1HQVA

Structure of apoptosis-linked protein alg-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
178
Chain Sequence
PGPGGGPGPAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROGRAMMED CELL DEATH PROTEIN 6
publication title Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 64
structure length 178
sequence length 181
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1hqvA00
3D0YA 2R2IA 2JTTA 1W7IB 2BE6A 2MLFC 2ZKMX 2K8MB 1K95A 2E30A 1CM1A 1J55A 2KBMA 2LMUA 2PRUA 5HYDA 2PVBA 2I2RE 1B8LA 5AERA 2P6BB 1GGWA 5ER5A 4YBHB 1FI6A 2F8PA 1L2OB 1PRWA 1QS7A 3BUMB 4M2PA 1JUOA 1DGVA 1QJTA 2BKHB 4N1GA 1QATA 3CGAA 2Q91A 5PALA 4MZLA 3NXAA 1TNPA 3BUXB 4MRXA 3M0WA 1J7OA 1HQVA 1ZUZA 2F2OA 1SPYA 2JC2A 2JXLA 2KGBC 2L98A 1TIZA 3AKBA 2HPSA 2M97A 1GQMA 2LV7A 1L7ZA 4PE1A 4MZKA 5HKZA 5GQQC 3O4YA 3DVMA 4PHMA 1NX2A 1IJ6A 1YR5A 3WHTB 1S6CA 1PVBA 1FI5A 2CBLA 1QX5B 5AXIA 1EXRA 1RK9A 1UHKA 2BBNA 3BUNB 3SG2A 1NCYA 1EG4A 2M7NA 2ZRSA 1XFXO 3FWCA 1S26D 2WORA 3SG4A 2FOTA 1CDNA 1AHRA 3OHMB 2H61C 5G08A 4NDCA 4ICBA 1J1EA 1LA0A 1RWYA 1M45A 2SASA 3JVTC 1MR8A 3OP0A 4PE4A 2F2PA 2L4IA 1N0YA 2FJUB 2KYCA 4MBEA 1JC2A 4DIRA 1SCVA 1BG1A 1SL8A 3I5HB 1F71A 2CT9A 2L51A 2JULA 2LCPA 5HKYA 3AAKA 4QJ3B 5I2LA 1EG3A 3OX6A 3WXAA 5K89A 3CR5X 1SRAA 2KFFA 1NP8A 2CXJA 2HQWA 4DS7A 4N1FA 5J3XA 3A4UB 3ICBA 3JTDC 1C07A 1K96A 4U8DA 4AQJA 2OTGC 4OVNF 1CDPA 4CLNA 1F4QA 2BECA 2ZFDA 1J7RA 3I5FB 4WQ3A 5DKQA 1QTXA 1TTXA 2HF5A 5I2OA 1UP5A 3CTNA 4QJ5B 2L4HA 1UUSA 1A03A 1SR6B 1QVIZ 3SIBA 1K9UA 1OOJA 2OS8C 2LLUA 5DKNA 1QIWA 1SL7A 3TS5B 3ZNIA 4IL1A 1FBVA 5IBWA 3LLEA 2LAPA 2O5GA 4BY5A 1NCXA 1S1EA 2CNPA 1PK0D 3D10A 2F3YA 2COLB 1QVIY 3PFVA 1SCMC 3DF0B 3CS1A 3PN7B 2MBXA 5I2QA 1DF0A 2KQYA 2KNEA 2K61A 3PSRA 1DJXA 1KSOA 1NX3A 2NCOA 1TOPA 1K9KA 1BR1B 2AAOA 2JT8A 2MLEC 5B8IB 1F54A 2CCMA 2QACA 3DD4A 2M1KB 1QV0A 1ALWA 2JNXA 2KI4B 2ISDA 1PALA 4AQIA 1K2HA 1XFVO 1LINA 1IGVA 2LMTA 1BF5A 1BOCA 3SJSA 4DCKA 5CSNA 1VRKA 4YGAA 2ZN9A 3DVKA 4MRYA 4C0JA 1S6IA 2KAYA 1IWQA 2MA2A 1QLSA 1Y0VH 2BE4A 1B1GA 1KWOC 2K7BA 1WRLA 2JU0A 3GK2A 1N2DA 1OMDA 1UHNA 3H4SE 4PHJA 1SYMA 1N65A 4GGFC 2OPOA 3TDUA 4JPZB 3BOWB 1TRFA 3LCPC 3SG6A 1Y1AA 1BT6A 1TN4A 1EH2A 1GJYA 2BCXA 3K21A 5F6TA 2PMYA 1CTRA 1J1DA 2GGMA 1YUTA 3KF9A 4ORBB 1KQMC 1KFXS 4P5OE 1NCZA 1FPWA 1OQPA 1OMVA 1Y6WA 2AUCA 2NLNA 3VGOA 1FW4A 2JQ6A 3VRNA 2GGZA 2JRFA 1NIWA 3TUYB 5KSZA 1V1GA 4TNCA 5HLVA 4MSPA 1ZMZA 2KYFA 4CFQA 1DJGA 3EK4A 1YURA 4YGDB 5KU1A 4M2OA 1KFXL 3LK0A 2JTZA 1ZACA 1KK8C 1DMOA 1B47A 2K7OA 3E3RA 1QV1A 5D7FA 3BYAA 2LUXA 4PHKA 4PHNA 2LHIA 4GAOA 3KEVA 2EC6C 1CMFA 3CR2A 4OCIA 3KHEA 1KCYA 2JXCA 3BXKA 1XFZO 4CPVA 2BKIB 2MRDA 1DT7B 1CFDA 1DJWA 4PCWA 1JFJA 1JWDA 4OKHA 4A4BA 3I5GB 2M49B 2M3WA 4FTGA 4YGCB 2OTGB 1CLBA 2BCAA 2I18A 4PE0A 1WDCC 2FCDA 2JT0A 2KBIA 3HCMA 1YUSA 2PALA 4M2QA 5D69A 1G8IA 2NXQA 1A4PA 4JWQA 3TDZA 2KQ6A 1DJIA 2ZNEA 1QASA 3PM8A 3CWGA 4USLA 1EL4A 1KQVA 1HT9A 1AP4A 1S6JA 1M31A 3EKHA 1XFYO 2KDHA 1QX2A 1SCMB 1U5IB 1JBAA 1YX7A 1G33A 3RLZA 1X02A 1DJZA 2LMVA 2Y1NA 3EK7A 2WCFA 1BU3A 1H4BA 2CTNA 2BCBA 5CSIA 3A8RA 4PDZA 3AAJA 1K8UA 2BL0B 1MHOA 4ETOA 4C0LA 1YTZC 1XK4A 1WY9A 2KI6C 1B8RA 2KSPA 3IQOA 1IQ3A 3DF0A 2V53A 2PSRA 3EVRA 4R1EA 1MF8B 1B7TZ 1SNLA 1YRTB 2BBMA 5JJGA 1D1OA 1QX7A 3FS7A 5I8NA 2H2KA 1CFPA 4DUQA 4I5KA 1B7TY 4WRIA 2GV5A 3BQ3A 3EVUA 4ORCB 1UURA 1YRUB 1H8BA 4OV2A 1KWOB 2I94A 4ZCUA 2G9BA 3O6BA 2K7DA 1OSAA 3IF7A 1K94A 1WRKA 2KGRA 2LVKA 4CFRA 3WNXB 3OB1B 2NZ0A 2KOTA 1CFFA 1AK8A 1CDMA 3CLNA 4GBAA 4BY4A 1E8AA 2RGIA 1AUIB 3FIAA 1UWOA 3TDIA 1NUBA 2ZRTA 1F8HA 3VROA 2MHHA 1AVSA 2QPTA 4MVFA 3QRXA 3ZWHA 1YVHA 1Q80A 2K7CA 3AKAA 2EGDA 3O2PA 1XVJA 2WOSA 1LVCD 1CKKA 2M9GA 3BUOB 1R6PA 5AEQA 1M39A 2Y1MA 3BOWA 3I5HC 1UHJA 3DVEA 4F0ZB 1A29A 2DOQA 3C1VA 5DKRA 3I5IC 1TNXA 4I5LB 1JFKA 1YVLA 4GPLB 2LNKA 3LL8B 3VRQA 2KHNA 3OB2B 1KK8B 2JWWA 3NSIA 4A4CA 1QIVA 1EJ3A 2LC5A 1CNPA 1SY9A 2K2AA 2I7AA 1AJ5A 2M29A 3GOFA 1CLMA 1SR6C 5CPVA 1IG5A 2SCPA 1TNQA 1M46A 3WHUB 1IJ5A 2LVVA 3TS5C 1A2XA 3PALA 2M0RA 2A4JA 2K0JA 3SIAA 1F70A 3KPXA 3VRRA 1TNWA 1A75B 5CSJA 2JZIA 1XK4C 1M63B 1SBJA 1CLLA 3CZTX 5AANA 4GGNA 1WDCB 1XA5A 3IQQA 2ZN8A 1UHIA 1F4OA 2LANA 2LHLA 3SG3A 1BR4B 1OMRA 4YI8A 2M7LA 2L0PA 4NDBA 1SL9A 1WRZA 1OE9B 1SMGA 1NYAA 3JVTB 3FWBA 2LLTA 1KFUS 3NSOA 1CFCA 5TNCA 1XFUO 4XJKB 4UPGA 2KI4C 4HREE 3VRPA 5BPJA 2G2BA 4P2YB 1ODBA 1QLKA 4DRWA 2LP3A 3RM1A 3EVVA 4MEWA 1YX8A 1DJHA 1SW8A 3DVJA 1B8CA 5ER4X 3D0YB 1KFUL 3LK1A 4GFTA 4GNKB 3JTDB 4MLWA 5KTYA 1DJYA 1U5IA 3O78A 1QXPA 3MSEB 1NWDA 1W7JB 1PULA 2KAVA 4I5JA 1TCFA 5CSFA 4CIDA 1K93D 1UHHA 5FYXA 1WLMA 1IRJA 2L5XB 4AOMA 1RJVA 1V1FA 1J7PA 4HRHA 2OS8B 1CM4A 4YGBB 2M1UA 1WLZA 4HRGA 2LM5A 1RTP1 4HSZA 1L2OC 2TN4A 1CDLA 2MAZA 1JSAA 1LXFC 3OX5A 5JOLA 1NX0A 3EK8A 1XFWO 1B9AA 1J7QA 4YGEB 4NDDA 3SG7A 1OZSA 3TUYC 4D1EA 4WQ2A 4YI9A 1RFJA 2JNFA 4I5NB 1XYDA 2JT3A 2B1UA 1B4CA 3NSLA 2JPTA 2MJWB 2F33A 2VRGA 1TCOB 2HETA 4GGFA 3HX4A 1MXEA 1BMOA 2LP2A 1FF1A 1OZOA 1R2UA 2LUCA 1YUUA 3I5IB 4MZJA 1KSMA 4YRUA 3NSKA 1MWNA 1DVIA 2KI6D 2HQ8A 3I5GC 1BLQA 4XYNA 1K90D 1SKTA 1JF2A 3EKJA 4MN0A 1LKJA 1MQ1A 1CB1A 1AJ4A 2ZNDA 1IQ5A 3TZ1A 1C7WA 5AFPA 1BJFA 1DTLA 2M8UA 1PSBA 4C0KA 1IH0A 4L9MA 1S3PA 2WC8A 4PE7A 2L2EA 1K9PA 2E6WA 2EHBA 2LLSA 4Q04A 1MUXA 1KQMB 2Y4QA 1XO5A 4NQGA 1PSRA 1SK6D 4PALA 5HKWA 4JQ0D 1NX1A 2F3ZA 4OR9B 1Y1XA 4N5XA 3KO0A 2WCBA 1G4YR 1Y1UA 2O60A 2WCEA 1DGUA 1S36A 2BL0C 2LVIA 1A75A 2PASA 4QJ4B 2K2FA 2FCEA 2LE9B 2D8NA 2L50A 2NCPA 1ALVA 1KK7Z 3I5FC 4ZCVA 2EC6B 3PLFB 2Q4UA 4ORAB 1ZOTB 1PVAA 1NPQA 2Y5IA 3F45A 1RROA 2H61A 2JOJA 2KFGA 1DF0B 3SG5A 2IS9A 4E68A 2WNDA 1IKUA 1JF0A 2AMIA 1KK7Y 4FQOA 4GUKA 1F55A 1S5GZ 2KFHA 2LVJA 1LA3A 1C7VA 3GK1A 4XJKA 3GK4X 2KAXA 1CMGA 1NSHA 1BODA 3CR4X 1ZFSA 1MXLC 3PATA 3PN7C 1S5GY 1GGZA 1RECA 3BUWB 5HLOA
