2MHHA

Solution structure of a ef-hand domain from sea urchin polycystin-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycystic kidney disease protein 2
publication title The number and location of EF hand motifs dictates the calcium dependence of polycystin-2 function.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Metal binding protein
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mhhA00
1IG5A 1QV0A 2LVIA 3GK2A 4YI8A 1DMOA 1AVSA 1UWOA 4A4BA 1KCYA 1K9UA 1QX2A 2IS9A 1Y1AA 4YGCB 1B4CA 2F3YA 2M8UA 1KSMA 5KSZA 2I2RE 2KFGA 2WORA 3QRXA 3EKJA 2K7OA 1PALA 1KWOB 1LKJA 2KFFA 3PATA 4GAOA 1WRLA 2BE4A 4JQ0D 1SCVA 1YTZC 3PN7B 1XVJA 3CS1A 1N65A 1AHRA 2OTGB 1IGVA 2LHIA 3LL8B 3GOFA 3D0YA 5TNCA 2RGIA 1QX5B 2JXCA 2F2PA 2M97A 4PE0A 2P6BB 1WDCC 1QS7A 2OS8C 1B8RA 2AAOA 1OZOA 2BBMA 2MLEC 2CCMA 1R2UA 4P2YB 2L50A 1CFFA 2R2IA 1FI5A 1DT7B 2M9GA 1S3PA 1A75B 4MN0A 5KU1A 1BG1A 1LA3A 2K2FA 2FJUB 3DVJA 2CXJA 2BL0B 1KQMB 1KK7Z 1CTRA 2LCPA 2BKHB 1BJFA 3IQOA 1TNQA 1UP5A 1BU3A 1DJZA 3TDIA 3BQ3A 3LCPC 3SG2A 2KAYA 1S6IA 4FQOA 1CKKA 1EG3A 1EJ3A 3WNXB 2MA2A 2JTZA 1PSRA 1XFVO 1YVHA 1KWOC 3JVTB 5ER4X 5K89A 1DGVA 1CLBA 1X02A 2HETA 2WCBA 1MQ1A 1TOPA 1U5IB 1XYDA 3O2PA 4PHKA 2KI6D 2I7AA 2KGBC 4GUKA 1UHNA 1CMFA 1FF1A 1OMRA 1YX7A 1UHHA 1L7ZA 2PASA 3KO0A 2JNXA 1RROA 3OX5A 1J7OA 4ORAB 1B8LA 1K95A 3E3RA 1RWYA 3BUMB 1LVCD 2L5XB 1RECA 2KYFA 1KFXL 2SCPA 4GFTA 4ZCVA 3TS5B 4AQIA 1UUSA 4PE1A 1KFXS 1YVLA 1XFUO 3VGOA 3BUWB 1CLLA 4R1EA 3FWCA 2LVVA 1B47A 3TDZA 1IQ3A 1K94A 2JT8A 4C0LA 2BL0C 2PMYA 1KQMC 3BXKA 3DD4A 1XK4C 1E8AA 1FBVA 4YGAA 1NP8A 1FI6A 3I5IB 3SG6A 1QASA 4MSPA 3GK4X 1OMDA 1DJYA 1YX8A 5HKYA 1NX0A 2F33A 2HPSA 1AP4A 4DIRA 3NSKA 3HCMA 2JPTA 1B7TZ 3BOWB 1L2OB 5CPVA 3RM1A 1LXFC 1OSAA 3SIAA 2MLFC 3M0WA 3VROA 1ZMZA 1WY9A 2LLUA 3OB1B 2LC5A 1C7VA 2K2AA 2M29A 1H4BA 1NX1A 2EC6B 2BKIB 4GGNA 