNCA 1DJWA 1SR6C 2WNDA 4MN0A 1IJ5A 2NXQA 1J55A 3DF0A 3E3RA 3SIAA 1TNQA 2JRFA 2JT0A 4YGBB 1J7QA 1UHNA 2BCXA 1QX2A 3EVUA 5KU1A 4I5LB 1SR6B 1R2UA 1SCVA 1TCFA 1OMVA 1YUTA 1QJTA 2ZN8A 4PCWA 2KI6C 1XK4A 1S26D 1SRAA 2JOJA 1M39A 3FIAA 3TS5C 1MQ1A 3ZWHA 4ORBB 2L4IA 1SPYA 1SK6D 4MRXA 1GGWA 5CSFA 1AJ5A 2JXCA 2PRUA 3CR4X 2LV7A 3TS5B 3BOWB 2M97A 4BY5A 1B4CA 3DVEA 1K9KA 3SJSA 2KQ6A 1B7TZ 4MLWA 1MF8B 3LCPC 4HSZA 1XK4C 1Y1XA 4YGAA 3JTDC 1YR5A 2MLEC 3DF0B 1LKJA 3GOFA 2JZIA 3EVVA 4ORAB 1GGZA 4ZCUA 1CB1A 4YI9A 1DJHA 3AAKA 1SL9A 1EJ3A 1KSMA 2Y4QA 2L50A 5JOLA 4XJKA 1FF1A 1B8RA 1QS7A 2OTGC 4N5XA 3JTDB 5HLVA 2EC6C 2JQ6A 3VROA 3D0YA 1CMGA 2KGBC 2K8MB 2SASA 4FQOA 2OS8C 1WRKA 2ZN9A 1K9UA 3LLEA 1NP8A 1FI6A 2MRDA 1J7OA 3BYAA 2OTGB 1YVHA 2KOTA 2E6WA 3OB2B 2EC6B 5G08A 5HKZA 1JFJA 3VGOA 1J1DA 3EVRA 1KCYA 4USLA 2JWWA 5AFPA 1KK7Y 1F71A 1M45A 5CSJA 1VRKA 4CIDA 1JBAA 4MVFA 1QX7A 4PE0A 3IQQA 1ZUZA 3D10A 3A4UB 2V53A 4WQ3A 2LP3A 3SG7A 1IRJA 2I94A 4P5OE 1F4OA 2HETA 1K93D 2MBXA 4YGEB 3NSKA 1UHKA 1CDMA 2CXJA 1JF2A 1AJ4A 3AKBA 1CLMA 1LA3A 2JTZA 3CTNA 1SMGA 1NPQA 2IS9A 2LNKA 4UPGA 4MZKA 2MA2A 1JFKA 1W7IB 1U5IB 1FBVA 1J7RA 4PHKA 1DTLA 1UURA 3CWGA 2LLTA 2L51A 1B47A 4M2PA 5B8IB 4GBAA 1ZOTB 1BR1B 2WOSA 3MSEB 4MEWA 2KFFA 4DUQA 1OOJA 1ALWA 1NCXA 1CLLA 2F2OA 4PALA 3WXAA 1BOCA 1AP4A 3OHMB 1CDLA 2M1UA 3GK1A 4GGNA 1YX8A 1QV1A 2H61C 1KQVA 2PMYA 3QRXA 1H8BA 1YVLA 3FWCA 3PM8A 5D69A 1QV0A 1M63B 1F54A 4CPVA 2KAVA 1YUSA 1K90D 2ZKMX 4JWQA 4D1EA 1S6CA 4GFTA 3SG6A 3NXAA 3HX4A 3ZNIA 2BCBA 2NZ0A 1RROA 5FYXA 1F4QA 2BE4A 4I5KA 2F2PA 4CFQA 4C0LA 1NYAA 3O2PA 3LK0A 4YGDB 1C07A 4DIRA 1OMRA 2A4JA 4OCIA 2LM5A 2LMTA 2PVBA 1JUOA 1XFYO 2M29A 3PLFB 1M31A 2TN4A 4BY4A 2KDHA 2ZRSA 4QJ4B 3OX6A 1HQVA 1FI5A 2JNFA 1G8IA 2K2FA 1KSOA 2KHNA 1UUSA 2BL0C 2EGDA 3BQ3A 2CT9A 5DKQA 2HQWA 1TIZA 1F70A 1B1GA 2P6BB 5AANA 2FJUB 2KAYA 3PN7C 4ICBA 3ICBA 2RGIA 1WY9A 1A75B 2LMUA 1A4PA 1MXEA 2BL0B 1AHRA 3WHUB 1BG1A 1Y6WA 2ZFDA 5CPVA 3EK7A 4OV2A 2I2RE 1JSAA 4XYNA 3PN7B 3TZ1A 2QPTA 1AUIB 3KHEA 2CBLA 1OSAA 5GQQC 3BUNB 1PK0D 1V1GA 4OR9B 5I2LA 2FCEA 2ZNDA 2LVKA 3NSLA 3TUYC 3VRRA 2WCFA 4PHNA 1C7WA 1N0YA 1MXLC 1RK9A 5DKRA 3VRQA 3BUXB 5I2OA 5I2QA 1B7TY 2LANA 1CDPA 1LXFC 5HYDA 4YGCB 4WQ2A 3TUYB 2M1KB 3FWBA 4U8DA 2LCPA 1NX1A 4HRHA 4PHMA 2EHBA 3LL8B 1Q80A 2LP2A 2QACA 3NSIA 2L5XB 3PALA 1X02A 4ZCVA 1WDCC 1DT7B 2Q91A 1S6IA 4AQJA 5IBWA 2KBIA 1CLBA 2O60A 2LMVA 2VRGA 2L98A 1DJXA 1KK8C 1D1OA 4P2YB 3EKHA 2LE9B 3I5FC 2KYFA 1TRFA 1WDCB 1RECA 2JT3A 1TTXA 2Q4UA 1XFXO 3SG5A 1MWNA 1S1EA 2K7BA 1PVBA 2WCBA 1PULA 2LC5A 2L4HA 2NLNA 4MZJA 2Y1NA 1SNLA 3I5FB 3IQOA 1S5GZ 2KAXA 2BKIB 1EL4A 1CNPA 1ZFSA 1QVIZ 5CSIA 1BR4B 1DF0A 1MUXA 2KYCA 2OS8B 1K95A 3TDUA 3A8RA 2K61A 1TNPA 1QTXA 2WC8A 1SL7A 2K0JA 4NDCA 1EXRA 1NCZA 4AQIA 2LUCA 5HKWA 2COLB 1A03A 2M8UA 1V1FA 2WORA 1QIVA 2LAPA 3RM1A 1A29A 1DGVA 4XJKB 2Y1MA 3OP0A 1FW4A 1Y1UA 2BCAA 2JC2A 2AUCA 3D0YB 3TDZA 1CDNA 2F3ZA 3OX5A 1SYMA 3M0WA 2K7DA 2H2KA 2KSPA 4GNKB 1MHOA 2GGMA 1KQMC 1RTP1 2MLFC 2PALA 5I8NA 2LLUA 2JNXA 4PHJA 1SBJA 3H4SE 3NSOA 4L9MA 3CS1A 2HF5A 1KQMB 2JTTA 3F45A 3KEVA 4GPLB 1IQ5A 1G33A 1F8HA 4PE4A 3AAJA 1WRZA 3CLNA 1UHIA 3I5IC 2MAZA 4HREE 4N1FA 1XA5A 4NDBA 1LVCD 4DRWA 2O5GA 1K96A 5K89A 3O4YA 3O6BA 1LINA 3JVTC 4C0JA 1N2DA 2K2AA 3PFVA 1LA0A 1RFJA 2LVJA 2FCDA 4YI8A 2MHHA 1ODBA 1YX7A 4YRUA 2PSRA 4I5NB 4CLNA 4WRIA 2F3YA 2ZRTA 3JVTB 4MZLA 2JPTA 1KFXS 1WLZA 4GUKA 1OE9B 3KO0A 2JU0A 1QXPA 2BBMA 3I5HC 4MSPA 2BKHB 1DGUA 4HRGA 2BBNA 1UP5A 1J1EA 1OZSA 1IJ6A 2BECA 1PRWA 1CFDA 2R2IA 1CFFA 1IH0A 4PE1A 3GK4X 1AVSA 4F0ZB 4YBHB 1NUBA 1IQ3A 1CKKA 3TDIA 3DD4A 3I5HB 2K7CA 4OKHA 4GGFA 3SIBA 2LHIA 2B1UA 2E30A 2M9GA 3C1VA 1SCMC 3BUOB 1TNWA 2MJWB 1NSHA 1FPWA 5ER5A 2OPOA 5F6TA 1BF5A 2FOTA 5HKYA 1DJIA 1UHHA 3FS7A 