2MHHA

Solution structure of a ef-hand domain from sea urchin polycystin-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycystic kidney disease protein 2
publication title The number and location of EF hand motifs dictates the calcium dependence of polycystin-2 function.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Metal binding protein
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mhhA00
3AAJA 2WNDA 1S6IA 2F8PA 1SL9A 3CTNA 1KK7Y 1SK6D 3EVUA 3LLEA 3GK2A 2BCAA 2SASA 3EVRA 1BODA 1PK0D 3LL8B 1QV0A 2GGMA 2PALA 3CR2A 2E30A 1IH0A 4ORAB 3BYAA 5CSIA 3VRQA 1TNPA 2M8UA 1KCYA 1S3PA 1SYMA 3BOWA 2KNEA 3O78A 3DF0A 4PHKA 4MN0A 2LE9B 3SG4A 2QACA 4M2OA 1K9KA 4WRIA 2LLSA 4ORBB 3VRNA 1XK4A 1MXEA 1XFYO 2CTNA 4GGFA 4YRUA 1IJ5A 1NCXA 4PDZA 4YGCB 1J55A 2NZ0A 3WXAA 4QJ4B 3MSEB 3C1VA 1OE9B 2BKIB 1NCZA 2CCMA 1U5IB 4GAOA 5F6TA 1B8LA 1QATA 4ZCUA 1XO5A 3VROA 1EXRA 4DCKA 1R2UA 1YX8A 4Q04A 2JT0A 2AMIA 2RGIA 2F2OA 1M46A 2MJWB 4C0LA 2CT9A 4I5NB 1FF1A 1WRLA 1QX5B 3ZWHA 1MQ1A 1CDNA 2KOTA 1F8HA 4MBEA 1PSBA 1EJ3A 1OQPA 1XFVO 4HRGA 4GPLB 5FYXA 1OMRA 2JXLA 3EK7A 3F45A 3HCMA 2FCEA 2LMTA 3LK1A 2A4JA 2ZRSA 1UHIA 1YUTA 4MSPA 4HSZA 3SG5A 2JPTA 1RTP1 4AQIA 3PALA 1B8RA 3JVTC 3D0YB 1NYAA 2CXJA 2HQ8A 3JVTB 5CSNA 1E8AA 1ZMZA 5I2LA 2K61A 4HREE 1QJTA 2M1KB 3I5GC 3DVEA 3I5GB 1XFXO 3O6BA 4JWQA 1TNWA 4MZKA 2AUCA 2CNPA 1NWDA 4CIDA 2L50A 4F0ZB 3EKJA 1H8BA 4HRHA 4OCIA 1S5GZ 1PSRA 5I2QA 1MWNA 1DVIA 1J1DA 2OS8C 2MA2A 1LVCD 2OS8B 3H4SE 4PE1A 3CR5X 4MEWA 1ALVA 4NDCA 3SG7A 2L98A 4N1GA 5TNCA 1ZOTB 3KHEA 1DF0B 4CFRA 1XVJA 5JOLA 4ETOA 2MLFC 1ALWA 4CLNA 1QASA 5D69A 3PSRA 1UHHA 1J1EA 1QX2A 1OMDA 1KSOA 3NXAA 3BUMB 1G8IA 3WHTB 4AQJA 3EVVA 4A4BA 2DOQA 1B7TZ 3CLNA 2LHLA 1IG5A 1F54A 1NX2A 1CM1A 1S5GY 3IF7A 5J3XA 2I2RE 2HETA 3KPXA 1DMOA 3K21A 1SRAA 2JNXA 2I18A 3RM1A 2ZRTA 2OPOA 1G4YR 2GV5A 1LA3A 2LVJA 2KI4C 2KI4B 2BCXA 4D1EA 1XYDA 3FWCA 4TNCA 3TS5C 4CFQA 3TS5B 4JQ0D 1CFCA 1SCVA 4GFTA 1QVIZ 1K9UA 1FBVA 1PVBA 4DIRA 1JC2A 2L4HA 1IWQA 4YBHB 1UURA 4FQOA 2Y1MA 1B7TY 2K8MB 3CZTX 1PVAA 2Y5IA 2ZFDA 4N5XA 1YURA 5AEQA 2LHIA 2H61C 2KYCA 2KAVA 1FI6A 3PLFB 2WORA 3HX4A 3OX6A 1EL4A 4IL1A 2I7AA 2K2AA 4DRWA 1A29A 2IS9A 3DVMA 5HYDA 3EK4A 1SL7A 4N1FA 1TIZA 2E6WA 2HQWA 4BY4A 4DS7A 1TTXA 2FOTA 2NCPA 1QVIY 2LCPA 4PE4A 1IJ6A 1BR1B 4BY5A 1NX0A 1PRWA 2L5XB 3GK4X 4E68A 3NSOA 1H4BA 1JSAA 4GUKA 3OB1B 4YGEB 2F3YA 3TDZA 1MHOA 2BBMA 1CLBA 1A75B 2WCFA 2KYFA 2R2IA 4R1EA 2LVIA 1NX1A 2PASA 5G08A 2B1UA 1UWOA 4MLWA 2KFHA 1IGVA 1K96A 4L9MA 1R6PA 2KBMA 1V1FA 1S36A 1S26D 2JQ6A 4U8DA 3SG2A 5ER4X 2LLUA 1V1GA 1CLMA 1KK8C 2LUCA 3OHMB 1KK8B 2MRDA 2JC2A 4PHMA 2L4IA 2WCEA 3CGAA 3I5IC 3I5IB 1JF2A 1YR5A 2BL0C 3OX5A 4NQGA 4XJKB 2BL0B 2JTZA 2M7LA 3O4YA 1QXPA 1RROA 1L2OC 1S6JA 2JRFA 3KEVA 1L2OB 4PHNA 1CMFA 1YX7A 1C7WA 4YI9A 1YRTB 2BBNA 2Q4UA 3EK8A 2F2PA 2M3WA 1L7ZA 3A4UB 4P5OE 1DJXA 2JU0A 3WHUB 2I94A 4UPGA 1QLSA 1CDPA 2LLTA 4P2YB 3KF9A 2Q91A 4OV2A 1M45A 2MBXA 1GJYA 1W7JB 1X02A 2KFFA 1WRKA 3GOFA 3NSKA 1OOJA 1B47A 4OR9B 3DF0B 5DKRA 1EG3A 3D10A 3I5HC 1FW4A 3I5HB 1UUSA 2KFGA 1XK4C 4GGFC 1MXLC 1QX7A 4GGNA 1SBJA 5ER5A 1A4PA 1Y0VH 1DJGA 5I8NA 3SG3A 4C0JA 1AUIB 4MZLA 2JXCA 1K93D 1F4OA 2NCOA 4M2QA 2D8NA 2JTTA 3PATA 2M29A 5CSFA 1BF5A 3SG6A 4CPVA 2KGBC 2KI6D 2F33A 1LKJA 1J7RA 1XFWO 2FCDA 1QIWA 2M9GA 3BUOB 4M2PA 5JJGA 2WC8A 3QRXA 1BG1A 2F3ZA 1CLLA 1NX3A 5KSZA 3TZ1A 3TDIA 2PSRA 1K94A 1YRUB 1UP5A 1TOPA 2P6BB 2MLEC 1M39A 3FIAA 1QLKA 5HLVA 1CDLA 2LC5A 2EHBA 1DT7B 1SNLA 1RJVA 2M49B 3JTDC 2HPSA 2K7CA 2Y1NA 3JTDB 4QJ3B 2M1UA 1SKTA 1Y1XA 1WDCC 1WDCB 1N65A 1TNQA 1SW8A 2GGZA 2ZN8A 2LMVA 2ZNDA 3PN7C 4USLA 3PN7B 1F71A 3PFVA 1TCOB 2ZKMX 2ISDA 1SL8A 3I5FB 3TUYC 1YVHA 3AAKA 4ZCVA 3TUYB 1CMGA 2V53A 5K89A 3DVJA 4I5JA 2KQYA 1D1OA 1FI5A 2SCPA 2BKHB 2KBIA 2LAPA 2KAYA 1AHRA 1KQMC 1KQMB 1U5IA 2VRGA 1TNXA 4YGDB 1KFUL 1JFKA 3NSLA 3DD4A 4PALA 1TN4A 1JFJA 4YI8A 1J7QA 1KFXL 1MUXA 1ZACA 3CWGA 5CPVA 3ZNIA 1HT9A 3BXKA 3WNXB 3O2PA 5BPJA 2LP2A 1YUUA 1NSHA 2KDHA 2PMYA 2G9BA 1KWOC 1BMOA 3AKBA 1KWOB 1BJFA 2LANA 3BUXB 4WQ2A 1PULA 1K8UA 1A2XA 1GGZA 2K7DA 2LP3A 1XFZO 4XYNA 3VRRA 2K0JA 2BE6A 2LUXA 1AJ4A 1C7VA 3VRPA 2H2KA 3VGOA 3D0YA 5HKWA 2MAZA 2LV7A 1NP8A 1S1EA 1WRZA 4YGAA 1AP4A 1SR6C 2AAOA 5AANA 1SR6B 1YVLA 1IQ5A 4FTGA 1AVSA 3SIBA 1AJ5A 2MHHA 1OZSA 3EKHA 1N2DA 2L2EA 1C07A 1QIVA 1JBAA 2Y4QA 3E3RA 2OTGC 1BU3A 1Y1UA 2OTGB 1IQ3A 2EC6C 2EC6B 2KHNA 4NDDA 1KSMA 1NIWA 1NUBA 1LINA 3ICBA 1G33A 1K90D 2JWWA 1B9AA 1JF0A 1OMVA 1AK8A 1DJWA 1CFFA 1DF0A 1UHJA 1PALA 1WLZA 1JWDA 1CFDA 1DJZA 2KSPA 3BOWB 1BLQA 2COLB 1F70A 2KI6C 2KQ6A 3LK0A 1SMGA 5KTYA 1UHNA 1Y1AA 4OKHA 2JULA 3FWBA 1IKUA 1SY9A 1CNPA 1M31A 2L0PA 2JOJA 1YTZC 2ZN9A 4NDBA 3GK1A 1TRFA 3OP0A 1QTXA 5AFPA 1KQVA 3DVKA 1BT6A 2PVBA 1HQVA 1RFJA 2EGDA 2LNKA 3AKAA 1WY9A 4I5KA 1B8CA 5DKQA 2NXQA 1CDMA 1F55A 2ZNEA 1W7IB 1EG4A 5AXIA 1GQMA 5KU1A 1CB1A 4PHJA 5AERA 5GQQC 2HF5A 1DJIA 1KFUS 2K7OA 2M0RA 4WQ3A 1DGUA 1GGWA 4MZJA 5PALA 1YUSA 4MVFA 1KFXS 3CS1A 4GNKB 2BECA 1RECA 4PE0A 3BUNB 4A4CA 4QJ5B 4MRXA 4DUQA 1TCFA 1J7PA 1S6CA 1CFPA 4GBAA 1RK9A 2M97A 2LM5A 2WCBA 4YGBB 1K2HA 2H61A 2TN4A 1CM4A 1NCYA 4PE7A 3A8RA 3PM8A 1NPQA 2PRUA 3TDUA 1A03A 1OZOA 1WLMA 5CSJA 1DJHA 2BE4A 1IRJA 1BR4B 2LVKA 5DKNA 3M0WA 2LVVA 1DJYA 2NLNA 5B8IB 5HKYA 1B1GA 4PCWA 3BUWB 2LMUA 4C0KA 2K2FA 2O60A 2JZIA 2QPTA 3I5FC 3RLZA 1Y6WA 2JNFA 1QV1A 1XFUO 4AOMA 4OVNF 3SJSA 1A75A 1F4QA 1BOCA 1B4CA 1DTLA 2G2BA 5I2OA 1SCMC 1RWYA 5HKZA 1SCMB 1DGVA 1VRKA 1KK7Z 2BCBA 2JT8A 3CR4X 3NSIA 3LCPC 2WOSA 4MRYA 5HLOA 5IBWA 4ICBA 2L51A 1OSAA 5D7FA 3SIAA 3FS7A 1MR8A 1CTRA 1UHKA 2K7BA 4I5LB 1QS7A 4ORCB 2CBLA 1MF8B 1CKKA 1JUOA 2JT3A 4XJKA 1M63B 2KAXA 1K95A 1Q80A 1N0YA 1ODBA 2KGRA 3BQ3A 3IQQA 2FJUB 1XA5A 4JPZB 1EH2A 3OB2B 2M7NA 1LXFC 3IQOA 1ZFSA 1ZUZA 2O5GA 1K9PA 1LA0A 1J7OA 3KO0A 1SPYA 1FPWA