4GPLB 2WOSA 3PLFB 1W7JB 1V1GA 2KQYA 3TS5C 4HSZA 2HF5A 5DKNA 2LMVA 1QVIY 2M7NA 1RJVA 3BUNB 2EGDA 2KHNA 4CFQA 3IF7A 3BYAA 2MAZA 1S5GY 3WHUB 1TNXA 3IQQA 1MF8B 1QV1A 3WXAA 4DS7A 3DF0B 1C07A 3I5IC 4I5KA 2H61C 3I5GB 4PALA 2BBNA 3SG4A 1K9KA 4MZLA 2LNKA 3OB2B 2WCFA 2ZN8A 1EXRA 4PHJA 3KPXA 2CBLA 2LV7A 3KHEA 1K8UA 1L2OC 2ZN9A 5AXIA 3TUYB 1SK6D 4MBEA 1ZOTB 3SG3A 2BCBA 3TDUA 1A75A 2KOTA 4HRHA 5J3XA 1S6CA 3EVRA 1SKTA 2EC6C 1A03A 1CFPA 4N1GA 3FS7A 3RLZA 1NIWA 1S26D 2K7BA 2AUCA 1XK4A 1A4PA 1WRKA 2PALA 1S1EA 2F8PA 1YR5A 2L0PA 2GV5A 1K90D 4PE7A 3ICBA 3F45A 4Q04A 3CGAA 2WCEA 4OR9B 2JZIA 4UPGA 3PFVA 3CR2A 4JPZB 1IH0A 1QTXA 1RK9A 1DJXA 2I94A 4XJKB 1G4YR 3SG7A 1PK0D 2B1UA 2LP3A 3DVMA 3CZTX 3OHMB 4P5OE 4BY5A 4DCKA 3MSEB 5JOLA 1J7QA 2SASA 4USLA 4ORBB 3EKHA 1JSAA 1OQPA 1YUUA 1ALVA 1TNPA 4AQJA 1BMOA 2KGRA 1DJHA 1GQMA 3TUYC 2MJWB 2M49B 2K61A 2L4IA 5G08A 5KTYA 4U8DA 1UURA 1ZFSA 2M3WA 1K93D 2PSRA 4YI9A 4TNCA 2FOTA 3DVEA 1YURA 3PN7C 2D8NA 2OTGC 1F55A 1SMGA 2KYCA 3BUXB 1KK7Y 1JF2A 2H61A 2M1KB 1QATA 1SRAA 1VRKA 1WLZA 1SNLA 1YRTB 2G2BA 2K0JA 3KEVA 3OP0A 4XYNA 4OCIA 1TIZA 2OPOA 1M39A 1YRUB 2E6WA 1UHKA 2I18A 1DF0B 2JT0A 2JTTA 3A8RA 1DTLA 2FCEA 2GGMA 1LA0A 1BF5A 1NCXA 5AANA 4NDDA 4YGDB 1KSOA 1AK8A 5CSFA 4CIDA 5AFPA 4N5XA 4NDBA 1SL7A 1UHIA 1ODBA 1DVIA 1CDLA 1XFYO 2LLTA 4ORCB 2EHBA 5CSIA 2KI6C 1BOCA 1WRZA 1XFZO 2JULA 1G8IA 3NSIA 1Y1XA 1R6PA 2K8MB 1M31A 3AAJA 4M2PA 4N1FA 2K7CA 3HX4A 2JQ6A 2QPTA 4CLNA 1SBJA 3JVTC 1TRFA 2PVBA 4F0ZB 2JNFA 4PHNA 3CR5X 4ETOA 1PVAA 4GBAA 1S6JA 4GGFC 1W7IB 2KI4B 2LLSA 2JU0A 1CLMA 5HYDA 1AJ4A 3DF0A 1YUTA 2KFHA 2Y5IA 3A4UB 1DJIA 1G33A 1J55A 4YGBB 1B9AA 1K9PA 1SR6B 2ZRSA 1A2XA 1K2HA 1QVIZ 1JC2A 1SY9A 1DGUA 1J7PA 1OE9B 4M2OA 2KAVA 2VRGA 3BUOB 3NXAA 3CR4X 4NDCA 3VRNA 3VRPA 1JBAA 2LHLA 1AUIB 1LINA 1OOJA 1S5GZ 2ZNEA 2ZKMX 1K96A 2K7DA 4MRXA 2NXQA 1B7TY 2BECA 5FYXA 