1CTRA 1K2HA 2KNEA 1NX2A 1RJVA 1SCMB 3BOWA 2PASA 3CR2A 3HCMA 2NCPA 5AERA 1UWOA 1N65A 1YURA 1H4BA 1XFVO 1KFUS 1CFCA 4GGFC 2LHLA 2KFHA 3SG3A 1YUUA 4N1GA 4NDDA 1KWOC 1DVIA 4IL1A 1SY9A 1PSRA 1UHJA 2Y5IA 3BUMB 2DOQA 4A4BA 1MR8A 2KI4C 3I5GC 1KWOB 3KF9A 1DJYA 1EG3A 3SG2A 3K21A 2AMIA 1DJGA 2L0PA 4MRYA 2I7AA 1G4YR 1YRUB 4PDZA 5J3XA 1S5GY 1HT9A 2L2EA 1RWYA 4I5JA 1QVIY 2KI4B 3I5GB 1KK8B 5BPJA 1SKTA 3IF7A 1XFZO 1E8AA 4JPZB 3VRNA 1BMOA 4QJ5B 3PATA 2ISDA 2M3WA 1CM1A 1ZMZA 1QLSA 2CCMA 3EK8A 3GK2A 1IKUA 2M49B 2F33A 1CM4A 1QX5B 1S6JA 2LUXA 4M2QA 1TOPA 4FTGA 1A2XA 1NX0A 1TNXA 1XFUO 2F8PA 2GGZA 2I18A 1EG4A 1U5IA 2JXLA 1BODA 1JF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  2LLS A;  1DJZ A;  3LK1 A;  2D8N A;  5DKN A;  1QAT A;  5KTY A;  1Y0V H;  4R1E A;  2G9B A;  5D7F A;  3DVM A;  1K8U A;  1PAL A;  1GQM A;  2LVI A;  3PSR A;  1SL8 A;  3DVJ A;  1QAS A;  1EH2 A;  2M7N A;  1Y1A A;  5AEQ A;  1S3P A;  1L7Z A;  1R6P A;  1W7J B;  2KQY A;  3OB1 B;  4M2O A;  1KK7 Z;  1WLM A;  5ER4 X;  1B8L A;  1DF0 B;  3VRP A;  2ZNE A;  3KPX A;  3BUW B;  4A4C A;  2H61 A;  4Q04 A;  4PE7 A;  1QIW A;  4E68 A;  1TN4 A;  2JUL A;  1IG5 A;  1GJY A;  1NCY A;  1M46 A;  1ALV A;  1SW8 A;  3AKA A;  2NCO A;  3EKJ A;  5HLO A;  3RLZ A;  2AAO A;  4GAO A;  1OZO A;  1YTZ C;  4ETO A;  3WHT B;  4DCK A;  3WNX B;  1AK8 A;  3I5I B;  1S36 A;  1TCO B;  4NQG A;  1KFU L;  2WCE A;  2JT8 A;  1YRT B;  4DS7 A;  1PVA A;  2M7L A;  1BU3 A;  4OVN F;  1IWQ A;  1XO5 A;  1K94 A;  2KFG A;  1ZAC A;  3CGA A;  4QJ3 B;  1B9A A;  1OMD A;  1XVJ A;  4JQ0 D;  5PAL A;  2SCP A;  1CMF A;  1CFP A;  1A75 A;  2KI6 D;  4CFR A;  1K9P A;  3O78 A;  4ORC B;  4TNC A;  4C0K A;  1IGV A;  5JJG A;  1F55 A;  4MBE A;  1JC2 A;  1XFW O;  2BE6 A;  2HQ8 A;  1NX3 A;  3BXK A;  2K7O A;  1WRL A;  1NWD A;  5CSN A;  3DVK A;  5AXI A;  2HPS A;  1QLK A;  1L2O C;  3EK4 A;  4AOM A;  1XYD A;  2KBM A;  3SG4 A;  5KSZ A;  1JWD A;  2M0R A;  2CTN A;  3CR5 X;  1BT6 A;  2GV5 A;  2G2B A;  3CZT X;  2CNP A;  2KGR A;  1DMO A;  1BLQ A;  1BJF A;  1C7V A;  1PSB A;  1B8C A;  1J7P A;  1L2O B;  1OQP A;  2LVV A;  1NIW A;  5TNC A;  1DJW A;  1SR6 C;  2WND A;  4MN0 A;  1IJ5 A;  2NXQ A;  1J55 A;  3DF0 A;  3E3R A;  3SIA A;  1TNQ A;  2JRF A;  2JT0 A;  4YGB B;  1J7Q A;  1UHN A;  2BCX A;  1QX2 A;  3EVU A;  5KU1 A;  4I5L B;  1SR6 B;  1R2U A;  1SCV A;  1TCF A;  1OMV A;  1YUT A;  1QJT A;  2ZN8 A;  4PCW A;  2KI6 C;  1XK4 A;  1S26 D;  1SRA A;  2JOJ A;  1M39 A;  3FIA A;  3TS5 C;  1MQ1 A;  3ZWH A;  4ORB B;  2L4I A;  1SPY A;  1SK6 D;  4MRX A;  1GGW A;  5CSF A;  1AJ5 A;  2JXC A;  2PRU A;  3CR4 X;  2LV7 A;  3TS5 B;  3BOW B;  2M97 A;  4BY5 A;  1B4C A;  3DVE A;  1K9K A;  3SJS A;  2KQ6 A;  1B7T Z;  4MLW A;  1MF8 B;  3LCP C;  4HSZ A;  1XK4 C;  1Y1X A;  4YGA A;  3JTD C;  1YR5 A;  2MLE C;  3DF0 B;  1LKJ A;  3GOF A;  2JZI A;  3EVV A;  4ORA B;  1GGZ A;  4ZCU A;  1CB1 A;  4YI9 A;  1DJH A;  3AAK A;  1SL9 A;  1EJ3 A;  1KSM A;  2Y4Q A;  2L50 A;  5JOL A;  4XJK A;  1FF1 A;  1B8R A;  1QS7 A;  2OTG C;  4N5X A;  3JTD B;  5HLV A;  2EC6 C;  2JQ6 A;  3VRO A;  3D0Y A;  1CMG A;  2KGB C;  2K8M B;  2SAS A;  4FQO A;  2OS8 C;  1WRK A;  2ZN9 A;  1K9U A;  3LLE A;  1NP8 A;  1FI6 A;  2MRD A;  1J7O A;  3BYA A;  2OTG B;  1YVH A;  2KOT A;  2E6W A;  3OB2 B;  2EC6 B;  5G08 A;  5HKZ A;  1JFJ A;  3VGO A;  1J1D A;  3EVR A;  1KCY A;  4USL A;  2JWW A;  5AFP A;  1KK7 Y;  1F71 A;  1M45 A;  5CSJ A;  1VRK A;  4CID A;  1JBA A;  4MVF A;  1QX7 A;  4PE0 A;  3IQQ A;  1ZUZ A;  3D10 A;  3A4U B;  2V53 A;  4WQ3 A;  2LP3 A;  3SG7 A;  1IRJ A;  2I94 A;  4P5O E;  1F4O A;  2HET A;  1K93 D;  2MBX A;  4YGE B;  3NSK A;  1UHK A;  1CDM A;  2CXJ A;  1JF2 A;  1AJ4 A;  3AKB A;  1CLM A;  1LA3 A;  2JTZ A;  3CTN A;  1SMG A;  