3L47A

Crystal structure of the anopheles gambiae odorant-binding protein 22a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title The Crystal Structures of an Anopheles gambiae Odorant-binding Protein AgamOBP22a and complexes with bound Odorants
rcsb
source organism Anopheles gambiae
total genus 35
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l47A00
2P70A 3CDNA 3OGNA 4F7FA 3DZTA 1TUJA 2FJYA 2QEVA 1XFRA 1OOIX 3R1VA 3B86A 2H8VA 3S0BA 3CZ2A 1OOGA 3L4LA 1C3ZA 1OOHA 3CZ1A 5EL2A 3DY9A 2WCJA 3B7AA 4OZDA 3V2LA 3VB1A 2PQLA 2GTEA 2ERBA 3R72A 4JD9A 2JPOA 1OW4A 3D77A 1T14A 3Q8IA 3RZSA 2QEOA 1LS8A 3NHIA 3L4AA 3D73A 1DQEA 4INWA 1C3YA 3B6XA 3S0GA 2QEHA 2QEBA 3L47A 3DYEA 1TWOA 3R1OA 2WCMA 3FE8A 2WCKA 3S0FA 4PT1A 4INXA 1OOFA 3NGVA 3CZ0A 3PJIA 3S0DA 2WC5A 3B87A 3S0AA 3D74A 3S0EA 3NHTA 3QMEA 3FE9A 3BFHA 2QDIA 2KPHA 1ORGA 3D75A 2WCHA 3CYZA 2P71A 2WC6A 3BJHA 3BFAA 2L2CA 3D78A 1GM0A 3BFBA 3N7HA 3FE6A 2WCLA 1QWVA 4FQTA 3D76A 3DXLA 3CABA 3K1EA 3B88A 5DICA 1P28A 3R1PA
chains in the Genus database with same CATH superfamily
5B8IB 3BUMB 1OMVA 1PK0D 4F0ZB 1TOPA 3SG6A 4ZCUA 2LLUA 2ISDA 3TDIA 4F7FA 1GJYA 2JU0A 4TNCA 5JOLA 4PE1A 1B47A 1XFRA 1YURA 1JF0A 3WHTB 2KLEA 2LVJA 3TS5C 4ETOA 4YGBB 2F3ZA 4GUKA 1JSAA 1MWNA 2LVIA 3TDZA 3SIBA 4IL1A 1F4QA 2WC8A 3EKHA 3I5FB 5F6TA 1PSRA 1M31A 2HQWA 2SCPA 4MEWA 5EL2A 1CFFA 3DY9A 2WCJA 2F3YA 1CDMA 4YI8A 2BL0B 2KAYA 2PALA 1AHRA 2NCOA 3PFVA 5HYDA 2NXQA 4U8DA 1CFPA 1NX3A 4NQGA 1IGVA 1XFWO 3V2LA 2KI6D 2WORA 1KQMC 3S0GA 1ALWA 1AJ5A 1DEKA 1S3PA 2GTEA 3EVRA 2BE4A 1EG3A 2I94A 3CR4X 3F45A 5HKZA 2JULA 2M49B 1V1FA 2CNPA 4PE4A 2ZN9A 5I2OA 2PASA 2PRUA 4QJ3B 1MQ1A 4N5XA 3GK1A 2K7BA 1T14A 2Q91A 1UHHA 2JC2A 3OX6A 4PCWA 1BOCA 1S6IA 1CDNA 1KSOA 1PVBA 2LVKA 2K61A 2KFGA 2BAPA 5HKYA 1LS8A 3VGOA 1EJ3A 3DVMA 3NHIA 1SMGA 3CR5X 2K2FA 4PHJA 1DQEA 1NWDA 3IVTA 3JTDB 1DJWA 4MRXA 4YGCB 1L2OB 1H8BA 2Y1NA 4IJ7A 1K96A 1W9ZA 2OS8B 3KPXA 2F8PA 1S5GY 5D3OA 1BJFA 2KQ6A 2CT9A 3BUNB 2KYCA 5HLOA 3M0WA 3ICBA 4WQ2A 1DVIA 1WRZA 2WNDA 3NXAA 4C0LA 3I5FC 1J7OA 1DELA 3PSRA 3LLEA 5ER4X 3L47A 1B7TY 1DJXA 3DYEA 1QVIY 2F33A 2BL0C 2BKHB 2JQ6A 1W7IB 1TWOA 2BCXA 3AAJA 3BUWB 3FE8A 4NDDA 2WCKA 5J3XA 3SS4A 4CFRA 2L50A 2M9GA 3SIAA 2OPOA 1PRWA 2CTNA 2M7NA 3KHEA 1K2HA 4ICBA 5D7FA 1SKTA 1VRKA 3AKBA 1TCOB 4E68A 1JUOA 1G8IA 1NUBA 4YBHB 3DVEA 5CSIA 5ER5A 1CLBA 5HL1A 3S0EA 3SG5A 1CB1A 2JXLA 3QMEA 1OMRA 4PHNA 5CPVA 1KQVA 