4MRYA 2M1UA 3PM8A 2MHHA 4AOMA 1SW8A 1CNPA 2AMIA 1PVBA 3ZWHA 1F54A 4WRIA 3LLEA 2M7LA 4OKHA 1MHOA 2ZRTA 3JTDB 4C0KA 3DVKA 2LMUA 2JT3A 1Y0VH 2CTNA 3O78A 4HRGA 5DKQA 5I2LA 1CFCA 3O4YA 1XFWO 3D10A 1OZSA 2KI4C 2L98A 1NPQA 2Y1MA 5GQQC 1DJWA 3EVUA 1IRJA 4PHMA 1ALWA 1MXLC 2HQWA 4YRUA 1NCZA 2CNPA 3O6BA 1IJ5A 1SR6C 2A4JA 1F4OA 1GGWA 1B1GA 2DOQA 1CDMA 1DJGA 1PULA 3PSRA 4WQ2A 4WQ3A 5I2QA 2NCPA 3WHTB 1F8HA 2TN4A 5IBWA 1QJTA 1CM1A 1SL8A 3EK4A 4ZCUA 2PRUA 1PRWA 5HKWA 4QJ5B 1BT6A 1U5IA 4A4CA 3I5GC 3LK1A 2ZFDA 1IKUA 1ZACA 4GGFA 2GGZA 3SG5A 5HLOA 1V1FA 2L2EA 2G9BA 2KSPA 2L4HA 3JTDC 4L9MA 1MWNA 1BR4B 1QX7A 1M46A 1EL4A 1M45A 2F2OA 1FPWA 1CB1A 1J1DA 1TCFA 2MBXA 1KK8B 4JWQA 1QXPA 1BR1B 5PALA 4I5LB 4YGEB 1MR8A 5I8NA 5CSJA 1DF0A 2MRDA 2O60A 1IJ6A 1RFJA 3I5FB 1XFXO 1QIVA 2KNEA 1EH2A 3AKBA 1FW4A 3D0YB 1S36A 4YBHB 4IL1A 5I2OA 2Q91A 1Q80A 1SCMB 1SL9A 2LP2A 1JFJA 1XA5A 2LM5A 2LE9B 1YUSA 2KQ6A 1F4QA 2M0RA 4MEWA 1CM4A 2ISDA 2LAPA 1D1OA 3NSLA 2LMTA 4GNKB 3BOWA 5BPJA 2LUCA 2HQ8A 3FWBA 1TN4A 1BLQA 1CDNA 4QJ3B 4MZJA 1IQ5A 2QACA 1NX3A 4I5JA 1JF0A 1KQVA 5D69A 3I5HC 1SPYA 3EVVA 2KDHA 3SJSA 1J7RA 2H2KA 4C0JA 3VRRA 1NWDA 3EK8A 2LUXA 3KF9A 1KK8C 2Q4UA 3NSOA 1OMVA 3PALA 2BCXA 1WLMA 4ICBA 4DRWA 1NX2A 1UHJA 4NQGA 1J1EA 2COLB 3VRQA 1TNWA 4PE4A 2FCDA 3FIAA 5F6TA 3I5FC 2WC8A 3LK0A 3OX6A 1PSBA 4D1EA 4QJ4B 1CFDA 2JRFA 1GJYA 2Y1NA 2JOJA 2BCAA 1RTP1 1N0YA 1Y1UA 3CLNA 1JUOA 1SCMC 1CMGA 3H4SE 2JXLA 3CTNA 3I5HB 4CFRA 2WNDA 1IWQA 4I5NB 1SYMA 1N2DA 5D7FA 2JWWA 1NCYA 1QLSA 2NZ0A 5DKRA 2NLNA 5AEQA 2ZNDA 1HQVA 4OV2A 1Y6WA 4MLWA 4CPVA 4FTGA 4OVNF 3EK7A 3AKAA 4M2QA 2Y4QA 1JWDA 3TZ1A 2KBMA 1QIWA 1AJ5A 1TCOB 2KBIA 4HREE 3C1VA 5AERA 1M63B 2KAXA 2O5GA 2BE6A 2JC2A 2NCOA 2E30A 1C7WA 1KFUL 2F3ZA 1JFKA 2LANA 2LVKA 1BODA 5ER5A 1WDCB 1KFUS 1F70A 2OS8B 2CT9A 5CSNA 4DUQA 3CWGA 4BY4A 1B8CA 1MUXA 4PCWA 5HKZA 5JJGA 3AAKA 3SIBA 4MZKA 4E68A 3GK1A 1TTXA 3K21A 1QLKA 4MVFA 4XJKA 5B8IB 1F71A 1EG4A 1ZUZA 2LVJA 1HT9A 2V53A 1NYAA 1NSHA 1XO5A 1GGZA 1NUBA 2L51A 4PDZA 1A29A 1CDPA 1H8BA 5HLVA 3ZNIA 1MXEA