1NPQ A;  2IS9 A;  2LNK A;  4UPG A;  4MZK A;  2MA2 A;  1JFK A;  1W7I B;  1U5I B;  1FBV A;  1J7R A;  4PHK A;  1DTL A;  1UUR A;  3CWG A;  2LLT A;  2L51 A;  1B47 A;  4M2P A;  5B8I B;  4GBA A;  1ZOT B;  1BR1 B;  2WOS A;  3MSE B;  4MEW A;  2KFF A;  4DUQ A;  1OOJ A;  1ALW A;  1NCX A;  1CLL A;  2F2O A;  4PAL A;  3WXA A;  1BOC A;  1AP4 A;  3OHM B;  1CDL A;  2M1U A;  3GK1 A;  4GGN A;  1YX8 A;  1QV1 A;  2H61 C;  1KQV A;  2PMY A;  3QRX A;  1H8B A;  1YVL A;  3FWC A;  3PM8 A;  5D69 A;  1QV0 A;  1M63 B;  1F54 A;  4CPV A;  2KAV A;  1YUS A;  1K90 D;  2ZKM X;  4JWQ A;  4D1E A;  1S6C A;  4GFT A;  3SG6 A;  3NXA A;  3HX4 A;  3ZNI A;  2BCB A;  2NZ0 A;  1RRO A;  5FYX A;  1F4Q A;  2BE4 A;  4I5K A;  2F2P A;  4CFQ A;  4C0L A;  1NYA A;  3O2P A;  3LK0 A;  4YGD B;  1C07 A;  4DIR A;  1OMR A;  2A4J A;  4OCI A;  2LM5 A;  2LMT A;  2PVB A;  1JUO A;  1XFY O;  2M29 A;  3PLF B;  1M31 A;  2TN4 A;  4BY4 A;  2KDH A;  2ZRS A;  4QJ4 B;  3OX6 A;  1HQV A;  1FI5 A;  2JNF A;  1G8I A;  2K2F A;  1KSO A;  2KHN A;  1UUS A;  2BL0 C;  2EGD A;  3BQ3 A;  2CT9 A;  5DKQ A;  2HQW A;  1TIZ A;  1F70 A;  1B1G A;  2P6B B;  5AAN A;  2FJU B;  2KAY A;  3PN7 C;  4ICB A;  3ICB A;  2RGI A;  1WY9 A;  1A75 B;  2LMU A;  1A4P A;  1MXE A;  2BL0 B;  1AHR A;  3WHU B;  1BG1 A;  1Y6W A;  2ZFD A;  5CPV A;  3EK7 A;  4OV2 A;  2I2R E;  1JSA A;  4XYN A;  3PN7 B;  3TZ1 A;  2QPT A;  1AUI B;  3KHE A;  2CBL A;  1OSA A;  5GQQ C;  3BUN B;  1PK0 D;  1V1G A;  4OR9 B;  5I2L A;  2FCE A;  2ZND A;  2LVK A;  3NSL A;  3TUY C;  3VRR A;  2WCF A;  4PHN A;  1C7W A;  1N0Y A;  1MXL C;  1RK9 A;  5DKR A;  3VRQ A;  3BUX B;  5I2O A;  5I2Q A;  1B7T Y;  2LAN A;  1CDP A;  1LXF C;  5HYD A;  4YGC B;  4WQ2 A;  3TUY B;  2M1K B;  3FWB A;  4U8D A;  2LCP A;  1NX1 A;  4HRH A;  4PHM A;  2EHB A;  3LL8 B;  1Q80 A;  2LP2 A;  2QAC A;  3NSI A;  2L5X B;  3PAL A;  1X02 A;  4ZCV A;  1WDC C;  1DT7 B;  2Q91 A;  1S6I A;  4AQJ A;  5IBW A;  2KBI A;  1CLB A;  2O60 A;  2LMV A;  2VRG A;  2L98 A;  1DJX A;  1KK8 C;  1D1O A;  4P2Y B;  3EKH A;  2LE9 B;  3I5F C;  2KYF A;  1TRF A;  1WDC B;  1REC A;  2JT3 A;  1TTX A;  2Q4U A;  1XFX O;  3SG5 A;  1MWN A;  1S1E A;  2K7B A;  1PVB A;  2WCB A;  1PUL A;  2LC5 A;  2L4H A;  2NLN A;  4MZJ A;  2Y1N A;  1SNL A;  3I5F B;  3IQO A;  1S5G Z;  2KAX A;  2BKI B;  1EL4 A;  1CNP A;  1ZFS A;  1QVI Z;  5CSI A;  1BR4 B;  1DF0 A;  1MUX A;  2KYC A;  2OS8 B;  1K95 A;  3TDU A;  3A8R A;  2K61 A;  1TNP A;  1QTX A;  2WC8 A;  1SL7 A;  2K0J A;  4NDC A;  1EXR A;  1NCZ A;  4AQI A;  2LUC A;  5HKW A;  2COL B;  1A03 A;  2M8U A;  1V1F A;  2WOR A;  1QIV A;  2LAP A;  3RM1 A;  1A29 A;  1DGV A;  4XJK B;  2Y1M A;  3OP0 A;  1FW4 A;  1Y1U A;  2BCA A;  2JC2 A;  2AUC A;  3D0Y B;  3TDZ A;  1CDN A;  2F3Z A;  3OX5 A;  1SYM A;  3M0W A;  2K7D A;  2H2K A;  2KSP A;  4GNK B;  1MHO A;  2GGM A;  1KQM C;  1RTP 1;  2MLF C;  2PAL A;  5I8N A;  2LLU A;  2JNX A;  4PHJ A;  1SBJ A;  3H4S E;  3NSO A;  4L9M A;  3CS1 A;  2HF5 A;  1KQM B;  2JTT A;  3F45 A;  3KEV A;  4GPL B;  1IQ5 A;  1G33 A;  1F8H A;  4PE4 A;  3AAJ A;  1WRZ A;  3CLN A;  1UHI A;  3I5I C;  2MAZ A;  4HRE E;  4N1F A;  1XA5 A;  4NDB A;  1LVC D;  4DRW A;  2O5G A;  1K96 A;  5K89 A;  3O4Y A;  3O6B A;  1LIN A;  3JVT C;  4C0J A;  1N2D A;  2K2A A;  3PFV A;  1LA0 A;  1RFJ A;  2LVJ A;  2FCD A;  4YI8 A;  2MHH A;  1ODB A;  1YX7 A;  4YRU A;  2PSR A;  4I5N B;  4CLN A;  4WRI A;  2F3Y A;  2ZRT A;  3JVT B;  4MZL A;  2JPT A;  1KFX S;  1WLZ A;  4GUK A;  1OE9 B;  3KO0 A;  2JU0 A;  1QXP A;  2BBM A;  3I5H C;  4MSP A;  2BKH B;  1DGU A;  4HRG A;  2BBN A;  1UP5 A;  1J1E A;  1OZS A;  1IJ6 A;  2BEC A;  1PRW A;  1CFD A;  2R2I A;  1CFF A;  1IH0 A;  4PE1 A;  3GK4 X;  1AVS A;  4F0Z B;  4YBH B;  1NUB A;  1IQ3 A;  1CKK A;  3TDI