1HQVA

Structure of apoptosis-linked protein alg-2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
178
Chain Sequence
PGPGGGPGPAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords PROGRAMMED CELL DEATH PROTEIN 6
publication title Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 178
sequence length 181
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1hqvA00
2KGBC 4GAOA 2KHNA 1F54A 3VRQA 2K7DA 2GV5A 1ZFSA 2FOTA 1C7VA 3TDUA 1MR8A 4I5LB 1CLMA 3TDIA 2LP2A 2VRGA 5CPVA 2MBXA 1NIWA 4MN0A 5J3XA 2E30A 3ZNIA 4CFRA 2KNEA 2P6BB 3OX6A 1RFJA 1XVJA 2L4HA 3FWCA 4HREE 1EXRA 3EK8A 2PVBA 3WNXB 5I8NA 4XJKA 1LVCD 3CR5X 2HQWA 2LP3A 1FI6A 2JULA 2ZN9A 2NCOA 5HLOA 2KQ6A 1NCYA 1QVIZ 2R2IA 5CSIA 4DCKA 4QJ4B 3JVTC 2JXLA 1BG1A 3PM8A 1NX1A 2CBLA 3QRXA 4YGAA 3BOWB 3DVEA 1YR5A 2IS9A 2M29A 2LVKA 1QTXA 1Y0VH 3BQ3A 3BXKA 2BL0C 3I5FB 3KHEA 3D0YA 3JTDB 3CS1A 3LK0A 1S6JA 1K8UA 3NSOA 1CFFA 3EK4A 4HRGA 1IKUA 1YRTB 4C0KA 1J7QA 5IBWA 2D8NA 4YBHB 3O78A 4E68A 5I2LA 1M39A 2EGDA 1A29A 2TN4A 2KSPA 1NYAA 2NZ0A 1KSOA 1S3PA 1S1EA 4C0JA 4PE0A 3NXAA 1QIVA 3I5HC 4YGCB 2MLFC 3I5GB 4DS7A 1M31A 3EVRA 1CLBA 2OTGC 1UP5A 4GGFC 1BJFA 2M3WA 4I5JA 2COLB 3TUYB 1YUTA 1DJXA 1JF0A 2JTTA 1SCMB 2MLEC 3SJSA 2I18A 4YGBB 3NSLA 3IQQA 3I5FC 2LVIA 1DTLA 1DMOA 3I5IC 3JTDC 1BU3A 1KFXS 2PASA 3IQOA 3KO0A 2JWWA 4F0ZB 2BE6A 4FQOA 1UHNA 1S5GY 1SK6D 2FCEA 1J7RA 1SL7A 1SYMA 1QLSA 1IH0A 1OQPA 4OV2A 2K2FA 3D0YB 1OZSA 1W7JB 4YGEB 2BE4A 1NPQA 3TS5B 4C0LA 5KU1A 2FCDA 4PHNA 3VRRA 1A2XA 1ZMZA 1XFXO 1B1GA 1YX7A 1HQVA 4MVFA 1ALWA 4GBAA 4YGDB 4A4BA 1WY9A 2LUXA 3VRPA 5I2OA 1OMVA 1JFKA 3BYAA 1KK8B 1AHRA 1XA5A 1AVSA 4ORAB 2BKHB 1TCOB 2QACA 3OP0A 3OB1B 4PE4A 4UPGA 4WQ3A 3TUYC 1S6CA 2LV7A 1J55A 2CNPA 5D7FA 1J7PA 1SCMC 1TNQA 2WCFA 2L50A 4JWQA 1SR6C 1Y6WA 1DJHA 3DVMA 1CM4A 1EJ3A 1E8AA 4GUKA 4MSPA 4USLA 2ZN8A 2CXJA 3KEVA 1SL8A 1M63B 5ER5A 1S26D 2Y1NA 2HQ8A 1IQ5A 1EH2A 1NP8A 1J7OA 4GFTA 3BOWA 1G4YR 3TS5C 4I5NB 2B1UA 4AOMA 4ETOA 1WRKA 5CSNA 2KBMA 2SASA 2F3ZA 1FW4A 2GGZA 2M49B 4N1FA 2JU0A 2M0RA 1KK8C 1QX7A 1BR1B 2JPTA 2M7NA 4WRIA 2EHBA 1NSHA 1BMOA 1BODA 3LCPC 4QJ5B 3OX5A 1SL9A 1C07A 4MZJA 2F3YA 2RGIA 1LINA 1XK4A 1QVIY 1LA3A 3FIAA 5HKWA 1NCZA 2LVVA 1CFDA 2ZRSA 3K21A 1OOJA 1XFUO 2M7LA 1IRJA 1DF0A 4U8DA 2F2OA 3NSKA 1J1EA 4N1GA 4OCIA 5DKQA 1G8IA 4GPLB 5AFPA 4IL1A 5G08A 1NUBA 2M1UA 5KTYA 1BLQA 1OMDA 1R6PA 3IF7A 2Y1MA 3MSEB 1DJWA 1KQVA 3KPXA 2JTZA 2L0PA 4AQJA 2BBNA 2NCPA 5HLVA 1SPYA 2MJWB 4MRYA 2A4JA 4DUQA 3PALA 2LAPA 1SNLA 4PHJA 1S36A 4NDBA 4PCWA 2F2PA 5KSZA 4OKHA 2QPTA 4FTGA 2AUCA 2CTNA 4ICBA 1H4BA 2K0JA 2LMVA 1C7WA 1OMRA 1BF5A 4AQIA 2EC6B 2KAXA 5PALA 1EG3A 1XFYO 1V1FA 3VROA 2PALA 5DKNA 2GGMA 2WCBA 5JOLA 1RJVA 3SIAA 2LANA 1OZOA 2OS8B 4YRUA 1TN4A 3DF0A 1WLMA 2Q91A 4CFQA 1OE9B 2LCPA 1CDPA 1IQ3A 1DF0B 1SRAA 3TZ1A 1KFUS 3CZTX 1PVAA 4MZKA 1CDMA 1LXFC 1JWDA 1K9UA 2JQ6A 2WC8A 1WRLA 1KCYA 2HPSA 4PDZA 2ZNEA 1PULA 2F8PA 1K93D 1M45A 1PSRA 1K94A 1NX3A 1L2OB 3GOFA 4DRWA 2O60A 4MZLA 2H61A 3KF9A 3M0WA 2EC6C 5JJGA 1AK8A 1K9KA 1WLZA 3DVJA 1B7TZ 2ZNDA 2ZFDA 1XK4C 1CKKA 2WORA 1GJYA 2F33A 1H8BA 3I5GC 4PE1A 1QV1A 1XYDA 2LMTA 2KBIA 4ORBB 1QATA 4YI9A 1JBAA 2MRDA 3OHMB 1JFJA 3LLEA 4A4CA 3PLFB 4DIRA 1A03A 4BY5A 1TCFA 1MQ1A 1TOPA 1AUIB 3GK4X 4PE7A 1CFPA 1GGWA 1FI5A 5CSFA 1XFZO 3DF0B 5I2QA 5AXIA 5B8IB 1RROA 1KK7Z 1FBVA 2PMYA 1LA0A 1MHOA 2BKIB 2L2EA 3LL8B 4PHKA 3O2PA 2KYFA 1NWDA 2LC5A 3RM1A 2M97A 1YUSA 4MRXA 1W7IB 1K2HA 4P2YB 1SBJA 2JXCA 4D1EA 3EVVA 3BUXB 4P5OE 2WNDA 2L98A 3FS7A 3SG7A 3CR4X 4ORCB 1JF2A 2NXQA 4Q04A 1CMGA 3E3RA 2LHLA 2KI4B 1TNXA 3WHUB 2NLNA 1MXEA 1SMGA 1F71A 1MF8B 1K9PA 5HKYA 2MA2A 1CLLA 1Y1XA 1TTXA 2I2RE 2K8MB 2MHHA 1Q80A 1JUOA 2LVJA 3AAKA 2KQYA 2OPOA 3CLNA 3DVKA 3EVUA 1IJ6A 2JRFA 1TNWA 1U5IB 4WQ2A 1WRZA 1B4CA 1ZUZA 1B8CA 2AAOA 1CNPA 2KFHA 2Y5IA 3JVTB 1RWYA 3HCMA 1TRFA 1ZACA 1CTRA 2O5GA 3A4UB 1QS7A 3O4YA 3TDZA 1X02A 2BL0B 3CWGA 1A75A 3SG4A 1Y1AA 1CMFA 4I5KA 1UHHA 1VRKA 1F4QA 5ER4X 5AANA 1CDLA 1YRUB 2K7BA 2KI6C 2PRUA 1QASA 4PHMA 1DT7B 1PSBA 2BBMA 2H61C 2K7CA 1QXPA 2KI6D 1DJIA 3DD4A 2K7OA 1UURA 1GQMA 2KI4C 1CDNA 1IG5A 3RLZA 1NCXA 1RTP1 2KAYA 1K96A 4M2QA 2JNXA 2KFGA 3SG5A 1MUXA 1DJYA 1OSAA 1N2DA 3I5HB 1YVLA 2G9BA 3O6BA 4HSZA 2KAVA 1CM1A 1PRWA 1EL4A 2OTGB 3GK1A 4CIDA 3BUWB 2BCXA 1YUUA 1D1OA 4MBEA 3VGOA 3NSIA 2KDHA 2JT3A 2AMIA 1ODBA 2LLUA 3AKBA 1BOCA 4CLNA 2JOJA 1AJ4A 1NX2A 1KQMB 2JT0A 2G2BA 1AP4A 2L51A 1BR4B 3I5IB 1V1GA 3GK2A 2JNFA 2DOQA 1L7ZA 3A8RA 1XFWO 2HF5A 1YX8A 2JT8A 1N65A 5HYDA 2MAZA 1UHKA 5FYXA 4NQGA 1ALVA 1PK0D 4OR9B 1B7TY 2SCPA 2M8UA 1DGVA 1A75B 2HETA 3PFVA 4NDDA 4QJ3B 3CGAA 2LM5A 5AEQA 4N5XA 3LK1A 3SG2A 4ZCVA 1A4PA 1RK9A 3PSRA 2KFFA 1IJ5A 1LKJA 1KSMA 3H4SE 2WOSA 2K2AA 2FJUB 3WXAA 2L4IA 2LE9B 3SG3A 2I94A 2JZIA 3FWBA 3SIBA 1MXLC 1SKTA 1F4OA 1SY9A 1KWOB 1YVHA 1B47A 1SR6B 1KK7Y 1R2UA 3C1VA 1KQMC 3OB2B 3CTNA 4XJKB 2LLSA 3HX4A 1N0YA 1K95A 1SW8A 4NDCA 2OS8C 5HKZA 1DVIA 2ZRTA 5DKRA 5AERA 1XFVO 4GNKB 5F6TA 1U5IA 1UUSA 1UHJA 1S6IA 1SCVA 4BY4A 3BUNB 1PALA 1J1DA 1NX0A 1MWNA 2H2KA 1EG4A 2CCMA 5BPJA 1G33A 1RECA 1WDCB 1YTZC 2M1KB 1QV0A 5D69A 4M2OA 1Y1UA 4CPVA 3PN7B 2Q4UA 4JQ0D 1QJTA 2KGRA 4L9MA 3CR2A 1AJ5A 1TIZA 1L2OC 5GQQC 2ISDA 2PSRA 1F8HA 1JSAA 4MEWA 1UHIA 2I7AA 1S5GZ 2LHIA 4JPZB 2LNKA 1DJGA 4PALA 4MLWA 1PVBA 1B8LA 4YI8A 3AAJA 1XO5A 3VRNA 1KWOC 1M46A 2BCBA 2LUCA 1F70A 4GGNA 1JC2A 1DGUA 1QLKA 1F55A 5CSJA 2V53A 1B8RA 2KYCA 1GGZA 1HT9A 4TNCA 1QX5B 1TNPA 2K61A 3ZWHA 1DJZA 3F45A 1FF1A 1CFCA 4GGFA 1QX2A 1FPWA 2CT9A 1ZOTB 2BCAA 4M2PA 2BECA 3BUOB 3WHTB 1WDCC 2M9GA 2LLTA 1QIWA 1YURA 2Y4QA 1KFUL 1UWOA 3ICBA 2WCEA 3PN7C 1IGVA 4R1EA 3D10A 4HRHA 4XYNA 1BT6A 1IWQA 1CB1A 1K90D 1KFXL 5K89A 3AKAA 2L5XB 5TNCA 3PATA 2E6WA 2ZKMX 4OVNF 2JC2A 2LMUA 3EK7A 3EKHA 3BUMB 2KOTA 1B9AA 4ZCUA 3SG6A 3EKJA