chains in the Genus database with same CATH superfamily
1IG5A 1QV0A 2LVIA 3GK2A 4YI8A 1DMOA 1AVSA 1UWOA 2P70A 4A4BA 1KCYA 1K9UA 1QX2A 2IS9A 1Y1AA 4YGCB 1B4CA 2F3YA 3K1EA 2M8UA 1KSMA 5KSZA 2I2RE 2KFGA 2WORA 3QRXA 2P71A 3EKJA 2K7OA 1PALA 1KWOB 1LKJA 2KFFA 3PATA 4GAOA 3NGVA 1WRLA 2BE4A 4JQ0D 1SCVA 1YTZC 3PN7B 1XVJA 3CS1A 1N65A 1AHRA 2OTGB 1IGVA 2LHIA 3D76A 3LL8B 1IIOA 3GOFA 3D0YA 5TNCA 2RGIA 1QX5B 2JXCA 2F2PA 2M97A 4PE0A 2P6BB 2WCHA 1WDCC 1QS7A 2OS8C 1B8RA 2AAOA 1OZOA 2BBMA 2MLEC 2CCMA 1R2UA 4P2YB 2L50A 1CFFA 2R2IA 1FI5A 1DT7B 2M9GA 3QMEA 1S3PA 1A75B 4MN0A 5KU1A 1BG1A 1LA3A 2KLEA 2K2FA 2FJUB 3DVJA 3PM2A 2CXJA 2BL0B 1KQMB 1KK7Z 3BJHA 1CTRA 2LCPA 2BKHB 1BJFA 3IQOA 1TNQA 3R1OA 3DYEA 1UP5A 1BU3A 1DJZA 3TDIA 3BQ3A 3LCPC 3SG2A 2KAYA 1S6IA 4FQOA 1CKKA 1EG3A 1EJ3A 3WNXB 2MA2A 2JTZA 1PSRA 1XFVO 1YVHA 1KWOC 3JVTB 5ER4X 5K89A 1C3YA 1DGVA 1CLBA 1X02A 2HETA 2WCBA 4IJ7A 1MQ1A 1TOPA 1U5IB 1XYDA 3O2PA 4PHKA 2KI6D 2I7AA 2KGBC 4GUKA 1UHNA 2K60A 3B88A 1CMFA 1FF1A 1OMRA 1YX7A 1UHHA 1L7ZA 2PASA 3KO0A 2JNXA 1RROA 3OX5A 1J7OA 4ORAB 1B8LA 1K95A 3D74A 1RWYA 3BUMB 1LVCD 2L5XB 1RECA 2KYFA 1KFXL 2SCPA 3CZ0A 4GFTA 4ZCVA 3TS5B 4AQIA 1UUSA 4PE1A 1KFXS 1YVLA 1XFUO 3VGOA 3BUWB 5FI7A 1CLLA 4R1EA 2WC6A 3D77A 3FWCA 2LVVA 1B47A 3TDZA 3S0DA 1IQ3A 1K94A 2JT8A 3ZNIA 1DC1A 1GM0A 4C0LA 2BL0C 2PMYA 1KQMC 3BXKA 3DD4A 1XK4C 1E8AA 1FBVA 4YGAA 1NP8A 1FI6A 3I5IB 3SG6A 1QASA 4MSPA 3GK4X 3D73A 1OMDA 1DJYA 1YX8A 5HKYA 1NX0A 2F33A 2HPSA 3S0BA 1AP4A 4DIRA 3NSKA 3DXLA 3HCMA 2JPTA 3R72A 1B7TZ 3BOWB 1L2OB 5CPVA 3RM1A 1LXFC 1OSAA 3SIAA 2MLFC 3M0WA 2KPHA 3VROA 1ZMZA 1WY9A 2LLUA 3OB1B 2LC5A 1C7VA 1Z4HA 2K2AA 2M29A 1H4BA 1NX1A 1TWOA 2EC6B 2BKIB 