chains in the Genus database with same CATH superfamily
3AAJA 2WNDA 1S6IA 2F8PA 1SL9A 3CTNA 1KK7Y 2L5YA 1SK6D 3EVUA 3LLEA 3GK2A 2BCAA 2SASA 3EVRA 1BODA 1PK0D 3B6XA 3LL8B 1QV0A 2GGMA 2PALA 3CR2A 2E30A 1IH0A 4ORAB 3BYAA 5CSIA 3VRQA 1TNPA 2M8UA 1KCYA 3IVTA 1S3PA 1SYMA 3BOWA 3O4XA 2L2CA 2KNEA 3O78A 3DF0A 4PHKA 4MN0A 2LE9B 3FE9A 3SG4A 2QACA 4M2OA 1K9KA 3D77A 4WRIA 2LLSA 4ORBB 3VRNA 1OOIX 1MXEA 1XFYO 1XK4A 2CTNA 4GGFA 1IJ5A 1NCXA 4PDZA 4YGCB 1J55A 2NZ0A 3WXAA 4QJ4B 3MSEB 3C1VA 1OE9B 2BKIB 1NCZA 2CCMA 1U5IB 4GAOA 5F6TA 1B8LA 1QATA 2KPHA 4ZCUA 1XO5A 3BFHA 3VROA 1EXRA 4DCKA 1R2UA 1YX8A 4Q04A 2JT0A 3S0AA 3CZ2A 2AMIA 2RGIA 2F2OA 1M46A 1OOHA 2MJWB 4C0LA 2CT9A 4I5NB 1FF1A 1WRLA 1QX5B 3ZWHA 1MQ1A 1CDNA 2KOTA 3K1EA 1QWVA 1F8HA 4MBEA 1PSBA 1EJ3A 1OQPA 1XFVO 2WCMA 4HRGA 4GPLB 5FYXA 1OMRA 2JXLA 3EK7A 3F45A 3HCMA 2FCEA 2LMTA 3LK1A 2A4JA 2ZRSA 1UHIA 5D3OA 1YUTA 4MSPA 4HSZA 3SS5A 2JPTA 1RTP1 3FE8A 3PM2A 3SG5A 3PALA 1B8RA 1DELA 3JVTC 3D0YB 1NYAA 2CXJA 2HQ8A 2PQLA 3JVTB 5CSNA 1E8AA 1ZMZA 5I2LA 2BNXA 2K61A 4HREE 1QJTA 2M1KB 3I5GC 2YGUA 3DVEA 3I5GB 1XFXO 3O6BA 4JWQA 1TNWA 4MZKA 2AUCA 2CNPA 1NWDA 5EL2A 4CIDA 2L50A 4F0ZB 3EKJA 1H8BA 4HRHA 4OCIA 1S5GZ 1PSRA 2WC6A 5I2QA 1MWNA 1DVIA 1J1DA 2OS8C 2MA2A 1LVCD 2OS8B 3H4SE 3L4AA 4PE1A 3CR5X 4MEWA 1ALVA 4NDCA 3SG7A 1TWOA 2L98A 4N1GA 5TNCA 1ZOTB 3D74A 1P28A 3KHEA 2P71A 3S0DA 1DF0B 4CFRA 1JSAA 1XVJA 3EG5B 5JOLA 2WCJA 4ETOA 2MLFC 3DY9A 1ALWA 4CLNA 1QASA 5D69A 3PSRA 1UHHA 1J1EA 3DXLA 1QX2A 1OMDA 1KSOA 3NXAA 3BUMB 1G8IA 3WHTB 3N7HA 4AQJA 3EVVA 4F7FA 3S0EA 4A4BA 2DOQA 1B7TZ 3CLNA 2LHLA 1IG5A 1F54A 1NX2A 1CM1A 1S5GY 3IF7A 5J3XA 3BFAA 2I2RE 2HETA 3KPXA 1DMOA 3K21A 3CYZA 1SRAA 2JNXA 2I18A 3RM1A 2ZRTA 2OPOA 1G4YR 3CABA 5I94A 2GV5A 1LA3A 2LVJA 2KI4C 2KI4B 2BCXA 4D1EA 1XYDA 3FWCA 3RZSA 4TNCA 3TS5C 4CFQA 3TS5B 4JQ0D 1CFCA 1SCVA 3NGVA 4GFTA 1QVIZ 1K9UA 4INXA 3SS4A 1FBVA 1PVBA 4DIRA 2PYQA 1JC2A 2L4HA 1IWQA 1OW4A 3DYEA 4YBHB 1UURA 4FQOA 2Y1MA 1B7TY 2K8MB 3CZTX 1PVAA 2Y5IA 5FI2A 2ZFDA 4N5XA 1YURA 5AEQA 3UO9A 4FQTA 1GM0A 2LHIA 2H61C 2KYCA 2KAVA 1FI6A 3PLFB 2WORA 4INWA 3HX4A 3OX6A 2FJYA 1EL4A 2WC5A 2I7AA 4IL1A 2K2AA 4DRWA 1A29A 2IS9A 1Z2CB 3DVMA 5HYDA 3EK4A 1SL7A 4N1FA 1TIZA 2E6WA 2HQWA 4BY4A 4DS7A 1TTXA 2FOTA 2NCPA 1QVIY 2K60A 2LCPA 1IJ6A 4PE4A 1BR1B 4BY5A 1NX0A 1PRWA 2L5XB 3GK4X 3QMEA 3NHIA 4E68A 3NSOA 1H4BA 1C3ZA 4GUKA 3OB1B 4OZDA 2F3YA 4YGEB 1MHOA 2BBMA 3TDZA 1A75B 2WCFA 1CLBA 2KYFA 2R2IA 4R1EA 2JPOA 2LVIA 1NX1A 2PASA 5G08A 2B1UA 1UWOA 4MLWA 2KFHA 1IGVA 1K96A 4L9MA 1R6PA 2KBMA 1V1FA 1S36A 1S26D 2JQ6A 4U8DA 3SG2A 5ER4X 2LLUA 1V1GA 1CLMA 1KK8C 2LUCA 3OHMB 1KK8B 3R1PA 2MRDA 2JC2A 4PHMA 2L4IA 2WCEA 3CGAA 3I5IC 3S0GA 3I5IB 1JF2A 2BAPA 1YR5A 2BL0C 3OX5A 4NQGA 4XJKB 2BL0B 2JTZA 3B7AA 3O4YA 2M7LA 1QXPA 1RROA 1L2OC 1S6JA 1TUZA 2JRFA 1L2OB 3KEVA 4PHNA 1YX7A 1CMFA 1C7WA 4JKTA 4YI9A 1YRTB 3KO0A 2BBNA 3L47A 3R1OA 2Q4UA 3EK8A 2F2PA 2M3WA 1L7ZA 3A4UB 4P5OE 3V2LA 1DJXA 2JU0A 3WHUB 2I94A 4UPGA 3PJIA 1QLSA 2ERBA 1CDPA 2LLTA 4P2YB 3KF9A 2Q91A 4OV2A 1M45A 1T14A 2MBXA 1GJYA 1W7JB 1X02A 2KFFA 1WRKA 1XFRA 1ORGA 3GOFA 3NSKA 1OOJA 1B47A 4OR9B 3DF0B 5DKRA 1EG3A 3L4LA 3D10A 3I5HC 1FW4A 3I5HB 1UUSA 2KFGA 1XK4C 4GGFC 1MXLC 1QX7A 4GGNA 1SBJA 5ER5A 1A4PA 1Y0VH 3UNWA 1DJGA 2KLDA 3SG3A 4C0JA 5I8NA 1SSEB 1AUIB 4MZLA 5DICA 1OOGA 2JXCA 1K93D 1F4OA 2NCOA 4M2QA 2D8NA 3B86A 2JTTA 3PATA 2M29A 5CSFA 1BF5A 3SG6A 2GTEA 4CPVA 2KGBC 2KI6D 2F33A 1LKJA 1J7RA 1XFWO 2FCDA 1QIWA 2M9GA 3BUOB 4M2PA 5JJGA 2WC8A 3QRXA 1BG1A 2F3ZA 1CLLA 1NX3A 5KSZA 3TZ1A 3TDIA 3D73A 2PSRA 1K94A 1YRUB 2QEBA 1UP5A 1TOPA 2P6BB 2MLEC 1M39A 3FIAA 1QLKA 5HLVA 1CDLA 2LC5A 2EHBA 4JD9A 1DT7B 2KLEA 1SNLA 1RJVA 2M49B 2QEHA 2HPSA 2K7CA 2Y1NA 3JTDB 3JTDC 4QJ3B 2M1UA 1SKTA 1Y1XA 1WDCC 3DZTA 1WDCB 1N65A 1TNQA 1SW8A 2GGZA 2ZN8A 2LMVA 2ZNDA 3PN7C 4USLA 3PN7B 1F71A 2WCKA 2QEVA 1TCOB 3PFVA 2ZKMX 2ISDA 1SL8A 3I5FB 3TUYC 1YVHA 3AAKA 3OGNA 4ZCVA 3TUYB 2V53A 5K89A 1CMGA 3DVJA 4I5JA 2KQYA 1D1OA 1FI5A 2SCPA 2BKHB 2KBIA 2LAPA 2KAYA 1AHRA 1KQMC 1KQMB 1U5IA 2VRGA 1TNXA 4YGDB 1KFUL 1JFKA 3NSLA 3DD4A 4PALA 1TN4A 1JFJA 4YI8A 1J7QA 1KFXL 1MUXA 1ZACA 3CWGA 5CPVA 3ZNIA 1HT9A 5FI6A 3BXKA 3WNXB 3O2PA 5BPJA 2LP2A 3S0BA 1YUUA 1NSHA 2KDHA 2PMYA 2G9BA 1KWOC 1BMOA 3AKBA 1KWOB 1BJFA 2LANA 3BUXB 4WQ2A 1PULA 1K8UA 1A2XA 1GGZA 2K7DA 2LP3A 1XFZO 4XYNA 2P70A 3VRRA 2K0JA 2BE6A 2LUXA 1AJ4A 4AQIA 1C7VA 3D78A 3VRPA 2H2KA 3VGOA 3D0YA 3D75A 5HKWA 2MAZA 2LV7A 1NP8A 1S1EA 1WRZA 3FE6A 4YGAA 1AP4A 1SR6C 2AAOA 4IJ7A 5AANA 1SR6B 1YVLA 3SS3A 1IQ5A 3R1VA 1AVSA 2WCHA 4FTGA 1AJ5A 2MHHA 1OZSA 3EKHA 3SIBA 1N2DA 2L2EA 3S0FA 1C07A 1QIVA 1JBAA 2Y4QA 3E3RA 2OTGC 1BU3A 1Y1UA 2OTGB 1IQ3A 2EC6C 2EC6B 2KHNA 4NDDA 1KSMA 1NIWA 5FI7A 1NUBA 3B88A 1LINA 3ICBA 1G33A 1K90D 2JWWA 1B9AA 1JF0A 1OMVA 1AK8A 3BJHA 1DJWA 1CFFA 1OOFA 4KYNA 1DF0A 1UHJA 1IIOA 1DQEA 1PALA 1WLZA 1JWDA 1CFDA 1DJZA 2KSPA 3BOWB 1BLQA 2COLB 3D76A 1F70A 2KI6C 2KQ6A 3LK0A 1SMGA 5KTYA 1UHNA 1Y1AA 4OKHA 2JULA 3BFBA 3FWBA 1IKUA 1SY9A 1CNPA 