1SR6B 2BNXA 3TUYC 1C7VA 2K0JA 1Q80A 2KGRA 1QS7A 2L2CA 1BODA 1GGWA 2KYFA 3CWGA 1TCFA 3FE6A 4FQOA 3D76A 4N1FA 3K1EA 3QRXA 2M0RA 3GK4X 3D10A 2KGBC 2ZRTA 1ZMZA 1L2OC 1S5GZ 3TS5B 3VRPA 5AFPA 1FF1A 4AQJA 2KBIA 1TNPA 3TZ1A 2NCPA 3CR2A 2FCEA 1CNPA 1B7TZ 1OMDA 1QVIZ 4ORAB 4JPZB 1KFUS 3OGNA 1TN4A 1F54A 4QJ4B 1M39A 1FPWA 1CM1A 1DJHA 1TUJA 2MJWB 2QEVA 4YI9A 1MXEA 5FI7A 1OOIX 2F2OA 3R1VA 3B86A 1M63B 4GBAA 1XFUO 3S0BA 2QPTA 1KFXS 1NSHA 2RGIA 2HF5A 1SY9A 2KFHA 3KEVA 3OX5A 1SCVA 4WRIA 4OCIA 2MLFC 1B4CA 2NLNA 3VRQA 1Y1UA 4Q04A 3BQ3A 1CMFA 1BT6A 4PALA 1XYDA 1A75B 3LCPC 1SCMB 1CTRA 5TNCA 1UURA 1DJYA 2BBNA 1CFCA 1QXPA 2KOTA 2MHHA 3B7AA 2KAVA 2PMYA 1TRFA 1NX0A 2K2AA 5D69A 2PSRA 5IBWA 3SS3A 3AKAA 4OZDA 4DRWA 2BCBA 1IKUA 2JRFA 2M97A 4I5JA 3I5IC 2PQLA 4N1GA 1NX2A 1FI6A 4DIRA 1YUUA 2L5XB 2HPSA 5FYXA 1QJTA 3RLZA 3R72A 4JQ0D 2G9BA 2HETA 1K90D 1NP8A 1SBJA 3PN7B 4PHMA 5CSFA 1OQPA 4JD9A 2JNFA 2LANA 3D77A 2L5YA 2Y1MA 2L4HA 1UUSA 4USLA 3Q8IA 4KYNA 4NDCA 1CDLA 2LHIA 3RZSA 1JFKA 4ZCVA 2KAXA 1SK6D 2WCBA 1F70A 3SG2A 2GV5A 4XYNA 2LP2A 1BMOA 3L4AA 1AVSA 2WOSA 3D73A 1NX1A 1DGUA 1QX5B 2LLTA 4GNKB 2JPTA 4M2PA 1FW4A 1EL4A 1PALA 1OSAA 1IQ5A 2G2BA 1OOJA 4INWA 5I94A 2LV7A 2KDHA 2QEHA 2ZFDA 3EVVA 4P2YB 1CM4A 1SCMC 3LK1A 1EXRA 3SG7A 4JWQA 3HX4A 4PE7A 3R1OA 4DS7A 2WCMA 5FI6A 1IG5A 1SRAA 2M29A 3TUYB 2R2IA 1SYMA 1JFJA 5KTYA 3EK7A 3NGVA 5AERA 3PATA 2M8UA 1RECA 1KSMA 3PJIA 2LMUA 2FJUB 2OTGC 2WC5A 3B87A 2AUCA 3O4YA 3S0AA 3VRNA 4PE0A 1LA3A 3NHTA 1IJ5A 1TTXA 1CLMA 1UHIA 2QDIA 1NIWA 3PN7C 3CZTX 1KK7Y 1XA5A 2KI4B 1IRJA 1ORGA 2KPHA 3CYZA 1U5IA 2EGDA 2ZKMX 3BOWA 2LUCA 1C07A 1J7RA 1WY9A 1K9KA 3BFAA 1AK8A 1QX7A 1UWOA 2O5GA 3I5HB 1A75A 3D78A 3N7HA 1JC2A 1MUXA 1YVHA 4A4CA 5CSJA 1UP5A 3DXLA 1J1DA 2K8MB 1D1OA 3BYAA 2COLB 3OB1B 4GGNA 3EK8A 3TDUA 1LXFC 3B88A 4XJKA 1YVLA 1ALVA 1IIOA 3R1PA 2BBMA 2K60A 1YTZC 2A4JA 2JT0A 2P70A 2LVVA 1CDPA 1A03A 1KFUL 3AAKA 3DZTA 1AJ4A 1J7PA 4DCKA 4ORCB 1HT9A 2LUXA 2M3WA 1JBAA 2H8VA 3EK4A 1DF0A 2D8NA 1OOGA 4HRHA 4M2OA 3I5IB 1K95A 4MBEA 1SL7A 1C3ZA 1OOHA 3OB2B 2CXJA 5PALA 4OR9B 3FWCA 2ZNEA 3CZ1A 3DF0A 1M45A 1KK7Z 1NCXA 2LE9B 1B8RA 2KI6C 2M1KB 3DVJA 5HLVA 1NCYA 1UHNA 2FCDA 2JWWA 2F2PA 3CTNA 4I5KA 2KI4C 1S6CA 2KBMA 2NZ0A 3EVUA 1DC1A 4JKTA 2BECA 2CBLA 2DOQA 2P6BB 2Y5IA 3OP0A 1RWYA 2BCAA 1C7WA 3VB1A 5DKRA 1QX2A 3I5HC 4MZLA 2LM5A 2E30A 2AAOA 2LC5A 1K93D 3NSIA 4WQ3A 3OHMB 1ZUZA 3WXAA 2ERBA 2Y4QA 1IH0A 4FTGA 2L51A 1MF8B 