4GGNA 3L4LA 4GPLB 2WOSA 3PLFB 1W7JB 2PYQA 1SSEB 1V1GA 2BNXA 2KQYA 3TS5C 3UO9A 1C3ZA 4HSZA 2HF5A 5DKNA 2LMVA 3CZ2A 1QVIY 2M7NA 1RJVA 2WCMA 3BUNB 2EGDA 5EL2A 5HL1A 2KHNA 4CFQA 3IF7A 3BYAA 2MAZA 1S5GY 3WHUB 1TNXA 3IQQA 1MF8B 1QV1A 3WXAA 4DS7A 2FJYA 2L5YA 2WCJA 3DF0B 1C07A 3I5IC 4I5KA 2H61C 3I5GB 3NHTA 4PALA 2BBNA 3SG4A 1K9KA 4MZLA 2LNKA 3OB2B 2WCFA 2ZN8A 1EXRA 4PHJA 2BAPA 3KPXA 2CBLA 2LV7A 3CZ1A 3KHEA 1K8UA 1L2OC 2ZN9A 5AXIA 3TUYB 1SK6D 4MBEA 1ZOTB 5FI6A 2BCBA 3SG3A 3TDUA 1A75A 2KOTA 4HRHA 5J3XA 1S6CA 3EVRA 1SKTA 2EC6C 1A03A 1LS8A 1CFPA 4N1GA 3FS7A 3RLZA 1NIWA 1S26D 2K7BA 2AUCA 5DICA 1XK4A 1A4PA 1WRKA 2PALA 1S1EA 2F8PA 1YR5A 2L0PA 3DZTA 2GV5A 1K90D 4PE7A 3ICBA 3F45A 4Q04A 3CGAA 2WCEA 4OR9B 2JZIA 4UPGA 3PFVA 3CR2A 4JPZB 1IH0A 1QTXA 1RK9A 1DJXA 2I94A 4XJKB 1G4YR 3D75A 3NHIA 3SG7A 1PK0D 2B1UA 2H8VA 2LP3A 3S0EA 3DVMA 3CZTX 3OHMB 4P5OE 4INWA 4BY5A 5I94A 4DCKA 3MSEB 4PT1A 5JOLA 1J7QA 2SASA 4USLA 3PJIA 4ORBB 3EKHA 1JSAA 1OQPA 1YUUA 1ALVA 2PQLA 1TNPA 4AQJA 1BMOA 2KGRA 3FE9A 1DJHA 1GQMA 3TUYC 2MJWB 3N7HA 2M49B 2K61A 2L4IA 1W9ZA 5G08A 5KTYA 4U8DA 1UURA 1ZFSA 2M3WA 1K93D 2PSRA 4YI9A 4TNCA 1TUJA 2KLDA 2FOTA 3DVEA 1YURA 3PN7C 2D8NA 2OTGC 1F55A 1SMGA 2KYCA 3BUXB 1KK7Y 3B7AA 1JF2A 2H61A 2M1KB 1QATA 1SRAA 1VRKA 1WLZA 1SNLA 1YRTB 2G2BA 2K0JA 3KEVA 3OP0A 4XYNA 4OCIA 3DY9A 1TIZA 3S0FA 2OPOA 1M39A 1YRUB 2E6WA 1UHKA 2I18A 1DF0B 2JT0A 2JTTA 2L2CA 3A8RA 1DTLA 2FCEA 2GGMA 1LA0A 1BF5A 1NCXA 1OOHA 5AANA 4NDDA 4YGDB 1KSOA 1AK8A 5CSFA 4CIDA 5AFPA 1ORGA 4N5XA 4NDBA 1SL7A 1UHIA 1ODBA 1DVIA 1CDLA 4CLNA 1XFYO 2LLTA 3BFBA 4ORCB 2EHBA 3OGNA 2KI6C 5CSIA 1WRZA 1XFZO 2JULA 3CDNA 1BOCA 1G8IA 3NSIA 1Y1XA 1R6PA 2K8MB 1M31A 3AAJA 4M2PA 4N1FA 2K7CA 3HX4A 2JQ6A 2QPTA 1Z2CB 1SBJA 3JVTC 1DQEA 1TRFA 2PVBA 3E3RA 4F0ZB 2JNFA 2QEOA 4PHNA 3CR5X 4ETOA 1PVAA 4GBAA 1S6JA 3B86A 1W7IB 2KI4B 4GGFC 2LLSA 