A;  3DD4 A;  3I5H B;  2K7C A;  4OKH A;  4GGF A;  3SIB A;  2LHI A;  2B1U A;  2E30 A;  2M9G A;  3C1V A;  1SCM C;  3BUO B;  1TNW A;  2MJW B;  1NSH A;  1FPW A;  5ER5 A;  2OPO A;  5F6T A;  1BF5 A;  2FOT A;  5HKY A;  1DJI A;  1UHH A;  3FS7 A;  1CTR A;  1K2H A;  2KNE A;  1NX2 A;  1RJV A;  1SCM B;  3BOW A;  2PAS A;  3CR2 A;  3HCM A;  2NCP A;  5AER A;  1UWO A;  1N65 A;  1YUR A;  1H4B A;  1XFV O;  1KFU S;  1CFC A;  4GGF C;  2LHL A;  2KFH A;  3SG3 A;  1YUU A;  4N1G A;  4NDD A;  1KWO C;  1DVI A;  4IL1 A;  1SY9 A;  1PSR A;  1UHJ A;  2Y5I A;  3BUM B;  2DOQ A;  4A4B A;  1MR8 A;  2KI4 C;  3I5G C;  1KWO B;  3KF9 A;  1DJY A;  1EG3 A;  3SG2 A;  3K21 A;  2AMI A;  1DJG A;  2L0P A;  4MRY A;  2I7A A;  1G4Y R;  1YRU B;  4PDZ A;  5J3X A;  1S5G Y;  1HT9 A;  2L2E A;  1RWY A;  4I5J A;  1QVI Y;  2KI4 B;  3I5G B;  1KK8 B;  5BPJ A;  1SKT A;  3IF7 A;  1XFZ O;  1E8A A;  4JPZ B;  3VRN A;  1BMO A;  4QJ5 B;  3PAT A;  2ISD A;  2M3W A;  1CM1 A;  1ZMZ A;  1QLS A;  2CCM A;  3EK8 A;  3GK2 A;  1IKU A;  2M49 B;  2F33 A;  1CM4 A;  1QX5 B;  1S6J A;  2LUX A;  4M2Q A;  1TOP A;  4FTG A;  1A2X A;  1NX0 A;  1TNX A;  1XFU O;  2F8P A;  2GGZ A;  2I18 A;  1EG4 A;  1U5I A;  2JXL A;  1BOD A;  1JF0 A; 
#chains in the Genus database with same CATH topology
 1KFX L;  2LLS A;  1DJZ A;  3LK1 A;  2D8N A;  5DKN A;  1QAT A;  5KTY A;  1Y0V H;  4R1E A;  3D76 A;  2G9B A;  5D7F A;  3DVM A;  1K8U A;  1PAL A;  1GQM A;  2LVI A;  3PSR A;  1SL8 A;  3DVJ A;  3O4X A;  1QAS A;  3S0E A;  1EH2 A;  2M7N A;  1Y1A A;  5AEQ A;  1S3P A;  1L7Z A;  1R6P A;  1W7J B;  2KQY A;  3OB1 B;  4M2O A;  1KK7 Z;  1WLM A;  5ER4 X;  3S0A A;  1B8L A;  1DF0 B;  3VRP A;  2ZNE A;  3KPX A;  3BUW B;  4A4C A;  2H61 A;  4Q04 A;  4PE7 A;  1QIW A;  4INX A;  1OOH A;  4E68 A;  1TN4 A;  4FQT A;  2JUL A;  1DEL A;  1GJY A;  1IG5 A;  1NCY A;  1M46 A;  1ALV A;  1SW8 A;  5I94 A;  3AKA A;  2NCO A;  3EKJ A;  5HLO A;  4KYN A;  2AAO A;  3RLZ A;  4GAO A;  5HL1 A;  1OZO A;  1YTZ C;  4ETO A;  3WHT B;  4DCK A;  3WNX B;  1AK8 A;  4JKT A;  3I5I B;  1S36 A;  1TCO B;  2ERB A;  4NQG A;  1KFU L;  2WCE A;  2JT8 A;  1YRT B;  2KLD A;  4DS7 A;  1PVA A;  2M7L A;  1BU3 A;  4OVN F;  1IWQ A;  1XO5 A;  1K94 A;  2KFG A;  1ZAC A;  3RZS A;  3CGA A;  4QJ3 B;  1B9A A;  1OMD A;  1XVJ A;  4JQ0 D;  5PAL A;  2SCP A;  1CMF A;  1CFP A;  1A75 A;  2KI6 D;  4CFR A;  1K9P A;  2YGU A;  3DXL A;  3O78 A;  4ORC B;  4TNC A;  4C0K A;  1IGV A;  5JJG A;  2PQL A;  4MBE A;  1QWV A;  1JC2 A;  1F55 A;  1XFW O;  1OOG A;  2BE6 A;  2HQ8 A;  1NX3 A;  3BXK A;  3D73 A;  3NGV A;  2K7O A;  3R72 A;  1WRL A;  1NWD A;  5CSN A;  3DVK A;  1GM0 A;  5AXI A;  2HPS A;  1QLK A;  1L2O C;  3EK4 A;  4AOM A;  1XYD A;  2KBM A;  3SG4 A;  5KSZ A;  1JWD A;  3D74 A;  2M0R A;  2CTN A;  3CR5 X;  1BT6 A;  2GV5 A;  2G2B A;  3CZT X;  1TUZ A;  2CNP A;  2KGR A;  1DMO A;  1BLQ A;  1BJF A;  1C7V A;  1PSB A;  1B8C A;  1J7P A;  1L2O B;  1OQP A;  2LVV A;  1NIW A;  5TNC A;  1DJW A;  1SR6 C;  2WND A;  4MN0 A;  1TUJ A;  1IJ5 A;  3B88 A;  1OW4 A;  2NXQ A;  3R1P A;  1J55 A;  3DF0 A;  3E3R A;  3SIA A;  3S0D A;  1TNQ A;  2JRF A;  2JT0 A;  4YGB B;  1J7Q A;  1UHN A;  2BCX A;  1QX2 A;  3EVU A;  5KU1 A;  4I5L B;  1SR6 B;  1R2U A;  1SCV A;  1TCF A;  1OMV A;  1YUT A;  1QJT A;  2ZN8 A;  4PCW A;  2KI6 C;  1XK4 A;  1S26 D;  1SRA A;  2JOJ A;  1M39 A;  3FIA A;  3TS5 C;  3PM2 A;  1MQ1 A;  3Q8I A;  3ZWH A;  4ORB B;  2L4I A;  1SPY A;  1SK6 D;  4MRX A;  1GGW A;  3OGN A;  5CSF A;  1AJ5 A;  2JXC A;  2PRU A;  3CR4 X;  2LV7 A;  3TS5 B;  3BOW B;  2M97 A;  4BY5 A;  3CZ0 A;  3DVE A;  1B4C A;  1K9K A;  3SJS A;  3FE9 A;  2KQ6 A;  1B7T Z;  4MLW A;  1MF8 B;  3LCP C;  4HSZ A;  1XK4 C;  1Y1X A;  4YGA A;  5FI2 A;  3JTD C;  1YR5 A;  2MLE C;  