chains in the Genus database with same CATH superfamily
3D0YA 2R2IA 2JTTA 1W7IB 2BE6A 2MLFC 2ZKMX 2K8MB 1K95A 2E30A 1CM1A 1J55A 2KBMA 2LMUA 2PRUA 5HYDA 2PVBA 2I2RE 1B8LA 5AERA 2P6BB 1GGWA 5ER5A 4YBHB 1FI6A 4IJ7A 2F8PA 1L2OB 1PRWA 1QS7A 3BUMB 3EG5B 4M2PA 1JUOA 1DGVA 1QJTA 2BKHB 4N1GA 1QATA 3DYEA 5FI7A 3CGAA 2Q91A 5PALA 4MZLA 3NXAA 1TNPA 3BUXB 4MRXA 3M0WA 3DXLA 1J7OA 1C3ZA 1HQVA 3D78A 1ZUZA 2F2OA 1SPYA 2JC2A 2JXLA 2KGBC 2L98A 1TIZA 3B86A 3AKBA 3L4LA 2HPSA 2M97A 1GQMA 2LV7A 1L7ZA 4PE1A 4MZKA 5HKZA 5GQQC 3O4YA 3DVMA 4PHMA 1NX2A 1IJ6A 1YR5A 3WHTB 1S6CA 1PVBA 3L4AA 1FI5A 2CBLA 1QX5B 5AXIA 1EXRA 1RK9A 1UHKA 2BBNA 3BUNB 3SG2A 1NCYA 1EG4A 2M7NA 2ZRSA 1XFXO 3FWCA 1S26D 3D74A 2WORA 3SG4A 2FOTA 1CDNA 1AHRA 3OHMB 1ORGA 2H61C 5G08A 4NDCA 4ICBA 1J1EA 1LA0A 1RWYA 1M45A 3SS3A 2SASA 1Z2CB 1MR8A 3JVTC 3OP0A 4PE4A 2F2PA 2L4IA 1N0YA 2FJUB 2KYCA 4MBEA 1JC2A 2BNXA 4DIRA 1SCVA 1BG1A 1SL8A 3I5HB 1F71A 2CT9A 2L51A 2JULA 2LCPA 2YGUA 5HKYA 3S0EA 3AAKA 2P70A 4QJ3B 5I2LA 1EG3A 3OX6A 3WXAA 1P28A 5K89A 3CR5X 1SRAA 2KFFA 1NP8A 2CXJA 2KLDA 2HQWA 3NHTA 4DS7A 2K60A 4N1FA 5J3XA 3A4UB 3ICBA 3JTDC 2H8VA 1C07A 1K96A 4U8DA 4AQJA 2OTGC 4OVNF 1CDPA 4CLNA 1F4QA 2BECA 2ZFDA 1J7RA 3I5FB 3R1VA 4WQ3A 1OOGA 5DKQA 1QTXA 1TTXA 2HF5A 5I2OA 1UP5A 3CTNA 4QJ5B 2L4HA 1UUSA 1A03A 1SR6B 1QVIZ 3SIBA 1K9UA 1OOJA 2OS8C 1OOFA 2LLUA 1QIWA 1SL7A 5DKNA 3TS5B 3ZNIA 4IL1A 1FBVA 5IBWA 3LLEA 2LAPA 2O5GA 3CZ0A 4BY5A 1NCXA 1S1EA 2CNPA 1PK0D 3D10A 3CABA 2F3YA 2COLB 1QVIY 3PFVA 1SCMC 3DF0B 3CS1A 3PN7B 2GTEA 2MBXA 5I2QA 1DF0A 2KQYA 3N7HA 2KNEA 2K61A 3PSRA 3S0FA 1DJXA 1KSOA 1NX3A 2NCOA 1TOPA 1K9KA 1BR1B 2AAOA 2JT8A 2MLEC 5B8IB 1F54A 2CCMA 2QACA 3DD4A 2M1KB 4JKTA 1QV0A 1ALWA 2JNXA 2KI4B 5EL2A 1PALA 3D75A 2ISDA 1XFVO 4AQIA 1K2HA 1SSEB 1LINA 1IGVA 2LMTA 1BF5A 1BOCA 3SJSA 4DCKA 5CSNA 1DEKA 1VRKA 4YGAA 2ZN9A 3DVKA 2QEBA 3S0GA 1Z4HA 4MRYA 4C0JA 1S6IA 2KAYA 1IWQA 2MA2A 1QLSA 1Y0VH 2ERBA 1OOHA 2BE4A 1B1GA 1KWOC 2K7BA 1WRLA 2JU0A 2WCHA 3GK2A 1N2DA 1OMDA 1UHNA 2WC5A 3H4SE 3PM2A 4PHJA 1SYMA 1N65A 4GGFC 2OPOA 3BFAA 3TDUA 4JPZB 3BOWB 1TRFA 3LCPC 3SG6A 1Y1AA 4KYNA 1BT6A 1TN4A 1EH2A 1GJYA 2BCXA 3K21A 5F6TA 2PMYA 1CTRA 3R1PA 1J1DA 2GGMA 1YUTA 3KF9A 4ORBB 1KQMC 1KFXS 4P5OE 1GM0A 1NCZA 1FPWA 1OQPA 1OMVA 1Y6WA 4OZDA 2AUCA 2NLNA 3VGOA 1FW4A 2JQ6A 3VRNA 2GGZA 2JRFA 1NIWA 3D73A 3TUYB 5HL1A 1V1GA 5KSZA 4TNCA 5HLVA 4MSPA 1ZMZA 2KYFA 3DZTA 4CFQA 2WCJA 1DJGA 3EK4A 1YURA 4YGDB 3B7AA 5KU1A 4M2OA 1KFXL 5DICA 3LK0A 2JTZA 1ZACA 1KK8C 1DMOA 1B47A 3B88A 2K7OA 3E3RA 1QV1A 5D7FA 3BYAA 2LUXA 4PHKA 4PHNA 2LHIA 4GAOA 3KEVA 2EC6C 1CMFA 3CR2A 4OCIA 3KHEA 3K1EA 1KCYA 2JXCA 3BXKA 1XFZO 4CPVA 2BKIB 2MRDA 1DT7B 1CFDA 1DJWA 4PCWA 3D76A 1JFJA 1JWDA 3B87A 4OKHA 4A4BA 3I5GB 2M49B 2M3WA 4FTGA 3BFHA 4YGCB 2OTGB 1CLBA 2BCAA 2I18A 4PE0A 3BFBA 1WDCC 2FCDA 2JT0A 2KBIA 3HCMA 4INXA 1YUSA 2PALA 4M2QA 2KLEA 5D69A 1G8IA 3OBVA 2NXQA 1A4PA 2BAPA 4JWQA 3TDZA 2KQ6A 1DJIA 2ZNEA 1QASA 3PM8A 3CWGA 4USLA 1EL4A 1KQVA 1HT9A 1AP4A 3CZ2A 3Q8IA 1S6JA 1M31A 3EKHA 1XFYO 2KDHA 1QX2A 1SCMB 1U5IB 1JBAA 1YX7A 2WCLA 3S0BA 1G33A 3RLZA 1X02A 1DJZA 1XFRA 2KPHA 2LMVA 2WCFA 1BU3A 2Y1NA 3EK7A 2CTNA 1H4BA 1OW4A 2BCBA 5CSIA 3A8RA 4PDZA 3AAJA 2WCMA 1K8UA 2BL0B 1MHOA 4ETOA 4C0LA 1YTZC 1XK4A 1WY9A 2KI6C 1B8RA 2KSPA 3IQOA 1IQ3A 3DF0A 2V53A 2PSRA 3EVRA 4R1EA 1MF8B 1B7TZ 1SNLA 1YRTB 3R1OA 2BBMA 5JJGA 1D1OA 1QX7A 3FS7A 5I8NA 2H2KA 1CFPA 2L2CA 3QMEA 4DUQA 4I5KA 1B7TY 4WRIA 1TWOA 2GV5A 3BQ3A 2PYQA 3DY9A 3EVUA 3RZSA 4ORCB 1UURA 1YRUB 1H8BA 4OV2A 1KWOB 2I94A 4ZCUA 2G9BA 3O6BA 2K7DA 1OSAA 1TUZA 3IF7A 1K94A 1WRKA 2KGRA 2LVKA 4CFRA 3WNXB 3OB1B 2NZ0A 2KOTA 1CFFA 1AK8A 1CDMA 3CLNA 4GBAA 4BY4A 1E8AA 2RGIA 1AUIB 3FIAA 1UWOA 3SS4A 3TDIA 1NUBA 3NHIA 2ZRTA 1F8HA 2JPOA 3UO9A 2MHHA 1AVSA 2QPTA 4MVFA 3QRXA 3VROA 3ZWHA 1YVHA 1Q80A 2K7CA 3AKAA 2EGDA 3O2PA 1XVJA 2WOSA 1LVCD 1CKKA 2M9GA 3BUOB 1R6PA 3BJHA 1M39A 2Y1MA 1T14A 3BOWA 3I5HC 5AEQA 3L47A 1UHJA 3SS5A 3DVEA 4F0ZB 1A29A 2DOQA 3C1VA 4FQTA 5DKRA 3I5IC 5FI6A 1TNXA 4I5LB 5I94A 1JFKA 1YVLA 3FE8A 4GPLB 2LNKA 2QEHA 3LL8B 3VRQA 2KHNA 2QEVA 1KK8B 3OB2B 2QEOA 2JWWA 3NSIA 4A4CA 1QIVA 1EJ3A 2LC5A 3B6XA 1W9ZA 1SY9A 1CNPA 2K2AA 2I7AA 1AJ5A 2M29A 3GOFA 1CLMA 1SR6C 5CPVA 1IG5A 2SCPA 1TNQA 1M46A 1DC1A 3WHUB 1IJ5A 2LVVA 3TS5C 1A2XA 3PALA 2M0RA 2A4JA 2K0JA 3SIAA 1F70A 3KPXA 3VRRA 1TNWA 1A75B 5CSJA 2JZIA 1XK4C 1M63B 1SBJA 1CLLA 3CZTX 3OGNA 5AANA 4GGNA 1WDCB 1XA5A 3IQQA 1IIOA 2ZN8A 1UHIA 1F4OA 2LANA 2LHLA 3SG3A 1BR4B 1OMRA 4YI8A 2M7LA 2L0PA 4NDBA 1SL9A 1WRZA 4INWA 1OE9B 1SMGA 1NYAA 3JVTB 1LS8A 3FWBA 2LLTA 1KFUS 3NSOA 5FI2A 1CFCA 4PT1A 5TNCA 1XFUO 4XJKB 4UPGA 2KI4C 4HREE 3VRPA 5BPJA 2G2BA 4P2YB 1ODBA 1QLKA 4DRWA 2LP3A 3RM1A 3EVVA 3NGVA 4MEWA 1YX8A 1DJHA 1SW8A 3DVJA 1B8CA 5ER4X 3PJIA 3D0YB 1KFUL 1DELA 3LK1A 4GFTA 4GNKB 3JTDB 4MLWA 5KTYA 1DJYA 1U5IA 3O78A 1TUJA 1QXPA 3MSEB 3V2LA 1NWDA 1W7JB 1PULA 2WC6A 3FE6A 2KAVA 3O4XA 4I5JA 1TCFA 5CSFA 4CIDA 1K93D 1UHHA 5FYXA 1WLMA 1IRJA 2L5XB 4AOMA 1RJVA 1V1FA 1J7PA 4HRHA 2OS8B 1CM4A 