1M31A 2L0PA 2JOJA 1YTZC 2QDIA 2ZN9A 4NDBA 3GK1A 1TRFA 3OP0A 1QTXA 1W9ZA 5AFPA 2H8VA 1KQVA 3DVKA 1BT6A 2PVBA 1HQVA 1RFJA 2EGDA 2LNKA 3AKAA 1WY9A 4I5KA 1B8CA 3B87A 5DKQA 2NXQA 1CDMA 1F55A 3CZ0A 2ZNEA 1W7IB 1EG4A 5AXIA 1GQMA 5KU1A 1CB1A 4PHJA 5AERA 5GQQC 2HF5A 1DJIA 1KFUS 2QEOA 2K7OA 3NHTA 2M0RA 4WQ3A 1DGUA 1GGWA 4MZJA 5PALA 1YUSA 4MVFA 1KFXS 3CS1A 4GNKB 2BECA 1RECA 4PE0A 3BUNB 4A4CA 4QJ5B 4MRXA 4DUQA 1C3YA 1TCFA 4YRUA 3R72A 1S6CA 1DC1A 4GBAA 1CFPA 1J7PA 1RK9A 2M97A 2LM5A 3Q8IA 2WCBA 4YGBB 1K2HA 2H61A 2TN4A 1CM4A 1NCYA 4PE7A 3A8RA 3PM8A 1NPQA 2PRUA 3TDUA 3VB1A 1A03A 1OZOA 1WLMA 5CSJA 1DJHA 1Z4HA 1IRJA 1BR4B 2BE4A 2LVKA 5DKNA 3M0WA 2LVVA 1DJYA 2NLNA 5B8IB 5HKYA 4PT1A 1B1GA 1TUJA 4PCWA 3BUWB 2LMUA 4C0KA 2K2FA 2O60A 2JZIA 2QPTA 3I5FC 3CDNA 3RLZA 1Y6WA 2JNFA 1QV1A 1XFUO 4AOMA 4OVNF 3SJSA 1A75A 1F4QA 1BOCA 1B4CA 1DTLA 2G2BA 5I2OA 1SCMC 1RWYA 5HKZA 1SCMB 1DGVA 1VRKA 1KK7Z 2BCBA 2JT8A 3CR4X 3NSIA 3LCPC 2WOSA 4MRYA 3OBVA 5HLOA 5IBWA 4ICBA 2L51A 1OSAA 5D7FA 3SIAA 3FS7A 1MR8A 1CTRA 1UHKA 2K7BA 4I5LB 1QS7A 4ORCB 2CBLA 1MF8B 5HL1A 1JUOA 1CKKA 3CZ1A 2JT3A 4XJKA 1M63B 2KAXA 1K95A 1Q80A 1N0YA 1ODBA 2KGRA 3BQ3A 3IQQA 1DEKA 2FJUB 1XA5A 4JPZB 1EH2A 3OB2B 2WCLA 2M7NA 1LXFC 3IQOA 1ZFSA 1ZUZA 2O5GA 1K9PA 1LA0A 1J7OA 1LS8A 1SPYA 1FPWA
chains in the Genus database with same CATH topology
3AAJA 2WNDA 1S6IA 2F8PA 1SL9A 3CTNA 1KK7Y 1SK6D 3EVUA 3LLEA 3GK2A 2BCAA 2SASA 3EVRA 1BODA 1PK0D 3LL8B 1QV0A 2GGMA 2PALA 3CR2A 2E30A 1IH0A 4ORAB 3BYAA 5CSIA 3VRQA 1TNPA 2M8UA 1KCYA 1S3PA 1SYMA 3BOWA 2KNEA 3O78A 3DF0A 4PHKA 4MN0A 2LE9B 3SG4A 2QACA 4M2OA 1K9KA 4WRIA 2LLSA 4ORBB 3VRNA 1XK4A 1MXEA 1XFYO 2CTNA 4GGFA 4YRUA 1IJ5A 1NCXA 4PDZA 4YGCB 1J55A 2NZ0A 3WXAA 4QJ4B 3MSEB 3C1VA 1OE9B 2BKIB 1NCZA 2CCMA 1U5IB 4GAOA 5F6TA 1B8LA 1QATA 4ZCUA 1XO5A 3VROA 1EXRA 4DCKA 1R2UA 1YX8A 4Q04A 2JT0A 2AMIA 2RGIA 2F2OA 1M46A 2MJWB 4C0LA 2CT9A 4I5NB 1FF1A 1WRLA 1QX5B 3ZWHA 1MQ1A 1CDNA 2KOTA 1F8HA 4MBEA 1PSBA 1EJ3A 1OQPA 1XFVO 4HRGA 4GPLB 5FYXA 1OMRA 2JXLA 3EK7A 3F45A 3HCMA 2FCEA 2LMTA 3LK1A 2A4JA 2ZRSA 1UHIA 1YUTA 4MSPA 4HSZA 3SG5A 2JPTA 1RTP1 4AQIA 3PALA 1B8RA 3JVTC 3D0YB 1NYAA 2CXJA 2HQ8A 3JVTB 5CSNA 1E8AA 1ZMZA 5I2LA 2K61A 4HREE 1QJTA 2M1KB 3I5GC 3DVEA 3I5GB 1XFXO 3O6BA 4JWQA 1TNWA 4MZKA 2AUCA 2CNPA 1NWDA 4CIDA 2L50A 4F0ZB 3EKJA 1H8BA 4HRHA 4OCIA 1S5GZ 1PSRA 5I2QA 1MWNA 1DVIA 1J1DA 2OS8C 2MA2A 1LVCD 2OS8B 3H4SE 4PE1A 3CR5X 4MEWA 1ALVA 4NDCA 3SG7A 2L98A 4N1GA 5TNCA 1ZOTB 3KHEA 1DF0B 4CFRA 1XVJA 5JOLA 4ETOA 2MLFC 1ALWA 4CLNA 1QASA 5D69A 3PSRA 1UHHA 1J1EA 1QX2A 1OMDA 1KSOA 3NXAA 3BUMB 1G8IA 3WHTB 4AQJA 3EVVA 4A4BA 2DOQA 1B7TZ 3CLNA 2LHLA 1IG5A 1F54A 1NX2A 1CM1A 1S5GY 3IF7A 5J3XA 2I2RE 2HETA 3KPXA 1DMOA 3K21A 1SRAA 2JNXA 2I18A 3RM1A 2ZRTA 2OPOA 1G4YR 2GV5A 1LA3A 2LVJA 2KI4C 2KI4B 2BCXA 4D1EA 1XYDA 3FWCA 4TNCA 3TS5C 4CFQA 3TS5B 4JQ0D 1CFCA 1SCVA 4GFTA 1QVIZ 1K9UA 1FBVA 1PVBA 4DIRA 1JC2A 2L4HA 1IWQA 4YBHB 1UURA 4FQOA 2Y1MA 1B7TY 2K8MB 3CZTX 1PVAA 2Y5IA 2ZFDA 4N5XA 1YURA 5AEQA 2LHIA 2H61C 2KYCA 2KAVA 1FI6A 3PLFB 2WORA 3HX4A 3OX6A 1EL4A 4IL1A 2I7AA 2K2AA 4DRWA 1A29A 2IS9A 3DVMA 5HYDA 3EK4A 1SL7A 4N1FA 1TIZA 2E6WA 2HQWA 4BY4A 4DS7A 1TTXA 2FOTA 2NCPA 1QVIY 2LCPA 4PE4A 1IJ6A 1BR1B 4BY5A 1NX0A 1PRWA 2L5XB 3GK4X 4E68A 3NSOA 1H4BA 1JSAA 4GUKA 3OB1B 4YGEB 2F3YA 3TDZA 1MHOA 2BBMA 1CLBA 1A75B 2WCFA 2KYFA 2R2IA 4R1EA 2LVIA 1NX1A 2PASA 5G08A 2B1UA 1UWOA 4MLWA 2KFHA 1IGVA 1K96A 4L9MA 1R6PA 2KBMA 1V1FA 1S36A 1S26D 2JQ6A 4U8DA 3SG2A 5ER4X 2LLUA 1V1GA 1CLMA 1KK8C 2LUCA 3OHMB 1KK8B 2MRDA 2JC2A 4PHMA 2L4IA 2WCEA 3CGAA 3I5IC 3I5IB 1JF2A 1YR5A 2BL0C 3OX5A 4NQGA 4XJKB 2BL0B 2JTZA 2M7LA 3O4YA 1QXPA 1RROA 1L2OC 1S6JA 2JRFA 3KEVA 1L2OB 4PHNA 1CMFA 1YX7A 1C7WA 4YI9A 1YRTB 2BBNA 2Q4UA 3EK8A 2F2PA 2M3WA 1L7ZA 3A4UB 4P5OE 1DJXA 2JU0A 3WHUB 2I94A 4UPGA 1QLSA 1CDPA 2LLTA 4P2YB 3KF9A 2Q91A 4OV2A 1M45A 2MBXA 1GJYA 1W7JB 1X02A 2KFFA 1WRKA 3GOFA 3NSKA 1OOJA 1B47A 4OR9B 3DF0B 5DKRA 1EG3A 3D10A 3I5HC 1FW4A 3I5HB 1UUSA 2KFGA 1XK4C 4GGFC 1MXLC 1QX7A 4GGNA 1SBJA 5ER5A 1A4PA 1Y0VH 1DJGA 5I8NA 3SG3A 4C0JA 1AUIB 4MZLA 2JXCA 1K93D 1F4OA 2NCOA 4M2QA 2D8NA 2JTTA 3PATA 2M29A 5CSFA 1BF5A 3SG6A 4CPVA 2KGBC 2KI6D 2F33A 1LKJA 1J7RA 1XFWO 2FCDA 1QIWA 2M9GA 3BUOB 4M2PA 5JJGA 2WC8A 3QRXA 1BG1A 2F3ZA 1CLLA 1NX3A 5KSZA 3TZ1A 3TDIA 2PSRA 1K94A 1YRUB 1UP5A 1TOPA 2P6BB 2MLEC 1M39A 3FIAA 1QLKA 5HLVA 1CDLA 2LC5A 2EHBA 1DT7B 1SNLA 1RJVA 2M49B 3JTDC 2HPSA 2K7CA 2Y1NA 3JTDB 4QJ3B 2M1UA 1SKTA 1Y1XA 1WDCC 1WDCB 1N65A 1TNQA 1SW8A 2GGZA 2ZN8A 2LMVA 2ZNDA 3PN7C 4USLA 3PN7B 1F71A 3PFVA 1TCOB 2ZKMX 2ISDA 1SL8A 3I5FB 3TUYC 1YVHA 3AAKA 4ZCVA 3TUYB 1CMGA 2V53A 5K89A 3DVJA 4I5JA 2KQYA 1D1OA 1FI5A 2SCPA 2BKHB 2KBIA 2LAPA 2KAYA 1AHRA 1KQMC 1KQMB 1U5IA 2VRGA 1TNXA 4YGDB 1KFUL 1JFKA 3NSLA 3DD4A 4PALA 1TN4A 1JFJA 4YI8A 1J7QA 1KFXL 1MUXA 1ZACA 3CWGA 5CPVA 3ZNIA 1HT9A 3BXKA 3WNXB 3O2PA 5BPJA 2LP2A 1YUUA 1NSHA 2KDHA 2PMYA 2G9BA 1KWOC 1BMOA 3AKBA 1KWOB 1BJFA 2LANA 3BUXB 4WQ2A 1PULA 1K8UA 1A2XA 1GGZA 2K7DA 2LP3A 1XFZO 4XYNA 3VRRA 2K0JA 2BE6A 2LUXA 1AJ4A 1C7VA 3VRPA 2H2KA 3VGOA 3D0YA 5HKWA 2MAZA 2LV7A 1NP8A 1S1EA 1WRZA 4YGAA 1AP4A 1SR6C 2AAOA 5AANA 1SR6B 1YVLA 1IQ5A 4FTGA 1AVSA 3SIBA 1AJ5A 2MHHA 1OZSA 3EKHA 1N2DA 2L2EA 1C07A 1QIVA 1JBAA 2Y4QA 3E3RA 2OTGC 1BU3A 1Y1UA 2OTGB 1IQ3A 2EC6C 2EC6B 2KHNA 4NDDA 1KSMA 1NIWA 1NUBA 1LINA 3ICBA 1G33A 1K90D 2JWWA 1B9AA 1JF0A 1OMVA 1AK8A 1DJWA 