chains in the Genus database with same CATH superfamily
2KGBC 2QEBA 4GAOA 2KHNA 1F54A 3VRQA 4OZDA 2K7DA 1DC1A 2GV5A 1ZFSA 2FOTA 1C7VA 3TDUA 1MR8A 4I5LB 1CLMA 3TDIA 2LP2A 2VRGA 3CZ2A 3V2LA 5CPVA 2MBXA 1NIWA 4MN0A 5J3XA 2E30A 3ZNIA 3D73A 4CFRA 2KNEA 2P6BB 3OX6A 1RFJA 1XVJA 2L4HA 3FWCA 4HREE 1EXRA 3EK8A 2PVBA 3WNXB 5I8NA 4XJKA 1LVCD 3CR5X 2HQWA 2LP3A 3O4XA 2JULA 2ZN9A 1FI6A 2NCOA 5HLOA 2KQ6A 1NCYA 1QVIZ 2R2IA 4IJ7A 5FI6A 5CSIA 4DCKA 4QJ4B 3JVTC 2JXLA 1BG1A 2QEHA 1NX1A 2CBLA 3PM8A 3QRXA 4YGAA 3SS4A 3BOWB 3DVEA 3UNWA 3BFBA 1YR5A 2IS9A 2M29A 2LVKA 1QTXA 1Y0VH 3BQ3A 3BXKA 2BL0C 3I5FB 3KHEA 3D0YA 3JTDB 3CS1A 3K1EA 1S6JA 3LK0A 2YGUA 1K8UA 3NSOA 1CFFA 3EK4A 4HRGA 1IKUA 2WC6A 1YRTB 1LS8A 1GM0A 4C0KA 3PJIA 3QMEA 1J7QA 5IBWA 2D8NA 4YBHB 3O78A 4E68A 5I2LA 1M39A 2EGDA 1A29A 2TN4A 2KSPA 1NYAA 2NZ0A 1KSOA 1S3PA 1S1EA 4C0JA 4PE0A 3L4LA 3NXAA 1QIVA 3I5HC 4YGCB 2MLFC 3I5GB 4DS7A 1M31A 3EVRA 1CLBA 2OTGC 1UP5A 4GGFC 1BJFA 1TWOA 2M3WA 4I5JA 2COLB 3TUYB 1YUTA 1DJXA 1JF0A 2JTTA 1SCMB 2MLEC 3SJSA 2I18A 4YGBB 4FQTA 3NSLA 3IQQA 3I5FC 2LVIA 1DTLA 1DMOA 3I5IC 3JTDC 1BU3A 1KFXS 2PASA 3IQOA 3KO0A 2JWWA 4F0ZB 2BE6A 4FQOA 1UHNA 1S5GY 1SK6D 2FCEA 1J7RA 1SL7A 1SYMA 1QLSA 1IH0A 1OQPA 4OV2A 2K2FA 3D0YB 1OZSA 1W7JB 4YGEB 2BE4A 1NPQA 3FE6A 3TS5B 3PM2A 4C0LA 5KU1A 2FCDA 4PHNA 3VRRA 1A2XA 1ZMZA 1XFXO 1B1GA 1YX7A 1HQVA 4MVFA 1ALWA 4GBAA 4YGDB 4A4BA 3IVTA 3NHIA 1WY9A 2LUXA 1OOGA 3S0BA 3VRPA 5I2OA 1OMVA 1JFKA 3BYAA 1KK8B 1AHRA 1XA5A 1AVSA 4ORAB 2BKHB 1TCOB 2QACA 3OP0A 3OB1B 4PE4A 4UPGA 4WQ3A 3TUYC 1S6CA 2LV7A 1J55A 2CNPA 5D7FA 1J7PA 1SCMC 1TNQA 2WCFA 2L50A 4JWQA 1SR6C 1Y6WA 1DJHA 3DVMA 1CM4A 1EJ3A 1E8AA 2PQLA 3VB1A 4GUKA 4MSPA 4USLA 2ZN8A 2CXJA 3Q8IA 3KEVA 1SL8A 3S0AA 1M63B 5ER5A 1S26D 2Y1NA 2HQ8A 1IQ5A 1EH2A 1NP8A 3S0DA 1J7OA 4GFTA 3BOWA 1G4YR 3TS5C 4I5NB 2B1UA 5FI2A 4AOMA 3D74A 4ETOA 1WRKA 3CYZA 5CSNA 2KBMA 2SASA 1TUJA 2F3ZA 1FW4A 2GGZA 2M49B 4N1FA 4JD9A 2JU0A 2M0RA 1KK8C 1QX7A 1BR1B 2JPTA 2M7NA 4WRIA 2EHBA 1NSHA 1BMOA 1BODA 3LCPC 4QJ5B 1OOHA 3OX5A 1SL9A 1C07A 4MZJA 2F3YA 2RGIA 1LINA 1XK4A 1QVIY 1LA3A 3FIAA 3EG5B 3FE9A 5HKWA 1NCZA 2LVVA 1CFDA 2KPHA 2ZRSA 3K21A 1OOJA 1XFUO 2M7LA 1IRJA 1DF0A 4U8DA 2F2OA 3NSKA 1J1EA 4N1GA 4OCIA 5DKQA 1G8IA 4GPLB 5AFPA 4IL1A 5G08A 1NUBA 2M1UA 5KTYA 3NHTA 1BLQA 4INXA 1OMDA 2WCHA 1R6PA 3IF7A 2Y1MA 5HL1A 3MSEB 1TUZA 1DJWA 1KQVA 3KPXA 2JTZA 2L0PA 4AQJA 2BBNA 2NCPA 5HLVA 1SPYA 2MJWB 4MRYA 2A4JA 2WC5A 3PALA 4DUQA 2LAPA 1SNLA 4PHJA 4PT1A 1S36A 4NDBA 4PCWA 2F2PA 5KSZA 4OKHA 2QPTA 4FTGA 2AUCA 2CTNA 4ICBA 3D77A 1H4BA 2K0JA 2LMVA 1C7WA 1OMRA 1OOIX 1BF5A 2BNXA 4AQIA 2EC6B 2KAXA 5PALA 1EG3A 1XFYO 1V1FA 3VROA 2PALA 5DKNA 2GGMA 2WCBA 5JOLA 1RJVA 3SIAA 2LANA 1OZOA 2OS8B 3L4AA 4YRUA 1TN4A 3DF0A 1WLMA 2Q91A 4CFQA 1OE9B 2LCPA 1CDPA 3CZ0A 1IQ3A 1DF0B 1SRAA 2FJYA 3TZ1A 1KFUS 3CZTX 2L2CA 1PVAA 4MZKA 1CDMA 1LXFC 2WCLA 1K9UA 2JQ6A 2WC8A 1WRLA 1JWDA 1KCYA 2HPSA 4PDZA 2ZNEA 1PULA 2F8PA 1K93D 1M45A 1PSRA 1K94A 1NX3A 1IIOA 1L2OB 3GOFA 1OOFA 4DRWA 2O60A 4MZLA 2H61A 3KF9A 3M0WA 2P70A 2EC6C 5JJGA 1AK8A 1DQEA 2WCJA 1K9KA 1WLZA 3DVJA 1Z2CB 1B7TZ 2ZNDA 2ZFDA 1XK4C 1CKKA 2WORA 1W9ZA 1GJYA 2F33A 1H8BA 3I5GC 4PE1A 1QV1A 1XYDA 2LMTA 2KBIA 4ORBB 1QATA 4YI9A 1JBAA 2MRDA 3OHMB 1JFJA 3LLEA 4A4CA 3PLFB 3B87A 4DIRA 1Z4HA 1A03A 4BY5A 1TCFA 1MQ1A 1TOPA 1AUIB 3GK4X 4PE7A 1CFPA 1GGWA 1FI5A 5CSFA 3B86A 1XFZO 3OGNA 1T14A 3DF0B 5I2QA 2PYQA 3B7AA 5AXIA 5B8IB 1DEKA 1RROA 1KK7Z 1FBVA 2PMYA 1LA0A 1MHOA 2BKIB 2L2EA 3LL8B 2KLEA 3O2PA 2KYFA 4PHKA 1NWDA 2LC5A 3RM1A 2M97A 1YUSA 4MRXA 1W7IB 1K2HA 4P2YB 1SBJA 2JXCA 4D1EA 3EVVA 3BUXB 4P5OE 2QEOA 2H8VA 2WNDA 3DYEA 2L98A 3FS7A 3OBVA 3SG7A 3CR4X 2WCKA 2K60A 1JF2A 2NXQA 3B88A 4ORCB 4Q04A 1CMGA 3E3RA 1C3YA 2LHLA 2KI4B 5I94A 2JPOA 1TNXA 3WHUB 2NLNA 1P28A 1MXEA 1SMGA 1F71A 1MF8B 1K9PA 5HKYA 2MA2A 1CLLA 1Y1XA 1TTXA 2I2RE 2K8MB 2MHHA 1Q80A 1JUOA 2LVJA 3AAKA 2KQYA 2OPOA 3CLNA 3DVKA 3EVUA 1IJ6A 2JRFA 1TNWA 1U5IB 4WQ2A 1WRZA 1B4CA 1ZUZA 1B8CA 2AAOA 1CNPA 2KFHA 2Y5IA 3JVTB 1RWYA 3HCMA 1TRFA 1ZACA 1CTRA 2ERBA 2O5GA 1QS7A 3A4UB 3O4YA 3S0GA 3TDZA 1X02A 2BL0B 1C3ZA 3CWGA 1A75A 3SS5A 3SG4A 1Y1AA 1CMFA 4I5KA 1UHHA 1VRKA 1F4QA 5ER4X 5AANA 1CDLA 1YRUB 2K7BA 2KI6C 2PRUA 1QASA 4PHMA 1DT7B 1PSBA 2BBMA 2H61C 3DZTA 2K7CA 3D76A 1QXPA 2KI6D 1DJIA 3DD4A 2K7OA 1UURA 1GQMA 2KI4C 3R1OA 3BFHA 1CDNA 3CABA 1IG5A 3RLZA 1NCXA 1RTP1 2KAYA 1K96A 4M2QA 2JNXA 2L5YA 2KFGA 3SG5A 1MUXA 1DJYA 1OSAA 1N2DA 3I5HB 1YVLA 2G9BA 3O6BA 3RZSA 4HSZA 2KAVA 1CM1A 1PRWA 1EL4A 2OTGB 3GK1A 4CIDA 3BUWB 2BCXA 5DICA 1YUUA 1D1OA 4MBEA 5EL2A 3VGOA 3NSIA 2KDHA 2JT3A 5D3OA 2AMIA 1ODBA 2LLUA 3AKBA 1BOCA 4CLNA 2JOJA 1AJ4A 2BAPA 1NX2A 1KQMB 2JT0A 2G2BA 1AP4A 2L51A 1BR4B 3I5IB 1V1GA 3GK2A 3L47A 2JNFA 2DOQA 1L7ZA 3A8RA 1XFWO 2HF5A 1YX8A 2JT8A 1N65A 5HYDA 2MAZA 1SSEB 1UHKA 5FYXA 4NQGA 1ALVA 1PK0D 4OR9B 1B7TY 2SCPA 2M8UA 1DGVA 1A75B 2HETA 3PFVA 4NDDA 3R1VA 4QJ3B 3S0FA 3CGAA 2LM5A 3CDNA 3FE8A 5AEQA 4N5XA 3LK1A 3SG2A 4ZCVA 1A4PA 1RK9A 3PSRA 2KFFA 1IJ5A 1LKJA 1KSMA 3H4SE 2WOSA 