4YGBB 2M1UA 1WLZA 4HRGA 2LM5A 1RTP1 3CDNA 4HSZA 1DQEA 1L2OC 2TN4A 3VB1A 1CDLA 2MAZA 1JSAA 1LXFC 3OX5A 5D3OA 5JOLA 1NX0A 3EK8A 1XFWO 2QDIA 3S0AA 1B9AA 1J7QA 4YGEB 4JD9A 4NDDA 3SG7A 1OZSA 3TUYC 3S0DA 4D1EA 4WQ2A 4YI9A 1RFJA 2JNFA 4I5NB 1XYDA 2JT3A 2B1UA 1B4CA 3NSLA 2JPTA 2MJWB 2F33A 2VRGA 1TCOB 2HETA 4GGFA 2PQLA 3HX4A 1MXEA 1BMOA 2LP2A 3D77A 1FF1A 1OZOA 1R2UA 2FJYA 2LUCA 1YUUA 3I5IB 4MZJA 1KSMA 4YRUA 3NSKA 1MWNA 1DVIA 2KI6D 2WCKA 2HQ8A 3I5GC 4F7FA 4XYNA 1K90D 1BLQA 1SKTA 1JF2A 3EKJA 3CZ1A 4MN0A 1LKJA 1MQ1A 1CB1A 1AJ4A 2ZNDA 1IQ5A 3TZ1A 1C7WA 5AFPA 1BJFA 1DTLA 2M8UA 1PSBA 4C0KA 1IH0A 4L9MA 1S3PA 2WC8A 4PE7A 3FE9A 2L2EA 1K9PA 2E6WA 2EHBA 2LLSA 3CYZA 4Q04A 1C3YA 1MUXA 1KQMB 2Y4QA 1XO5A 4NQGA 1PSRA 1SK6D 4PALA 5HKWA 4JQ0D 1NX1A 2F3ZA 4OR9B 1Y1XA 4N5XA 3R72A 3KO0A 2WCBA 1G4YR 1Y1UA 2O60A 2WCEA 1DGUA 3UNWA 1S36A 2BL0C 2LVIA 1A75A 2PASA 4QJ4B 2K2FA 2FCEA 2LE9B 2D8NA 3IVTA 1OOIX 2L50A 2NCPA 1ALVA 1KK7Z 3I5FC 4ZCVA 2P71A 2EC6B 3PLFB 2Q4UA 4ORAB 1ZOTB 1PVAA 1NPQA 2Y5IA 3F45A 1RROA 2H61A 2JOJA 2KFGA 1DF0B 3SG5A 2IS9A 4E68A 2WNDA 1IKUA 1JF0A 2AMIA 1KK7Y 2L5YA 4FQOA 4GUKA 1F55A 1S5GZ 2KFHA 2LVJA 1LA3A 1C7VA 3GK1A 4XJKA 3GK4X 2KAXA 1CMGA 1NSHA 1BODA 3CR4X 1ZFSA 1MXLC 3PATA 1QWVA 3PN7C 1S5GY 1GGZA 1RECA 3BUWB 5HLOA
chains in the Genus database with same CATH topology
3D0YA 2R2IA 2JTTA 1W7IB 2BE6A 2MLFC 2ZKMX 2K8MB 1K95A 2E30A 1CM1A 1J55A 2KBMA 2LMUA 2PRUA 5HYDA 2PVBA 2I2RE 1B8LA 5AERA 2P6BB 1GGWA 5ER5A 4YBHB 1FI6A 2F8PA 1L2OB 1PRWA 1QS7A 3BUMB 4M2PA 1JUOA 1DGVA 1QJTA 2BKHB 4N1GA 1QATA 3CGAA 2Q91A 5PALA 4MZLA 3NXAA 1TNPA 3BUXB 4MRXA 3M0WA 1J7OA 1HQVA 1ZUZA 2F2OA 1SPYA 2JC2A 2JXLA 2KGBC 2L98A 1TIZA 3AKBA 2HPSA 2M97A 1GQMA 2LV7A 1L7ZA 4PE1A 4MZKA 5HKZA 5GQQC 3O4YA 3DVMA 4PHMA 1NX2A 1IJ6A 1YR5A 3WHTB 1S6CA 1PVBA 1FI5A 2CBLA 1QX5B 5AXIA 1EXRA 1RK9A 1UHKA 2BBNA 3BUNB 3SG2A 1NCYA 1EG4A 2M7NA 2ZRSA 1XFXO 3FWCA 1S26D 2WORA 3SG4A 2FOTA 1CDNA 1AHRA 3OHMB 2H61C 5G08A 4NDCA 4ICBA 1J1EA 1LA0A 1RWYA 1M45A 2SASA 3JVTC 1MR8A 3OP0A 4PE4A 2F2PA 2L4IA 1N0YA 2FJUB 2KYCA 4MBEA 1JC2A 4DIRA 1SCVA 1BG1A 1SL8A 3I5HB 1F71A 2CT9A 2L51A 2JULA 2LCPA 5HKYA 3AAKA 4QJ3B 5I2LA 1EG3A 3OX6A 3WXAA 5K89A 3CR5X 1SRAA 2KFFA 1NP8A 2CXJA 2HQWA 4DS7A 4N1FA 5J3XA 3A4UB 3ICBA 3JTDC 1C07A 1K96A 4U8DA 4AQJA 2OTGC 4OVNF 1CDPA 4CLNA 1F4QA 2BECA 2ZFDA 1J7RA 3I5FB 4WQ3A 5DKQA 1QTXA 1TTXA 2HF5A 5I2OA 1UP5A 3CTNA 4QJ5B 2L4HA 1UUSA 1A03A 1SR6B 1QVIZ 3SIBA 1K9UA 1OOJA 2OS8C 2LLUA 5DKNA 1QIWA 1SL7A 3TS5B 3ZNIA 4IL1A 1FBVA 5IBWA 3LLEA 2LAPA 2O5GA 4BY5A 1NCXA 1S1EA 2CNPA 1PK0D 3D10A 2F3YA 2COLB 1QVIY 3PFVA 1SCMC 3DF0B 3CS1A 3PN7B 2MBXA 5I2QA 1DF0A 2KQYA 2KNEA 2K61A 3PSRA 1DJXA 1KSOA 1NX3A 2NCOA 1TOPA 1K9KA 1BR1B 2AAOA 2JT8A 2MLEC 5B8IB 1F54A 2CCMA 2QACA 3DD4A 2M1KB 1QV0A 1ALWA 2JNXA 2KI4B 2ISDA 1PALA 4AQIA 1K2HA 1XFVO 1LINA 1IGVA 2LMTA 1BF5A 1BOCA 3SJSA 4DCKA 5CSNA 1VRKA 4YGAA 2ZN9A 3DVKA 4MRYA 4C0JA 1S6IA 2KAYA 1IWQA 2MA2A 1QLSA 1Y0VH 2BE4A 1B1GA 1KWOC 2K7BA 1WRLA 2JU0A 3GK2A 1N2DA 1OMDA 1UHNA 3H4SE 4PHJA 1SYMA 1N65A 4GGFC 2OPOA 3TDUA 4JPZB 3BOWB 1TRFA 3LCPC 3SG6A 1Y1AA 1BT6A 1TN4A 1EH2A 1GJYA 2BCXA 3K21A 5F6TA 2PMYA 1CTRA 1J1DA 2GGMA 1YUTA 3KF9A 4ORBB 1KQMC 1KFXS 4P5OE 1NCZA 1FPWA 1OQPA 1OMVA 1Y6WA 2AUCA 2NLNA 3VGOA 1FW4A 2JQ6A 3VRNA 2GGZA 2JRFA 1NIWA 3TUYB 5KSZA 1V1GA 4TNCA 5HLVA 4MSPA 1ZMZA 2KYFA 4CFQA 1DJGA 3EK4A 1YURA 4YGDB 5KU1A 4M2OA 1KFXL 3LK0A 2JTZA 1ZACA 1KK8C 1DMOA 1B47A 2K7OA 3E3RA 1QV1A 5D7FA 3BYAA 2LUXA 4PHKA 4PHNA 2LHIA 4GAOA 3KEVA 2EC6C 1CMFA 3CR2A 4OCIA 3KHEA 1KCYA 2JXCA 3BXKA 1XFZO 4CPVA 2BKIB 2MRDA 1DT7B 1CFDA 1DJWA 4PCWA 1JFJA 1JWDA 4OKHA 4A4BA 3I5GB 2M49B 2M3WA 4FTGA 4YGCB 2OTGB 1CLBA 2BCAA 2I18A 4PE0A 1WDCC 2FCDA 2JT0A 2KBIA 3HCMA 1YUSA 2PALA 4M2QA 5D69A 1G8IA 2NXQA 1A4PA 4JWQA 3TDZA 2KQ6A 1DJIA 2ZNEA 1QASA 3PM8A 3CWGA 4USLA 1EL4A 1KQVA 1HT9A 1AP4A 1S6JA 1M31A 3EKHA 1XFYO 2KDHA 1QX2A 1SCMB 1U5IB 1JBAA 1YX7A 1G33A 3RLZA 1X02A 1DJZA 2LMVA 2Y1NA 3EK7A 2WCFA 1BU3A 1H4BA 2CTNA 2BCBA 5CSIA 3A8RA 4PDZA 3AAJA 1K8UA 2BL0B 1MHOA 4ETOA 4C0LA 1YTZC 1XK4A 1WY9A 2KI6C 1B8RA 2KSPA 3IQOA 1IQ3A 3DF0A 2V53A 2PSRA 3EVRA 4R1EA 1MF8B 1B7TZ 1SNLA 1YRTB 2BBMA 5JJGA 1D1OA 1QX7A 3FS7A 5I8NA 2H2KA 1CFPA 4DUQA 4I5KA 1B7TY 4WRIA 2GV5A 3BQ3A 3EVUA 4ORCB 1UURA 1YRUB 1H8BA 4OV2A 1KWOB 2I94A 4ZCUA 2G9BA 3O6BA 2K7DA 1OSAA 3IF7A 1K94A 1WRKA 2KGRA 2LVKA 4CFRA 3WNXB 3OB1B 2NZ0A 2KOTA 1CFFA 1AK8A 1CDMA 3CLNA 4GBAA 4BY4A 1E8AA 2RGIA 1AUIB 3FIAA 1UWOA 3TDIA 1NUBA 2ZRTA 1F8HA 3VROA 2MHHA 1AVSA 2QPTA 4MVFA 3QRXA 3ZWHA 1YVHA 1Q80A 2K7CA 3AKAA 2EGDA 3O2PA 1XVJA 2WOSA 1LVCD 1CKKA 2M9GA 3BUOB 1R6PA 5AEQA 1M39A 2Y1MA 3BOWA 3I5HC 1UHJA 3DVEA 4F0ZB 1A29A 2DOQA 3C1VA 5DKRA 3I5IC 1TNXA 4I5LB 1JFKA 1YVLA 4GPLB 2LNKA 3LL8B 3VRQA 2KHNA 3OB2B 1KK8B 2JWWA 3NSIA 4A4CA 1QIVA 1EJ3A 2LC5A 1CNPA 1SY9A 2K2AA 2I7AA 1AJ5A 2M29A 3GOFA 1CLMA 1SR6C 5CPVA 1IG5A 2SCPA 1TNQA 1M46A 3WHUB 1IJ5A 2LVVA 3TS5C 1A2XA 3PALA 2M0RA 2A4JA 2K0JA 3SIAA 1F70A 3KPXA 3VRRA 1TNWA 1A75B 5CSJA 2JZIA 1XK4C 1M63B 1SBJA 1CLLA 3CZTX 5AANA 4GGNA 1WDCB 1XA5A 3IQQA 2ZN8A 1UHIA 1F4OA 2LANA 2LHLA 3SG3A 1BR4B 1OMRA 4YI8A 2M7LA 2L0PA 4NDBA 1SL9A 1WRZA 1OE9B 1SMGA 1NYAA 3JVTB 3FWBA 2LLTA 1KFUS 3NSOA 1CFCA 5TNCA 1XFUO 4XJKB 4UPGA 2KI4C 4HREE 3VRPA 5BPJA 2G2BA 4P2YB 1ODBA 1QLKA 4DRWA 2LP3A 3RM1A 3EVVA 4MEWA 1YX8A 1DJHA 1SW8A 3DVJA 1B8CA 5ER4X 3D0YB 1KFUL 3LK1A 4GFTA 4GNKB 3JTDB 