1CFFA 1DF0A 1UHJA 1PALA 1WLZA 1JWDA 1CFDA 1DJZA 2KSPA 3BOWB 1BLQA 2COLB 1F70A 2KI6C 2KQ6A 3LK0A 1SMGA 5KTYA 1UHNA 1Y1AA 4OKHA 2JULA 3FWBA 1IKUA 1SY9A 1CNPA 1M31A 2L0PA 2JOJA 1YTZC 2ZN9A 4NDBA 3GK1A 1TRFA 3OP0A 1QTXA 5AFPA 1KQVA 3DVKA 1BT6A 2PVBA 1HQVA 1RFJA 2EGDA 2LNKA 3AKAA 1WY9A 4I5KA 1B8CA 5DKQA 2NXQA 1CDMA 1F55A 2ZNEA 1W7IB 1EG4A 5AXIA 1GQMA 5KU1A 1CB1A 4PHJA 5AERA 5GQQC 2HF5A 1DJIA 1KFUS 2K7OA 2M0RA 4WQ3A 1DGUA 1GGWA 4MZJA 5PALA 1YUSA 4MVFA 1KFXS 3CS1A 4GNKB 2BECA 1RECA 4PE0A 3BUNB 4A4CA 4QJ5B 4MRXA 4DUQA 1TCFA 1J7PA 1S6CA 1CFPA 4GBAA 1RK9A 2M97A 2LM5A 2WCBA 4YGBB 1K2HA 2H61A 2TN4A 1CM4A 1NCYA 4PE7A 3A8RA 3PM8A 1NPQA 2PRUA 3TDUA 1A03A 1OZOA 1WLMA 5CSJA 1DJHA 2BE4A 1IRJA 1BR4B 2LVKA 5DKNA 3M0WA 2LVVA 1DJYA 2NLNA 5B8IB 5HKYA 1B1GA 4PCWA 3BUWB 2LMUA 4C0KA 2K2FA 2O60A 2JZIA 2QPTA 3I5FC 3RLZA 1Y6WA 2JNFA 1QV1A 1XFUO 4AOMA 4OVNF 3SJSA 1A75A 1F4QA 1BOCA 1B4CA 1DTLA 2G2BA 5I2OA 1SCMC 1RWYA 5HKZA 1SCMB 1DGVA 1VRKA 1KK7Z 2BCBA 2JT8A 3CR4X 3NSIA 3LCPC 2WOSA 4MRYA 5HLOA 5IBWA 4ICBA 2L51A 1OSAA 5D7FA 3SIAA 3FS7A 1MR8A 1CTRA 1UHKA 2K7BA 4I5LB 1QS7A 4ORCB 2CBLA 1MF8B 1CKKA 1JUOA 2JT3A 4XJKA 1M63B 2KAXA 1K95A 1Q80A 1N0YA 1ODBA 2KGRA 3BQ3A 3IQQA 2FJUB 1XA5A 4JPZB 1EH2A 3OB2B 2M7NA 1LXFC 3IQOA 1ZFSA 1ZUZA 2O5GA 1K9PA 1LA0A 1J7OA 3KO0A 1SPYA 1FPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAJ A;  2WND A;  1S6I A;  2F8P A;  1SL9 A;  3CTN A;  1KK7 Y;  1SK6 D;  3EVU A;  3LLE A;  3GK2 A;  2BCA A;  2SAS A;  3EVR A;  1BOD A;  1PK0 D;  3LL8 B;  1QV0 A;  2GGM A;  2PAL A;  3CR2 A;  2E30 A;  1IH0 A;  4ORA B;  3BYA A;  5CSI A;  3VRQ A;  1TNP A;  2M8U A;  1KCY A;  1S3P A;  1SYM A;  3BOW A;  2KNE A;  3O78 A;  3DF0 A;  4PHK A;  4MN0 A;  2LE9 B;  3SG4 A;  2QAC A;  4M2O A;  1K9K A;  4WRI A;  2LLS A;  4ORB B;  3VRN A;  1XK4 A;  1MXE A;  1XFY O;  2CTN A;  4GGF A;  4YRU A;  1IJ5 A;  1NCX A;  4PDZ A;  4YGC B;  1J55 A;  2NZ0 A;  3WXA A;  4QJ4 B;  3MSE B;  3C1V A;  1OE9 B;  2BKI B;  1NCZ A;  2CCM A;  1U5I B;  4GAO A;  5F6T A;  1B8L A;  1QAT A;  4ZCU A;  1XO5 A;  3VRO A;  1EXR A;  4DCK A;  1R2U A;  1YX8 A;  4Q04 A;  2JT0 A;  2AMI A;  2RGI A;  2F2O A;  1M46 A;  2MJW B;  4C0L A;  2CT9 A;  4I5N B;  1FF1 A;  1WRL A;  1QX5 B;  3ZWH A;  1MQ1 A;  1CDN A;  2KOT A;  1F8H A;  4MBE A;  1PSB A;  1EJ3 A;  1OQP A;  1XFV O;  4HRG A;  4GPL B;  5FYX A;  1OMR A;  2JXL A;  3EK7 A;  3F45 A;  3HCM A;  2FCE A;  2LMT A;  3LK1 A;  2A4J A;  2ZRS A;  1UHI A;  1YUT A;  4MSP A;  4HSZ A;  3SG5 A;  2JPT A;  1RTP 1;  4AQI A;  3PAL A;  1B8R A;  3JVT C;  3D0Y B;  1NYA A;  2CXJ A;  2HQ8 A;  3JVT B;  5CSN A;  1E8A A;  1ZMZ A;  5I2L A;  2K61 A;  4HRE E;  1QJT A;  2M1K B;  3I5G C;  3DVE A;  3I5G B;  1XFX O;  3O6B A;  4JWQ A;  1TNW A;  4MZK A;  2AUC A;  2CNP A;  1NWD A;  4CID A;  2L50 A;  4F0Z B;  3EKJ A;  1H8B A;  4HRH A;  4OCI A;  1S5G Z;  1PSR A;  5I2Q A;  1MWN A;  1DVI A;  1J1D A;  2OS8 C;  2MA2 A;  1LVC D;  2OS8 B;  3H4S E;  4PE1 A;  3CR5 X;  4MEW A;  1ALV A;  4NDC A;  3SG7 A;  2L98 A;  4N1G A;  5TNC A;  1ZOT B;  3KHE A;  1DF0 B;  4CFR A;  1XVJ A;  5JOL A;  4ETO A;  2MLF C;  1ALW A;  4CLN A;  1QAS A;  5D69 A;  3PSR A;  1UHH A;  1J1E A;  1QX2 A;  1OMD A;  1KSO A;  3NXA A;  3BUM B;  1G8I A;  3WHT B;  4AQJ A;  3EVV A;  4A4B A;  2DOQ A;  1B7T Z;  3CLN A;  2LHL A;  1IG5 A;  1F54 A;  1NX2 A;  1CM1 A;  1S5G Y;  3IF7 A;  5J3X A;  2I2R E;  2HET A;  3KPX A;  1DMO A;  3K21 A;  1SRA A;  2JNX A;  2I18 A;  3RM1 A;  2ZRT A;  2OPO A;  1G4Y R;  2GV5 A;  1LA3 A;  2LVJ A;  2KI4 C;  2KI4 B;  2BCX A;  4D1E A;  1XYD A;  3FWC A;  4TNC A;  3TS5 C;  4CFQ A;  3TS5 B;  4JQ0 D;  1CFC A;  1SCV A;  4GFT A;  1QVI Z;  1K9U A;  1FBV A;  1PVB A;  4DIR A;  1JC2 A;  2L4H A;  1IWQ A;  4YBH B;  1UUR A;  4FQO A;  2Y1M A;  1B7T Y;  2K8M B;  3CZT X;  1PVA A;  2Y5I A;  2ZFD A;  4N5X A;  1YUR A;  5AEQ A;  2LHI A;  2H61 C;  2KYC A;  2KAV A;  1FI6 A;  3PLF B;  2WOR A;  3HX4 A;  3OX6 A;  1EL4 A;  4IL1 A;  2I7A A;  2K2A A;  4DRW A;  1A29 A;  2IS9 A;  3DVM A;  5HYD A;  3EK4 A;  1SL7 A;  4N1F A;  1TIZ A;  2E6W A;  2HQW A;  4BY4 A;  4DS7 A;  1TTX A;  2FOT A;  2NCP A;  1QVI Y;  2LCP A;  4PE4 A;  1IJ6 A;  1BR1 B;  4BY5 A;  1NX0 A;  1PRW A;  2L5X B;  3GK4 X;  4E68 A;  3NSO A;  1H4B A;  1JSA A;  4GUK A;  3OB1 B;  4YGE B;  2F3Y A;  3TDZ A;  1MHO A;  2BBM A;  1CLB A;  1A75 B;  2WCF A;  2KYF A;  2R2I A;  4R1E A;  2LVI A;  1NX1 A;  2PAS A;  5G08 A;  2B1U A;  1UWO A;  4MLW A;  2KFH A;  1IGV A;  1K96 A;  4L9M A;  1R6P A;  2KBM A;  1V1F A;  1S36 A;  1S26 D;  2JQ6 A;  4U8D A;  3SG2 A;  5ER4 X;  2LLU A;  1V1G A;  1CLM A;  1KK8 C;  2LUC A;  3OHM B;  1KK8 B;  2MRD A;  2JC2 A;  4PHM A;  2L4I A;  2WCE A;  3CGA A;  3I5I C;  3I5I B;  1JF2 A;  1YR5 A;  2BL0 C;  3OX5 A;  4NQG A;  4XJK B;  2BL0 B;  2JTZ A;  2M7L A;  3O4Y A;  1QXP A;  1RRO A;  1L2O C;  1S6J A;  2JRF A;  3KEV A;  1L2O B;  4PHN A;  1CMF A;  1YX7 A;  1C7W A;  4YI9 A;  1YRT B;  2BBN A;  2Q4U A;  3EK8 A;  2F2P A;  2M3W A;  1L7Z A;  3A4U B;  4P5O E;  1DJX A;  2JU0 A;  3WHU B;  2I94 A;  4UPG A;  1QLS A;  1CDP A;  2LLT A;  4P2Y B;  3KF9 A;  2Q91 A;  4OV2 A;  1M45 A;  2MBX A;  1GJY A;  1W7J B;  1X02 A;  2KFF A;  1WRK A;  3GOF A;  3NSK A;  1OOJ A;  1B47 A;  4OR9 B;  3DF0 B;  5DKR A;  1EG3 A;  3D10 A;  3I5H C;  1FW4 A;  3I5H B;  1UUS A;  2KFG A;  1XK4 C;  4GGF C;  1MXL C;  1QX7 A;  4GGN A;  1SBJ A;  5ER5 