2K2AA 3DXLA 2FJUB 3WXAA 1XFRA 1DELA 2L4IA 2LE9B 3DY9A 3SG3A 2GTEA 1ORGA 2I94A 2JZIA 3FWBA 3SIBA 1MXLC 1SKTA 1F4OA 1SY9A 1KWOB 1YVHA 1B47A 1SR6B 1KK7Y 1R2UA 3C1VA 1KQMC 3OB2B 3CTNA 4XJKB 2LLSA 3HX4A 1N0YA 1K95A 1SW8A 4NDCA 2OS8C 5HKZA 1DVIA 2ZRTA 5DKRA 5AERA 1XFVO 4GNKB 5F6TA 1U5IA 1UUSA 1UHJA 1S6IA 1SCVA 4BY4A 3BUNB 1PALA 1J1DA 3D75A 1NX0A 1MWNA 1OW4A 2H2KA 2QEVA 1EG4A 2CCMA 4F7FA 5BPJA 1G33A 1RECA 1WDCB 1YTZC 2M1KB 1QV0A 3S0EA 5D69A 4M2OA 1Y1UA 4CPVA 3PN7B 2Q4UA 4JQ0D 1QJTA 2KGRA 4L9MA 3CR2A 1AJ5A 1TIZA 1L2OC 5FI7A 5GQQC 2ISDA 2PSRA 1F8HA 1JSAA 4MEWA 1UHIA 4KYNA 2I7AA 2P71A 1S5GZ 2LHIA 4JPZB 3CZ1A 2LNKA 1DJGA 4PALA 4MLWA 3N7HA 1PVBA 1B8LA 4YI8A 3BFAA 3AAJA 1XO5A 3VRNA 1KWOC 3R72A 1M46A 2BCBA 2LUCA 2WCMA 1F70A 4GGNA 1JC2A 1DGUA 1QLKA 4INWA 1F55A 5CSJA 2V53A 1B8RA 2KYCA 1GGZA 1HT9A 4TNCA 3B6XA 1QX5B 1TNPA 2K61A 3ZWHA 1DJZA 3F45A 1FF1A 1CFCA 4GGFA 1QX2A 1FPWA 3BJHA 2CT9A 1ZOTB 2BCAA 2QDIA 2BECA 4M2PA 3BUOB 3WHTB 1WDCC 2M9GA 2LLTA 1QIWA 1YURA 2Y4QA 1KFUL 1UWOA 1QWVA 3ICBA 2WCEA 3SS3A 3PN7C 1IGVA 4R1EA 3D10A 4HRHA 3NGVA 4XYNA 1BT6A 1IWQA 1CB1A 1K90D 1KFXL 5K89A 3D78A 3AKAA 2L5XB 5TNCA 3R1PA 3PATA 2E6WA 2ZKMX 4OVNF 2JC2A 2LMUA 3EK7A 3EKHA 3BUMB 2KOTA 1B9AA 3UO9A 4ZCUA 2KLDA 4JKTA 3SG6A 3EKJA
chains in the Genus database with same CATH topology
2KGBC 4GAOA 2KHNA 1F54A 3VRQA 2K7DA 2GV5A 1ZFSA 2FOTA 1C7VA 3TDUA 1MR8A 4I5LB 1CLMA 3TDIA 2LP2A 2VRGA 5CPVA 2MBXA 1NIWA 4MN0A 5J3XA 2E30A 3ZNIA 4CFRA 2KNEA 2P6BB 3OX6A 1RFJA 1XVJA 2L4HA 3FWCA 4HREE 1EXRA 3EK8A 2PVBA 3WNXB 5I8NA 4XJKA 1LVCD 3CR5X 2HQWA 2LP3A 1FI6A 2JULA 2ZN9A 2NCOA 5HLOA 2KQ6A 1NCYA 1QVIZ 2R2IA 5CSIA 4DCKA 4QJ4B 3JVTC 2JXLA 1BG1A 3PM8A 1NX1A 2CBLA 3QRXA 4YGAA 3BOWB 3DVEA 1YR5A 2IS9A 2M29A 2LVKA 1QTXA 1Y0VH 3BQ3A 3BXKA 2BL0C 3I5FB 3KHEA 3D0YA 3JTDB 3CS1A 3LK0A 1S6JA 1K8UA 3NSOA 1CFFA 3EK4A 4HRGA 1IKUA 1YRTB 4C0KA 1J7QA 5IBWA 2D8NA 4YBHB 3O78A 4E68A 5I2LA 1M39A 2EGDA 1A29A 2TN4A 2KSPA 1NYAA 2NZ0A 1KSOA 1S3PA 1S1EA 4C0JA 4PE0A 3NXAA 1QIVA 3I5HC 4YGCB 2MLFC 3I5GB 4DS7A 1M31A 3EVRA 1CLBA 2OTGC 1UP5A 4GGFC 1BJFA 2M3WA 4I5JA 2COLB 3TUYB 1YUTA 1DJXA 1JF0A 2JTTA 1SCMB 2MLEC 3SJSA 2I18A 4YGBB 3NSLA 3IQQA 3I5FC 2LVIA 1DTLA 1DMOA 3I5IC 3JTDC 1BU3A 1KFXS 2PASA 3IQOA 3KO0A 2JWWA 4F0ZB 2BE6A 4FQOA 1UHNA 1S5GY 1SK6D 2FCEA 1J7RA 1SL7A 1SYMA 1QLSA 1IH0A 1OQPA 4OV2A 2K2FA 3D0YB 1OZSA 1W7JB 4YGEB 2BE4A 1NPQA 3TS5B 4C0LA 5KU1A 2FCDA 4PHNA 3VRRA 1A2XA 1ZMZA 1XFXO 1B1GA 1YX7A 1HQVA 4MVFA 1ALWA 4GBAA 4YGDB 4A4BA 1WY9A 2LUXA 3VRPA 5I2OA 1OMVA 1JFKA 3BYAA 1KK8B 1AHRA 1XA5A 1AVSA 4ORAB 2BKHB 1TCOB 2QACA 3OP0A 3OB1B 4PE4A 4UPGA 4WQ3A 3TUYC 1S6CA 2LV7A 1J55A 2CNPA 5D7FA 1J7PA 1SCMC 1TNQA 2WCFA 2L50A 4JWQA 1SR6C 1Y6WA 1DJHA 3DVMA 1CM4A 1EJ3A 1E8AA 4GUKA 4MSPA 4USLA 2ZN8A 2CXJA 3KEVA 1SL8A 1M63B 5ER5A 1S26D 2Y1NA 2HQ8A 1IQ5A 1EH2A 1NP8A 1J7OA 4GFTA 3BOWA 1G4YR 3TS5C 4I5NB 2B1UA 4AOMA 4ETOA 1WRKA 5CSNA 2KBMA 2SASA 2F3ZA 1FW4A 2GGZA 2M49B 4N1FA 2JU0A 2M0RA 1KK8C 1QX7A 1BR1B 2JPTA 2M7NA 4WRIA 2EHBA 1NSHA 1BMOA 1BODA 3LCPC 4QJ5B 3OX5A 1SL9A 1C07A 4MZJA 2F3YA 2RGIA 1LINA 1XK4A 1QVIY 1LA3A 3FIAA 5HKWA 1NCZA 2LVVA 1CFDA 2ZRSA 3K21A 1OOJA 1XFUO 2M7LA 1IRJA 1DF0A 4U8DA 2F2OA 3NSKA 1J1EA 4N1GA 4OCIA 5DKQA 1G8IA 4GPLB 5AFPA 4IL1A 5G08A 1NUBA 2M1UA 5KTYA 1BLQA 1OMDA 1R6PA 3IF7A 2Y1MA 3MSEB 1DJWA 1KQVA 3KPXA 2JTZA 2L0PA 4AQJA 2BBNA 2NCPA 5HLVA 1SPYA 2MJWB 4MRYA 2A4JA 4DUQA 3PALA 2LAPA 1SNLA 4PHJA 1S36A 4NDBA 4PCWA 2F2PA 5KSZA 4OKHA 2QPTA 4FTGA 2AUCA 2CTNA 4ICBA 1H4BA 2K0JA 2LMVA 1C7WA 1OMRA 1BF5A 4AQIA 2EC6B 2KAXA 5PALA 1EG3A 1XFYO 1V1FA 3VROA 2PALA 5DKNA 2GGMA 2WCBA 5JOLA 1RJVA 3SIAA 2LANA 1OZOA 2OS8B 4YRUA 1TN4A 3DF0A 1WLMA 2Q91A 4CFQA 1OE9B 2LCPA 1CDPA 1IQ3A 1DF0B 1SRAA 3TZ1A 1KFUS 3CZTX 1PVAA 4MZKA 1CDMA 1LXFC 1JWDA 1K9UA 2JQ6A 2WC8A 1WRLA 1KCYA 2HPSA 4PDZA 2ZNEA 1PULA 2F8PA 1K93D 1M45A 1PSRA 1K94A 1NX3A 1L2OB 3GOFA 4DRWA 2O60A 4MZLA 2H61A 3KF9A 3M0WA 2EC6C 5JJGA 1AK8A 1K9KA 1WLZA 3DVJA 1B7TZ 2ZNDA 2ZFDA 1XK4C 1CKKA 2WORA 1GJYA 2F33A 1H8BA 3I5GC 4PE1A 1QV1A 1XYDA 2LMTA 2KBIA 4ORBB 1QATA 4YI9A 1JBAA 2MRDA 3OHMB 1JFJA 3LLEA 4A4CA 3PLFB 4DIRA 1A03A 4BY5A 1TCFA 1MQ1A 1TOPA 1AUIB 3GK4X 4PE7A 1CFPA 1GGWA 1FI5A 5CSFA 1XFZO 3DF0B 5I2QA 5AXIA 5B8IB 1RROA 1KK7Z 1FBVA 2PMYA 1LA0A 1MHOA 2BKIB 2L2EA 3LL8B 4PHKA 3O2PA 2KYFA 1NWDA 2LC5A 3RM1A 2M97A 1YUSA 4MRXA 1W7IB 1K2HA 4P2YB 1SBJA 2JXCA 4D1EA 3EVVA 3BUXB 4P5OE 2WNDA 2L98A 3FS7A 3SG7A 3CR4X 4ORCB 1JF2A 2NXQA 4Q04A 1CMGA 3E3RA 2LHLA 2KI4B 1TNXA 3WHUB 2NLNA 1MXEA 1SMGA 1F71A 1MF8B 1K9PA 5HKYA 2MA2A 1CLLA 1Y1XA 1TTXA 2I2RE 2K8MB 2MHHA 1Q80A 1JUOA 2LVJA 3AAKA 2KQYA 2OPOA 3CLNA 3DVKA 3EVUA 1IJ6A 2JRFA 1TNWA 1U5IB 4WQ2A 1WRZA 1B4CA 1ZUZA 1B8CA 2AAOA 1CNPA 2KFHA 2Y5IA 3JVTB 1RWYA 3HCMA 1TRFA 1ZACA 1CTRA 2O5GA 3A4UB 1QS7A 3O4YA 3TDZA 1X02A 2BL0B 3CWGA 1A75A 3SG4A 1Y1AA 1CMFA 4I5KA 1UHHA 1VRKA 1F4QA 5ER4X 5AANA 1CDLA 1YRUB 2K7BA 2KI6C 2PRUA 1QASA 4PHMA 1DT7B 1PSBA 2BBMA 2H61C 2K7CA 1QXPA 2KI6D 1DJIA 3DD4A 2K7OA 1UURA 1GQMA 2KI4C 1CDNA 1IG5A 3RLZA 1NCXA 1RTP1 2KAYA 1K96A 4M2QA 2JNXA 2KFGA 3SG5A 1MUXA 1DJYA 1OSAA 1N2DA 3I5HB 1YVLA 2G9BA 3O6BA 4HSZA 2KAVA 1CM1A 1PRWA 1EL4A 2OTGB 3GK1A 4CIDA 3BUWB 2BCXA 1YUUA 1D1OA 4MBEA 3VGOA 3NSIA 2KDHA 2JT3A 2AMIA 1ODBA 2LLUA 3AKBA 1BOCA 4CLNA 2JOJA 1AJ4A 1NX2A 1KQMB 2JT0A 2G2BA 1AP4A 2L51A 1BR4B 3I5IB 1V1GA 3GK2A 2JNFA 2DOQA 1L7ZA 3A8RA 1XFWO 2HF5A 