4MLWA 5KTYA 1DJYA 1U5IA 3O78A 1QXPA 3MSEB 1NWDA 1W7JB 1PULA 2KAVA 4I5JA 1TCFA 5CSFA 4CIDA 1K93D 1UHHA 5FYXA 1WLMA 1IRJA 2L5XB 4AOMA 1RJVA 1V1FA 1J7PA 4HRHA 2OS8B 1CM4A 4YGBB 2M1UA 1WLZA 4HRGA 2LM5A 1RTP1 4HSZA 1L2OC 2TN4A 1CDLA 2MAZA 1JSAA 1LXFC 3OX5A 5JOLA 1NX0A 3EK8A 1XFWO 1B9AA 1J7QA 4YGEB 4NDDA 3SG7A 1OZSA 3TUYC 4D1EA 4WQ2A 4YI9A 1RFJA 2JNFA 4I5NB 1XYDA 2JT3A 2B1UA 1B4CA 3NSLA 2JPTA 2MJWB 2F33A 2VRGA 1TCOB 2HETA 4GGFA 3HX4A 1MXEA 1BMOA 2LP2A 1FF1A 1OZOA 1R2UA 2LUCA 1YUUA 3I5IB 4MZJA 1KSMA 4YRUA 3NSKA 1MWNA 1DVIA 2KI6D 2HQ8A 3I5GC 1BLQA 4XYNA 1K90D 1SKTA 1JF2A 3EKJA 4MN0A 1LKJA 1MQ1A 1CB1A 1AJ4A 2ZNDA 1IQ5A 3TZ1A 1C7WA 5AFPA 1BJFA 1DTLA 2M8UA 1PSBA 4C0KA 1IH0A 4L9MA 1S3PA 2WC8A 4PE7A 2L2EA 1K9PA 2E6WA 2EHBA 2LLSA 4Q04A 1MUXA 1KQMB 2Y4QA 1XO5A 4NQGA 1PSRA 1SK6D 4PALA 5HKWA 4JQ0D 1NX1A 2F3ZA 4OR9B 1Y1XA 4N5XA 3KO0A 2WCBA 1G4YR 1Y1UA 2O60A 2WCEA 1DGUA 1S36A 2BL0C 2LVIA 1A75A 2PASA 4QJ4B 2K2FA 2FCEA 2LE9B 2D8NA 2L50A 2NCPA 1ALVA 1KK7Z 3I5FC 4ZCVA 2EC6B 3PLFB 2Q4UA 4ORAB 1ZOTB 1PVAA 1NPQA 2Y5IA 3F45A 1RROA 2H61A 2JOJA 2KFGA 1DF0B 3SG5A 2IS9A 4E68A 2WNDA 1IKUA 1JF0A 2AMIA 1KK7Y 4FQOA 4GUKA 1F55A 1S5GZ 2KFHA 2LVJA 1LA3A 1C7VA 3GK1A 4XJKA 3GK4X 2KAXA 1CMGA 1NSHA 1BODA 3CR4X 1ZFSA 1MXLC 3PATA 3PN7C 1S5GY 1GGZA 1RECA 3BUWB 5HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Y A;  2R2I A;  2JTT A;  1W7I B;  2BE6 A;  2MLF C;  2ZKM X;  2K8M B;  1K95 A;  2E30 A;  1CM1 A;  1J55 A;  2KBM A;  2LMU A;  2PRU A;  5HYD A;  2PVB A;  2I2R E;  1B8L A;  5AER A;  2P6B B;  1GGW A;  5ER5 A;  4YBH B;  1FI6 A;  2F8P A;  1L2O B;  1PRW A;  1QS7 A;  3BUM B;  4M2P A;  1JUO A;  1DGV A;  1QJT A;  2BKH B;  4N1G A;  1QAT A;  3CGA A;  2Q91 A;  5PAL A;  4MZL A;  3NXA A;  1TNP A;  3BUX B;  4MRX A;  3M0W A;  1J7O A;  1HQV A;  1ZUZ A;  2F2O A;  1SPY A;  2JC2 A;  2JXL A;  2KGB C;  2L98 A;  1TIZ A;  3AKB A;  2HPS A;  2M97 A;  1GQM A;  2LV7 A;  1L7Z A;  4PE1 A;  4MZK A;  5HKZ A;  5GQQ C;  3O4Y A;  3DVM A;  4PHM A;  1NX2 A;  1IJ6 A;  1YR5 A;  3WHT B;  1S6C A;  1PVB A;  1FI5 A;  2CBL A;  1QX5 B;  5AXI A;  1EXR A;  1RK9 A;  1UHK A;  2BBN A;  3BUN B;  3SG2 A;  1NCY A;  1EG4 A;  2M7N A;  2ZRS A;  1XFX O;  3FWC A;  1S26 D;  2WOR A;  3SG4 A;  2FOT A;  1CDN A;  1AHR A;  3OHM B;  2H61 C;  5G08 A;  4NDC A;  4ICB A;  1J1E A;  1LA0 A;  1RWY A;  1M45 A;  2SAS A;  3JVT C;  1MR8 A;  3OP0 A;  4PE4 A;  2F2P A;  2L4I A;  1N0Y A;  2FJU B;  2KYC A;  4MBE A;  1JC2 A;  4DIR A;  1SCV A;  1BG1 A;  1SL8 A;  3I5H B;  1F71 A;  2CT9 A;  2L51 A;  2JUL A;  2LCP A;  5HKY A;  3AAK A;  4QJ3 B;  5I2L A;  1EG3 A;  3OX6 A;  3WXA A;  5K89 A;  3CR5 X;  1SRA A;  2KFF A;  1NP8 A;  2CXJ A;  2HQW A;  4DS7 A;  4N1F A;  5J3X A;  3A4U B;  3ICB A;  3JTD C;  1C07 A;  1K96 A;  4U8D A;  4AQJ A;  2OTG C;  4OVN F;  1CDP A;  4CLN A;  1F4Q A;  2BEC A;  2ZFD A;  1J7R A;  3I5F B;  4WQ3 A;  5DKQ A;  1QTX A;  1TTX A;  2HF5 A;  5I2O A;  1UP5 A;  3CTN A;  4QJ5 B;  2L4H A;  1UUS A;  1A03 A;  1SR6 B;  1QVI Z;  3SIB A;  1K9U A;  1OOJ A;  2OS8 C;  2LLU A;  5DKN A;  1QIW A;  1SL7 A;  3TS5 B;  3ZNI A;  4IL1 A;  1FBV A;  5IBW A;  3LLE A;  2LAP A;  2O5G A;  4BY5 A;  1NCX A;  1S1E A;  2CNP A;  1PK0 D;  3D10 A;  2F3Y A;  2COL B;  1QVI Y;  3PFV A;  1SCM C;  3DF0 B;  3CS1 A;  3PN7 B;  2MBX A;  5I2Q A;  1DF0 A;  2KQY A;  2KNE A;  2K61 A;  3PSR A;  1DJX A;  1KSO A;  1NX3 A;  2NCO A;  1TOP A;  1K9K A;  1BR1 B;  2AAO A;  2JT8 A;  2MLE C;  5B8I B;  1F54 A;  2CCM A;  2QAC A;  3DD4 A;  2M1K B;  1QV0 A;  1ALW A;  2JNX A;  2KI4 B;  2ISD A;  1PAL A;  4AQI A;  1K2H A;  1XFV O;  1LIN A;  1IGV A;  2LMT A;  1BF5 A;  1BOC A;  3SJS A;  4DCK A;  5CSN A;  1VRK A;  4YGA A;  2ZN9 A;  3DVK A;  4MRY A;  4C0J A;  1S6I A;  2KAY A;  1IWQ A;  2MA2 A;  1QLS A;  1Y0V H;  2BE4 A;  1B1G A;  1KWO C;  2K7B A;  1WRL A;  2JU0 A;  3GK2 A;  1N2D A;  1OMD A;  1UHN A;  3H4S E;  4PHJ A;  1SYM A;  1N65 A;  4GGF C;  2OPO A;  3TDU A;  4JPZ B;  3BOW B;  1TRF A;  3LCP C;  3SG6 A;  1Y1A A;  1BT6 A;  1TN4 A;  1EH2 A;  1GJY A;  2BCX A;  3K21 A;  5F6T A;  2PMY A;  1CTR A;  1J1D A;  2GGM A;  1YUT A;  3KF9 A;  4ORB B;  1KQM C;  1KFX S;  4P5O E;  1NCZ A;  1FPW A;  1OQP A;  1OMV A;  1Y6W A;  2AUC A;  2NLN A;  3VGO A;  1FW4 A;  2JQ6 A;  3VRN A;  2GGZ A;  2JRF A;  1NIW A;  3TUY B;  5KSZ A;  1V1G A;  4TNC A;  5HLV A;  4MSP A;  1ZMZ A;  2KYF A;  4CFQ A;  1DJG A;  3EK4 A;  1YUR A;  4YGD B;  5KU1 A;  4M2O A;  1KFX L;  3LK0 A;  2JTZ A;  1ZAC A;  1KK8 C;  1DMO A;  1B47 A;  2K7O A;  3E3R A;  1QV1 A;  5D7F A;  3BYA A;  2LUX A;  4PHK A;  4PHN A;  2LHI A;  4GAO A;  3KEV A;  2EC6 C;  1CMF A;  3CR2 A;  4OCI A;  3KHE A;  1KCY A;  2JXC A;  3BXK A;  1XFZ O;  4CPV A;  2BKI B;  2MRD A;  1DT7 B;  1CFD A;  1DJW A;  4PCW A;  1JFJ A;  1JWD A;  4OKH A;  4A4B A;  3I5G B;  2M49 B;  2M3W A;  4FTG A;  4YGC B;  2OTG B;  1CLB A;  2BCA A;  2I18 A;  4PE0 A;  1WDC C;  2FCD A;  2JT0 A;  2KBI A;  3HCM A;  1YUS A;  2PAL A;  4M2Q A;  5D69 A;  1G8I A;  2NXQ A;  1A4P A;  4JWQ A;  3TDZ A;  2KQ6 A;  1DJI A;  2ZNE A;  1QAS A;  3PM8 A;  3CWG A;  4USL A;  1EL4 A;  1KQV A;  1HT9 A;  1AP4 A;  1S6J A;  1M31 A;  3EKH A;  1XFY O;  2KDH A;  1QX2 A;  1SCM B;  1U5I B;  1JBA A;  1YX7 A;  1G33 A;  3RLZ A;  1X02 A;  1DJZ A;  2LMV A;  2Y1N A;  3EK7 A;  2WCF A;  1BU3 A;  1H4B A;  2CTN A;  2BCB A;  5CSI A;  3A8R A;  4PDZ A;  3AAJ A;  1K8U