A;  1A4P A;  1Y0V H;  1DJG A;  5I8N A;  3SG3 A;  4C0J A;  1AUI B;  4MZL A;  2JXC A;  1K93 D;  1F4O A;  2NCO A;  4M2Q A;  2D8N A;  2JTT A;  3PAT A;  2M29 A;  5CSF A;  1BF5 A;  3SG6 A;  4CPV A;  2KGB C;  2KI6 D;  2F33 A;  1LKJ A;  1J7R A;  1XFW O;  2FCD A;  1QIW A;  2M9G A;  3BUO B;  4M2P A;  5JJG A;  2WC8 A;  3QRX A;  1BG1 A;  2F3Z A;  1CLL A;  1NX3 A;  5KSZ A;  3TZ1 A;  3TDI A;  2PSR A;  1K94 A;  1YRU B;  1UP5 A;  1TOP A;  2P6B B;  2MLE C;  1M39 A;  3FIA A;  1QLK A;  5HLV A;  1CDL A;  2LC5 A;  2EHB A;  1DT7 B;  1SNL A;  1RJV A;  2M49 B;  3JTD C;  2HPS A;  2K7C A;  2Y1N A;  3JTD B;  4QJ3 B;  2M1U A;  1SKT A;  1Y1X A;  1WDC C;  1WDC B;  1N65 A;  1TNQ A;  1SW8 A;  2GGZ A;  2ZN8 A;  2LMV A;  2ZND A;  3PN7 C;  4USL A;  3PN7 B;  1F71 A;  3PFV A;  1TCO B;  2ZKM X;  2ISD A;  1SL8 A;  3I5F B;  3TUY C;  1YVH A;  3AAK A;  4ZCV A;  3TUY B;  1CMG A;  2V53 A;  5K89 A;  3DVJ A;  4I5J A;  2KQY A;  1D1O A;  1FI5 A;  2SCP A;  2BKH B;  2KBI A;  2LAP A;  2KAY A;  1AHR A;  1KQM C;  1KQM B;  1U5I A;  2VRG A;  1TNX A;  4YGD B;  1KFU L;  1JFK A;  3NSL A;  3DD4 A;  4PAL A;  1TN4 A;  1JFJ A;  4YI8 A;  1J7Q A;  1KFX L;  1MUX A;  1ZAC A;  3CWG A;  5CPV A;  3ZNI A;  1HT9 A;  3BXK A;  3WNX B;  3O2P A;  5BPJ A;  2LP2 A;  1YUU A;  1NSH A;  2KDH A;  2PMY A;  2G9B A;  1KWO C;  1BMO A;  3AKB A;  1KWO B;  1BJF A;  2LAN A;  3BUX B;  4WQ2 A;  1PUL A;  1K8U A;  1A2X A;  1GGZ A;  2K7D A;  2LP3 A;  1XFZ O;  4XYN A;  3VRR A;  2K0J A;  2BE6 A;  2LUX A;  1AJ4 A;  1C7V A;  3VRP A;  2H2K A;  3VGO A;  3D0Y A;  5HKW A;  2MAZ A;  2LV7 A;  1NP8 A;  1S1E A;  1WRZ A;  4YGA A;  1AP4 A;  1SR6 C;  2AAO A;  5AAN A;  1SR6 B;  1YVL A;  1IQ5 A;  4FTG A;  1AVS A;  3SIB A;  1AJ5 A;  2MHH A;  1OZS A;  3EKH A;  1N2D A;  2L2E A;  1C07 A;  1QIV A;  1JBA A;  2Y4Q A;  3E3R A;  2OTG C;  1BU3 A;  1Y1U A;  2OTG B;  1IQ3 A;  2EC6 C;  2EC6 B;  2KHN A;  4NDD A;  1KSM A;  1NIW A;  1NUB A;  1LIN A;  3ICB A;  1G33 A;  1K90 D;  2JWW A;  1B9A A;  1JF0 A;  1OMV A;  1AK8 A;  1DJW A;  1CFF A;  1DF0 A;  1UHJ A;  1PAL A;  1WLZ A;  1JWD A;  1CFD A;  1DJZ A;  2KSP A;  3BOW B;  1BLQ A;  2COL B;  1F70 A;  2KI6 C;  2KQ6 A;  3LK0 A;  1SMG A;  5KTY A;  1UHN A;  1Y1A A;  4OKH A;  2JUL A;  3FWB A;  1IKU A;  1SY9 A;  1CNP A;  1M31 A;  2L0P A;  2JOJ A;  1YTZ C;  2ZN9 A;  4NDB A;  3GK1 A;  1TRF A;  3OP0 A;  1QTX A;  5AFP A;  1KQV A;  3DVK A;  1BT6 A;  2PVB A;  1HQV A;  1RFJ A;  2EGD A;  2LNK A;  3AKA A;  1WY9 A;  4I5K A;  1B8C A;  5DKQ A;  2NXQ A;  1CDM A;  1F55 A;  2ZNE A;  1W7I B;  1EG4 A;  5AXI A;  1GQM A;  5KU1 A;  1CB1 A;  4PHJ A;  5AER A;  5GQQ C;  2HF5 A;  1DJI A;  1KFU S;  2K7O A;  2M0R A;  4WQ3 A;  1DGU A;  1GGW A;  4MZJ A;  5PAL A;  1YUS A;  4MVF A;  1KFX S;  3CS1 A;  4GNK B;  2BEC A;  1REC A;  4PE0 A;  3BUN B;  4A4C A;  4QJ5 B;  4MRX A;  4DUQ A;  1TCF A;  1J7P A;  1S6C A;  1CFP A;  4GBA A;  1RK9 A;  2M97 A;  2LM5 A;  2WCB A;  4YGB B;  1K2H A;  2H61 A;  2TN4 A;  1CM4 A;  1NCY A;  4PE7 A;  3A8R A;  3PM8 A;  1NPQ A;  2PRU A;  3TDU A;  1A03 A;  1OZO A;  1WLM A;  5CSJ A;  1DJH A;  2BE4 A;  1IRJ A;  1BR4 B;  2LVK A;  5DKN A;  3M0W A;  2LVV A;  1DJY A;  2NLN A;  5B8I B;  5HKY A;  1B1G A;  4PCW A;  3BUW B;  2LMU A;  4C0K A;  2K2F A;  2O60 A;  2JZI A;  2QPT A;  3I5F C;  3RLZ A;  1Y6W A;  2JNF A;  1QV1 A;  1XFU O;  4AOM A;  4OVN F;  3SJS A;  1A75 A;  1F4Q A;  1BOC A;  1B4C A;  1DTL A;  2G2B A;  5I2O A;  1SCM C;  1RWY A;  5HKZ A;  1SCM B;  1DGV A;  1VRK A;  1KK7 Z;  2BCB A;  2JT8 A;  3CR4 X;  3NSI A;  3LCP C;  2WOS A;  4MRY A;  5HLO A;  5IBW A;  4ICB A;  2L51 A;  1OSA A;  5D7F A;  3SIA A;  3FS7 A;  1MR8 A;  1CTR A;  1UHK A;  2K7B A;  4I5L B;  1QS7 A;  4ORC B;  2CBL A;  1MF8 B;  1CKK A;  1JUO A;  2JT3 A;  4XJK A;  1M63 B;  2KAX A;  1K95 A;  1Q80 A;  1N0Y A;  1ODB A;  2KGR A;  3BQ3 A;  3IQQ A;  2FJU B;  1XA5 A;  4JPZ B;  1EH2 A;  3OB2 B;  2M7N A;  1LXF C;  3IQO A;  1ZFS A;  1ZUZ A;  2O5G A;  1K9P A;  1LA0 A;  1J7O A;  3KO0 A;  1SPY A;  1FPW A; 
#chains in the Genus database with same CATH topology
 3AAJ A;  2WND A;  1S6I A;  2F8P A;  1SL9 A;  3CTN A;  1KK7 Y;  2L5Y A;  1SK6 D;  3EVU A;  3LLE A;  3GK2 A;  2BCA A;  2SAS A;  3EVR A;  1BOD A;  1PK0 D;  3B6X A;  3LL8 B;  1QV0 A;  2GGM A;  2PAL A;  3CR2 A;  2E30 A;  1IH0 A;  4ORA B;  3BYA A;  5CSI A;  3VRQ A;  1TNP A;  2M8U A;  1KCY A;  3IVT A;  1S3P A;  1SYM A;  3BOW A;  3O4X A;  2L2C A;  2KNE A;  3O78 A;  3DF0 A;  4PHK A;  4MN0 A;  2LE9 B;  3FE9 A;  3SG4 A;  2QAC A;  4M2O A;  1K9K A;  3D77 A;  4WRI A;  2LLS A;  4ORB B;  3VRN A;  1OOI X;  1MXE A;  1XFY O;  1XK4 A;  2CTN A;  4GGF A;  1IJ5 A;  1NCX A;  4PDZ A;  4YGC B;  1J55 A;  2NZ0 A;  3WXA A;  4QJ4 B;  3MSE B;  3C1V A;  1OE9 B;  2BKI B;  1NCZ A;  2CCM A;  1U5I B;  4GAO A;  5F6T A;  1B8L A;  1QAT A;  2KPH A;  4ZCU A;  1XO5 A;  3BFH A;  3VRO A;  1EXR A;  4DCK A;  1R2U A;  1YX8 A;  4Q04 A;  2JT0 A;  3S0A A;  3CZ2 A;  2AMI A;  2RGI A;  2F2O A;  1M46 A;  1OOH A;  2MJW B;  4C0L A;  2CT9 A;  4I5N B;  1FF1 A;  1WRL A;  1QX5 B;  3ZWH A;  1MQ1 A;  1CDN A;  2KOT A;  3K1E A;  1QWV A;  1F8H A;  4MBE A;  1PSB A;  1EJ3 A;  1OQP A;  1XFV O;  2WCM A;  4HRG A;  4GPL B;  5FYX A;  1OMR A;  2JXL A;  3EK7 A;  3F45 A;  3HCM A;  2FCE A;  2LMT A;  3LK1 A;  2A4J A;  2ZRS A;  1UHI A;  5D3O A;  1YUT A;  4MSP A;  4HSZ A;  3SS5 A;  2JPT A;  1RTP 1;  3FE8 A;  