1YX8A 2JT8A 1N65A 5HYDA 2MAZA 1UHKA 5FYXA 4NQGA 1ALVA 1PK0D 4OR9B 1B7TY 2SCPA 2M8UA 1DGVA 1A75B 2HETA 3PFVA 4NDDA 4QJ3B 3CGAA 2LM5A 5AEQA 4N5XA 3LK1A 3SG2A 4ZCVA 1A4PA 1RK9A 3PSRA 2KFFA 1IJ5A 1LKJA 1KSMA 3H4SE 2WOSA 2K2AA 2FJUB 3WXAA 2L4IA 2LE9B 3SG3A 2I94A 2JZIA 3FWBA 3SIBA 1MXLC 1SKTA 1F4OA 1SY9A 1KWOB 1YVHA 1B47A 1SR6B 1KK7Y 1R2UA 3C1VA 1KQMC 3OB2B 3CTNA 4XJKB 2LLSA 3HX4A 1N0YA 1K95A 1SW8A 4NDCA 2OS8C 5HKZA 1DVIA 2ZRTA 5DKRA 5AERA 1XFVO 4GNKB 5F6TA 1U5IA 1UUSA 1UHJA 1S6IA 1SCVA 4BY4A 3BUNB 1PALA 1J1DA 1NX0A 1MWNA 2H2KA 1EG4A 2CCMA 5BPJA 1G33A 1RECA 1WDCB 1YTZC 2M1KB 1QV0A 5D69A 4M2OA 1Y1UA 4CPVA 3PN7B 2Q4UA 4JQ0D 1QJTA 2KGRA 4L9MA 3CR2A 1AJ5A 1TIZA 1L2OC 5GQQC 2ISDA 2PSRA 1F8HA 1JSAA 4MEWA 1UHIA 2I7AA 1S5GZ 2LHIA 4JPZB 2LNKA 1DJGA 4PALA 4MLWA 1PVBA 1B8LA 4YI8A 3AAJA 1XO5A 3VRNA 1KWOC 1M46A 2BCBA 2LUCA 1F70A 4GGNA 1JC2A 1DGUA 1QLKA 1F55A 5CSJA 2V53A 1B8RA 2KYCA 1GGZA 1HT9A 4TNCA 1QX5B 1TNPA 2K61A 3ZWHA 1DJZA 3F45A 1FF1A 1CFCA 4GGFA 1QX2A 1FPWA 2CT9A 1ZOTB 2BCAA 4M2PA 2BECA 3BUOB 3WHTB 1WDCC 2M9GA 2LLTA 1QIWA 1YURA 2Y4QA 1KFUL 1UWOA 3ICBA 2WCEA 3PN7C 1IGVA 4R1EA 3D10A 4HRHA 4XYNA 1BT6A 1IWQA 1CB1A 1K90D 1KFXL 5K89A 3AKAA 2L5XB 5TNCA 3PATA 2E6WA 2ZKMX 4OVNF 2JC2A 2LMUA 3EK7A 3EKHA 3BUMB 2KOTA 1B9AA 4ZCUA 3SG6A 3EKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGB C;  4GAO A;  2KHN A;  1F54 A;  3VRQ A;  2K7D A;  2GV5 A;  1ZFS A;  2FOT A;  1C7V A;  3TDU A;  1MR8 A;  4I5L B;  1CLM A;  3TDI A;  2LP2 A;  2VRG A;  5CPV A;  2MBX A;  1NIW A;  4MN0 A;  5J3X A;  2E30 A;  3ZNI A;  4CFR A;  2KNE A;  2P6B B;  3OX6 A;  1RFJ A;  1XVJ A;  2L4H A;  3FWC A;  4HRE E;  1EXR A;  3EK8 A;  2PVB A;  3WNX B;  5I8N A;  4XJK A;  1LVC D;  3CR5 X;  2HQW A;  2LP3 A;  1FI6 A;  2JUL A;  2ZN9 A;  2NCO A;  5HLO A;  2KQ6 A;  1NCY A;  1QVI Z;  2R2I A;  5CSI A;  4DCK A;  4QJ4 B;  3JVT C;  2JXL A;  1BG1 A;  3PM8 A;  1NX1 A;  2CBL A;  3QRX A;  4YGA A;  3BOW B;  3DVE A;  1YR5 A;  2IS9 A;  2M29 A;  2LVK A;  1QTX A;  1Y0V H;  3BQ3 A;  3BXK A;  2BL0 C;  3I5F B;  3KHE A;  3D0Y A;  3JTD B;  3CS1 A;  3LK0 A;  1S6J A;  1K8U A;  3NSO A;  1CFF A;  3EK4 A;  4HRG A;  1IKU A;  1YRT B;  4C0K A;  1J7Q A;  5IBW A;  2D8N A;  4YBH B;  3O78 A;  4E68 A;  5I2L A;  1M39 A;  2EGD A;  1A29 A;  2TN4 A;  2KSP A;  1NYA A;  2NZ0 A;  1KSO A;  1S3P A;  1S1E A;  4C0J A;  4PE0 A;  3NXA A;  1QIV A;  3I5H C;  4YGC B;  2MLF C;  3I5G B;  4DS7 A;  1M31 A;  3EVR A;  1CLB A;  2OTG C;  1UP5 A;  4GGF C;  1BJF A;  2M3W A;  4I5J A;  2COL B;  3TUY B;  1YUT A;  1DJX A;  1JF0 A;  2JTT A;  1SCM B;  2MLE C;  3SJS A;  2I18 A;  4YGB B;  3NSL A;  3IQQ A;  3I5F C;  2LVI A;  1DTL A;  1DMO A;  3I5I C;  3JTD C;  1BU3 A;  1KFX S;  2PAS A;  3IQO A;  3KO0 A;  2JWW A;  4F0Z B;  2BE6 A;  4FQO A;  1UHN A;  1S5G Y;  1SK6 D;  2FCE A;  1J7R A;  1SL7 A;  1SYM A;  1QLS A;  1IH0 A;  1OQP A;  4OV2 A;  2K2F A;  3D0Y B;  1OZS A;  1W7J B;  4YGE B;  2BE4 A;  1NPQ A;  3TS5 B;  4C0L A;  5KU1 A;  2FCD A;  4PHN A;  3VRR A;  1A2X A;  1ZMZ A;  1XFX O;  1B1G A;  1YX7 A;  1HQV A;  4MVF A;  1ALW A;  4GBA A;  4YGD B;  4A4B A;  1WY9 A;  2LUX A;  3VRP A;  5I2O A;  1OMV A;  1JFK A;  3BYA A;  1KK8 B;  1AHR A;  1XA5 A;  1AVS A;  4ORA B;  2BKH B;  1TCO B;  2QAC A;  3OP0 A;  3OB1 B;  4PE4 A;  4UPG A;  4WQ3 A;  3TUY C;  1S6C A;  2LV7 A;  1J55 A;  2CNP A;  5D7F A;  1J7P A;  1SCM C;  1TNQ A;  2WCF A;  2L50 A;  4JWQ A;  1SR6 C;  1Y6W A;  1DJH A;  3DVM A;  1CM4 A;  1EJ3 A;  1E8A A;  4GUK A;  4MSP A;  4USL A;  2ZN8 A;  2CXJ A;  3KEV A;  1SL8 A;  1M63 B;  5ER5 A;  1S26 D;  2Y1N A;  2HQ8 A;  1IQ5 A;  1EH2 A;  1NP8 A;  1J7O A;  4GFT A;  3BOW A;  1G4Y R;  3TS5 C;  4I5N B;  2B1U A;  4AOM A;  4ETO A;  1WRK A;  5CSN A;  2KBM A;  2SAS A;  2F3Z A;  1FW4 A;  2GGZ A;  2M49 B;  4N1F A;  2JU0 A;  2M0R A;  1KK8 C;  1QX7 A;  1BR1 B;  2JPT A;  2M7N A;  4WRI A;  2EHB A;  1NSH A;  1BMO A;  1BOD A;  3LCP C;  4QJ5 B;  3OX5 A;  1SL9 A;  1C07 A;  4MZJ A;  2F3Y A;  2RGI A;  1LIN A;  1XK4 A;  1QVI Y;  1LA3 A;  3FIA A;  5HKW A;  1NCZ A;  2LVV A;  1CFD A;  2ZRS A;  3K21 A;  1OOJ A;  1XFU O;  2M7L A;  1IRJ A;  1DF0 A;  4U8D A;  2F2O A;  3NSK A;  1J1E A;  4N1G A;  4OCI A;  5DKQ A;  1G8I A;  4GPL B;  5AFP A;  4IL1 A;  5G08 A;  1NUB A;  2M1U A;  5KTY A;  1BLQ A;  1OMD A;  1R6P A;  3IF7 A;  2Y1M A;  3MSE B;  1DJW A;  1KQV A;  3KPX A;  2JTZ A;  2L0P A;  4AQJ A;  2BBN A;  2NCP A;  5HLV A;  1SPY A;  2MJW B;  4MRY A;  2A4J A;  4DUQ A;  3PAL A;  2LAP A;  1SNL A;  4PHJ A;  1S36 A;  4NDB A;  4PCW A;  2F2P A;  5KSZ A;  4OKH A;  2QPT A;  4FTG A;  2AUC A;  2CTN A;  4ICB A;  1H4B A;  2K0J A;  2LMV A;  1C7W A;  1OMR A;  1BF5 A;  4AQI A;  2EC6 B;  2KAX A;  5PAL A;  1EG3 A;  1XFY O;  1V1F A;  3VRO A;  2PAL A;  5DKN A;  2GGM A;  2WCB A;  5JOL A;  1RJV A;  3SIA A;  2LAN A;  1OZO A;  2OS8 B;  4YRU A;  1TN4 A;  3DF0 A;  1WLM A;  2Q91 A;  4CFQ A;  1OE9 B;  2LCP A;  1CDP A;  1IQ3 A;  1DF0 B;  1SRA A;  3TZ1 A;  1KFU S;  3CZT X;  1PVA A;  4MZK A;  1CDM A;  1LXF C;  1JWD A;  1K9U A;  2JQ6 A;  2WC8 A;  1WRL A;  1KCY A;  2HPS A;  4PDZ A;  2ZNE A;  1PUL A;  2F8P A;  1K93 D;  1M45 A;  1PSR A;  1K94 A;  1NX3 A;  1L2O B;  3GOF A;  4DRW A;  2O60 A;  4MZL A;  2H61 A;  3KF9 A;  3M0W A;  2EC6 C;  5JJG A;  1AK8 A;  1K9K A;  1WLZ A;  3DVJ A;  1B7T Z;  2ZND A;  2ZFD A;  1XK4 C;  1CKK A;  2WOR A;  1GJY A;  2F33 A;  1H8B