2JU0A 1CLMA 5HYDA 1AJ4A 3DF0A 1YUTA 2KFHA 2Y5IA 3A4UB 1DJIA 1G33A 1J55A 4YGBB 1B9AA 1K9PA 1SR6B 2ZRSA 1A2XA 2WCLA 1K2HA 1QVIZ 1JC2A 1SY9A 1DGUA 1J7PA 1OE9B 4M2OA 2KAVA 2VRGA 3BUOB 3NXAA 3CR4X 4NDCA 3VRNA 1QWVA 3VRPA 1JBAA 2LHLA 1AUIB 1LINA 1OOJA 1S5GZ 2ZNEA 4F7FA 2ZKMX 1K96A 2K7DA 3CYZA 4MRXA 2QEHA 2NXQA 1B7TY 2BECA 5FYXA 4MRYA 2M1UA 3PM8A 4JD9A 2MHHA 4FQTA 4AOMA 1SW8A 1CNPA 2AMIA 1PVBA 3ZWHA 1F54A 4WRIA 3LLEA 2M7LA 4OKHA 1MHOA 2ZRTA 3JTDB 4C0KA 3DVKA 2LMUA 2JT3A 1Y0VH 2CTNA 3O78A 4HRGA 5DKQA 5I2LA 3SS3A 1CFCA 3O4YA 1XFWO 3D10A 1OZSA 2ERBA 2KI4C 2L98A 1NPQA 2Y1MA 5GQQC 1DJWA 3EVUA 1IRJA 2WCKA 1ALWA 4PHMA 1MXLC 2HQWA 4YRUA 1NCZA 3CABA 3SS5A 2CNPA 3O6BA 1IJ5A 1SR6C 2A4JA 1F4OA 1GGWA 1B1GA 2DOQA 1CDMA 1DJGA 1PULA 3PSRA 4WQ2A 4WQ3A 5I2QA 2NCPA 3WHTB 1F8HA 1XFRA 3V2LA 3D78A 2TN4A 5IBWA 1QJTA 1CM1A 1SL8A 2QEBA 3EK4A 4ZCUA 2PRUA 1PRWA 5HKWA 4QJ5B 5D3OA 1BT6A 1U5IA 4A4CA 3I5GC 3LK1A 2ZFDA 1DELA 3B87A 1IKUA 1ZACA 3L47A 4GGFA 2JPOA 3O4XA 2GGZA 4KYNA 5HLOA 3SG5A 1V1FA 3B6XA 2L2EA 2G9BA 2KSPA 2L4HA 3JTDC 4L9MA 1MWNA 1BR4B 1QX7A 1M46A 5FI2A 1EL4A 1M45A 2F2OA 3VB1A 1CB1A 1J1DA 1TCFA 3FE6A 2MBXA 1FPWA 1KK8B 4JWQA 1QXPA 1BR1B 5PALA 3Q8IA 3EG5B 3R1VA 4I5LB 4YGEB 1MR8A 5I8NA 5CSJA 1DF0A 2MRDA 2WC5A 2O60A 1IJ6A 1DEKA 1RFJA 3I5FB 1XFXO 1QIVA 2KNEA 1EH2A 3AKBA 1FW4A 3D0YB 1S36A 4YBHB 4IL1A 3L4AA 2Q91A 1Q80A 1SCMB 1SL9A 2LP2A 5I2OA 1JFJA 1XA5A 3S0AA 2LM5A 2LE9B 2YGUA 1YUSA 2KQ6A 1F4QA 2M0RA 4MEWA 1CM4A 2ISDA 2LAPA 3R1PA 1D1OA 3NSLA 3OBVA 2LMTA 4GNKB 3BOWA 5BPJA 2LUCA 1OOGA 2HQ8A 3FWBA 1TN4A 1BLQA 1CDNA 4QJ3B 4MZJA 1IQ5A 2QACA 1NX3A 4I5JA 1JF0A 1KQVA 5D69A 3SS4A 3I5HC 1SPYA 3EVVA 2KDHA 3SJSA 1J7RA 2H2KA 4C0JA 3VRRA 1NWDA 3EK8A 2LUXA 3KF9A 1KK8C 2Q4UA 3NSOA 1OMVA 3PALA 2BCXA 1WLMA 4ICBA 3RZSA 4DRWA 1NX2A 1UHJA 4NQGA 3IVTA 1OOFA 1J1EA 2COLB 3BFAA 1TNWA 4PE4A 3VRQA 2FCDA 3FIAA 