3PM2 A;  3SG5 A;  3PAL A;  1B8R A;  1DEL A;  3JVT C;  3D0Y B;  1NYA A;  2CXJ A;  2HQ8 A;  2PQL A;  3JVT B;  5CSN A;  1E8A A;  1ZMZ A;  5I2L A;  2BNX A;  2K61 A;  4HRE E;  1QJT A;  2M1K B;  3I5G C;  2YGU A;  3DVE A;  3I5G B;  1XFX O;  3O6B A;  4JWQ A;  1TNW A;  4MZK A;  2AUC A;  2CNP A;  1NWD A;  5EL2 A;  4CID A;  2L50 A;  4F0Z B;  3EKJ A;  1H8B A;  4HRH A;  4OCI A;  1S5G Z;  1PSR A;  2WC6 A;  5I2Q A;  1MWN A;  1DVI A;  1J1D A;  2OS8 C;  2MA2 A;  1LVC D;  2OS8 B;  3H4S E;  3L4A A;  4PE1 A;  3CR5 X;  4MEW A;  1ALV A;  4NDC A;  3SG7 A;  1TWO A;  2L98 A;  4N1G A;  5TNC A;  1ZOT B;  3D74 A;  1P28 A;  3KHE A;  2P71 A;  3S0D A;  1DF0 B;  4CFR A;  1JSA A;  1XVJ A;  3EG5 B;  5JOL A;  2WCJ A;  4ETO A;  2MLF C;  3DY9 A;  1ALW A;  4CLN A;  1QAS A;  5D69 A;  3PSR A;  1UHH A;  1J1E A;  3DXL A;  1QX2 A;  1OMD A;  1KSO A;  3NXA A;  3BUM B;  1G8I A;  3WHT B;  3N7H A;  4AQJ A;  3EVV A;  4F7F A;  3S0E A;  4A4B A;  2DOQ A;  1B7T Z;  3CLN A;  2LHL A;  1IG5 A;  1F54 A;  1NX2 A;  1CM1 A;  1S5G Y;  3IF7 A;  5J3X A;  3BFA A;  2I2R E;  2HET A;  3KPX A;  1DMO A;  3K21 A;  3CYZ A;  1SRA A;  2JNX A;  2I18 A;  3RM1 A;  2ZRT A;  2OPO A;  1G4Y R;  3CAB A;  5I94 A;  2GV5 A;  1LA3 A;  2LVJ A;  2KI4 C;  2KI4 B;  2BCX A;  4D1E A;  1XYD A;  3FWC A;  3RZS A;  4TNC A;  3TS5 C;  4CFQ A;  3TS5 B;  4JQ0 D;  1CFC A;  1SCV A;  3NGV A;  4GFT A;  1QVI Z;  1K9U A;  4INX A;  3SS4 A;  1FBV A;  1PVB A;  4DIR A;  2PYQ A;  1JC2 A;  2L4H A;  1IWQ A;  1OW4 A;  3DYE A;  4YBH B;  1UUR A;  4FQO A;  2Y1M A;  1B7T Y;  2K8M B;  3CZT X;  1PVA A;  2Y5I A;  5FI2 A;  2ZFD A;  4N5X A;  1YUR A;  5AEQ A;  3UO9 A;  4FQT A;  1GM0 A;  2LHI A;  2H61 C;  2KYC A;  2KAV A;  1FI6 A;  3PLF B;  2WOR A;  4INW A;  3HX4 A;  3OX6 A;  2FJY A;  1EL4 A;  2WC5 A;  2I7A A;  4IL1 A;  2K2A A;  4DRW A;  1A29 A;  2IS9 A;  1Z2C B;  3DVM A;  5HYD A;  3EK4 A;  1SL7 A;  4N1F A;  1TIZ A;  2E6W A;  2HQW A;  4BY4 A;  4DS7 A;  1TTX A;  2FOT A;  2NCP A;  1QVI Y;  2K60 A;  2LCP A;  1IJ6 A;  4PE4 A;  1BR1 B;  4BY5 A;  1NX0 A;  1PRW A;  2L5X B;  3GK4 X;  3QME A;  3NHI A;  4E68 A;  3NSO A;  1H4B A;  1C3Z A;  4GUK A;  3OB1 B;  4OZD A;  2F3Y A;  4YGE B;  1MHO A;  2BBM A;  3TDZ A;  1A75 B;  2WCF A;  1CLB A;  2KYF A;  2R2I A;  4R1E A;  2JPO A;  2LVI A;  1NX1 A;  2PAS A;  5G08 A;  2B1U A;  1UWO A;  4MLW A;  2KFH A;  1IGV A;  1K96 A;  4L9M A;  1R6P A;  2KBM A;  1V1F A;  1S36 A;  1S26 D;  2JQ6 A;  4U8D A;  3SG2 A;  5ER4 X;  2LLU A;  1V1G A;  1CLM A;  1KK8 C;  2LUC A;  3OHM B;  1KK8 B;  3R1P A;  2MRD A;  2JC2 A;  4PHM A;  2L4I A;  2WCE A;  3CGA A;  3I5I C;  3S0G A;  3I5I B;  1JF2 A;  2BAP A;  1YR5 A;  2BL0 C;  3OX5 A;  4NQG A;  4XJK B;  2BL0 B;  2JTZ A;  3B7A A;  3O4Y A;  2M7L A;  1QXP A;  1RRO A;  1L2O C;  1S6J A;  1TUZ A;  2JRF A;  1L2O B;  3KEV A;  4PHN A;  1YX7 A;  1CMF A;  1C7W A;  4JKT A;  4YI9 A;  1YRT B;  3KO0 A;  2BBN A;  3L47 A;  3R1O A;  2Q4U A;  3EK8 A;  2F2P A;  2M3W A;  1L7Z A;  3A4U B;  4P5O E;  3V2L A;  1DJX A;  2JU0 A;  3WHU B;  2I94 A;  4UPG A;  3PJI A;  1QLS A;  2ERB A;  1CDP A;  2LLT A;  4P2Y B;  3KF9 A;  2Q91 A;  4OV2 A;  1M45 A;  1T14 A;  2MBX A;  1GJY A;  1W7J B;  1X02 A;  2KFF A;  1WRK A;  1XFR A;  1ORG A;  3GOF A;  3NSK A;  1OOJ A;  1B47 A;  4OR9 B;  3DF0 B;  5DKR A;  1EG3 A;  3L4L A;  3D10 A;  3I5H C;  1FW4 A;  3I5H B;  1UUS A;  2KFG A;  1XK4 C;  4GGF C;  1MXL C;  1QX7 A;  4GGN A;  1SBJ A;  5ER5 A;  1A4P A;  1Y0V H;  3UNW A;  1DJG A;  2KLD A;  3SG3 A;  4C0J A;  5I8N A;  1SSE B;  1AUI B;  4MZL A;  5DIC A;  1OOG A;  2JXC A;  1K93 D;  1F4O A;  2NCO A;  4M2Q A;  2D8N A;  3B86 A;  2JTT A;  3PAT A;  2M29 A;  5CSF A;  1BF5 A;  3SG6 A;  2GTE A;  4CPV A;  2KGB C;  2KI6 D;  2F33 A;  1LKJ A;  1J7R A;  1XFW O;  2FCD A;  1QIW A;  2M9G A;  3BUO B;  4M2P A;  5JJG A;  2WC8 A;  3QRX A;  1BG1 A;  2F3Z A;  1CLL A;  1NX3 A;  5KSZ A;  3TZ1 A;  3TDI A;  3D73 A;  2PSR A;  1K94 A;  1YRU B;  2QEB A;  1UP5 A;  1TOP A;  2P6B B;  2MLE C;  1M39 A;  3FIA A;  1QLK A;  5HLV A;  1CDL A;  2LC5 A;  2EHB A;  4JD9 A;  1DT7 B;  2KLE A;  1SNL A;  1RJV A;  2M49 B;  2QEH A;  2HPS A;  2K7C A;  2Y1N A;  3JTD B;  3JTD C;  4QJ3 B;  2M1U A;  1SKT A;  1Y1X A;  1WDC C;  3DZT A;  1WDC B;  1N65 A;  1TNQ A;  1SW8 A;  2GGZ A;  2ZN8 A;  2LMV A;  2ZND A;  3PN7 C;  4USL A;  3PN7 B;  1F71 A;  2WCK A;  2QEV A;  1TCO B;  3PFV A;  2ZKM X;  2ISD A;  1SL8 A;  3I5F B;  3TUY C;  1YVH A;  3AAK A;  3OGN A;  4ZCV A;  3TUY B;  2V53 A;  5K89 A;  1CMG A;  3DVJ A;  4I5J A;  2KQY A;  1D1O A;  1FI5 A;  2SCP A;  2BKH B;  2KBI A;  2LAP A;  2KAY A;  1AHR A;  1KQM C;  1KQM B;  1U5I A;  2VRG A;  1TNX A;  4YGD B;  1KFU L;  1JFK A;  3NSL A;  3DD4 A;  4PAL A;  1TN4 A;  1JFJ A;  4YI8 A;  1J7Q A;  1KFX L;  1MUX A;  1ZAC A;  3CWG A;  5CPV A;  3ZNI A;  1HT9 A;  5FI6 A;  3BXK A;  3WNX B;  3O2P A;  5BPJ A;  2LP2 A;  3S0B A;  1YUU A;  1NSH A;  2KDH A;  2PMY A;  2G9B A;  1KWO C;  1BMO A;  3AKB A;  1KWO B;  1BJF A;  2LAN A;  3BUX B;  4WQ2 A;  1PUL A;  1K8U A;  1A2X A;  1GGZ A;  2K7D A;  2LP3 A;  1XFZ O;  4XYN A;  2P70 A;  3VRR A;  2K0J A;  2BE6 A;  2LUX A;  1AJ4 A;  4AQI A;  1C7V A;  3D78 A;  3VRP A;  2H2K A;  3VGO A;  3D0Y A;  3D75 A;  5HKW A;  2MAZ A;  2LV7 A;  1NP8 A;  1S1E A;  1WRZ A;  3FE6 A;  4YGA A;  1AP4 A;  1SR6 C;  2AAO A;  4IJ7 A;  5AAN A;  1SR6 B;  1YVL A;  3SS3 A;  1IQ5 A;  3R1V A;  