A;  2BL0 B;  1MHO A;  4ETO A;  4C0L A;  1YTZ C;  1XK4 A;  1WY9 A;  2KI6 C;  1B8R A;  2KSP A;  3IQO A;  1IQ3 A;  3DF0 A;  2V53 A;  2PSR A;  3EVR A;  4R1E A;  1MF8 B;  1B7T Z;  1SNL A;  1YRT B;  2BBM A;  5JJG A;  1D1O A;  1QX7 A;  3FS7 A;  5I8N A;  2H2K A;  1CFP A;  4DUQ A;  4I5K A;  1B7T Y;  4WRI A;  2GV5 A;  3BQ3 A;  3EVU A;  4ORC B;  1UUR A;  1YRU B;  1H8B A;  4OV2 A;  1KWO B;  2I94 A;  4ZCU A;  2G9B A;  3O6B A;  2K7D A;  1OSA A;  3IF7 A;  1K94 A;  1WRK A;  2KGR A;  2LVK A;  4CFR A;  3WNX B;  3OB1 B;  2NZ0 A;  2KOT A;  1CFF A;  1AK8 A;  1CDM A;  3CLN A;  4GBA A;  4BY4 A;  1E8A A;  2RGI A;  1AUI B;  3FIA A;  1UWO A;  3TDI A;  1NUB A;  2ZRT A;  1F8H A;  3VRO A;  2MHH A;  1AVS A;  2QPT A;  4MVF A;  3QRX A;  3ZWH A;  1YVH A;  1Q80 A;  2K7C A;  3AKA A;  2EGD A;  3O2P A;  1XVJ A;  2WOS A;  1LVC D;  1CKK A;  2M9G A;  3BUO B;  1R6P A;  5AEQ A;  1M39 A;  2Y1M A;  3BOW A;  3I5H C;  1UHJ A;  3DVE A;  4F0Z B;  1A29 A;  2DOQ A;  3C1V A;  5DKR A;  3I5I C;  1TNX A;  4I5L B;  1JFK A;  1YVL A;  4GPL B;  2LNK A;  3LL8 B;  3VRQ A;  2KHN A;  3OB2 B;  1KK8 B;  2JWW A;  3NSI A;  4A4C A;  1QIV A;  1EJ3 A;  2LC5 A;  1CNP A;  1SY9 A;  2K2A A;  2I7A A;  1AJ5 A;  2M29 A;  3GOF A;  1CLM A;  1SR6 C;  5CPV A;  1IG5 A;  2SCP A;  1TNQ A;  1M46 A;  3WHU B;  1IJ5 A;  2LVV A;  3TS5 C;  1A2X A;  3PAL A;  2M0R A;  2A4J A;  2K0J A;  3SIA A;  1F70 A;  3KPX A;  3VRR A;  1TNW A;  1A75 B;  5CSJ A;  2JZI A;  1XK4 C;  1M63 B;  1SBJ A;  1CLL A;  3CZT X;  5AAN A;  4GGN A;  1WDC B;  1XA5 A;  3IQQ A;  2ZN8 A;  1UHI A;  1F4O A;  2LAN A;  2LHL A;  3SG3 A;  1BR4 B;  1OMR A;  4YI8 A;  2M7L A;  2L0P A;  4NDB A;  1SL9 A;  1WRZ A;  1OE9 B;  1SMG A;  1NYA A;  3JVT B;  3FWB A;  2LLT A;  1KFU S;  3NSO A;  1CFC A;  5TNC A;  1XFU O;  4XJK B;  4UPG A;  2KI4 C;  4HRE E;  3VRP A;  5BPJ A;  2G2B A;  4P2Y B;  1ODB A;  1QLK A;  4DRW A;  2LP3 A;  3RM1 A;  3EVV A;  4MEW A;  1YX8 A;  1DJH A;  1SW8 A;  3DVJ A;  1B8C A;  5ER4 X;  3D0Y B;  1KFU L;  3LK1 A;  4GFT A;  4GNK B;  3JTD B;  4MLW A;  5KTY A;  1DJY A;  1U5I A;  3O78 A;  1QXP A;  3MSE B;  1NWD A;  1W7J B;  1PUL A;  2KAV A;  4I5J A;  1TCF A;  5CSF A;  4CID A;  1K93 D;  1UHH A;  5FYX A;  1WLM A;  1IRJ A;  2L5X B;  4AOM A;  1RJV A;  1V1F A;  1J7P A;  4HRH A;  2OS8 B;  1CM4 A;  4YGB B;  2M1U A;  1WLZ A;  4HRG A;  2LM5 A;  1RTP 1;  4HSZ A;  1L2O C;  2TN4 A;  1CDL A;  2MAZ A;  1JSA A;  1LXF C;  3OX5 A;  5JOL A;  1NX0 A;  3EK8 A;  1XFW O;  1B9A A;  1J7Q A;  4YGE B;  4NDD A;  3SG7 A;  1OZS A;  3TUY C;  4D1E A;  4WQ2 A;  4YI9 A;  1RFJ A;  2JNF A;  4I5N B;  1XYD A;  2JT3 A;  2B1U A;  1B4C A;  3NSL A;  2JPT A;  2MJW B;  2F33 A;  2VRG A;  1TCO B;  2HET A;  4GGF A;  3HX4 A;  1MXE A;  1BMO A;  2LP2 A;  1FF1 A;  1OZO A;  1R2U A;  2LUC A;  1YUU A;  3I5I B;  4MZJ A;  1KSM A;  4YRU A;  3NSK A;  1MWN A;  1DVI A;  2KI6 D;  2HQ8 A;  3I5G C;  1BLQ A;  4XYN A;  1K90 D;  1SKT A;  1JF2 A;  3EKJ A;  4MN0 A;  1LKJ A;  1MQ1 A;  1CB1 A;  1AJ4 A;  2ZND A;  1IQ5 A;  3TZ1 A;  1C7W A;  5AFP A;  1BJF A;  1DTL A;  2M8U A;  1PSB A;  4C0K A;  1IH0 A;  4L9M A;  1S3P A;  2WC8 A;  4PE7 A;  2L2E A;  1K9P A;  2E6W A;  2EHB A;  2LLS A;  4Q04 A;  1MUX A;  1KQM B;  2Y4Q A;  1XO5 A;  4NQG A;  1PSR A;  1SK6 D;  4PAL A;  5HKW A;  4JQ0 D;  1NX1 A;  2F3Z A;  4OR9 B;  1Y1X A;  4N5X A;  3KO0 A;  2WCB A;  1G4Y R;  1Y1U A;  2O60 A;  2WCE A;  1DGU A;  1S36 A;  2BL0 C;  2LVI A;  1A75 A;  2PAS A;  4QJ4 B;  2K2F A;  2FCE A;  2LE9 B;  2D8N A;  2L50 A;  2NCP A;  1ALV A;  1KK7 Z;  3I5F C;  4ZCV A;  2EC6 B;  3PLF B;  2Q4U A;  4ORA B;  1ZOT B;  1PVA A;  1NPQ A;  2Y5I A;  3F45 A;  1RRO A;  2H61 A;  2JOJ A;  2KFG A;  1DF0 B;  3SG5 A;  2IS9 A;  4E68 A;  2WND A;  1IKU A;  1JF0 A;  2AMI A;  1KK7 Y;  4FQO A;  4GUK A;  1F55 A;  1S5G Z;  2KFH A;  2LVJ A;  1LA3 A;  1C7V A;  3GK1 A;  4XJK A;  3GK4 X;  2KAX A;  1CMG A;  1NSH A;  1BOD A;  3CR4 X;  1ZFS A;  1MXL C;  3PAT A;  3PN7 C;  1S5G Y;  1GGZ A;  1REC A;  3BUW B;  5HLO A; 
#chains in the Genus database with same CATH topology
 3D0Y A;  2R2I A;  2JTT A;  1W7I B;  2BE6 A;  2MLF C;  2ZKM X;  2K8M B;  1K95 A;  2E30 A;  1CM1 A;  1J55 A;  2KBM A;  2LMU A;  2PRU A;  5HYD A;  2PVB A;  2I2R E;  1B8L A;  5AER A;  2P6B B;  1GGW A;  5ER5 A;  4YBH B;  1FI6 A;  4IJ7 A;  2F8P A;  1L2O B;  1PRW A;  1QS7 A;  3BUM B;  3EG5 B;  4M2P A;  1JUO A;  1DGV A;  1QJT A;  2BKH B;  4N1G A;  1QAT A;  3DYE A;  5FI7 A;  3CGA A;  2Q91 A;  5PAL A;  4MZL A;  3NXA A;  1TNP A;  3BUX B;  4MRX A;  3M0W A;  3DXL A;  1J7O A;  1C3Z A;  1HQV A;  3D78 A;  1ZUZ A;  2F2O A;  1SPY A;  2JC2 A;  2JXL A;  2KGB C;  2L98 A;  1TIZ A;  3B86 A;  3AKB A;  3L4L A;  2HPS A;  2M97 A;  1GQM A;  2LV7 A;  1L7Z A;  4PE1 A;  4MZK A;  5HKZ A;  5GQQ C;  3O4Y A;  3DVM A;  4PHM A;  1NX2 A;  1IJ6 A;  1YR5 A;  3WHT B;  1S6C A;  1PVB A;  3L4A A;  1FI5 A;  2CBL A;  1QX5 B;  5AXI A;  1EXR A;  1RK9 A;  1UHK A;  2BBN A;  3BUN B;  3SG2 A;  1NCY A;  1EG4 A;  2M7N A;  2ZRS A;  1XFX O;  3FWC A;  1S26 D;  3D74 A;  2WOR A;  3SG4 A;  2FOT A;  1CDN A;  1AHR A;  3OHM B;  1ORG A;  2H61 C;  5G08 A;  4NDC A;  4ICB A;  1J1E A;  1LA0 A;  1RWY A;  1M45 A;  3SS3 A;  2SAS A;  1Z2C B;  1MR8 A;  3JVT C;  3OP0 A;  4PE4 A;  2F2P A;  2L4I A;  1N0Y A;  2FJU B;  2KYC A;  4MBE A;  1JC2 A;  2BNX A;  4DIR A;  1SCV A;  1BG1 A;  1SL8 A;  3I5H B;  1F71 A;  2CT9 