5F6TA 3I5FC 2WC8A 3FE8A 2QEVA 3LK0A 1PSBA 3OX6A 4D1EA 4QJ4B 1CFDA 2JRFA 1GJYA 2Y1NA 2JOJA 3UNWA 2BCAA 1RTP1 1N0YA 1Y1UA 3CLNA 1JUOA 1SCMC 1CMGA 3H4SE 2JXLA 3BFHA 3CTNA 3I5HB 4CFRA 2WNDA 1IWQA 4I5NB 1SYMA 1N2DA 5D7FA 2JWWA 1NCYA 1QLSA 2NZ0A 4INXA 5DKRA 2NLNA 5AEQA 2ZNDA 1HQVA 4OV2A 1Y6WA 4MLWA 4CPVA 4FTGA 4OVNF 3EK7A 3AKAA 4M2QA 2Y4QA 1TUZA 4OZDA 1JWDA 2GTEA 3TZ1A 2KBMA 1QIWA 1AJ5A 1TCOB 2KBIA 4HREE 3C1VA 5AERA 1M63B 2KAXA 2O5GA 2BE6A 2JC2A 4JKTA 2NCOA 2E30A 1C7WA 1KFUL 2F3ZA 1JFKA 2LANA 2LVKA 1BODA 5ER5A 1WDCB 1KFUS 1F70A 2OS8B 2CT9A 1P28A 5CSNA 4DUQA 3CWGA 4BY4A 1B8CA 1MUXA 4PCWA 5HKZA 5JJGA 3AAKA 3SIBA 4MZKA 4E68A 3GK1A 1TTXA 1OW4A 1QLKA 3K21A 4MVFA 4XJKA 5B8IB 1F71A 1EG4A 1ZUZA 2LVJA 1HT9A 2QDIA 2V53A 1NYAA 1NSHA 1OOIX 1XO5A 3S0GA 1GGZA 1NUBA 2L51A 4PDZA 1A29A 1CDPA 1H8BA 5HLVA 1T14A 1MXEA
chains in the Genus database with same CATH topology
1IG5A 1QV0A 2LVIA 3GK2A 4YI8A 1DMOA 1AVSA 1UWOA 4A4BA 1KCYA 1K9UA 1QX2A 2IS9A 1Y1AA 4YGCB 1B4CA 2F3YA 2M8UA 1KSMA 5KSZA 2I2RE 2KFGA 2WORA 3QRXA 3EKJA 2K7OA 1PALA 1KWOB 1LKJA 2KFFA 3PATA 4GAOA 1WRLA 2BE4A 4JQ0D 1SCVA 1YTZC 3PN7B 1XVJA 3CS1A 1N65A 1AHRA 2OTGB 1IGVA 2LHIA 3LL8B 3GOFA 3D0YA 5TNCA 2RGIA 1QX5B 2JXCA 2F2PA 2M97A 4PE0A 2P6BB 1WDCC 1QS7A 2OS8C 1B8RA 2AAOA 1OZOA 2BBMA 2MLEC 2CCMA 1R2UA 4P2YB 2L50A 1CFFA 2R2IA 1FI5A 1DT7B 2M9GA 1S3PA 1A75B 4MN0A 5KU1A 1BG1A 1LA3A 2K2FA 2FJUB 3DVJA 2CXJA 2BL0B 1KQMB 1KK7Z 1CTRA 2LCPA 2BKHB 1BJFA 3IQOA 1TNQA 1UP5A 1BU3A 1DJZA 3TDIA 3BQ3A 3LCPC 3SG2A 2KAYA 1S6IA 4FQOA 1CKKA 1EG3A 1EJ3A 3WNXB 2MA2A 2JTZA 1PSRA 1XFVO 1YVHA 1KWOC 3JVTB 5ER4X 5K89A 1DGVA 1CLBA 1X02A 2HETA 2WCBA 1MQ1A 1TOPA 1U5IB 1XYDA 3O2PA 4PHKA 2KI6D 2I7AA 2KGBC 4GUKA 1UHNA 1CMFA 1FF1A 1OMRA 1YX7A 1UHHA 1L7ZA 2PASA 3KO0A 2JNXA 1RROA 3OX5A 1J7OA 4ORAB 1B8LA 1K95A 3E3RA 1RWYA 3BUMB 1LVCD 2L5XB 1RECA 2KYFA 