A;  3I5G C;  4PE1 A;  1QV1 A;  1XYD A;  2LMT A;  2KBI A;  4ORB B;  1QAT A;  4YI9 A;  1JBA A;  2MRD A;  3OHM B;  1JFJ A;  3LLE A;  4A4C A;  3PLF B;  4DIR A;  1A03 A;  4BY5 A;  1TCF A;  1MQ1 A;  1TOP A;  1AUI B;  3GK4 X;  4PE7 A;  1CFP A;  1GGW A;  1FI5 A;  5CSF A;  1XFZ O;  3DF0 B;  5I2Q A;  5AXI A;  5B8I B;  1RRO A;  1KK7 Z;  1FBV A;  2PMY A;  1LA0 A;  1MHO A;  2BKI B;  2L2E A;  3LL8 B;  4PHK A;  3O2P A;  2KYF A;  1NWD A;  2LC5 A;  3RM1 A;  2M97 A;  1YUS A;  4MRX A;  1W7I B;  1K2H A;  4P2Y B;  1SBJ A;  2JXC A;  4D1E A;  3EVV A;  3BUX B;  4P5O E;  2WND A;  2L98 A;  3FS7 A;  3SG7 A;  3CR4 X;  4ORC B;  1JF2 A;  2NXQ A;  4Q04 A;  1CMG A;  3E3R A;  2LHL A;  2KI4 B;  1TNX A;  3WHU B;  2NLN A;  1MXE A;  1SMG A;  1F71 A;  1MF8 B;  1K9P A;  5HKY A;  2MA2 A;  1CLL A;  1Y1X A;  1TTX A;  2I2R E;  2K8M B;  2MHH A;  1Q80 A;  1JUO A;  2LVJ A;  3AAK A;  2KQY A;  2OPO A;  3CLN A;  3DVK A;  3EVU A;  1IJ6 A;  2JRF A;  1TNW A;  1U5I B;  4WQ2 A;  1WRZ A;  1B4C A;  1ZUZ A;  1B8C A;  2AAO A;  1CNP A;  2KFH A;  2Y5I A;  3JVT B;  1RWY A;  3HCM A;  1TRF A;  1ZAC A;  1CTR A;  2O5G A;  3A4U B;  1QS7 A;  3O4Y A;  3TDZ A;  1X02 A;  2BL0 B;  3CWG A;  1A75 A;  3SG4 A;  1Y1A A;  1CMF A;  4I5K A;  1UHH A;  1VRK A;  1F4Q A;  5ER4 X;  5AAN A;  1CDL A;  1YRU B;  2K7B A;  2KI6 C;  2PRU A;  1QAS A;  4PHM A;  1DT7 B;  1PSB A;  2BBM A;  2H61 C;  2K7C A;  1QXP A;  2KI6 D;  1DJI A;  3DD4 A;  2K7O A;  1UUR A;  1GQM A;  2KI4 C;  1CDN A;  1IG5 A;  3RLZ A;  1NCX A;  1RTP 1;  2KAY A;  1K96 A;  4M2Q A;  2JNX A;  2KFG A;  3SG5 A;  1MUX A;  1DJY A;  1OSA A;  1N2D A;  3I5H B;  1YVL A;  2G9B A;  3O6B A;  4HSZ A;  2KAV A;  1CM1 A;  1PRW A;  1EL4 A;  2OTG B;  3GK1 A;  4CID A;  3BUW B;  2BCX A;  1YUU A;  1D1O A;  4MBE A;  3VGO A;  3NSI A;  2KDH A;  2JT3 A;  2AMI A;  1ODB A;  2LLU A;  3AKB A;  1BOC A;  4CLN A;  2JOJ A;  1AJ4 A;  1NX2 A;  1KQM B;  2JT0 A;  2G2B A;  1AP4 A;  2L51 A;  1BR4 B;  3I5I B;  1V1G A;  3GK2 A;  2JNF A;  2DOQ A;  1L7Z A;  3A8R A;  1XFW O;  2HF5 A;  1YX8 A;  2JT8 A;  1N65 A;  5HYD A;  2MAZ A;  1UHK A;  5FYX A;  4NQG A;  1ALV A;  1PK0 D;  4OR9 B;  1B7T Y;  2SCP A;  2M8U A;  1DGV A;  1A75 B;  2HET A;  3PFV A;  4NDD A;  4QJ3 B;  3CGA A;  2LM5 A;  5AEQ A;  4N5X A;  3LK1 A;  3SG2 A;  4ZCV A;  1A4P A;  1RK9 A;  3PSR A;  2KFF A;  1IJ5 A;  1LKJ A;  1KSM A;  3H4S E;  2WOS A;  2K2A A;  2FJU B;  3WXA A;  2L4I A;  2LE9 B;  3SG3 A;  2I94 A;  2JZI A;  3FWB A;  3SIB A;  1MXL C;  1SKT A;  1F4O A;  1SY9 A;  1KWO B;  1YVH A;  1B47 A;  1SR6 B;  1KK7 Y;  1R2U A;  3C1V A;  1KQM C;  3OB2 B;  3CTN A;  4XJK B;  2LLS A;  3HX4 A;  1N0Y A;  1K95 A;  1SW8 A;  4NDC A;  2OS8 C;  5HKZ A;  1DVI A;  2ZRT A;  5DKR A;  5AER A;  1XFV O;  4GNK B;  5F6T A;  1U5I A;  1UUS A;  1UHJ A;  1S6I A;  1SCV A;  4BY4 A;  3BUN B;  1PAL A;  1J1D A;  1NX0 A;  1MWN A;  2H2K A;  1EG4 A;  2CCM A;  5BPJ A;  1G33 A;  1REC A;  1WDC B;  1YTZ C;  2M1K B;  1QV0 A;  5D69 A;  4M2O A;  1Y1U A;  4CPV A;  3PN7 B;  2Q4U A;  4JQ0 D;  1QJT A;  2KGR A;  4L9M A;  3CR2 A;  1AJ5 A;  1TIZ A;  1L2O C;  5GQQ C;  2ISD A;  2PSR A;  1F8H A;  1JSA A;  4MEW A;  1UHI A;  2I7A A;  1S5G Z;  2LHI A;  4JPZ B;  2LNK A;  1DJG A;  4PAL A;  4MLW A;  1PVB A;  1B8L A;  4YI8 A;  3AAJ A;  1XO5 A;  3VRN A;  1KWO C;  1M46 A;  2BCB A;  2LUC A;  1F70 A;  4GGN A;  1JC2 A;  1DGU A;  1QLK A;  1F55 A;  5CSJ A;  2V53 A;  1B8R A;  2KYC A;  1GGZ A;  1HT9 A;  4TNC A;  1QX5 B;  1TNP A;  2K61 A;  3ZWH A;  1DJZ A;  3F45 A;  1FF1 A;  1CFC A;  4GGF A;  1QX2 A;  1FPW A;  2CT9 A;  1ZOT B;  2BCA A;  4M2P A;  2BEC A;  3BUO B;  3WHT B;  1WDC C;  2M9G A;  2LLT A;  1QIW A;  1YUR A;  2Y4Q A;  1KFU L;  1UWO A;  3ICB A;  2WCE A;  3PN7 C;  1IGV A;  4R1E A;  3D10 A;  4HRH A;  4XYN A;  1BT6 A;  1IWQ A;  1CB1 A;  1K90 D;  1KFX L;  5K89 A;  3AKA A;  2L5X B;  5TNC A;  3PAT A;  2E6W A;  2ZKM X;  4OVN F;  2JC2 A;  2LMU A;  3EK7 A;  3EKH A;  3BUM B;  2KOT A;  1B9A A;  4ZCU A;  3SG6 A;  3EKJ A; 
#chains in the Genus database with same CATH topology
 2KGB C;  2QEB A;  4GAO A;  2KHN A;  1F54 A;  3VRQ A;  4OZD A;  2K7D A;  1DC1 A;  2GV5 A;  1ZFS A;  2FOT A;  1C7V A;  3TDU A;  1MR8 A;  4I5L B;  1CLM A;  3TDI A;  2LP2 A;  2VRG A;  3CZ2 A;  3V2L A;  5CPV A;  2MBX A;  1NIW A;  4MN0 A;  5J3X A;  2E30 A;  3ZNI A;  3D73 A;  4CFR A;  2KNE A;  2P6B B;  3OX6 A;  1RFJ A;  1XVJ A;  2L4H A;  3FWC A;  4HRE E;  1EXR A;  3EK8 A;  2PVB A;  3WNX B;  5I8N A;  4XJK A;  1LVC D;  3CR5 X;  2HQW A;  2LP3 A;  3O4X A;  2JUL A;  2ZN9 A;  1FI6 A;  2NCO A;  5HLO A;  2KQ6 A;  1NCY A;  1QVI Z;  2R2I A;  4IJ7 A;  5FI6 A;  5CSI A;  4DCK A;  4QJ4 B;  3JVT C;  2JXL A;  1BG1 A;  2QEH A;  1NX1 A;  2CBL A;  3PM8 A;  3QRX A;  4YGA A;  3SS4 A;  3BOW B;  3DVE A;  3UNW A;  3BFB A;  1YR5 A;  2IS9 A;  2M29 A;  2LVK A;  1QTX A;  1Y0V H;  3BQ3 A;  3BXK A;  2BL0 C;  3I5F B;  3KHE A;  3D0Y A;  3JTD B;  3CS1 A;  3K1E A;  1S6J A;  3LK0 A;  2YGU A;  1K8U A;  3NSO A;  1CFF A;  3EK4 A;  4HRG A;  1IKU A;  2WC6 A;  1YRT B;  1LS8 A;  1GM0 A;  4C0K A;  3PJI A;  3QME A;  1J7Q A;  5IBW A;  2D8N A;  4YBH B;  3O78 A;  4E68 A;  5I2L A;  1M39 A;  2EGD A;  1A29 A;  2TN4 A;  2KSP A;  1NYA A;  2NZ0 A;  1KSO A;  1S3P A;  1S1E A;  4C0J A;  4PE0 A;  3L4L A;  3NXA A;  1QIV A;  3I5H C;  4YGC B;  2MLF C;  3I5G B;  4DS7 A;  1M31 A;  3EVR A;  1CLB A;  2OTG C;  