1JWDA 2M1UA 2JPOA 2MAZA 1OW4A 1QV1A 1U5IB 2LNKA 3BOWB 4A4BA 3IQQA 2L98A 4GPLB 3WNXB 1RFJA 2SASA 1ODBA 1S36A 1SPYA 2QEOA 4QJ5B 4CPVA 2TN4A 1L7ZA 1M46A 1MR8A 2I2RE 2HQ8A 3S0FA 4L9MA 5JJGA 3CS1A 5AEQA 1F55A 3FWBA 1F4OA 4XJKB 1LA0A 2H2KA 3JVTC 4MZJA 2MLEC 1C3YA 4OKHA 2MA2A 2OTGB 3NSLA 3ZWHA 1KWOC 2LAPA 4PDZA 1DJIA 1B9AA 1QV0A 1S26D 1WRLA 3D0YA 1HQVA 2GGZA 4AQIA 1QATA 3A4UB 1DMOA 2QEBA 3BXKA 1V1GA 3PLFB 5K89A 1WDCB 1XO5A 3NSOA 1KCYA 1J7QA 2EHBA 1OZOA 4PT1A 1TNWA 1OOFA 5CSNA 1DF0B 3CZ0A 3IF7A 3LK0A 2JT8A 3S0DA 2JTZA 1CLLA 1WLZA 1YUSA 2B1UA 3D74A 3KF9A 1RTP1 1ZOTB 2JNXA 4YRUA 1BLQA 1Y6WA 3DF0B 1RJVA 2O60A 1YR5A 2L2EA 3BFHA 3ZNIA 4GGFC 3EG5B 2ZNDA 1WRKA 1F8HA 2H61C 4P5OE 4PHKA 3SJSA 1LVCD 2P71A 1QTXA 1N65A 2E6WA 2PYQA 2WC6A 2LLSA 3GOFA 4GAOA 5DKNA 1AP4A 1J55A 1B8CA 3BUXB 1DTLA 3CLNA 3SG3A 1AUIB 1G33A 2WCLA 1QWVA 1SL8A 2LHLA 2LMTA 4HRGA 4MRYA 1BR4B 5GQQC 4I5NB 5BPJA 1EG4A 1PULA 5DICA 1B1GA 2K7DA 1SSEB 1IQ3A 1H4BA 4GFTA 4DUQA 3FS7A 1YUTA 2AMIA 1RK9A 4MZKA 5HKWA 4CLNA 1R2UA 2BE6A 1DJZA 5I2QA 3CDNA 1Z4HA 1NPQA 2LCPA 4GGFA 3I5GC 1N2DA 1E8AA 2FJYA 2H61A 2IS9A 1MHOA 3CGAA 1BG1A 1WDCC 4CFQA 1IWQA 1UHJA 1X02A 1FBVA 3BUOB 3CZ2A 1W7JB 1FI5A 1JF2A 2EC6B 2KQYA 4C0JA 1KK8B 2L0PA 3L4LA 1DGVA 1SNLA 2VRGA 3D0YB 3EKJA 2KNEA 3A8RA 1BR1B 1K9UA 2MBXA 3UNWA 2K7OA 3MSEB 4D1EA 1GQMA 1TIZA 2KHNA 1Y1AA 3WHUB 3DD4A 3KO0A 5I2LA 2FOTA 3O2PA 1A4PA 4BY5A 1TUZA 5AANA 1WLMA 2JXCA 2JZIA 4YGDB 5KU1A 1CMGA 1BU3A 4C0KA 1LKJA 3JVTB 1CKKA 1B8LA 1QASA 1KFXL 1YRUB 4AOMA 1KWOB 1S6JA 1BF5A 5AXIA 3SG4A 1OE9B 3HCMA 2GGMA 5DKQA 4M2QA 2KSPA 2ZN8A 4NDBA 1G4YR 3RM1A 2JT3A 1IJ6A 1PVAA 3PM8A 4MSPA 4HSZA 2PVBA 3NSKA 3O4XA 2WCEA 1DT7B 1SW8A 2LP3A 2ZRSA 1ZACA 3IQOA 1MXLC 1QIVA 2WCFA 3B6XA 2EC6C 3H4SE 5FI2A 1KK8C 2JOJA 1CFDA 2KFFA 4R1EA 4YGAA 1TNQA 1K94A 1F71A 2Q4UA 4UPGA 1K8UA 1A2XA 1R6PA 3K21A 1Y1XA 2BKIB 1QLKA 1N0YA 2I18A 2KLDA 1XK4C 3GK2A 1OZSA 1A29A 2JTTA 3JTDC 3O78A 4INXA 1XFXO 3VROA 3VRRA 3LL8B 3PALA 3E3RA 3SS5A 1J1EA 1Y0VH 2L4IA 1XFZO 2QACA 2OS8C 3O6BA 2V53A 1XFVO 5I8NA 4MLWA 4YGEB 3OBVA 4MVFA 2I7AA 1GGZA 1K9PA 1NCZA 3FE9A 4BY4A 1XVJA 2LMVA 3FIAA 5KSZA 3UO9A 1QIWA 2WCHA 3D75A 1YX7A 2MRDA 1ZFSA 4OVNF 2YGUA 2K7CA 3BJHA 1S1EA 5G08A 1KQMB 1GM0A 3PM2A 3BFBA 1DJGA 1TNXA 3I5GB 1Z2CB 1PSBA 3C1VA 4FQTA 1YX8A 1RROA 2M7LA 1XK4A 3CABA 4OV2A 1NYAA 4I5LB 4CIDA 1SL9A 1YRTB 1XFYO 2CCMA 3DVKA 1EH2A 4HREE 1P28A 4MN0A 1SR6C 1QLSA 1LINA 1UHKA 4ORBB