1AVS A;  2WCH A;  4FTG A;  1AJ5 A;  2MHH A;  1OZS A;  3EKH A;  3SIB A;  1N2D A;  2L2E A;  3S0F A;  1C07 A;  1QIV A;  1JBA A;  2Y4Q A;  3E3R A;  2OTG C;  1BU3 A;  1Y1U A;  2OTG B;  1IQ3 A;  2EC6 C;  2EC6 B;  2KHN A;  4NDD A;  1KSM A;  1NIW A;  5FI7 A;  1NUB A;  3B88 A;  1LIN A;  3ICB A;  1G33 A;  1K90 D;  2JWW A;  1B9A A;  1JF0 A;  1OMV A;  1AK8 A;  3BJH A;  1DJW A;  1CFF A;  1OOF A;  4KYN A;  1DF0 A;  1UHJ A;  1IIO A;  1DQE A;  1PAL A;  1WLZ A;  1JWD A;  1CFD A;  1DJZ A;  2KSP A;  3BOW B;  1BLQ A;  2COL B;  3D76 A;  1F70 A;  2KI6 C;  2KQ6 A;  3LK0 A;  1SMG A;  5KTY A;  1UHN A;  1Y1A A;  4OKH A;  2JUL A;  3BFB A;  3FWB A;  1IKU A;  1SY9 A;  1CNP A;  1M31 A;  2L0P A;  2JOJ A;  1YTZ C;  2QDI A;  2ZN9 A;  4NDB A;  3GK1 A;  1TRF A;  3OP0 A;  1QTX A;  1W9Z A;  5AFP A;  2H8V A;  1KQV A;  3DVK A;  1BT6 A;  2PVB A;  1HQV A;  1RFJ A;  2EGD A;  2LNK A;  3AKA A;  1WY9 A;  4I5K A;  1B8C A;  3B87 A;  5DKQ A;  2NXQ A;  1CDM A;  1F55 A;  3CZ0 A;  2ZNE A;  1W7I B;  1EG4 A;  5AXI A;  1GQM A;  5KU1 A;  1CB1 A;  4PHJ A;  5AER A;  5GQQ C;  2HF5 A;  1DJI A;  1KFU S;  2QEO A;  2K7O A;  3NHT A;  2M0R A;  4WQ3 A;  1DGU A;  1GGW A;  4MZJ A;  5PAL A;  1YUS A;  4MVF A;  1KFX S;  3CS1 A;  4GNK B;  2BEC A;  1REC A;  4PE0 A;  3BUN B;  4A4C A;  4QJ5 B;  4MRX A;  4DUQ A;  1C3Y A;  1TCF A;  4YRU A;  3R72 A;  1S6C A;  1DC1 A;  4GBA A;  1CFP A;  1J7P A;  1RK9 A;  2M97 A;  2LM5 A;  3Q8I A;  2WCB A;  4YGB B;  1K2H A;  2H61 A;  2TN4 A;  1CM4 A;  1NCY A;  4PE7 A;  3A8R A;  3PM8 A;  1NPQ A;  2PRU A;  3TDU A;  3VB1 A;  1A03 A;  1OZO A;  1WLM A;  5CSJ A;  1DJH A;  1Z4H A;  1IRJ A;  1BR4 B;  2BE4 A;  2LVK A;  5DKN A;  3M0W A;  2LVV A;  1DJY A;  2NLN A;  5B8I B;  5HKY A;  4PT1 A;  1B1G A;  1TUJ A;  4PCW A;  3BUW B;  2LMU A;  4C0K A;  2K2F A;  2O60 A;  2JZI A;  2QPT A;  3I5F C;  3CDN A;  3RLZ A;  1Y6W A;  2JNF A;  1QV1 A;  1XFU O;  4AOM A;  4OVN F;  3SJS A;  1A75 A;  1F4Q A;  1BOC A;  1B4C A;  1DTL A;  2G2B A;  5I2O A;  1SCM C;  1RWY A;  5HKZ A;  1SCM B;  1DGV A;  1VRK A;  1KK7 Z;  2BCB A;  2JT8 A;  3CR4 X;  3NSI A;  3LCP C;  2WOS A;  4MRY A;  3OBV A;  5HLO A;  5IBW A;  4ICB A;  2L51 A;  1OSA A;  5D7F A;  3SIA A;  3FS7 A;  1MR8 A;  1CTR A;  1UHK A;  2K7B A;  4I5L B;  1QS7 A;  4ORC B;  2CBL A;  1MF8 B;  5HL1 A;  1JUO A;  1CKK A;  3CZ1 A;  2JT3 A;  4XJK A;  1M63 B;  2KAX A;  1K95 A;  1Q80 A;  1N0Y A;  1ODB A;  2KGR A;  3BQ3 A;  3IQQ A;  1DEK A;  2FJU B;  1XA5 A;  4JPZ B;  1EH2 A;  3OB2 B;  2WCL A;  2M7N A;  1LXF C;  3IQO A;  1ZFS A;  1ZUZ A;  2O5G A;  1K9P A;  1LA0 A;  1J7O A;  1LS8 A;  1SPY A;  1FPW A; 
#chains in the Genus database with same CATH homology
 3AAJ A;  2WND A;  1S6I A;  2F8P A;  1SL9 A;  3CTN A;  1KK7 Y;  1SK6 D;  3EVU A;  3LLE A;  3GK2 A;  2BCA A;  2SAS A;  3EVR A;  1BOD A;  1PK0 D;  3LL8 B;  1QV0 A;  2GGM A;  2PAL A;  3CR2 A;  2E30 A;  1IH0 A;  4ORA B;  3BYA A;  5CSI A;  3VRQ A;  1TNP A;  2M8U A;  1KCY A;  1S3P A;  1SYM A;  3BOW A;  2KNE A;  3O78 A;  3DF0 A;  4PHK A;  4MN0 A;  2LE9 B;  3SG4 A;  2QAC A;  4M2O A;  1K9K A;  4WRI A;  2LLS A;  4ORB B;  3VRN A;  1XK4 A;  1MXE A;  1XFY O;  2CTN A;  4GGF A;  4YRU A;  1IJ5 A;  1NCX A;  4PDZ A;  4YGC B;  1J55 A;  2NZ0 A;  3WXA A;  4QJ4 B;  3MSE B;  3C1V A;  1OE9 B;  2BKI B;  1NCZ A;  2CCM A;  1U5I B;  4GAO A;  5F6T A;  1B8L A;  1QAT A;  4ZCU A;  1XO5 A;  3VRO A;  1EXR A;  4DCK A;  1R2U A;  1YX8 A;  4Q04 A;  2JT0 A;  2AMI A;  2RGI A;  2F2O A;  1M46 A;  2MJW B;  4C0L A;  2CT9 A;  4I5N B;  1FF1 A;  1WRL A;  1QX5 B;  3ZWH A;  1MQ1 A;  1CDN A;  2KOT A;  1F8H A;  4MBE A;  1PSB A;  1EJ3 A;  1OQP A;  1XFV O;  4HRG A;  4GPL B;  5FYX A;  1OMR A;  2JXL A;  3EK7 A;  3F45 A;  3HCM A;  2FCE A;  2LMT A;  3LK1 A;  2A4J A;  2ZRS A;  1UHI A;  1YUT A;  4MSP A;  4HSZ A;  3SG5 A;  2JPT A;  1RTP 1;  4AQI A;  3PAL A;  1B8R A;  3JVT C;  3D0Y B;  1NYA A;  2CXJ A;  2HQ8 A;  3JVT B;  5CSN A;  1E8A A;  1ZMZ A;  5I2L A;  2K61 A;  4HRE E;  1QJT A;  2M1K B;  3I5G C;  3DVE A;  3I5G B;  1XFX O;  3O6B A;  4JWQ A;  1TNW A;  4MZK A;  2AUC A;  2CNP A;  1NWD A;  4CID A;  2L50 A;  4F0Z B;  3EKJ A;  1H8B A;  4HRH A;  4OCI A;  1S5G Z;  1PSR A;  5I2Q A;  1MWN A;  1DVI A;  1J1D A;  2OS8 C;  2MA2 A;  1LVC D;  2OS8 B;  3H4S E;  4PE1 A;  3CR5 X;  4MEW A;  1ALV A;  4NDC A;  3SG7 A;  2L98 A;  4N1G A;  5TNC A;  1ZOT B;  3KHE A;  1DF0 B;  4CFR A;  1XVJ A;  5JOL A;  4ETO A;  2MLF C;  1ALW A;  4CLN A;  1QAS A;  5D69 A;  3PSR A;  1UHH A;  1J1E A;  1QX2 A;  1OMD A;  1KSO A;  3NXA A;  3BUM B;  1G8I A;  3WHT B;  4AQJ A;  3EVV A;  4A4B A;  2DOQ A;  1B7T Z;  3CLN A;  2LHL A;  1IG5 A;  1F54 A;  1NX2 A;  1CM1 A;  1S5G Y;  3IF7 A;  5J3X A;  2I2R E;  2HET A;  3KPX A;  1DMO A;  3K21 A;  1SRA A;  2JNX A;  2I18 A;  3RM1 A;  2ZRT A;  2OPO A;  1G4Y R;  2GV5 A;  1LA3 A;  2LVJ A;  2KI4 C;  2KI4 B;  2BCX A;  4D1E A;  1XYD A;  3FWC A;  4TNC A;  3TS5 C;  4CFQ A;  3TS5 B;  4JQ0 D;  1CFC A;  1SCV A;  4GFT A;  1QVI Z;  1K9U A;  1FBV A;  1PVB A;  4DIR A;  1JC2 A;  2L4H A;  1IWQ A;  4YBH B;  1UUR A;  4FQO A;  2Y1M A;  1B7T Y;  2K8M B;  3CZT X;  1PVA A;  2Y5I A;  2ZFD A;  4N5X A;  1YUR A;  5AEQ A;  2LHI A;  2H61 C;  2KYC A;  2KAV A;  1FI6 A;  3PLF B;  2WOR A;  3HX4 A;  3OX6 A;  1EL4 A;  4IL1 A;  2I7A A;  2K2A A;  4DRW A;  1A29 A;  2IS9 A;  3DVM A;  5HYD A;  3EK4 A;  1SL7 A;  4N1F A;  1TIZ A;  