3DF0 B;  1LKJ A;  3GOF A;  2JZI A;  3EVV A;  4ORA B;  1GGZ A;  4ZCU A;  3S0B A;  1CB1 A;  4YI9 A;  5FI6 A;  1DJH A;  1DQE A;  1XFR A;  3K1E A;  3AAK A;  1SL9 A;  1EJ3 A;  1KSM A;  2Y4Q A;  2L50 A;  5JOL A;  4XJK A;  1FF1 A;  1B8R A;  1QS7 A;  2OTG C;  3EG5 B;  4N5X A;  3JTD B;  5HLV A;  2EC6 C;  1OOF A;  2JQ6 A;  3L4A A;  3VRO A;  3D0Y A;  3SS4 A;  1CMG A;  2KGB C;  2K8M B;  2SAS A;  4FQO A;  2PYQ A;  2OS8 C;  1WRK A;  2ZN9 A;  1K9U A;  3LLE A;  1NP8 A;  1FI6 A;  2MRD A;  1J7O A;  3BYA A;  2OTG B;  1YVH A;  2KOT A;  2E6W A;  3OB2 B;  2EC6 B;  5G08 A;  5HKZ A;  1JFJ A;  3VGO A;  1J1D A;  3EVR A;  1KCY A;  4USL A;  2JWW A;  5AFP A;  1KK7 Y;  1F71 A;  1M45 A;  5CSJ A;  1VRK A;  4CID A;  1JBA A;  4MVF A;  1QX7 A;  4PE0 A;  3IQQ A;  1ZUZ A;  3D10 A;  3A4U B;  2V53 A;  2JPO A;  2LP3 A;  4WQ3 A;  1IRJ A;  3SG7 A;  3S0F A;  2I94 A;  3OBV A;  1F4O A;  2HET A;  1K93 D;  4P5O E;  2MBX A;  1OOI X;  1LS8 A;  4YGE B;  3NSK A;  1UHK A;  1CDM A;  2CXJ A;  3NHI A;  1JF2 A;  1AJ4 A;  3AKB A;  1CLM A;  1LA3 A;  2JTZ A;  2P70 A;  3CTN A;  1SMG A;  1NPQ A;  2IS9 A;  2LNK A;  4UPG A;  4MZK A;  2MA2 A;  1JFK A;  1W7I B;  1U5I B;  1FBV A;  1J7R A;  4PHK A;  1DTL A;  1UUR A;  3CWG A;  2LLT A;  2L51 A;  1B47 A;  3FE8 A;  4M2P A;  5B8I B;  4GBA A;  1ZOT B;  1BR1 B;  2WOS A;  3MSE B;  4MEW A;  2KFF A;  4DUQ A;  1OOJ A;  1ALW A;  1NCX A;  1CLL A;  2F2O A;  4PAL A;  3WXA A;  1BOC A;  1AP4 A;  3OHM B;  1CDL A;  2M1U A;  3CYZ A;  3GK1 A;  1YX8 A;  4GGN A;  1QV1 A;  1IH0 A;  2H61 C;  1KQV A;  2PMY A;  3QRX A;  1H8B A;  1YVL A;  3FWC A;  3PM8 A;  5D69 A;  1QV0 A;  1M63 B;  1F54 A;  4CPV A;  2KAV A;  1YUS A;  1K90 D;  2ZKM X;  3S0G A;  4JWQ A;  2QEH A;  1S6C A;  4D1E A;  3BFB A;  3UNW A;  4GFT A;  3SG6 A;  3NXA A;  3HX4 A;  3ZNI A;  2BCB A;  2NZ0 A;  3DY9 A;  1RRO A;  5FYX A;  1F4Q A;  2BE4 A;  4I5K A;  2F2P A;  4CFQ A;  4C0L A;  1NYA A;  3O2P A;  3LK0 A;  4YGD B;  1C07 A;  4DIR A;  1OMR A;  2A4J A;  4OCI A;  2LM5 A;  2LMT A;  2PVB A;  1JUO A;  1XFY O;  2M29 A;  3PLF B;  1M31 A;  3R1V A;  2TN4 A;  4BY4 A;  1DC1 A;  1ORG A;  2P71 A;  2KDH A;  2ZRS A;  4QJ4 B;  3OX6 A;  1HQV A;  1FI5 A;  2JNF A;  1G8I A;  2K2F A;  1KSO A;  2KHN A;  1UUS A;  2BL0 C;  2EGD A;  3BQ3 A;  2CT9 A;  5DKQ A;  2HQW A;  1TIZ A;  1F70 A;  1B1G A;  2BAP A;  2P6B B;  5AAN A;  2FJU B;  2KAY A;  3PN7 C;  4ICB A;  3ICB A;  2RGI A;  1WY9 A;  1A75 B;  2LMU A;  1A4P A;  1MXE A;  2BL0 B;  1AHR A;  3WHU B;  1BG1 A;  1Y6W A;  2K60 A;  2ZFD A;  5CPV A;  3EK7 A;  4OV2 A;  3BFH A;  2I2R E;  1JSA A;  4XYN A;  3B86 A;  3PN7 B;  3TZ1 A;  2QPT A;  1AUI B;  3KHE A;  2CBL A;  2QEV A;  1OSA A;  2GTE A;  2BNX A;  1PK0 D;  1V1G A;  2KPH A;  3BUN B;  4JD9 A;  4OR9 B;  5GQQ C;  2FCE A;  3NHT A;  5FI7 A;  2ZND A;  2LVK A;  3NSL A;  3TUY C;  3VRR A;  2L2C A;  2WCF A;  1C7W A;  1N0Y A;  1MXL C;  1RK9 A;  3N7H A;  4PHN A;  3BUX B;  5DKR A;  3VRQ A;  5I2O A;  3L47 A;  5I2Q A;  3DYE A;  1B7T Y;  2LAN A;  1CDP A;  3PJI A;  1LXF C;  5HYD A;  4YGC B;  4WQ2 A;  3TUY B;  2M1K B;  3FWB A;  5I2L A;  3BJH A;  4U8D A;  2LCP A;  1NX1 A;  4HRH A;  4PHM A;  2EHB A;  3LL8 B;  1Q80 A;  2LP2 A;  2QAC A;  3NSI A;  2L5X B;  3PAL A;  1T14 A;  1X02 A;  4ZCV A;  1WDC C;  1DT7 B;  2Q91 A;  1S6I A;  4AQJ A;  5IBW A;  2KBI A;  1CLB A;  2O60 A;  2LMV A;  2VRG A;  2L98 A;  1DJX A;  1KK8 C;  1P28 A;  1D1O A;  4P2Y B;  3EKH A;  2LE9 B;  5DIC A;  3I5F C;  1DEK A;  1SSE B;  2KYF A;  1TRF A;  1WDC B;  1REC A;  2JT3 A;  1TTX A;  2Q4U A;  1XFX O;  3SG5 A;  1MWN A;  1S1E A;  2K7B A;  1PVB A;  2WCB A;  1PUL A;  2LC5 A;  2QEO A;  2L4H A;  2NLN A;  4MZJ A;  2Y1N A;  1SNL A;  3I5F B;  3IQO A;  1S5G Z;  2KAX A;  2BKI B;  1EL4 A;  1CNP