A;  2L51 A;  2JUL A;  2LCP A;  2YGU A;  5HKY A;  3S0E A;  3AAK A;  2P70 A;  4QJ3 B;  5I2L A;  1EG3 A;  3OX6 A;  3WXA A;  1P28 A;  5K89 A;  3CR5 X;  1SRA A;  2KFF A;  1NP8 A;  2CXJ A;  2KLD A;  2HQW A;  3NHT A;  4DS7 A;  2K60 A;  4N1F A;  5J3X A;  3A4U B;  3ICB A;  3JTD C;  2H8V A;  1C07 A;  1K96 A;  4U8D A;  4AQJ A;  2OTG C;  4OVN F;  1CDP A;  4CLN A;  1F4Q A;  2BEC A;  2ZFD A;  1J7R A;  3I5F B;  3R1V A;  4WQ3 A;  1OOG A;  5DKQ A;  1QTX A;  1TTX A;  2HF5 A;  5I2O A;  1UP5 A;  3CTN A;  4QJ5 B;  2L4H A;  1UUS A;  1A03 A;  1SR6 B;  1QVI Z;  3SIB A;  1K9U A;  1OOJ A;  2OS8 C;  1OOF A;  2LLU A;  1QIW A;  1SL7 A;  5DKN A;  3TS5 B;  3ZNI A;  4IL1 A;  1FBV A;  5IBW A;  3LLE A;  2LAP A;  2O5G A;  3CZ0 A;  4BY5 A;  1NCX A;  1S1E A;  2CNP A;  1PK0 D;  3D10 A;  3CAB A;  2F3Y A;  2COL B;  1QVI Y;  3PFV A;  1SCM C;  3DF0 B;  3CS1 A;  3PN7 B;  2GTE A;  2MBX A;  5I2Q A;  1DF0 A;  2KQY A;  3N7H A;  2KNE A;  2K61 A;  3PSR A;  3S0F A;  1DJX A;  1KSO A;  1NX3 A;  2NCO A;  1TOP A;  1K9K A;  1BR1 B;  2AAO A;  2JT8 A;  2MLE C;  5B8I B;  1F54 A;  2CCM A;  2QAC A;  3DD4 A;  2M1K B;  4JKT A;  1QV0 A;  1ALW A;  2JNX A;  2KI4 B;  5EL2 A;  1PAL A;  3D75 A;  2ISD A;  1XFV O;  4AQI A;  1K2H A;  1SSE B;  1LIN A;  1IGV A;  2LMT A;  1BF5 A;  1BOC A;  3SJS A;  4DCK A;  5CSN A;  1DEK A;  1VRK A;  4YGA A;  2ZN9 A;  3DVK A;  2QEB A;  3S0G A;  1Z4H A;  4MRY A;  4C0J A;  1S6I A;  2KAY A;  1IWQ A;  2MA2 A;  1QLS A;  1Y0V H;  2ERB A;  1OOH A;  2BE4 A;  1B1G A;  1KWO C;  2K7B A;  1WRL A;  2JU0 A;  2WCH A;  3GK2 A;  1N2D A;  1OMD A;  1UHN A;  2WC5 A;  3H4S E;  3PM2 A;  4PHJ A;  1SYM A;  1N65 A;  4GGF C;  2OPO A;  3BFA A;  3TDU A;  4JPZ B;  3BOW B;  1TRF A;  3LCP C;  3SG6 A;  1Y1A A;  4KYN A;  1BT6 A;  1TN4 A;  1EH2 A;  1GJY A;  2BCX A;  3K21 A;  5F6T A;  2PMY A;  1CTR A;  3R1P A;  1J1D A;  2GGM A;  1YUT A;  3KF9 A;  4ORB B;  1KQM C;  1KFX S;  4P5O E;  1GM0 A;  1NCZ A;  1FPW A;  1OQP A;  1OMV A;  1Y6W A;  4OZD A;  2AUC A;  2NLN A;  3VGO A;  1FW4 A;  2JQ6 A;  3VRN A;  2GGZ A;  2JRF A;  1NIW A;  3D73 A;  3TUY B;  5HL1 A;  1V1G A;  5KSZ A;  4TNC A;  5HLV A;  4MSP A;  1ZMZ A;  2KYF A;  3DZT A;  4CFQ A;  2WCJ A;  1DJG A;  3EK4 A;  1YUR A;  4YGD B;  3B7A A;  5KU1 A;  4M2O A;  1KFX L;  5DIC A;  3LK0 A;  2JTZ A;  1ZAC A;  1KK8 C;  1DMO A;  1B47 A;  3B88 A;  2K7O A;  3E3R A;  1QV1 A;  5D7F A;  3BYA A;  2LUX A;  4PHK A;  4PHN A;  2LHI A;  4GAO A;  3KEV A;  2EC6 C;  1CMF A;  3CR2 A;  4OCI A;  3KHE A;  3K1E A;  1KCY A;  2JXC A;  3BXK A;  1XFZ O;  4CPV A;  2BKI B;  2MRD A;  1DT7 B;  1CFD A;  1DJW A;  4PCW A;  3D76 A;  1JFJ A;  1JWD A;  3B87 A;  4OKH A;  4A4B A;  3I5G B;  2M49 B;  2M3W A;  4FTG A;  3BFH A;  4YGC B;  2OTG B;  1CLB A;  2BCA A;  2I18 A;  4PE0 A;  3BFB A;  1WDC C;  2FCD A;  2JT0 A;  2KBI A;  3HCM A;  4INX A;  1YUS A;  2PAL A;  4M2Q A;  2KLE A;  5D69 A;  1G8I A;  3OBV A;  2NXQ A;  1A4P A;  2BAP A;  4JWQ A;  3TDZ A;  2KQ6 A;  1DJI A;  2ZNE A;  1QAS A;  3PM8 A;  3CWG A;  4USL A;  1EL4 A;  1KQV A;  1HT9 A;  1AP4 A;  3CZ2 A;  3Q8I A;  1S6J A;  1M31 A;  3EKH A;  1XFY O;  2KDH A;  1QX2 A;  1SCM B;  1U5I B;  1JBA A;  1YX7 A;  2WCL A;  3S0B A;  1G33 A;  3RLZ A;  1X02 A;  1DJZ A;  1XFR A;  2KPH A;  2LMV A;  2WCF A;  1BU3 A;  2Y1N A;  3EK7 A;  2CTN A;  1H4B A;  1OW4 A;  2BCB A;  5CSI A;  3A8R A;  4PDZ A;  3AAJ A;  2WCM A;  1K8U A;  2BL0 B;  1MHO A;  4ETO A;  4C0L A;  1YTZ C;  1XK4 A;  1WY9 A;  2KI6 C;  1B8R A;  2KSP A;  3IQO A;  1IQ3 A;  3DF0 A;  2V53 A;  2PSR A;  3EVR A;  4R1E A;  1MF8 B;  1B7T Z;  1SNL A;  1YRT B;  3R1O A;  2BBM A;  5JJG A;  1D1O A;  1QX7 A;  3FS7 A;  5I8N A;  2H2K A;  1CFP A;  2L2C A;  3QME A;  4DUQ A;  4I5K A;  1B7T Y;  4WRI A;  1TWO A;  2GV5 A;  3BQ3 A;  2PYQ A;  3DY9 A;  3EVU A;  3RZS A;  4ORC B;  1UUR A;  1YRU B;  1H8B A;  4OV2 A;  1KWO B;  2I94 A;  4ZCU A;  2G9B A;  3O6B A;  2K7D A;  1OSA A;  1TUZ A;  3IF7 A;  1K94 A;  1WRK A;  2KGR A;  2LVK A;  4CFR A;  3WNX B;  3OB1 B;  2NZ0 A;  2KOT A;  1CFF A;  1AK8 A;  1CDM A;  3CLN A;  4GBA A;  4BY4 A;  1E8A A;  2RGI A;  1AUI B;  3FIA A;  1UWO A;  3SS4 A;  3TDI A;  1NUB A;  3NHI A;  2ZRT A;  1F8H A;  2JPO A;  3UO9 A;  2MHH A;  1AVS A;  2QPT A;  4MVF A;  3QRX A;  3VRO A;  3ZWH A;  1YVH A;  1Q80 A;  2K7C A;  3AKA A;  2EGD A;  3O2P A;  1XVJ A;  2WOS A;  1LVC D;  1CKK A;  2M9G A;  3BUO B;  1R6P A;  3BJH A;  1M39 A;  2Y1M A;  1T14 A;  3BOW A;  3I5H C;  5AEQ A;  3L47 A;  1UHJ A;  3SS5 A;  3DVE A;  4F0Z B;  1A29 A;  2DOQ A;  3C1V A;  4FQT A;  5DKR A;  3I5I C;  5FI6 A;  1TNX A;  4I5L B;  5I94 A;  1JFK A;  1YVL A;  3FE8 A;  4GPL B;  2LNK A;  2QEH A;  3LL8 B;  3VRQ A;  2KHN A;  2QEV A;  1KK8 B;  3OB2 B;  2QEO A;  2JWW A;  3NSI A;  4A4C A;  1QIV A;  1EJ3 A;  2LC5 A;  3B6X A;  1W9Z A;  1SY9 A;  1CNP A;  2K2A A;  2I7A A;  1AJ5 A;  2M29 A;  3GOF A;  1CLM A;  1SR6 C;  5CPV A;  1IG5 A;  2SCP A;  1TNQ A;  1M46 A;  1DC1 A;  3WHU B;  1IJ5 A;  2LVV A;  3TS5 C;  1A2X A;  3PAL A;  2M0R A;  2A4J A;  2K0J A;  3SIA A;  1F70 A;  3KPX A;  3VRR A;  1TNW A;  1A75 B;  5CSJ A;  2JZI A;  1XK4 C;  1M63 B;  1SBJ A;  1CLL A;  3CZT X;  3OGN A;  5AAN A;  4GGN A;  1WDC B;  1XA5 A;  3IQQ A;  1IIO A;  2ZN8 A;  1UHI A;  1F4O A;  2LAN A;  2LHL A;  3SG3 A;  1BR4 B;  1OMR A;  4YI8 A;  2M7L A;  2L0P A;  4NDB A;  1SL9 A;  1WRZ A;  4INW A;  1OE9 B;  1SMG A;  1NYA