2E6W A;  2HQW A;  4BY4 A;  4DS7 A;  1TTX A;  2FOT A;  2NCP A;  1QVI Y;  2LCP A;  4PE4 A;  1IJ6 A;  1BR1 B;  4BY5 A;  1NX0 A;  1PRW A;  2L5X B;  3GK4 X;  4E68 A;  3NSO A;  1H4B A;  1JSA A;  4GUK A;  3OB1 B;  4YGE B;  2F3Y A;  3TDZ A;  1MHO A;  2BBM A;  1CLB A;  1A75 B;  2WCF A;  2KYF A;  2R2I A;  4R1E A;  2LVI A;  1NX1 A;  2PAS A;  5G08 A;  2B1U A;  1UWO A;  4MLW A;  2KFH A;  1IGV A;  1K96 A;  4L9M A;  1R6P A;  2KBM A;  1V1F A;  1S36 A;  1S26 D;  2JQ6 A;  4U8D A;  3SG2 A;  5ER4 X;  2LLU A;  1V1G A;  1CLM A;  1KK8 C;  2LUC A;  3OHM B;  1KK8 B;  2MRD A;  2JC2 A;  4PHM A;  2L4I A;  2WCE A;  3CGA A;  3I5I C;  3I5I B;  1JF2 A;  1YR5 A;  2BL0 C;  3OX5 A;  4NQG A;  4XJK B;  2BL0 B;  2JTZ A;  2M7L A;  3O4Y A;  1QXP A;  1RRO A;  1L2O C;  1S6J A;  2JRF A;  3KEV A;  1L2O B;  4PHN A;  1CMF A;  1YX7 A;  1C7W A;  4YI9 A;  1YRT B;  2BBN A;  2Q4U A;  3EK8 A;  2F2P A;  2M3W A;  1L7Z A;  3A4U B;  4P5O E;  1DJX A;  2JU0 A;  3WHU B;  2I94 A;  4UPG A;  1QLS A;  1CDP A;  2LLT A;  4P2Y B;  3KF9 A;  2Q91 A;  4OV2 A;  1M45 A;  2MBX A;  1GJY A;  1W7J B;  1X02 A;  2KFF A;  1WRK A;  3GOF A;  3NSK A;  1OOJ A;  1B47 A;  4OR9 B;  3DF0 B;  5DKR A;  1EG3 A;  3D10 A;  3I5H C;  1FW4 A;  3I5H B;  1UUS A;  2KFG A;  1XK4 C;  4GGF C;  1MXL C;  1QX7 A;  4GGN A;  1SBJ A;  5ER5 A;  1A4P A;  1Y0V H;  1DJG A;  5I8N A;  3SG3 A;  4C0J A;  1AUI B;  4MZL A;  2JXC A;  1K93 D;  1F4O A;  2NCO A;  4M2Q A;  2D8N A;  2JTT A;  3PAT A;  2M29 A;  5CSF A;  1BF5 A;  3SG6 A;  4CPV A;  2KGB C;  2KI6 D;  2F33 A;  1LKJ A;  1J7R A;  1XFW O;  2FCD A;  1QIW A;  2M9G A;  3BUO B;  4M2P A;  5JJG A;  2WC8 A;  3QRX A;  1BG1 A;  2F3Z A;  1CLL A;  1NX3 A;  5KSZ A;  3TZ1 A;  3TDI A;  2PSR A;  1K94 A;  1YRU B;  1UP5 A;  1TOP A;  2P6B B;  2MLE C;  1M39 A;  3FIA A;  1QLK A;  5HLV A;  1CDL A;  2LC5 A;  2EHB A;  1DT7 B;  1SNL A;  1RJV A;  2M49 B;  3JTD C;  2HPS A;  2K7C A;  2Y1N A;  3JTD B;  4QJ3 B;  2M1U A;  1SKT A;  1Y1X A;  1WDC C;  1WDC B;  1N65 A;  1TNQ A;  1SW8 A;  2GGZ A;  2ZN8 A;  2LMV A;  2ZND A;  3PN7 C;  4USL A;  3PN7 B;  1F71 A;  3PFV A;  1TCO B;  2ZKM X;  2ISD A;  1SL8 A;  3I5F B;  3TUY C;  1YVH A;  3AAK A;  4ZCV A;  3TUY B;  1CMG A;  2V53 A;  5K89 A;  3DVJ A;  4I5J A;  2KQY A;  1D1O A;  1FI5 A;  2SCP A;  2BKH B;  2KBI A;  2LAP A;  2KAY A;  1AHR A;  1KQM C;  1KQM B;  1U5I A;  2VRG A;  1TNX A;  4YGD B;  1KFU L;  1JFK A;  3NSL A;  3DD4 A;  4PAL A;  1TN4 A;  1JFJ A;  4YI8 A;  1J7Q A;  1KFX L;  1MUX A;  1ZAC A;  3CWG A;  5CPV A;  3ZNI A;  1HT9 A;  3BXK A;  3WNX B;  3O2P A;  5BPJ A;  2LP2 A;  1YUU A;  1NSH A;  2KDH A;  2PMY A;  2G9B A;  1KWO C;  1BMO A;  3AKB A;  1KWO B;  1BJF A;  2LAN A;  3BUX B;  4WQ2 A;  1PUL A;  1K8U A;  1A2X A;  1GGZ A;  2K7D A;  2LP3 A;  1XFZ O;  4XYN A;  3VRR A;  2K0J A;  2BE6 A;  2LUX A;  1AJ4 A;  1C7V A;  3VRP A;  2H2K A;  3VGO A;  3D0Y A;  5HKW A;  2MAZ A;  2LV7 A;  1NP8 A;  1S1E A;  1WRZ A;  4YGA A;  1AP4 A;  1SR6 C;  2AAO A;  5AAN A;  1SR6 B;  1YVL A;  1IQ5 A;  4FTG A;  1AVS A;  3SIB A;  1AJ5 A;  2MHH A;  1OZS A;  3EKH A;  1N2D A;  2L2E A;  1C07 A;  1QIV A;  1JBA A;  2Y4Q A;  3E3R A;  2OTG C;  1BU3 A;  1Y1U A;  2OTG B;  1IQ3 A;  2EC6 C;  2EC6 B;  2KHN A;  4NDD A;  1KSM A;  1NIW A;  1NUB A;  1LIN A;  3ICB A;  1G33 A;  1K90 D;  2JWW A;  1B9A A;  1JF0 A;  1OMV A;  1AK8 A;  1DJW A;  1CFF A;  1DF0 A;  1UHJ A;  1PAL A;  1WLZ A;  1JWD A;  1CFD A;  1DJZ A;  2KSP A;  3BOW B;  1BLQ A;  2COL B;  1F70 A;  2KI6 C;  2KQ6 A;  3LK0 A;  1SMG A;  5KTY A;  1UHN A;  1Y1A A;  4OKH A;  2JUL A;  3FWB A;  1IKU A;  1SY9 A;  1CNP A;  1M31 A;  2L0P A;  2JOJ A;  1YTZ C;  2ZN9 A;  4NDB A;  3GK1 A;  1TRF A;  3OP0 A;  1QTX A;  5AFP A;  1KQV A;  3DVK A;  1BT6 A;  2PVB A;  1HQV A;  1RFJ A;  2EGD A;  2LNK A;  3AKA A;  1WY9 A;  4I5K A;  1B8C A;  5DKQ A;  2NXQ A;  1CDM A;  1F55 A;  2ZNE A;  1W7I B;  1EG4 A;  5AXI A;  1GQM A;  5KU1 A;  1CB1 A;  4PHJ A;  5AER A;  5GQQ C;  2HF5 A;  1DJI A;  1KFU S;  2K7O A;  2M0R A;  4WQ3 A;  1DGU A;  1GGW A;  4MZJ A;  5PAL A;  1YUS A;  4MVF A;  1KFX S;  3CS1 A;  4GNK B;  2BEC A;  1REC A;  4PE0 A;  3BUN B;  4A4C A;  4QJ5 B;  4MRX A;  4DUQ A;  1TCF A;  1J7P A;  1S6C A;  1CFP A;  4GBA A;  1RK9 A;  2M97 A;  2LM5 A;  2WCB A;  4YGB B;  1K2H A;  2H61 A;  2TN4 A;  1CM4 A;  1NCY A;  4PE7 A;  3A8R A;  3PM8 A;  1NPQ A;  2PRU A;  3TDU A;  1A03 A;  1OZO A;  1WLM A;  5CSJ A;  1DJH A;  2BE4 A;  1IRJ A;  1BR4 B;  2LVK A;  5DKN A;  3M0W A;  2LVV A;  1DJY A;  2NLN A;  5B8I B;  5HKY A;  1B1G A;  4PCW A;  3BUW B;  2LMU A;  4C0K A;  2K2F A;  2O60 A;  2JZI A;  2QPT A;  3I5F C;  3RLZ A;  1Y6W A;  2JNF A;  1QV1 A;  1XFU O;  4AOM A;  4OVN F;  3SJS A;  1A75 A;  1F4Q A;  1BOC A;  1B4C A;  1DTL A;  2G2B A;  5I2O A;  1SCM C;  1RWY A;  5HKZ A;  1SCM B;  1DGV A;  1VRK A;  1KK7 Z;  2BCB A;  2JT8 A;  3CR4 X;  3NSI A;  3LCP C;  2WOS A;  4MRY A;  5HLO A;  5IBW A;  4ICB A;  2L51 A;  1OSA A;  5D7F A;  3SIA A;  3FS7 A;  1MR8 A;  1CTR A;  1UHK A;  2K7B A;  4I5L B;  1QS7 A;  4ORC B;  2CBL A;  1MF8 B;  1CKK A;  1JUO A;  2JT3 A;  4XJK A;  1M63 B;  2KAX A;  1K95 A;  1Q80 A;  1N0Y A;  1ODB A;  2KGR A;  3BQ3 A;  3IQQ A;  2FJU B;  1XA5 A;  4JPZ B;  1EH2 A;  3OB2 B;  2M7N A;  1LXF C;  3IQO A;  1ZFS A;  1ZUZ A;  2O5G A;  1K9P A;  1LA0 A;  1J7O A;  3KO0 A;  1SPY A;  1FPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...