A;  1ZFS A;  1QVI Z;  5CSI A;  1BR4 B;  3FE6 A;  1DF0 A;  1MUX A;  2KYC A;  2OS8 B;  1K95 A;  3TDU A;  3A8R A;  2K61 A;  1TNP A;  1QTX A;  2WC8 A;  1SL7 A;  2K0J A;  4NDC A;  1EXR A;  1NCZ A;  4AQI A;  2LUC A;  5HKW A;  2COL B;  1A03 A;  2M8U A;  1V1F A;  2WOR A;  1QIV A;  2LAP A;  3RM1 A;  3B6X A;  1A29 A;  1DGV A;  4XJK B;  2Y1M A;  3OP0 A;  1FW4 A;  1Y1U A;  3B7A A;  2BCA A;  2JC2 A;  2AUC A;  3D0Y B;  3TDZ A;  1CDN A;  2F3Z A;  3OX5 A;  2WCK A;  1SYM A;  2KLE A;  3M0W A;  2K7D A;  2H2K A;  2KSP A;  4GNK B;  1MHO A;  2GGM A;  1KQM C;  1RTP 1;  2MLF C;  2PAL A;  5I8N A;  3SS5 A;  3VB1 A;  2LLU A;  2JNX A;  4PHJ A;  1SBJ A;  4PT1 A;  2WC6 A;  3H4S E;  3NSO A;  4L9M A;  3CS1 A;  2HF5 A;  1KQM B;  2JTT A;  3F45 A;  3KEV A;  4GPL B;  1IQ5 A;  1G33 A;  1F8H A;  4PE4 A;  3AAJ A;  1WRZ A;  3CLN A;  1UHI A;  3I5I C;  2MAZ A;  4HRE E;  4N1F A;  1XA5 A;  4NDB A;  1LVC D;  4DRW A;  2O5G A;  4F7F A;  1K96 A;  5K89 A;  3O4Y A;  3O6B A;  1LIN A;  1TWO A;  3JVT C;  4C0J A;  2WCJ A;  1N2D A;  2K2A A;  3PFV A;  1LA0 A;  1RFJ A;  2LVJ A;  2FCD A;  4YI8 A;  1Z4H A;  2MHH A;  1ODB A;  1YX7 A;  4YRU A;  2PSR A;  2QEB A;  4I5N B;  4CLN A;  4WRI A;  2F3Y A;  2ZRT A;  3QME A;  3JVT B;  4MZL A;  2JPT A;  1KFX S;  1WLZ A;  4GUK A;  1OE9 B;  3KO0 A;  2QDI A;  2JU0 A;  1QXP A;  2BBM A;  3I5H C;  4MSP A;  2BKH B;  1DGU A;  4HRG A;  2BBN A;  1UP5 A;  3IVT A;  1J1E A;  1OZS A;  1IJ6 A;  1PRW A;  2BEC A;  1CFD A;  2R2I A;  2WCM A;  3DZT A;  1CFF A;  4PE1 A;  3GK4 X;  1AVS A;  4F0Z B;  4YBH B;  1NUB A;  1IQ3 A;  2L5Y A;  3TDI A;  1CKK A;  3DD4 A;  3I5H B;  2K7C A;  3D75 A;  3CDN A;  5D3O A;  4OKH A;  4GGF A;  3SIB A;  2LHI A;  2B1U A;  2E30 A;  2M9G A;  3C1V A;  1SCM C;  3SS3 A;  3BUO B;  1TNW A;  2MJW B;  1NSH A;  1FPW A;  5ER5 A;  3L4L A;  3BFA A;  1Z2C B;  2OPO A;  5F6T A;  1BF5 A;  2FOT A;  5HKY A;  1DJI A;  1UHH A;  3FS7 A;  1CTR A;  1K2H A;  2KNE A;  1NX2 A;  4IJ7 A;  1RJV A;  1SCM B;  3BOW A;  2PAS A;  3CR2 A;  3HCM A;  2NCP A;  5AER A;  2WCH A;  1UWO A;  1N65 A;  1YUR A;  2H8V A;  1W9Z A;  1XFV O;  1H4B A;  1KFU S;  4OZD A;  1CFC A;  4GGF C;  2LHL A;  2KFH A;  3SG3 A;  3D77 A;  1YUU A;  3R1O A;  4N1G A;  4NDD A;  1C3Z A;  1KWO C;  3CZ1 A;  1DVI A;  3CAB A;  3CZ2 A;  4IL1 A;  1SY9 A;  1C3Y A;  1PSR A;  1UHJ A;  2Y5I A;  3BUM B;  2DOQ A;  5EL2 A;  4A4B A;  1MR8 A;  2KI4 C;  3I5G C;  1KWO B;  3KF9 A;  1IIO A;  1DJY A;  1EG3 A;  3SG2 A;  2WCL A;  3K21 A;  2AMI A;  1DJG A;  2L0P A;  4MRY A;  2I7A A;  1G4Y R;  3UO9 A;  1YRU B;  4PDZ A;  5J3X A;  1S5G Y;  1HT9 A;  2L2E A;  1RWY A;  4I5J A;  1QVI Y;  2KI4 B;  3I5G B;  1KK8 B;  5BPJ A;  1SKT A;  3IF7 A;  3B87 A;  1XFZ O;  3D78 A;  1E8A A;  4JPZ B;  3VRN A;  1BMO A;  4QJ5 B;  3PAT A;  4INW A;  2ISD A;  2M3W A;  1CM1 A;  1ZMZ A;  1QLS A;  2CCM A;  3EK8 A;  3GK2 A;  2FJY A;  3V2L A;  2M49 B;  1IKU A;  2F33 A;  1CM4 A;  1QX5 B;  1S6J A;  2LUX A;  4M2Q A;  1TOP A;  4FTG A;  1A2X A;  1NX0 A;  1TNX A;  1XFU O;  2F8P A;  2GGZ A;  2I18 A;  2WC5 A;  1EG4 A;  1U5I A;  2JXL A;  1BOD A;  1JF0 A; 
#chains in the Genus database with same CATH homology
 1KFX L;  2LLS A;  1DJZ A;  3LK1 A;  2D8N A;  5DKN A;  1QAT A;  5KTY A;  1Y0V H;  4R1E A;  2G9B A;  5D7F A;  3DVM A;  1K8U A;  1PAL A;  1GQM A;  2LVI A;  3PSR A;  1SL8 A;  3DVJ A;  1QAS A;  1EH2 A;  2M7N A;  1Y1A A;  5AEQ A;  1S3P A;  1L7Z A;  1R6P A;  1W7J B;  2KQY A;  3OB1 B;  4M2O A;  1KK7 Z;  1WLM A;  5ER4 X;  1B8L A;  1DF0 B;  3VRP A;  2ZNE A;  3KPX A;  3BUW B;  4A4C A;  2H61 A;  4Q04 A;  4PE7 A;  1QIW A;  4E68 A;  1TN4 A;  2JUL A;  1IG5 A;  1GJY A;  1NCY A;  1M46 A;  1ALV A;  1SW8 A;  3AKA A;  2NCO A;  3EKJ A;  5HLO A;  3RLZ A;  2AAO A;  4GAO