chains in the Genus database with same CATH topology
2P70A 3CDNA 3OGNA 4F7FA 3DZTA 1TUJA 2FJYA 2QEVA 1XFRA 1OOIX 3R1VA 3B86A 2H8VA 3S0BA 3CZ2A 1OOGA 3L4LA 1C3ZA 1OOHA 3CZ1A 5EL2A 3DY9A 2WCJA 3B7AA 4OZDA 3V2LA 3VB1A 2PQLA 2GTEA 2ERBA 3R72A 4JD9A 2JPOA 1OW4A 3D77A 1T14A 3Q8IA 3RZSA 2QEOA 1LS8A 3NHIA 3L4AA 3D73A 1DQEA 4INWA 1C3YA 3B6XA 3S0GA 2QEHA 2QEBA 3L47A 3DYEA 1TWOA 3R1OA 2WCMA 3FE8A 2WCKA 3S0FA 4PT1A 4INXA 1OOFA 3NGVA 3CZ0A 3PJIA 3S0DA 2WC5A 3B87A 3S0AA 3D74A 3S0EA 3NHTA 3QMEA 3FE9A 3BFHA 2QDIA 2KPHA 1ORGA 3D75A 2WCHA 3CYZA 2P71A 2WC6A 3BJHA 3BFAA 2L2CA 3D78A 1GM0A 3BFBA 3N7HA 3FE6A 2WCLA 1QWVA 4FQTA 3D76A 3DXLA 3CABA 3K1EA 3B88A 5DICA 1P28A 3R1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P70 A;  3CDN A;  3OGN A;  4F7F A;  3DZT A;  1TUJ A;  2FJY A;  2QEV A;  1XFR A;  1OOI X;  3R1V A;  3B86 A;  2H8V A;  3S0B A;  3CZ2 A;  1OOG A;  3L4L A;  1C3Z A;  1OOH A;  3CZ1 A;  5EL2 A;  3DY9 A;  2WCJ A;  3B7A A;  4OZD A;  3V2L A;  3VB1 A;  2PQL A;  2GTE A;  2ERB A;  3R72 A;  4JD9 A;  2JPO A;  1OW4 A;  3D77 A;  1T14 A;  3Q8I A;  3RZS A;  2QEO A;  1LS8 A;  3NHI A;  3L4A A;  3D73 A;  1DQE A;  4INW A;  1C3Y A;  3B6X A;  3S0G A;  2QEH A;  2QEB A;  3L47 A;  3DYE A;  1TWO A;  3R1O A;  2WCM A;  3FE8 A;  2WCK A;  3S0F A;  4PT1 A;  4INX A;  1OOF A;  3NGV A;  3CZ0 A;  3PJI A;  3S0D A;  2WC5 A;  3B87 A;  3S0A A;  3D74 A;  3S0E A;  3NHT A;  3QME A;  3FE9 A;  3BFH A;  2QDI A;  2KPH A;  1ORG A;  3D75 A;  2WCH A;  3CYZ A;  2P71 A;  2WC6 A;  3BJH A;  3BFA A;  2L2C A;  3D78 A;  1GM0 A;  3BFB A;  3N7H A;  3FE6 A;  2WCL A;  1QWV A;  4FQT A;  3D76 A;  3DXL A;  3CAB A;  3K1E A;  3B88 A;  5DIC A;  1P28 A;  3R1P A; 
#chains in the Genus database with same CATH topology
 5B8I B;  3BUM B;  1OMV A;  1PK0 D;  4F0Z B;  1TOP A;  3SG6 A;  4ZCU A;  2LLU A;  2ISD A;  3TDI A;  4F7F A;  1GJY A;  2JU0 A;  4TNC A;  5JOL A;  4PE1 A;  1B47 A;  1XFR A;  1YUR A;  1JF0 A;  3WHT B;  2KLE A;  2LVJ A;  3TS5 C;  4ETO A;  4YGB B;  2F3Z A;  4GUK A;  1JSA A;  1MWN A;  2LVI A;  3TDZ A;  3SIB A;  4IL1 A;  1F4Q A;  2WC8 A;  3EKH A;  3I5F B;  5F6T A;  1PSR A;  1M31 A;  2HQW A;  2SCP A;  4MEW A;  5EL2 A;  1CFF A;  3DY9 A;  2WCJ A;  2F3Y A;  1CDM A;  4YI8 A;  2BL0 B;  2KAY A;  2PAL A;  1AHR A;  2NCO A;  3PFV A;  5HYD A;  2NXQ A;  4U8D A;  1CFP A;  1NX3 A;  4NQG A;  1IGV A;  1XFW O;  3V2L A;  2KI6 D;  2WOR A;  1KQM C;  3S0G