1UP5 A;  4GGF C;  1BJF A;  1TWO A;  2M3W A;  4I5J A;  2COL B;  3TUY B;  1YUT A;  1DJX A;  1JF0 A;  2JTT A;  1SCM B;  2MLE C;  3SJS A;  2I18 A;  4YGB B;  4FQT A;  3NSL A;  3IQQ A;  3I5F C;  2LVI A;  1DTL A;  1DMO A;  3I5I C;  3JTD C;  1BU3 A;  1KFX S;  2PAS A;  3IQO A;  3KO0 A;  2JWW A;  4F0Z B;  2BE6 A;  4FQO A;  1UHN A;  1S5G Y;  1SK6 D;  2FCE A;  1J7R A;  1SL7 A;  1SYM A;  1QLS A;  1IH0 A;  1OQP A;  4OV2 A;  2K2F A;  3D0Y B;  1OZS A;  1W7J B;  4YGE B;  2BE4 A;  1NPQ A;  3FE6 A;  3TS5 B;  3PM2 A;  4C0L A;  5KU1 A;  2FCD A;  4PHN A;  3VRR A;  1A2X A;  1ZMZ A;  1XFX O;  1B1G A;  1YX7 A;  1HQV A;  4MVF A;  1ALW A;  4GBA A;  4YGD B;  4A4B A;  3IVT A;  3NHI A;  1WY9 A;  2LUX A;  1OOG A;  3S0B A;  3VRP A;  5I2O A;  1OMV A;  1JFK A;  3BYA A;  1KK8 B;  1AHR A;  1XA5 A;  1AVS A;  4ORA B;  2BKH B;  1TCO B;  2QAC A;  3OP0 A;  3OB1 B;  4PE4 A;  4UPG A;  4WQ3 A;  3TUY C;  1S6C A;  2LV7 A;  1J55 A;  2CNP A;  5D7F A;  1J7P A;  1SCM C;  1TNQ A;  2WCF A;  2L50 A;  4JWQ A;  1SR6 C;  1Y6W A;  1DJH A;  3DVM A;  1CM4 A;  1EJ3 A;  1E8A A;  2PQL A;  3VB1 A;  4GUK A;  4MSP A;  4USL A;  2ZN8 A;  2CXJ A;  3Q8I A;  3KEV A;  1SL8 A;  3S0A A;  1M63 B;  5ER5 A;  1S26 D;  2Y1N A;  2HQ8 A;  1IQ5 A;  1EH2 A;  1NP8 A;  3S0D A;  1J7O A;  4GFT A;  3BOW A;  1G4Y R;  3TS5 C;  4I5N B;  2B1U A;  5FI2 A;  4AOM A;  3D74 A;  4ETO A;  1WRK A;  3CYZ A;  5CSN A;  2KBM A;  2SAS A;  1TUJ A;  2F3Z A;  1FW4 A;  2GGZ A;  2M49 B;  4N1F A;  4JD9 A;  2JU0 A;  2M0R A;  1KK8 C;  1QX7 A;  1BR1 B;  2JPT A;  2M7N A;  4WRI A;  2EHB A;  1NSH A;  1BMO A;  1BOD A;  3LCP C;  4QJ5 B;  1OOH A;  3OX5 A;  1SL9 A;  1C07 A;  4MZJ A;  2F3Y A;  2RGI A;  1LIN A;  1XK4 A;  1QVI Y;  1LA3 A;  3FIA A;  3EG5 B;  3FE9 A;  5HKW A;  1NCZ A;  2LVV A;  1CFD A;  2KPH A;  2ZRS A;  3K21 A;  1OOJ A;  1XFU O;  2M7L A;  1IRJ A;  1DF0 A;  4U8D A;  2F2O A;  3NSK A;  1J1E A;  4N1G A;  4OCI A;  5DKQ A;  1G8I A;  4GPL B;  5AFP A;  4IL1 A;  5G08 A;  1NUB A;  2M1U A;  5KTY A;  3NHT A;  1BLQ A;  4INX A;  1OMD A;  2WCH A;  1R6P A;  3IF7 A;  2Y1M A;  5HL1 A;  3MSE B;  1TUZ A;  1DJW A;  1KQV A;  3KPX A;  2JTZ A;  2L0P A;  4AQJ A;  2BBN A;  2NCP A;  5HLV A;  1SPY A;  2MJW B;  4MRY A;  2A4J A;  2WC5 A;  3PAL A;  4DUQ A;  2LAP A;  1SNL A;  4PHJ A;  4PT1 A;  1S36 A;  4NDB A;  4PCW A;  2F2P A;  5KSZ A;  4OKH A;  2QPT A;  4FTG A;  2AUC A;  2CTN A;  4ICB A;  3D77 A;  1H4B A;  2K0J A;  2LMV A;  1C7W A;  1OMR A;  1OOI X;  1BF5 A;  2BNX A;  4AQI A;  2EC6 B;  2KAX A;  5PAL A;  1EG3 A;  1XFY O;  1V1F A;  3VRO A;  2PAL A;  5DKN A;  2GGM A;  2WCB A;  5JOL A;  1RJV A;  3SIA A;  2LAN A;  1OZO A;  2OS8 B;  3L4A A;  4YRU A;  1TN4 A;  3DF0 A;  1WLM A;  2Q91 A;  4CFQ A;  1OE9 B;  2LCP A;  1CDP A;  3CZ0 A;  1IQ3 A;  1DF0 B;  1SRA A;  2FJY A;  3TZ1 A;  1KFU S;  3CZT X;  2L2C A;  1PVA A;  4MZK A;  1CDM A;  1LXF C;  2WCL A;  1K9U A;  2JQ6 A;  2WC8 A;  1WRL A;  1JWD A;  1KCY A;  2HPS A;  4PDZ A;  2ZNE A;  1PUL A;  2F8P A;  1K93 D;  1M45 A;  1PSR A;  1K94 A;  1NX3 A;  1IIO A;  1L2O B;  3GOF A;  1OOF A;  4DRW A;  2O60 A;  4MZL A;  2H61 A;  3KF9 A;  3M0W A;  2P70 A;  2EC6 C;  5JJG A;  1AK8 A;  1DQE A;  2WCJ A;  1K9K A;  1WLZ A;  3DVJ A;  1Z2C B;  1B7T Z;  2ZND A;  2ZFD A;  1XK4 C;  1CKK A;  2WOR A;  1W9Z A;  1GJY A;  2F33 A;  1H8B A;  3I5G C;  4PE1 A;  1QV1 A;  1XYD A;  2LMT A;  2KBI A;  4ORB B;  1QAT A;  4YI9 A;  1JBA A;  2MRD A;  3OHM B;  1JFJ A;  3LLE A;  4A4C A;  3PLF B;  3B87 A;  4DIR A;  1Z4H A;  1A03 A;  4BY5 A;  1TCF A;  1MQ1 A;  1TOP A;  1AUI B;  3GK4 X;  4PE7 A;  1CFP A;  1GGW A;  1FI5 A;  5CSF A;  3B86 A;  1XFZ O;  3OGN A;  1T14 A;  3DF0 B;  5I2Q A;  2PYQ A;  3B7A A;  5AXI A;  5B8I B;  1DEK A;  1RRO A;  1KK7 Z;  1FBV A;  2PMY A;  1LA0 A;  1MHO A;  2BKI B;  2L2E A;  3LL8 B;  2KLE A;  3O2P A;  2KYF A;  4PHK A;  1NWD A;  2LC5 A;  3RM1 A;  2M97 A;  1YUS A;  4MRX A;  1W7I B;  1K2H A;  4P2Y B;  1SBJ A;  2JXC A;  4D1E A;  3EVV A;  3BUX B;  4P5O E;  2QEO A;  2H8V A;  2WND A;  3DYE A;  2L98 A;  3FS7 A;  3OBV A;  3SG7 A;  3CR4 X;  2WCK A;  2K60 A;  1JF2 A;  2NXQ A;  3B88 A;  4ORC B;  4Q04 A;  1CMG A;  3E3R A;  1C3Y A;  2LHL A;  2KI4 B;  5I94 A;  2JPO A;  1TNX A;  3WHU B;  2NLN A;  1P28 A;  1MXE A;  1SMG A;  1F71 A;  1MF8 B;  1K9P A;  5HKY A;  2MA2 A;  1CLL A;  1Y1X A;  1TTX A;  2I2R E;  2K8M B;  2MHH A;  1Q80 A;  1JUO A;  2LVJ A;  3AAK A;  2KQY A;  2OPO A;  3CLN A;  3DVK A;  3EVU A;  1IJ6 A;  2JRF A;  1TNW A;  1U5I B;  4WQ2 A;  1WRZ A;  1B4C A;  1ZUZ A;  1B8C A;  2AAO A;  1CNP A;  2KFH A;  2Y5I A;  3JVT B;  1RWY A;  3HCM A;  1TRF A;  1ZAC A;  1CTR A;  2ERB A;  2O5G A;  1QS7 A;  3A4U B;  3O4Y A;  3S0G A;  3TDZ A;  1X02 A;  2BL0 B;  1C3Z A;  3CWG A;  1A75 A;  3SS5 A;  3SG4 A;  1Y1A A;  1CMF A;  4I5K A;  1UHH A;  1VRK A;  1F4Q A;  5ER4 X;  5AAN A;  1CDL A;  1YRU B;  2K7B A;  2KI6 C;  2PRU A;  1QAS A;  4PHM A;  1DT7 B;  1PSB A;  2BBM A;  2H61 C;  3DZT A;  2K7C A;  3D76 A;  1QXP A;  2KI6 D;  1DJI A;  3DD4 A;  2K7O A;  1UUR A;  1GQM A;  2KI4 C;  3R1O A;  3BFH A;  1CDN A;  3CAB A;  1IG5 A;  3RLZ A;  1NCX A;  1RTP 1;  2KAY A;  1K96 A;  4M2Q A;  2JNX A;  2L5Y A;  2KFG A;  3SG5 A;  1MUX A;  1DJY A;  1OSA A;  1N2D A;  3I5H B;  1YVL A;  2G9B A;  3O6B A;  3RZS A;  4HSZ A;  2KAV A;  1CM1 A;  1PRW A;  1EL4 A;  2OTG B;  3GK1 A;  4CID A;  3BUW B;  2BCX A;  5DIC A;  