A;  1OZO A;  1YTZ C;  4ETO A;  3WHT B;  4DCK A;  3WNX B;  1AK8 A;  3I5I B;  1S36 A;  1TCO B;  4NQG A;  1KFU L;  2WCE A;  2JT8 A;  1YRT B;  4DS7 A;  1PVA A;  2M7L A;  1BU3 A;  4OVN F;  1IWQ A;  1XO5 A;  1K94 A;  2KFG A;  1ZAC A;  3CGA A;  4QJ3 B;  1B9A A;  1OMD A;  1XVJ A;  4JQ0 D;  5PAL A;  2SCP A;  1CMF A;  1CFP A;  1A75 A;  2KI6 D;  4CFR A;  1K9P A;  3O78 A;  4ORC B;  4TNC A;  4C0K A;  1IGV A;  5JJG A;  1F55 A;  4MBE A;  1JC2 A;  1XFW O;  2BE6 A;  2HQ8 A;  1NX3 A;  3BXK A;  2K7O A;  1WRL A;  1NWD A;  5CSN A;  3DVK A;  5AXI A;  2HPS A;  1QLK A;  1L2O C;  3EK4 A;  4AOM A;  1XYD A;  2KBM A;  3SG4 A;  5KSZ A;  1JWD A;  2M0R A;  2CTN A;  3CR5 X;  1BT6 A;  2GV5 A;  2G2B A;  3CZT X;  2CNP A;  2KGR A;  1DMO A;  1BLQ A;  1BJF A;  1C7V A;  1PSB A;  1B8C A;  1J7P A;  1L2O B;  1OQP A;  2LVV A;  1NIW A;  5TNC A;  1DJW A;  1SR6 C;  2WND A;  4MN0 A;  1IJ5 A;  2NXQ A;  1J55 A;  3DF0 A;  3E3R A;  3SIA A;  1TNQ A;  2JRF A;  2JT0 A;  4YGB B;  1J7Q A;  1UHN A;  2BCX A;  1QX2 A;  3EVU A;  5KU1 A;  4I5L B;  1SR6 B;  1R2U A;  1SCV A;  1TCF A;  1OMV A;  1YUT A;  1QJT A;  2ZN8 A;  4PCW A;  2KI6 C;  1XK4 A;  1S26 D;  1SRA A;  2JOJ A;  1M39 A;  3FIA A;  3TS5 C;  1MQ1 A;  3ZWH A;  4ORB B;  2L4I A;  1SPY A;  1SK6 D;  4MRX A;  1GGW A;  5CSF A;  1AJ5 A;  2JXC A;  2PRU A;  3CR4 X;  2LV7 A;  3TS5 B;  3BOW B;  2M97 A;  4BY5 A;  1B4C A;  3DVE A;  1K9K A;  3SJS A;  2KQ6 A;  1B7T Z;  4MLW A;  1MF8 B;  3LCP C;  4HSZ A;  1XK4 C;  1Y1X A;  4YGA A;  3JTD C;  1YR5 A;  2MLE C;  3DF0 B;  1LKJ A;  3GOF A;  2JZI A;  3EVV A;  4ORA B;  1GGZ A;  4ZCU A;  1CB1 A;  4YI9 A;  1DJH A;  3AAK A;  1SL9 A;  1EJ3 A;  1KSM A;  2Y4Q A;  2L50 A;  5JOL A;  4XJK A;  1FF1 A;  1B8R A;  1QS7 A;  2OTG C;  4N5X A;  3JTD B;  5HLV A;  2EC6 C;  2JQ6 A;  3VRO A;  3D0Y A;  1CMG A;  2KGB C;  2K8M B;  2SAS A;  4FQO A;  2OS8 C;  1WRK A;  2ZN9 A;  1K9U A;  3LLE A;  1NP8 A;  1FI6 A;  2MRD A;  1J7O A;  3BYA A;  2OTG B;  1YVH A;  2KOT A;  2E6W A;  3OB2 B;  2EC6 B;  5G08 A;  5HKZ A;  1JFJ A;  3VGO A;  1J1D A;  3EVR A;  1KCY A;  4USL A;  2JWW A;  5AFP A;  1KK7 Y;  1F71 A;  1M45 A;  5CSJ A;  1VRK A;  4CID A;  1JBA A;  4MVF A;  1QX7 A;  4PE0 A;  3IQQ A;  1ZUZ A;  3D10 A;  3A4U B;  2V53 A;  4WQ3 A;  2LP3 A;  3SG7 A;  1IRJ A;  2I94 A;  4P5O E;  1F4O A;  2HET A;  1K93 D;  2MBX A;  4YGE B;  3NSK A;  1UHK A;  1CDM A;  2CXJ A;  1JF2 A;  1AJ4 A;  3AKB A;  1CLM A;  1LA3 A;  2JTZ A;  3CTN A;  1SMG A;  1NPQ A;  2IS9 A;  2LNK A;  4UPG A;  4MZK A;  2MA2 A;  1JFK A;  1W7I B;  1U5I B;  1FBV A;  1J7R A;  4PHK A;  1DTL A;  1UUR A;  3CWG A;  2LLT A;  2L51 A;  1B47 A;  4M2P A;  5B8I B;  4GBA A;  1ZOT B;  1BR1 B;  2WOS A;  3MSE B;  4MEW A;  2KFF A;  4DUQ A;  1OOJ A;  1ALW A;  1NCX A;  1CLL A;  2F2O A;  4PAL A;  3WXA A;  1BOC A;  1AP4 A;  3OHM B;  1CDL A;  2M1U A;  3GK1 A;  4GGN A;  1YX8 A;  1QV1 A;  2H61 C;  1KQV A;  2PMY A;  3QRX A;  1H8B A;  1YVL A;  3FWC A;  3PM8 A;  5D69 A;  1QV0 A;  1M63 B;  1F54 A;  4CPV A;  2KAV A;  1YUS A;  1K90 D;  2ZKM X;  4JWQ A;  4D1E A;  1S6C A;  4GFT A;  3SG6 A;  3NXA A;  3HX4 A;  3ZNI A;  2BCB A;  2NZ0 A;  1RRO A;  5FYX A;  1F4Q A;  2BE4 A;  4I5K A;  2F2P A;  4CFQ A;  4C0L A;  1NYA A;  3O2P A;  3LK0 A;  4YGD B;  1C07 A;  4DIR A;  1OMR A;  2A4J A;  4OCI A;  2LM5 A;  2LMT A;  2PVB A;  1JUO A;  1XFY O;  2M29 A;  3PLF B;  1M31 A;  2TN4 A;  4BY4 A;  2KDH A;  2ZRS A;  4QJ4 B;  3OX6 A;  1HQV A;  1FI5 A;  2JNF A;  1G8I A;  2K2F A;  1KSO A;  2KHN A;  1UUS A;  2BL0 C;  2EGD A;  3BQ3 A;  2CT9 A;  5DKQ A;  2HQW A;  1TIZ A;  1F70 A;  1B1G A;  2P6B B;  5AAN A;  2FJU B;  2KAY A;  3PN7 C;  4ICB A;  3ICB A;  2RGI A;  1WY9 A;  1A75 B;  2LMU A;  1A4P A;  1MXE A;  2BL0 B;  1AHR A;  3WHU B;  