A;  1ALW A;  1AJ5 A;  1DEK A;  1S3P A;  2GTE A;  3EVR A;  2BE4 A;  1EG3 A;  2I94 A;  3CR4 X;  3F45 A;  5HKZ A;  2JUL A;  2M49 B;  1V1F A;  2CNP A;  4PE4 A;  2ZN9 A;  5I2O A;  2PAS A;  2PRU A;  4QJ3 B;  1MQ1 A;  4N5X A;  3GK1 A;  2K7B A;  1T14 A;  2Q91 A;  1UHH A;  2JC2 A;  3OX6 A;  4PCW A;  1BOC A;  1S6I A;  1CDN A;  1KSO A;  1PVB A;  2LVK A;  2K61 A;  2KFG A;  2BAP A;  5HKY A;  1LS8 A;  3VGO A;  1EJ3 A;  3DVM A;  3NHI A;  1SMG A;  3CR5 X;  2K2F A;  4PHJ A;  1DQE A;  1NWD A;  3IVT A;  3JTD B;  1DJW A;  4MRX A;  4YGC B;  1L2O B;  1H8B A;  2Y1N A;  4IJ7 A;  1K96 A;  1W9Z A;  2OS8 B;  3KPX A;  2F8P A;  1S5G Y;  5D3O A;  1BJF A;  2KQ6 A;  2CT9 A;  3BUN B;  2KYC A;  5HLO A;  3M0W A;  3ICB A;  4WQ2 A;  1DVI A;  1WRZ A;  2WND A;  3NXA A;  4C0L A;  3I5F C;  1J7O A;  1DEL A;  3PSR A;  3LLE A;  5ER4 X;  3L47 A;  1B7T Y;  1DJX A;  3DYE A;  1QVI Y;  2F33 A;  2BL0 C;  2BKH B;  2JQ6 A;  1W7I B;  1TWO A;  2BCX A;  3AAJ A;  3BUW B;  3FE8 A;  4NDD A;  2WCK A;  5J3X A;  3SS4 A;  4CFR A;  2L50 A;  2M9G A;  3SIA A;  2OPO A;  1PRW A;  2CTN A;  2M7N A;  3KHE A;  1K2H A;  4ICB A;  5D7F A;  1SKT A;  1VRK A;  3AKB A;  1TCO B;  4E68 A;  1JUO A;  1G8I A;  1NUB A;  4YBH B;  3DVE A;  5CSI A;  5ER5 A;  1CLB A;  5HL1 A;  3S0E A;  3SG5 A;  1CB1 A;  2JXL A;  3QME A;  1OMR A;  4PHN A;  5CPV A;  1KQV A;  1SR6 B;  2BNX A;  3TUY C;  1C7V A;  2K0J A;  1Q80 A;  2KGR A;  1QS7 A;  2L2C A;  1BOD A;  1GGW A;  2KYF A;  3CWG A;  1TCF A;  3FE6 A;  4FQO A;  3D76 A;  4N1F A;  3K1E A;  3QRX A;  2M0R A;  3GK4 X;  3D10 A;  2KGB C;  2ZRT A;  1ZMZ A;  1L2O C;  1S5G Z;  3TS5 B;  3VRP A;  5AFP A;  1FF1 A;  4AQJ A;  2KBI A;  1TNP A;  3TZ1 A;  2NCP A;  3CR2 A;  2FCE A;  1CNP A;  1B7T Z;  1OMD A;  1QVI Z;  4ORA B;  4JPZ B;  1KFU S;  3OGN A;  1TN4 A;  1F54 A;  4QJ4 B;  1M39 A;  1FPW A;  1CM1 A;  1DJH A;  1TUJ A;  2MJW B;  2QEV A;  4YI9 A;  1MXE A;  5FI7 A;  1OOI X;  2F2O A;  3R1V A;  3B86 A;  1M63 B;  4GBA A;  1XFU O;  3S0B A;  2QPT A;  1KFX S;  1NSH A;  2RGI A;  2HF5 A;  1SY9 A;  2KFH A;  3KEV A;  3OX5 A;  1SCV A;  4WRI A;  4OCI A;  2MLF C;  1B4C A;  2NLN A;  3VRQ A;  1Y1U A;  4Q04 A;  3BQ3 A;  1CMF A;  1BT6 A;  4PAL A;  1XYD A;  1A75 B;  3LCP C;  1SCM B;  1CTR A;  5TNC A;  1UUR A;  1DJY A;  2BBN A;  1CFC A;  1QXP A;  2KOT A;  2MHH A;  3B7A A;  2KAV A;  2PMY A;  1TRF A;  1NX0 A;  2K2A A;  5D69 A;  2PSR A;  5IBW A;  3SS3 A;  3AKA