A;  3JVT B;  1LS8 A;  3FWB A;  2LLT A;  1KFU S;  3NSO A;  5FI2 A;  1CFC A;  4PT1 A;  5TNC A;  1XFU O;  4XJK B;  4UPG A;  2KI4 C;  4HRE E;  3VRP A;  5BPJ A;  2G2B A;  4P2Y B;  1ODB A;  1QLK A;  4DRW A;  2LP3 A;  3RM1 A;  3EVV A;  3NGV A;  4MEW A;  1YX8 A;  1DJH A;  1SW8 A;  3DVJ A;  1B8C A;  5ER4 X;  3PJI A;  3D0Y B;  1KFU L;  1DEL A;  3LK1 A;  4GFT A;  4GNK B;  3JTD B;  4MLW A;  5KTY A;  1DJY A;  1U5I A;  3O78 A;  1TUJ A;  1QXP A;  3MSE B;  3V2L A;  1NWD A;  1W7J B;  1PUL A;  2WC6 A;  3FE6 A;  2KAV A;  3O4X A;  4I5J A;  1TCF A;  5CSF A;  4CID A;  1K93 D;  1UHH A;  5FYX A;  1WLM A;  1IRJ A;  2L5X B;  4AOM A;  1RJV A;  1V1F A;  1J7P A;  4HRH A;  2OS8 B;  1CM4 A;  4YGB B;  2M1U A;  1WLZ A;  4HRG A;  2LM5 A;  1RTP 1;  3CDN A;  4HSZ A;  1DQE A;  1L2O C;  2TN4 A;  3VB1 A;  1CDL A;  2MAZ A;  1JSA A;  1LXF C;  3OX5 A;  5D3O A;  5JOL A;  1NX0 A;  3EK8 A;  1XFW O;  2QDI A;  3S0A A;  1B9A A;  1J7Q A;  4YGE B;  4JD9 A;  4NDD A;  3SG7 A;  1OZS A;  3TUY C;  3S0D A;  4D1E A;  4WQ2 A;  4YI9 A;  1RFJ A;  2JNF A;  4I5N B;  1XYD A;  2JT3 A;  2B1U A;  1B4C A;  3NSL A;  2JPT A;  2MJW B;  2F33 A;  2VRG A;  1TCO B;  2HET A;  4GGF A;  2PQL A;  3HX4 A;  1MXE A;  1BMO A;  2LP2 A;  3D77 A;  1FF1 A;  1OZO A;  1R2U A;  2FJY A;  2LUC A;  1YUU A;  3I5I B;  4MZJ A;  1KSM A;  4YRU A;  3NSK A;  1MWN A;  1DVI A;  2KI6 D;  2WCK A;  2HQ8 A;  3I5G C;  4F7F A;  4XYN A;  1K90 D;  1BLQ A;  1SKT A;  1JF2 A;  3EKJ A;  3CZ1 A;  4MN0 A;  1LKJ A;  1MQ1 A;  1CB1 A;  1AJ4 A;  2ZND A;  1IQ5 A;  3TZ1 A;  1C7W A;  5AFP A;  1BJF A;  1DTL A;  2M8U A;  1PSB A;  4C0K A;  1IH0 A;  4L9M A;  1S3P A;  2WC8 A;  4PE7 A;  3FE9 A;  2L2E A;  1K9P A;  2E6W A;  2EHB A;  2LLS A;  3CYZ A;  4Q04 A;  1C3Y A;  1MUX A;  1KQM B;  2Y4Q A;  1XO5 A;  4NQG A;  1PSR A;  1SK6 D;  4PAL A;  5HKW A;  4JQ0 D;  1NX1 A;  2F3Z A;  4OR9 B;  1Y1X A;  4N5X A;  3R72 A;  3KO0 A;  2WCB A;  1G4Y R;  1Y1U A;  2O60 A;  2WCE A;  1DGU A;  3UNW A;  1S36 A;  2BL0 C;  2LVI A;  1A75 A;  2PAS A;  4QJ4 B;  2K2F A;  2FCE A;  2LE9 B;  2D8N A;  3IVT A;  1OOI X;  2L50 A;  2NCP A;  1ALV A;  1KK7 Z;  3I5F C;  4ZCV A;  2P71 A;  2EC6 B;  3PLF B;  2Q4U A;  4ORA B;  1ZOT B;  1PVA A;  1NPQ A;  2Y5I A;  3F45 A;  1RRO A;  2H61 A;  2JOJ A;  2KFG A;  1DF0 B;  3SG5 A;  2IS9 A;  4E68 A;  2WND A;  1IKU A;  1JF0 A;  2AMI A;  1KK7 Y;  2L5Y A;  4FQO A;  4GUK A;  1F55 A;  1S5G Z;  2KFH A;  2LVJ A;  1LA3 A;  1C7V A;  3GK1 A;  4XJK A;  3GK4 X;  2KAX A;  1CMG A;  1NSH A;  1BOD A;  3CR4 X;  1ZFS A;  1MXL C;  3PAT A;  1QWV A;  3PN7 C;  1S5G Y;  1GGZ A;  1REC A;  3BUW B;  5HLO A; 
#chains in the Genus database with same CATH homology
 3D0Y A;  2R2I A;  2JTT A;  1W7I B;  2BE6 A;  2MLF C;  2ZKM X;  2K8M B;  1K95 A;  2E30 A;  1CM1 A;  1J55 A;  2KBM A;  2LMU A;  2PRU A;  5HYD A;  2PVB A;  2I2R E;  1B8L A;  5AER A;  2P6B B;  1GGW A;  5ER5 A;  4YBH B;  1FI6 A;  2F8P A;  1L2O B;  1PRW A;  1QS7 A;  3BUM B;  4M2P A;  1JUO A;  1DGV A;  1QJT A;  2BKH B;  4N1G A;  1QAT A;  3CGA A;  2Q91 A;  5PAL A;  4MZL A;  3NXA A;  1TNP A;  3BUX B;  4MRX A;  3M0W A;  1J7O A;  1HQV A;  1ZUZ A;  2F2O A;  1SPY A;  2JC2 A;  2JXL A;  2KGB C;  2L98 A;  1TIZ A;  3AKB A;  2HPS A;  2M97 A;  1GQM A;  2LV7 A;  1L7Z A;  4PE1 A;  4MZK A;  5HKZ A;  5GQQ C;  3O4Y A;  3DVM A;  4PHM A;  1NX2 A;  1IJ6 A;  1YR5 A;  3WHT B;  1S6C A;  1PVB A;  1FI5 A;  2CBL A;  1QX5 B;  5AXI A;  1EXR A;  1RK9 A;  1UHK A;  2BBN A;  3BUN B;  3SG2 A;  1NCY A;  1EG4 A;  2M7N A;  2ZRS A;  1XFX O;  3FWC A;  1S26 D;  2WOR A;  3SG4 A;  2FOT A;  1CDN A;  1AHR A;  3OHM B;  2H61 C;  5G08 A;  4NDC A;  4ICB A;  1J1E A;  1LA0 A;  1RWY A;  1M45 A;  2SAS A;  3JVT C;  1MR8 A;  3OP0 A;  4PE4 A;  2F2P A;  2L4I A;  1N0Y A;  2FJU B;  2KYC A;  4MBE A;  1JC2 A;  4DIR A;  1SCV A;  1BG1 A;  1SL8 A;  3I5H B;  1F71 A;  2CT9 A;  2L51 A;  2JUL A;  2LCP A;  5HKY A;  3AAK A;  4QJ3 B;  5I2L A;  1EG3 A;  3OX6 A;  3WXA A;  5K89 A;  3CR5 X;  1SRA A;  2KFF A;  1NP8 A;  2CXJ A;  2HQW A;  4DS7 A;  4N1F A;  5J3X A;  3A4U B;  3ICB A;  3JTD C;  1C07 A;  1K96 A;  4U8D A;  4AQJ A;  2OTG C;  4OVN F;  1CDP A;  4CLN A;  1F4Q A;  2BEC A;  2ZFD A;  1J7R A;  3I5F B;  4WQ3 A;  5DKQ A;  1QTX A;  1TTX A;  2HF5 A;  5I2O A;  1UP5 A;  3CTN A;  4QJ5 B;  2L4H A;  1UUS A;  1A03 A;  1SR6 B;  1QVI Z;  3SIB A;  1K9U A;  1OOJ A;  2OS8 C;  2LLU A;  5DKN A;  1QIW A;  1SL7 A;  3TS5 B;  3ZNI A;  4IL1 A;  1FBV A;  5IBW A;  3LLE A;  2LAP A;  2O5G A;  4BY5 A;  1NCX A;  1S1E A;  2CNP A;  1PK0 D;  3D10 A;  2F3Y A;  2COL B;  1QVI Y;  3PFV A;  1SCM C;  3DF0 B;  3CS1 A;  3PN7 B;  2MBX A;  5I2Q A;  1DF0 A;  2KQY A;  2KNE A;  2K61 A;  3PSR A;  1DJX A;  1KSO A;  1NX3 A;  2NCO A;  1TOP A;  1K9K A;  1BR1 B;  2AAO A;  2JT8 A;  2MLE C;  5B8I B;  1F54 A;  2CCM A;  2QAC A;  3DD4 A;  2M1K B;  1QV0 A;  1ALW A;  2JNX A;  2KI4 B;  2ISD A;  1PAL A;  4AQI A;  1K2H A;  1XFV O;  1LIN A;  1IGV A;  2LMT A;  1BF5 A;  1BOC A;  3SJS A;  4DCK A;  5CSN A;  1VRK A;  4YGA A;  2ZN9 A;  3DVK A;  4MRY A;  4C0J A;  1S6I A;  2KAY A;  1IWQ A;  2MA2 A;  1QLS A;  1Y0V H;  2BE4 A;  1B1G A;  1KWO C;  2K7B A;  1WRL A;  2JU0 A;  3GK2 A;  1N2D A;  1OMD A;  1UHN A;  3H4S E;  4PHJ A;  1SYM A;  1N65 A;  4GGF C;  2OPO A;  3TDU A;  4JPZ B;  3BOW B;  1TRF A;  3LCP C;  3SG6 A;  1Y1A A;  1BT6 A;  1TN4 A;  1EH2 A;  1GJY A;  2BCX A;  3K21 