1BG1 A;  1Y6W A;  2ZFD A;  5CPV A;  3EK7 A;  4OV2 A;  2I2R E;  1JSA A;  4XYN A;  3PN7 B;  3TZ1 A;  2QPT A;  1AUI B;  3KHE A;  2CBL A;  1OSA A;  5GQQ C;  3BUN B;  1PK0 D;  1V1G A;  4OR9 B;  5I2L A;  2FCE A;  2ZND A;  2LVK A;  3NSL A;  3TUY C;  3VRR A;  2WCF A;  4PHN A;  1C7W A;  1N0Y A;  1MXL C;  1RK9 A;  5DKR A;  3VRQ A;  3BUX B;  5I2O A;  5I2Q A;  1B7T Y;  2LAN A;  1CDP A;  1LXF C;  5HYD A;  4YGC B;  4WQ2 A;  3TUY B;  2M1K B;  3FWB A;  4U8D A;  2LCP A;  1NX1 A;  4HRH A;  4PHM A;  2EHB A;  3LL8 B;  1Q80 A;  2LP2 A;  2QAC A;  3NSI A;  2L5X B;  3PAL A;  1X02 A;  4ZCV A;  1WDC C;  1DT7 B;  2Q91 A;  1S6I A;  4AQJ A;  5IBW A;  2KBI A;  1CLB A;  2O60 A;  2LMV A;  2VRG A;  2L98 A;  1DJX A;  1KK8 C;  1D1O A;  4P2Y B;  3EKH A;  2LE9 B;  3I5F C;  2KYF A;  1TRF A;  1WDC B;  1REC A;  2JT3 A;  1TTX A;  2Q4U A;  1XFX O;  3SG5 A;  1MWN A;  1S1E A;  2K7B A;  1PVB A;  2WCB A;  1PUL A;  2LC5 A;  2L4H A;  2NLN A;  4MZJ A;  2Y1N A;  1SNL A;  3I5F B;  3IQO A;  1S5G Z;  2KAX A;  2BKI B;  1EL4 A;  1CNP A;  1ZFS A;  1QVI Z;  5CSI A;  1BR4 B;  1DF0 A;  1MUX A;  2KYC A;  2OS8 B;  1K95 A;  3TDU A;  3A8R A;  2K61 A;  1TNP A;  1QTX A;  2WC8 A;  1SL7 A;  2K0J A;  4NDC A;  1EXR A;  1NCZ A;  4AQI A;  2LUC A;  5HKW A;  2COL B;  1A03 A;  2M8U A;  1V1F A;  2WOR A;  1QIV A;  2LAP A;  3RM1 A;  1A29 A;  1DGV A;  4XJK B;  2Y1M A;  3OP0 A;  1FW4 A;  1Y1U A;  2BCA A;  2JC2 A;  2AUC A;  3D0Y B;  3TDZ A;  1CDN A;  2F3Z A;  3OX5 A;  1SYM A;  3M0W A;  2K7D A;  2H2K A;  2KSP A;  4GNK B;  1MHO A;  2GGM A;  1KQM C;  1RTP 1;  2MLF C;  2PAL A;  5I8N A;  2LLU A;  2JNX A;  4PHJ A;  1SBJ A;  3H4S E;  3NSO A;  4L9M A;  3CS1 A;  2HF5 A;  1KQM B;  2JTT A;  3F45 A;  3KEV A;  4GPL B;  1IQ5 A;  1G33 A;  1F8H A;  4PE4 A;  3AAJ A;  1WRZ A;  3CLN A;  1UHI A;  3I5I C;  2MAZ A;  4HRE E;  4N1F A;  1XA5 A;  4NDB A;  1LVC D;  4DRW A;  2O5G A;  1K96 A;  5K89 A;  3O4Y A;  3O6B A;  1LIN A;  3JVT C;  4C0J A;  1N2D A;  2K2A A;  3PFV A;  1LA0 A;  1RFJ A;  2LVJ A;  2FCD A;  4YI8 A;  2MHH A;  1ODB A;  1YX7 A;  4YRU A;  2PSR A;  4I5N B;  4CLN A;  4WRI A;  2F3Y A;  2ZRT A;  3JVT B;  4MZL A;  2JPT A;  1KFX S;  1WLZ A;  4GUK A;  1OE9 B;  3KO0 A;  2JU0 A;  1QXP A;  2BBM A;  3I5H C;  4MSP A;  2BKH B;  1DGU A;  4HRG A;  2BBN A;  1UP5 A;  1J1E A;  1OZS A;  1IJ6 A;  2BEC A;  1PRW A;  1CFD A;  2R2I A;  1CFF A;  1IH0 A;  4PE1 A;  3GK4 X;  1AVS A;  4F0Z B;  4YBH B;  1NUB A;  1IQ3 A;  1CKK A;  3TDI A;  3DD4 A;  3I5H B;  2K7C A;  4OKH A;  4GGF A;  3SIB A;  2LHI A;  2B1U A;  2E30 A;  2M9G A;  3C1V A;  1SCM C;  3BUO B;  1TNW A;  2MJW B;  1NSH A;  1FPW A;  5ER5 A;  2OPO A;  5F6T A;  1BF5 A;  2FOT A;  5HKY A;  1DJI A;  1UHH A;  3FS7 A;  1CTR A;  1K2H A;  2KNE A;  1NX2 A;  1RJV A;  1SCM B;  3BOW A;  2PAS A;  3CR2 A;  3HCM A;  2NCP A;  5AER A;  1UWO A;  1N65 A;  1YUR A;  1H4B A;  1XFV O;  1KFU S;  1CFC A;  4GGF C;  2LHL A;  2KFH A;  3SG3 A;  1YUU A;  4N1G A;  4NDD A;  1KWO C;  1DVI A;  4IL1 A;  1SY9 A;  1PSR A;  1UHJ A;  2Y5I A;  3BUM B;  2DOQ A;  4A4B A;  1MR8 A;  2KI4 C;  3I5G C;  1KWO B;  3KF9 A;  1DJY A;  1EG3 A;  3SG2 A;  3K21 A;  2AMI A;  1DJG A;  2L0P A;  4MRY A;  2I7A A;  1G4Y R;  1YRU B;  4PDZ A;  5J3X A;  1S5G Y;  1HT9 A;  2L2E A;  1RWY A;  4I5J A;  1QVI Y;  2KI4 B;  3I5G B;  1KK8 B;  5BPJ A;  1SKT A;  3IF7 A;  1XFZ O;  1E8A A;  4JPZ B;  3VRN A;  1BMO A;  4QJ5 B;  3PAT A;  2ISD A;  2M3W A;  1CM1 A;  1ZMZ A;  1QLS A;  2CCM A;  3EK8 A;  3GK2 A;  1IKU A;  2M49 B;  2F33 A;  1CM4 A;  1QX5 B;  1S6J A;  2LUX A;  4M2Q A;  1TOP A;  4FTG A;  1A2X A;  1NX0 A;  1TNX A;  1XFU O;  2F8P A;  2GGZ A;  2I18 A;  1EG4 A;  1U5I A;  2JXL A;  1BOD A;  1JF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...