1YUU A;  1D1O A;  4MBE A;  5EL2 A;  3VGO A;  3NSI A;  2KDH A;  2JT3 A;  5D3O A;  2AMI A;  1ODB A;  2LLU A;  3AKB A;  1BOC A;  4CLN A;  2JOJ A;  1AJ4 A;  2BAP A;  1NX2 A;  1KQM B;  2JT0 A;  2G2B A;  1AP4 A;  2L51 A;  1BR4 B;  3I5I B;  1V1G A;  3GK2 A;  3L47 A;  2JNF A;  2DOQ A;  1L7Z A;  3A8R A;  1XFW O;  2HF5 A;  1YX8 A;  2JT8 A;  1N65 A;  5HYD A;  2MAZ A;  1SSE B;  1UHK A;  5FYX A;  4NQG A;  1ALV A;  1PK0 D;  4OR9 B;  1B7T Y;  2SCP A;  2M8U A;  1DGV A;  1A75 B;  2HET A;  3PFV A;  4NDD A;  3R1V A;  4QJ3 B;  3S0F A;  3CGA A;  2LM5 A;  3CDN A;  3FE8 A;  5AEQ A;  4N5X A;  3LK1 A;  3SG2 A;  4ZCV A;  1A4P A;  1RK9 A;  3PSR A;  2KFF A;  1IJ5 A;  1LKJ A;  1KSM A;  3H4S E;  2WOS A;  2K2A A;  3DXL A;  2FJU B;  3WXA A;  1XFR A;  1DEL A;  2L4I A;  2LE9 B;  3DY9 A;  3SG3 A;  2GTE A;  1ORG A;  2I94 A;  2JZI A;  3FWB A;  3SIB A;  1MXL C;  1SKT A;  1F4O A;  1SY9 A;  1KWO B;  1YVH A;  1B47 A;  1SR6 B;  1KK7 Y;  1R2U A;  3C1V A;  1KQM C;  3OB2 B;  3CTN A;  4XJK B;  2LLS A;  3HX4 A;  1N0Y A;  1K95 A;  1SW8 A;  4NDC A;  2OS8 C;  5HKZ A;  1DVI A;  2ZRT A;  5DKR A;  5AER A;  1XFV O;  4GNK B;  5F6T A;  1U5I A;  1UUS A;  1UHJ A;  1S6I A;  1SCV A;  4BY4 A;  3BUN B;  1PAL A;  1J1D A;  3D75 A;  1NX0 A;  1MWN A;  1OW4 A;  2H2K A;  2QEV A;  1EG4 A;  2CCM A;  4F7F A;  5BPJ A;  1G33 A;  1REC A;  1WDC B;  1YTZ C;  2M1K B;  1QV0 A;  3S0E A;  5D69 A;  4M2O A;  1Y1U A;  4CPV A;  3PN7 B;  2Q4U A;  4JQ0 D;  1QJT A;  2KGR A;  4L9M A;  3CR2 A;  1AJ5 A;  1TIZ A;  1L2O C;  5FI7 A;  5GQQ C;  2ISD A;  2PSR A;  1F8H A;  1JSA A;  4MEW A;  1UHI A;  4KYN A;  2I7A A;  2P71 A;  1S5G Z;  2LHI A;  4JPZ B;  3CZ1 A;  2LNK A;  1DJG A;  4PAL A;  4MLW A;  3N7H A;  1PVB A;  1B8L A;  4YI8 A;  3BFA A;  3AAJ A;  1XO5 A;  3VRN A;  1KWO C;  3R72 A;  1M46 A;  2BCB A;  2LUC A;  2WCM A;  1F70 A;  4GGN A;  1JC2 A;  1DGU A;  1QLK A;  4INW A;  1F55 A;  5CSJ A;  2V53 A;  1B8R A;  2KYC A;  1GGZ A;  1HT9 A;  4TNC A;  3B6X A;  1QX5 B;  1TNP A;  2K61 A;  3ZWH A;  1DJZ A;  3F45 A;  1FF1 A;  1CFC A;  4GGF A;  1QX2 A;  1FPW A;  3BJH A;  2CT9 A;  1ZOT B;  2BCA A;  2QDI A;  2BEC A;  4M2P A;  3BUO B;  3WHT B;  1WDC C;  2M9G A;  2LLT A;  1QIW A;  1YUR A;  2Y4Q A;  1KFU L;  1UWO A;  1QWV A;  3ICB A;  2WCE A;  3SS3 A;  3PN7 C;  1IGV A;  4R1E A;  3D10 A;  4HRH A;  3NGV A;  4XYN A;  1BT6 A;  1IWQ A;  1CB1 A;  1K90 D;  1KFX L;  5K89 A;  3D78 A;  3AKA A;  2L5X B;  5TNC A;  3R1P A;  3PAT A;  2E6W A;  2ZKM X;  4OVN F;  2JC2 A;  2LMU A;  3EK7 A;  3EKH A;  3BUM B;  2KOT A;  1B9A A;  3UO9 A;  4ZCU A;  2KLD A;  4JKT A;  3SG6 A;  3EKJ A; 
#chains in the Genus database with same CATH homology
 2KGB C;  4GAO A;  2KHN A;  1F54 A;  3VRQ A;  2K7D A;  2GV5 A;  1ZFS A;  2FOT A;  1C7V A;  3TDU A;  1MR8 A;  4I5L B;  1CLM A;  3TDI A;  2LP2 A;  2VRG A;  5CPV A;  2MBX A;  1NIW A;  4MN0 A;  5J3X A;  2E30 A;  3ZNI A;  4CFR A;  2KNE A;  2P6B B;  3OX6 A;  1RFJ A;  1XVJ A;  2L4H A;  3FWC A;  4HRE E;  1EXR A;  3EK8 A;  2PVB A;  3WNX B;  5I8N A;  4XJK A;  1LVC D;  3CR5 X;  2HQW A;  2LP3 A;  1FI6 A;  2JUL A;  2ZN9 A;  2NCO A;  5HLO A;  2KQ6 A;  1NCY A;  1QVI Z;  2R2I A;  5CSI A;  4DCK A;  4QJ4 B;  3JVT C;  2JXL A;  1BG1 A;  3PM8 A;  1NX1 A;  2CBL A;  3QRX A;  4YGA A;  3BOW B;  3DVE A;  1YR5 A;  2IS9 A;  2M29 A;  2LVK A;  1QTX A;  1Y0V H;  3BQ3 A;  3BXK A;  2BL0 C;  3I5F B;  3KHE A;  3D0Y A;  3JTD B;  3CS1 A;  3LK0 A;  1S6J A;  1K8U A;  3NSO A;  1CFF A;  3EK4 A;  4HRG A;  1IKU A;  1YRT B;  4C0K A;  1J7Q A;  5IBW A;  2D8N A;  4YBH B;  3O78 A;  4E68 A;  5I2L A;  1M39 A;  2EGD A;  1A29 A;  2TN4 A;  2KSP A;  1NYA A;  2NZ0 A;  1KSO A;  1S3P A;  1S1E A;  4C0J A;  4PE0 A;  3NXA A;  1QIV A;  3I5H C;  4YGC B;  2MLF C;  3I5G B;  4DS7 A;  1M31 A;  3EVR A;  1CLB A;  2OTG C;  1UP5 A;  4GGF C;  1BJF A;  2M3W A;  4I5J A;  2COL B;  3TUY B;  1YUT A;  1DJX A;  1JF0 A;  2JTT A;  1SCM B;  2MLE C;  3SJS A;  2I18 A;  4YGB B;  3NSL A;  3IQQ A;  3I5F C;  2LVI A;  1DTL A;  1DMO A;  3I5I C;  3JTD C;  1BU3 A;  1KFX S;  2PAS A;  3IQO A;  3KO0 A;  2JWW A;  4F0Z B;  2BE6 A;  4FQO A;  1UHN A;  1S5G Y;  1SK6 D;  2FCE A;  1J7R A;  1SL7 A;  1SYM A;  1QLS A;  1IH0 A;  1OQP A;  4OV2 A;  2K2F A;  3D0Y B;  1OZS A;  1W7J B;  4YGE B;  2BE4 A;  1NPQ A;  3TS5 B;  4C0L A;  5KU1 A;  2FCD A;  4PHN A;  3VRR A;  1A2X A;  1ZMZ A;  1XFX O;  1B1G A;  1YX7 A;  1HQV A;  4MVF A;  1ALW A;  4GBA A;  4YGD B;  4A4B A;  1WY9 A;  2LUX A;  3VRP A;  5I2O A;  1OMV A;  1JFK A;  3BYA A;  1KK8 B;  1AHR A;  1XA5 A;  1AVS A;  4ORA B;  2BKH B;  1TCO B;  2QAC A;  3OP0 A;  3OB1 B;  4PE4 A;  4UPG A;  4WQ3 A;  3TUY C;  1S6C A;  2LV7 A;  1J55 A;  2CNP A;  5D7F A;  1J7P A;  1SCM C;  1TNQ A;  2WCF A;  2L50 A;  4JWQ A;  1SR6 C;  1Y6W A;  1DJH A;  3DVM A;  1CM4 A;  1EJ3 A;  1E8A A;  4GUK A;  4MSP A;  4USL A;  2ZN8 A;  2CXJ A;  3KEV A;  1SL8 A;  1M63 B;  5ER5 A;  1S26 D;  2Y1N A;  2HQ8 A;  1IQ5 A;  1EH2 A;  1NP8 A;  1J7O A;  4GFT A;  3BOW A;  1G4Y R;  3TS5 C;  4I5N B;  2B1U A;  4AOM A;  4ETO A;  1WRK A;  5CSN A;  2KBM A;  2SAS A;  2F3Z A;  1FW4 A;  2GGZ A;  2M49 B;  4N1F A;  2JU0 A;  2M0R A;  1KK8 C;  1QX7 A;  1BR1 B;  2JPT A;  2M7N A;  4WRI A;  2EHB A;  1NSH A;  1BMO A;  1BOD A;  3LCP C;  4QJ5 B;  3OX5 A;  1SL9 A;  1C07 A;  4MZJ A;  2F3Y A;  2RGI A;  1LIN A;  1XK4 A;  1QVI Y;  1LA3 A;  3FIA A;  5HKW A;  1NCZ A;  2LVV A;  1CFD A;  2ZRS A;  3K21 A;  1OOJ A;  1XFU O;  2M7L A;  1IRJ A;  1DF0 A;  4U8D A;  2F2O A;  3NSK A;  1J1E A;  4N1G A;  4OCI A;  5DKQ A;  1G8I A;  4GPL B;  5AFP A;  4IL1 A;  5G08 A;  1NUB A;  2M1U A;  5KTY A;  1BLQ A;  1OMD A;  1R6P A;  3IF7 A;  2Y1M A;  3MSE B;  1DJW A;  1KQV A;  3KPX A;  2JTZ A;  2L0P A;  4AQJ A;  2BBN A;  2NCP A;  5HLV A;  1SPY A;  2MJW B;  4MRY A;  2A4J A;  4DUQ A;  3PAL A;  2LAP A;  1SNL A;  4PHJ A;  1S36 A;  4NDB A;  4PCW A;  2F2P A;  5KSZ A;  4OKH A;  2QPT A;  4FTG A;  2AUC A;  2CTN A;  4ICB A;  1H4B A;  2K0J A;  2LMV A;  1C7W A;  1OMR A;  1BF5 A;  4AQI A;  2EC6 B;  2KAX A;  5PAL A;  1EG3 A;  1XFY O;  1V1F A;  3VRO A;  2PAL A;  5DKN A;  2GGM A;  2WCB A;  5JOL A;  1RJV A;  3SIA A;  2LAN A;  1OZO A;  2OS8 B;  4YRU A;  1TN4 A;  3DF0 A;  1WLM A;  2Q91 A;  4CFQ A;  1OE9 B;  2LCP A;  1CDP A;  1IQ3 A;  1DF0 B;  1SRA A;  3TZ1 A;  1KFU S;  3CZT X;  1PVA A;  4MZK A;  1CDM A;  1LXF C;  1JWD A;  1K9U A;  2JQ6 A;  2WC8 A;  1WRL A;  1KCY A;  2HPS A;  4PDZ A;  2ZNE A;  1PUL A;  2F8P A;  1K93 D;  1M45 A;  1PSR A;  1K94 A;  1NX3 A;  1L2O B;  3GOF A;  4DRW A;  2O60 A;  4MZL A;  2H61 A;  3KF9 A;  3M0W A;  2EC6 C;  5JJG A;  1AK8 A;  1K9K A;  1WLZ A;  3DVJ A;  1B7T Z;  2ZND A;  2ZFD A;  1XK4 C;  1CKK A;  2WOR A;  1GJY A;  2F33 A;  1H8B A;  3I5G C;  4PE1 A;  1QV1 A;  1XYD A;  2LMT A;  2KBI A;  4ORB B;  1QAT A;  4YI9 A;  1JBA A;  2MRD A;  3OHM B;  1JFJ A;  3LLE A;  4A4C A;  3PLF B;  4DIR A;  1A03 A;  4BY5 A;  1TCF A;  1MQ1 A;  1TOP A;  1AUI B;  3GK4 X;  4PE7 A;  1CFP A;  1GGW A;  1FI5 A;  5CSF A;  1XFZ O;  3DF0 B;  5I2Q A;  5AXI A;  5B8I B;  1RRO A;  1KK7 Z;  1FBV A;  2PMY A;  1LA0 A;  1MHO A;  2BKI B;  2L2E A;  3LL8 B;  4PHK A;  3O2P A;  2KYF A;  1NWD A;  2LC5 A;  3RM1 A;  2M97 A;  1YUS A;  4MRX A;  1W7I B;  1K2H A;  4P2Y B;  1SBJ A;  2JXC A;  4D1E A;  3EVV A;  3BUX B;  4P5O E;  2WND A;  2L98 A;  3FS7 A;  3SG7 A;  3CR4 X;  4ORC B;  1JF2 A;  2NXQ A;  4Q04 A;  1CMG A;  3E3R A;  2LHL A;  2KI4 B;  1TNX A;  3WHU B;  2NLN A;  1MXE A;  1SMG A;  1F71 A;  1MF8 B;  1K9P A;  5HKY A;  2MA2 A;  1CLL A;  1Y1X A;  1TTX A;  2I2R E;  2K8M B;  2MHH A;  1Q80 A;  1JUO A;  2LVJ A;  3AAK A;  2KQY A;  2OPO A;  3CLN A;  3DVK A;  3EVU A;  1IJ6 A;  2JRF A;  1TNW A;  1U5I B;  4WQ2 A;  1WRZ A;  1B4C A;  1ZUZ A;  1B8C A;  2AAO A;  1CNP A;  2KFH A;  2Y5I A;  3JVT B;  1RWY A;  3HCM A;  1TRF A;  1ZAC A;  1CTR A;  2O5G A;  3A4U B;  1QS7 A;  3O4Y A;  3TDZ A;  1X02 A;  2BL0 B;  3CWG A;  1A75 A;  3SG4 A;  1Y1A A;  1CMF A;  4I5K A;  1UHH A;  1VRK A;  1F4Q A;  5ER4 X;  5AAN A;  1CDL A;  1YRU B;  2K7B A;  2KI6 C;  2PRU A;  1QAS A;  4PHM A;  1DT7 B;  1PSB A;  2BBM A;  2H61 C;  2K7C A;  1QXP A;  2KI6 D;  1DJI A;  3DD4 A;  2K7O A;  1UUR A;  1GQM A;  2KI4 C;  1CDN A;  1IG5 A;  3RLZ A;  1NCX A;  1RTP 1;  2KAY A;  1K96 A;  4M2Q A;  2JNX A;  2KFG A;  3SG5 A;  1MUX A;  1DJY A;  1OSA A;  1N2D A;  3I5H B;  1YVL A;  2G9B A;  3O6B A;  4HSZ A;  2KAV A;  1CM1 A;  1PRW A;  1EL4 A;  2OTG B;  3GK1 A;  4CID A;  3BUW B;  2BCX A;  1YUU A;  1D1O A;  4MBE A;  3VGO A;  3NSI A;  2KDH A;  2JT3 A;  2AMI A;  1ODB A;  2LLU A;  3AKB A;  1BOC A;  4CLN A;  2JOJ A;  1AJ4 A;  1NX2 A;  1KQM B;  2JT0 A;  2G2B A;  1AP4 A;  2L51 A;  1BR4 B;  3I5I B;  1V1G A;  3GK2 A;  2JNF A;  2DOQ A;  1L7Z A;  3A8R A;  1XFW O;  2HF5 A;  1YX8 A;  2JT8 A;  1N65 A;  5HYD A;  2MAZ A;  1UHK A;  5FYX A;  4NQG A;  1ALV A;  1PK0 D;  4OR9 B;  1B7T Y;  2SCP A;  2M8U A;  1DGV A;  1A75 B;  2HET A;  3PFV A;  4NDD A;  4QJ3 B;  3CGA A;  2LM5 A;  5AEQ A;  4N5X A;  3LK1 A;  3SG2 A;  4ZCV A;  1A4P A;  1RK9 A;  3PSR A;  2KFF A;  1IJ5 A;  1LKJ A;  1KSM A;  3H4S E;  2WOS A;  2K2A A;  2FJU B;  3WXA A;  2L4I A;  2LE9 B;  3SG3 A;  2I94 A;  2JZI A;  3FWB A;  3SIB A;  1MXL C;  1SKT A;  1F4O A;  1SY9 A;  1KWO B;  1YVH A;  1B47 A;  1SR6 B;  1KK7 Y;  1R2U A;  3C1V A;  1KQM C;  3OB2 B;  3CTN A;  4XJK B;  2LLS A;  3HX4 A;  1N0Y A;  1K95 A;  1SW8 A;  4NDC A;  2OS8 C;  5HKZ A;  1DVI A;  2ZRT A;  5DKR A;  5AER A;  1XFV O;  4GNK B;  5F6T A;  1U5I A;  1UUS A;  1UHJ A;  1S6I A;  1SCV A;  4BY4 A;  3BUN B;  1PAL A;  1J1D A;  1NX0 A;  1MWN A;  2H2K A;  1EG4 A;  2CCM A;  5BPJ A;  1G33 A;  1REC A;  1WDC B;  1YTZ C;  2M1K B;  1QV0 A;  5D69 A;  4M2O A;  1Y1U A;  4CPV A;  3PN7 B;  2Q4U A;  4JQ0 D;  1QJT A;  2KGR A;  4L9M A;  3CR2 A;  1AJ5 A;  1TIZ A;  1L2O C;  5GQQ C;  2ISD A;  2PSR A;  1F8H A;  1JSA A;  4MEW A;  1UHI A;  2I7A A;  1S5G Z;  2LHI A;  4JPZ B;  2LNK A;  1DJG A;  4PAL A;  4MLW A;  1PVB A;  1B8L A;  4YI8 A;  3AAJ A;  1XO5 A;  3VRN A;  1KWO C;  1M46 A;  2BCB A;  2LUC A;  1F70 A;  4GGN A;  1JC2 A;  1DGU A;  1QLK A;  1F55 A;  5CSJ A;  2V53 A;  1B8R A;  2KYC A;  1GGZ A;  1HT9 A;  4TNC A;  1QX5 B;  1TNP A;  2K61 A;  3ZWH A;  1DJZ A;  3F45 A;  1FF1 A;  1CFC A;  4GGF A;  1QX2 A;  1FPW A;  2CT9 A;  1ZOT B;  2BCA A;  4M2P A;  2BEC A;  3BUO B;  3WHT B;  1WDC C;  2M9G A;  2LLT A;  1QIW A;  1YUR A;  2Y4Q A;  1KFU L;  1UWO A;  3ICB A;  2WCE A;  3PN7 C;  1IGV A;  4R1E A;  3D10 A;  4HRH A;  4XYN A;  1BT6 A;  1IWQ A;  1CB1 A;  1K90 D;  1KFX L;  5K89 A;  3AKA A;  2L5X B;  5TNC A;  3PAT A;  2E6W A;  2ZKM X;  4OVN F;  2JC2 A;  2LMU A;  3EK7 A;  3EKH A;  3BUM B;  2KOT A;  1B9A A;  4ZCU A;  3SG6 A;  3EKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...