A;  4OZD A;  4DRW A;  2BCB A;  1IKU A;  2JRF A;  2M97 A;  4I5J A;  3I5I C;  2PQL A;  4N1G A;  1NX2 A;  1FI6 A;  4DIR A;  1YUU A;  2L5X B;  2HPS A;  5FYX A;  1QJT A;  3RLZ A;  3R72 A;  4JQ0 D;  2G9B A;  2HET A;  1K90 D;  1NP8 A;  1SBJ A;  3PN7 B;  4PHM A;  5CSF A;  1OQP A;  4JD9 A;  2JNF A;  2LAN A;  3D77 A;  2L5Y A;  2Y1M A;  2L4H A;  1UUS A;  4USL A;  3Q8I A;  4KYN A;  4NDC A;  1CDL A;  2LHI A;  3RZS A;  1JFK A;  4ZCV A;  2KAX A;  1SK6 D;  2WCB A;  1F70 A;  3SG2 A;  2GV5 A;  4XYN A;  2LP2 A;  1BMO A;  3L4A A;  1AVS A;  2WOS A;  3D73 A;  1NX1 A;  1DGU A;  1QX5 B;  2LLT A;  4GNK B;  2JPT A;  4M2P A;  1FW4 A;  1EL4 A;  1PAL A;  1OSA A;  1IQ5 A;  2G2B A;  1OOJ A;  4INW A;  5I94 A;  2LV7 A;  2KDH A;  2QEH A;  2ZFD A;  3EVV A;  4P2Y B;  1CM4 A;  1SCM C;  3LK1 A;  1EXR A;  3SG7 A;  4JWQ A;  3HX4 A;  4PE7 A;  3R1O A;  4DS7 A;  2WCM A;  5FI6 A;  1IG5 A;  1SRA A;  2M29 A;  3TUY B;  2R2I A;  1SYM A;  1JFJ A;  5KTY A;  3EK7 A;  3NGV A;  5AER A;  3PAT A;  2M8U A;  1REC A;  1KSM A;  3PJI A;  2LMU A;  2FJU B;  2OTG C;  2WC5 A;  3B87 A;  2AUC A;  3O4Y A;  3S0A A;  3VRN A;  4PE0 A;  1LA3 A;  3NHT A;  1IJ5 A;  1TTX A;  1CLM A;  1UHI A;  2QDI A;  1NIW A;  3PN7 C;  3CZT X;  1KK7 Y;  1XA5 A;  2KI4 B;  1IRJ A;  1ORG A;  2KPH A;  3CYZ A;  1U5I A;  2EGD A;  2ZKM X;  3BOW A;  2LUC A;  1C07 A;  1J7R A;  1WY9 A;  1K9K A;  3BFA A;  1AK8 A;  1QX7 A;  1UWO A;  2O5G A;  3I5H B;  1A75 A;  3D78 A;  3N7H A;  1JC2 A;  1MUX A;  1YVH A;  4A4C A;  5CSJ A;  1UP5 A;  3DXL A;  1J1D A;  2K8M B;  1D1O A;  3BYA A;  2COL B;  3OB1 B;  4GGN A;  3EK8 A;  3TDU A;  1LXF C;  3B88 A;  4XJK A;  1YVL A;  1ALV A;  1IIO A;  3R1P A;  2BBM A;  2K60 A;  1YTZ C;  2A4J A;  2JT0 A;  2P70 A;  2LVV A;  1CDP A;  1A03 A;  1KFU L;  3AAK A;  3DZT A;  1AJ4 A;  1J7P A;  4DCK A;  4ORC B;  1HT9 A;  2LUX A;  2M3W A;  1JBA A;  2H8V A;  3EK4 A;  1DF0 A;  2D8N A;  1OOG A;  4HRH A;  4M2O A;  3I5I B;  1K95 A;  4MBE A;  1SL7 A;  1C3Z A;  1OOH A;  3OB2 B;  2CXJ A;  5PAL A;  4OR9 B;  3FWC A;  2ZNE A;  3CZ1 A;  3DF0 A;  1M45 A;  1KK7 Z;  1NCX A;  2LE9 B;  1B8R A;  2KI6 C;  2M1K B;  3DVJ A;  5HLV A;  1NCY A;  1UHN A;  2FCD A;  2JWW A;  2F2P A;  3CTN A;  4I5K A;  2KI4 C;  1S6C A;  2KBM A;  2NZ0 A;  3EVU A;  1DC1 A;  4JKT A;  2BEC A;  2CBL A;  2DOQ A;  2P6B B;  2Y5I A;  3OP0 A;  1RWY A;  2BCA A;  1C7W A;  3VB1 A;  5DKR A;  1QX2 A;  3I5H C;  4MZL A;  2LM5 