A;  5F6T A;  2PMY A;  1CTR A;  1J1D A;  2GGM A;  1YUT A;  3KF9 A;  4ORB B;  1KQM C;  1KFX S;  4P5O E;  1NCZ A;  1FPW A;  1OQP A;  1OMV A;  1Y6W A;  2AUC A;  2NLN A;  3VGO A;  1FW4 A;  2JQ6 A;  3VRN A;  2GGZ A;  2JRF A;  1NIW A;  3TUY B;  5KSZ A;  1V1G A;  4TNC A;  5HLV A;  4MSP A;  1ZMZ A;  2KYF A;  4CFQ A;  1DJG A;  3EK4 A;  1YUR A;  4YGD B;  5KU1 A;  4M2O A;  1KFX L;  3LK0 A;  2JTZ A;  1ZAC A;  1KK8 C;  1DMO A;  1B47 A;  2K7O A;  3E3R A;  1QV1 A;  5D7F A;  3BYA A;  2LUX A;  4PHK A;  4PHN A;  2LHI A;  4GAO A;  3KEV A;  2EC6 C;  1CMF A;  3CR2 A;  4OCI A;  3KHE A;  1KCY A;  2JXC A;  3BXK A;  1XFZ O;  4CPV A;  2BKI B;  2MRD A;  1DT7 B;  1CFD A;  1DJW A;  4PCW A;  1JFJ A;  1JWD A;  4OKH A;  4A4B A;  3I5G B;  2M49 B;  2M3W A;  4FTG A;  4YGC B;  2OTG B;  1CLB A;  2BCA A;  2I18 A;  4PE0 A;  1WDC C;  2FCD A;  2JT0 A;  2KBI A;  3HCM A;  1YUS A;  2PAL A;  4M2Q A;  5D69 A;  1G8I A;  2NXQ A;  1A4P A;  4JWQ A;  3TDZ A;  2KQ6 A;  1DJI A;  2ZNE A;  1QAS A;  3PM8 A;  3CWG A;  4USL A;  1EL4 A;  1KQV A;  1HT9 A;  1AP4 A;  1S6J A;  1M31 A;  3EKH A;  1XFY O;  2KDH A;  1QX2 A;  1SCM B;  1U5I B;  1JBA A;  1YX7 A;  1G33 A;  3RLZ A;  1X02 A;  1DJZ A;  2LMV A;  2Y1N A;  3EK7 A;  2WCF A;  1BU3 A;  1H4B A;  2CTN A;  2BCB A;  5CSI A;  3A8R A;  4PDZ A;  3AAJ A;  1K8U A;  2BL0 B;  1MHO A;  4ETO A;  4C0L A;  1YTZ C;  1XK4 A;  1WY9 A;  2KI6 C;  1B8R A;  2KSP A;  3IQO A;  1IQ3 A;  3DF0 A;  2V53 A;  2PSR A;  3EVR A;  4R1E A;  1MF8 B;  1B7T Z;  1SNL A;  1YRT B;  2BBM A;  5JJG A;  1D1O A;  1QX7 A;  3FS7 A;  5I8N A;  2H2K A;  1CFP A;  4DUQ A;  4I5K A;  1B7T Y;  4WRI A;  2GV5 A;  3BQ3 A;  3EVU A;  4ORC B;  1UUR A;  1YRU B;  1H8B A;  4OV2 A;  1KWO B;  2I94 A;  4ZCU A;  2G9B A;  3O6B A;  2K7D A;  1OSA A;  3IF7 A;  1K94 A;  1WRK A;  2KGR A;  2LVK A;  4CFR A;  3WNX B;  3OB1 B;  2NZ0 A;  2KOT A;  1CFF A;  1AK8 A;  1CDM A;  3CLN A;  4GBA A;  4BY4 A;  1E8A A;  2RGI A;  1AUI B;  3FIA A;  1UWO A;  3TDI A;  1NUB A;  2ZRT A;  1F8H A;  3VRO A;  2MHH A;  1AVS A;  2QPT A;  4MVF A;  3QRX A;  3ZWH A;  1YVH A;  1Q80 A;  2K7C A;  3AKA A;  2EGD A;  3O2P A;  1XVJ A;  2WOS A;  1LVC D;  1CKK A;  2M9G A;  3BUO B;  1R6P A;  5AEQ A;  1M39 A;  2Y1M A;  3BOW A;  3I5H C;  1UHJ A;  3DVE A;  4F0Z B;  1A29 A;  2DOQ A;  3C1V A;  5DKR A;  3I5I C;  1TNX A;  4I5L B;  1JFK A;  1YVL A;  4GPL B;  2LNK A;  3LL8 B;  3VRQ A;  2KHN A;  3OB2 B;  1KK8 B;  2JWW A;  3NSI A;  4A4C A;  1QIV A;  1EJ3 A;  2LC5 A;  1CNP A;  1SY9 A;  2K2A A;  2I7A A;  1AJ5 A;  2M29 A;  3GOF A;  1CLM A;  1SR6 C;  5CPV A;  1IG5 A;  2SCP A;  1TNQ A;  1M46 A;  3WHU B;  1IJ5 A;  2LVV A;  3TS5 C;  1A2X A;  3PAL A;  2M0R A;  2A4J A;  2K0J A;  3SIA A;  1F70 A;  3KPX A;  3VRR A;  1TNW A;  1A75 B;  5CSJ A;  2JZI A;  1XK4 C;  1M63 B;  1SBJ A;  1CLL A;  3CZT X;  5AAN A;  4GGN A;  1WDC B;  1XA5 A;  3IQQ A;  2ZN8 A;  1UHI A;  1F4O A;  2LAN A;  2LHL A;  3SG3 A;  1BR4 B;  1OMR A;  4YI8 A;  2M7L A;  2L0P A;  4NDB A;  1SL9 A;  1WRZ A;  1OE9 B;  1SMG A;  1NYA A;  3JVT B;  3FWB A;  2LLT A;  1KFU S;  3NSO A;  1CFC A;  5TNC A;  1XFU O;  4XJK B;  4UPG A;  2KI4 C;  4HRE E;  3VRP A;  5BPJ A;  2G2B A;  4P2Y B;  1ODB A;  1QLK A;  4DRW A;  2LP3 A;  3RM1 A;  3EVV A;  4MEW A;  1YX8 A;  1DJH A;  1SW8 A;  3DVJ A;  1B8C A;  5ER4 X;  3D0Y B;  1KFU L;  3LK1 A;  4GFT A;  4GNK B;  3JTD B;  4MLW A;  5KTY A;  1DJY A;  1U5I A;  3O78 A;  1QXP A;  3MSE B;  1NWD A;  1W7J B;  1PUL A;  2KAV A;  4I5J A;  1TCF A;  5CSF A;  4CID A;  1K93 D;  1UHH A;  5FYX A;  1WLM A;  1IRJ A;  2L5X B;  4AOM A;  1RJV A;  1V1F A;  1J7P A;  4HRH A;  2OS8 B;  1CM4 A;  4YGB B;  2M1U A;  1WLZ A;  4HRG A;  2LM5 A;  1RTP 1;  4HSZ A;  1L2O C;  2TN4 A;  1CDL A;  2MAZ A;  1JSA A;  1LXF C;  3OX5 A;  5JOL A;  1NX0 A;  3EK8 A;  1XFW O;  1B9A A;  1J7Q A;  4YGE B;  4NDD A;  3SG7 A;  1OZS A;  3TUY C;  4D1E A;  4WQ2 A;  4YI9 A;  1RFJ A;  2JNF A;  4I5N B;  1XYD A;  2JT3 A;  2B1U A;  1B4C A;  3NSL A;  2JPT A;  2MJW B;  2F33 A;  2VRG A;  1TCO B;  2HET A;  4GGF A;  3HX4 A;  1MXE A;  1BMO A;  2LP2 A;  1FF1 A;  1OZO A;  1R2U A;  2LUC A;  1YUU A;  3I5I B;  4MZJ A;  1KSM A;  4YRU A;  3NSK A;  1MWN A;  1DVI A;  2KI6 D;  2HQ8 A;  3I5G C;  1BLQ A;  4XYN A;  1K90 D;  1SKT A;  1JF2 A;  3EKJ A;  4MN0 A;  1LKJ A;  1MQ1 A;  1CB1 A;  1AJ4 A;  2ZND A;  1IQ5 A;  3TZ1 A;  1C7W A;  5AFP A;  1BJF A;  1DTL A;  2M8U A;  1PSB A;  4C0K A;  1IH0 A;  4L9M A;  1S3P A;  2WC8 A;  4PE7 A;  2L2E A;  1K9P A;  2E6W A;  2EHB A;  2LLS A;  4Q04 A;  1MUX A;  1KQM B;  2Y4Q A;  1XO5 A;  4NQG A;  1PSR A;  1SK6 D;  4PAL A;  5HKW A;  4JQ0 D;  1NX1 A;  2F3Z A;  4OR9 B;  1Y1X A;  4N5X A;  3KO0 A;  2WCB A;  1G4Y R;  1Y1U A;  2O60 A;  2WCE A;  1DGU A;  1S36 A;  2BL0 C;  2LVI A;  1A75 A;  2PAS A;  4QJ4 B;  2K2F A;  2FCE A;  2LE9 B;  2D8N A;  2L50 A;  2NCP A;  1ALV A;  1KK7 Z;  3I5F C;  4ZCV A;  2EC6 B;  3PLF B;  2Q4U A;  4ORA B;  1ZOT B;  1PVA A;  1NPQ A;  2Y5I A;  3F45 A;  1RRO A;  2H61 A;  2JOJ A;  2KFG A;  1DF0 B;  3SG5 A;  2IS9 A;  4E68 A;  2WND A;  1IKU A;  1JF0 A;  2AMI A;  1KK7 Y;  4FQO A;  4GUK A;  1F55 A;  1S5G Z;  2KFH A;  2LVJ A;  1LA3 A;  1C7V A;  3GK1 A;  4XJK A;  3GK4 X;  2KAX A;  1CMG A;  1NSH A;  1BOD A;  3CR4 X;  1ZFS A;  1MXL C;  3PAT A;  3PN7 C;  1S5G Y;  1GGZ A;  1REC A;  3BUW B;  5HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...