A;  2E30 A;  2AAO A;  2LC5 A;  1K93 D;  3NSI A;  4WQ3 A;  3OHM B;  1ZUZ A;  3WXA A;  2ERB A;  2Y4Q A;  1IH0 A;  4FTG A;  2L51 A;  1MF8 B;  1JWD A;  2M1U A;  2JPO A;  2MAZ A;  1OW4 A;  1QV1 A;  1U5I B;  2LNK A;  3BOW B;  4A4B A;  3IQQ A;  2L98 A;  4GPL B;  3WNX B;  1RFJ A;  2SAS A;  1ODB A;  1S36 A;  1SPY A;  2QEO A;  4QJ5 B;  4CPV A;  2TN4 A;  1L7Z A;  1M46 A;  1MR8 A;  2I2R E;  2HQ8 A;  3S0F A;  4L9M A;  5JJG A;  3CS1 A;  5AEQ A;  1F55 A;  3FWB A;  1F4O A;  4XJK B;  1LA0 A;  2H2K A;  3JVT C;  4MZJ A;  2MLE C;  1C3Y A;  4OKH A;  2MA2 A;  2OTG B;  3NSL A;  3ZWH A;  1KWO C;  2LAP A;  4PDZ A;  1DJI A;  1B9A A;  1QV0 A;  1S26 D;  1WRL A;  3D0Y A;  1HQV A;  2GGZ A;  4AQI A;  1QAT A;  3A4U B;  1DMO A;  2QEB A;  3BXK A;  1V1G A;  3PLF B;  5K89 A;  1WDC B;  1XO5 A;  3NSO A;  1KCY A;  1J7Q A;  2EHB A;  1OZO A;  4PT1 A;  1TNW A;  1OOF A;  5CSN A;  1DF0 B;  3CZ0 A;  3IF7 A;  3LK0 A;  2JT8 A;  3S0D A;  2JTZ A;  1CLL A;  1WLZ A;  1YUS A;  2B1U A;  3D74 A;  3KF9 A;  1RTP 1;  1ZOT B;  2JNX A;  4YRU A;  1BLQ A;  1Y6W A;  3DF0 B;  1RJV A;  2O60 A;  1YR5 A;  2L2E A;  3BFH A;  3ZNI A;  4GGF C;  3EG5 B;  2ZND A;  1WRK A;  1F8H A;  2H61 C;  4P5O E;  4PHK A;  3SJS A;  1LVC D;  2P71 A;  1QTX A;  1N65 A;  2E6W A;  2PYQ A;  2WC6 A;  2LLS A;  3GOF A;  4GAO A;  5DKN A;  1AP4 A;  1J55 A;  1B8C A;  3BUX B;  1DTL A;  3CLN A;  3SG3 A;  1AUI B;  1G33 A;  2WCL A;  1QWV A;  1SL8 A;  2LHL A;  2LMT A;  4HRG A;  4MRY A;  1BR4 B;  5GQQ C;  4I5N B;  5BPJ A;  1EG4 A;  1PUL A;  5DIC A;  1B1G A;  2K7D A;  1SSE B;  1IQ3 A;  1H4B A;  4GFT A;  4DUQ A;  3FS7 A;  1YUT A;  2AMI A;  1RK9 A;  4MZK A;  5HKW A;  4CLN A;  1R2U A;  2BE6 A;  1DJZ A;  5I2Q A;  3CDN A;  1Z4H A;  1NPQ A;  2LCP A;  4GGF A;  3I5G C;  1N2D A;  1E8A A;  2FJY A;  2H61 A;  2IS9 A;  1MHO A;  3CGA A;  1BG1 A;  1WDC C;  4CFQ A;  1IWQ A;  1UHJ A;  1X02 A;  1FBV A;  3BUO B;  3CZ2 A;  1W7J B;  1FI5 A;  1JF2 A;  2EC6 B;  2KQY A;  4C0J A;  1KK8 B;  2L0P A;  3L4L A;  1DGV A;  1SNL A;  2VRG A;  3D0Y B;  3EKJ A;  2KNE A;  3A8R A;  1BR1 B;  1K9U A;  2MBX A;  3UNW A;  2K7O A;  3MSE B;  4D1E A;  1GQM A;  1TIZ A;  2KHN A;  1Y1A A;  3WHU B;  3DD4 A;  3KO0 A;  5I2L A;  2FOT A;  3O2P A;  1A4P A;  4BY5 A;  1TUZ A;  5AAN A;  1WLM A;  2JXC A;  2JZI A;  4YGD B;  5KU1 A;  1CMG A;  1BU3 A;  4C0K A;  1LKJ A;  3JVT B;  1CKK A;  1B8L A;  1QAS A;  1KFX L;  1YRU B;  4AOM A;  1KWO B;  1S6J A;  1BF5 A;  5AXI A;  3SG4 A;  1OE9 B;  3HCM A;  2GGM A;  5DKQ A;  4M2Q A;  2KSP A;  2ZN8 A;  4NDB A;  1G4Y R;  3RM1 A;  2JT3 A;  1IJ6 A;  1PVA A;  3PM8 A;  4MSP A;  4HSZ A;  2PVB A;  3NSK A;  3O4X A;  2WCE A;  1DT7 B;  1SW8 A;  2LP3 A;  2ZRS A;  1ZAC A;  3IQO A;  1MXL C;  1QIV A;  2WCF A;  3B6X A;  2EC6 C;  3H4S E;  5FI2 A;  1KK8 C;  2JOJ A;  1CFD A;  2KFF A;  4R1E A;  4YGA A;  1TNQ A;  1K94 A;  1F71 A;  2Q4U A;  4UPG A;  1K8U A;  1A2X A;  1R6P A;  3K21 A;  1Y1X A;  2BKI B;  1QLK A;  1N0Y A;  2I18 A;  2KLD A;  1XK4 C;  3GK2 A;  1OZS A;  1A29 A;  2JTT A;  3JTD C;  3O78 A;  4INX A;  1XFX O;  3VRO A;  3VRR A;  3LL8 B;  3PAL A;  3E3R A;  3SS5 A;  1J1E A;  1Y0V H;  2L4I A;  1XFZ O;  2QAC A;  2OS8 C;  3O6B A;  2V53 A;  1XFV O;  5I8N A;  4MLW A;  4YGE B;  3OBV A;  4MVF A;  2I7A A;  1GGZ A;  1K9P A;  1NCZ A;  3FE9 A;  4BY4 A;  1XVJ A;  2LMV A;  3FIA A;  5KSZ A;  3UO9 A;  1QIW A;  2WCH A;  3D75 A;  1YX7 A;  2MRD A;  1ZFS A;  4OVN F;  2YGU A;  2K7C A;  3BJH A;  1S1E A;  5G08 A;  1KQM B;  1GM0 A;  3PM2 A;  3BFB A;  1DJG A;  1TNX A;  3I5G B;  1Z2C B;  1PSB A;  3C1V A;  4FQT A;  1YX8 A;  1RRO A;  2M7L A;  1XK4 A;  3CAB A;  4OV2 A;  1NYA A;  4I5L B;  4CID A;  1SL9 A;  1YRT B;  1XFY O;  2CCM A;  3DVK A;  1EH2 A;  4HRE E;  1P28 A;  4MN0 A;  1SR6 C;  1QLS A;  1LIN A;  1UHK A;  4ORB B; 
#chains in the Genus database with same CATH homology
 2P70 A;  3CDN A;  3OGN A;  4F7F A;  3DZT A;  1TUJ A;  2FJY A;  2QEV A;  1XFR A;  1OOI X;  3R1V A;  3B86 A;  2H8V A;  3S0B A;  3CZ2 A;  1OOG A;  3L4L A;  1C3Z A;  1OOH A;  3CZ1 A;  5EL2 A;  3DY9 A;  2WCJ A;  3B7A A;  4OZD A;  3V2L A;  3VB1 A;  2PQL A;  2GTE A;  2ERB A;  3R72 A;  4JD9 A;  2JPO A;  1OW4 A;  3D77 A;  1T14 A;  3Q8I A;  3RZS A;  2QEO A;  1LS8 A;  3NHI A;  3L4A A;  3D73 A;  1DQE A;  4INW A;  1C3Y A;  3B6X A;  3S0G A;  2QEH A;  2QEB A;  3L47 A;  3DYE A;  1TWO A;  3R1O A;  2WCM A;  3FE8 A;  2WCK A;  3S0F A;  4PT1 A;  4INX A;  1OOF A;  3NGV A;  3CZ0 A;  3PJI A;  3S0D A;  2WC5 A;  3B87 A;  3S0A A;  3D74 A;  3S0E A;  3NHT A;  3QME A;  3FE9 A;  3BFH A;  2QDI A;  2KPH A;  1ORG A;  3D75 A;  2WCH A;  3CYZ A;  2P71 A;  2WC6 A;  3BJH A;  3BFA A;  2L2C A;  3D78 A;  1GM0 A;  3BFB A;  3N7H A;  3FE6 A;  2WCL A;  1QWV A;  4FQT A;  3D76 A;  3DXL A;  3CAB A;  3K1E A;  3B88 A;  5DIC A;  1P28 A;  3R1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...