1KFXL 2SCPA 4GFTA 4ZCVA 3TS5B 4AQIA 1UUSA 4PE1A 1KFXS 1YVLA 1XFUO 3VGOA 3BUWB 1CLLA 4R1EA 3FWCA 2LVVA 1B47A 3TDZA 1IQ3A 1K94A 2JT8A 4C0LA 2BL0C 2PMYA 1KQMC 3BXKA 3DD4A 1XK4C 1E8AA 1FBVA 4YGAA 1NP8A 1FI6A 3I5IB 3SG6A 1QASA 4MSPA 3GK4X 1OMDA 1DJYA 1YX8A 5HKYA 1NX0A 2F33A 2HPSA 1AP4A 4DIRA 3NSKA 3HCMA 2JPTA 1B7TZ 3BOWB 1L2OB 5CPVA 3RM1A 1LXFC 1OSAA 3SIAA 2MLFC 3M0WA 3VROA 1ZMZA 1WY9A 2LLUA 3OB1B 2LC5A 1C7VA 2K2AA 2M29A 1H4BA 1NX1A 2EC6B 2BKIB 4GGNA 4GPLB 2WOSA 3PLFB 1W7JB 1V1GA 2KQYA 3TS5C 4HSZA 2HF5A 5DKNA 2LMVA 1QVIY 2M7NA 1RJVA 3BUNB 2EGDA 2KHNA 4CFQA 3IF7A 3BYAA 2MAZA 1S5GY 3WHUB 1TNXA 3IQQA 1MF8B 1QV1A 3WXAA 4DS7A 3DF0B 1C07A 3I5IC 4I5KA 2H61C 3I5GB 4PALA 2BBNA 3SG4A 1K9KA 4MZLA 2LNKA 3OB2B 2WCFA 2ZN8A 1EXRA 4PHJA 3KPXA 2CBLA 2LV7A 3KHEA 1K8UA 1L2OC 2ZN9A 5AXIA 3TUYB 1SK6D 4MBEA 1ZOTB 3SG3A 2BCBA 3TDUA 1A75A 2KOTA 4HRHA 5J3XA 1S6CA 3EVRA 1SKTA 2EC6C 1A03A 1CFPA 4N1GA 3FS7A 3RLZA 1NIWA 1S26D 2K7BA 2AUCA 1XK4A 1A4PA 1WRKA 2PALA 1S1EA 2F8PA 1YR5A 2L0PA 2GV5A 1K90D 4PE7A 3ICBA 3F45A 4Q04A 3CGAA 2WCEA 4OR9B 2JZIA 4UPGA 3PFVA 3CR2A 4JPZB 1IH0A 1QTXA 1RK9A 1DJXA 2I94A 4XJKB 1G4YR 3SG7A 1PK0D 2B1UA 2LP3A 3DVMA 3CZTX 3OHMB 4P5OE 4BY5A 4DCKA 3MSEB 5JOLA 1J7QA 2SASA 4USLA 4ORBB 3EKHA 1JSAA 1OQPA 1YUUA 1ALVA 1TNPA 4AQJA 1BMOA 2KGRA 1DJHA 1GQMA 3TUYC 2MJWB 2M49B 2K61A 2L4IA 5G08A 5KTYA 4U8DA 1UURA 1ZFSA 2M3WA 1K93D 2PSRA 4YI9A 4TNCA 2FOTA 3DVEA 1YURA 3PN7C 2D8NA 2OTGC 1F55A 1SMGA 2KYCA 3BUXB 1KK7Y 1JF2A 2H61A 2M1KB 1QATA 1SRAA 1VRKA 1WLZA 1SNLA 1YRTB 2G2BA 2K0JA 3KEVA 3OP0A 4XYNA 4OCIA 1TIZA 2OPOA 1M39A 1YRUB 2E6WA 1UHKA 2I18A 1DF0B 2JT0A 2JTTA 3A8RA 1DTLA 2FCEA 2GGMA 1LA0A 1BF5A 1NCXA 5AANA 4NDDA 4YGDB 1KSOA 1AK8A 5CSFA 4CIDA 5AFPA 4N5XA 4NDBA 1SL7A 1UHIA 1ODBA 1DVIA 1CDLA 1XFYO 2LLTA 4ORCB 2EHBA 5CSIA 2KI6C 1BOCA 1WRZA 1XFZO 2JULA 1G8IA 3NSIA 1Y1XA 1R6PA 2K8MB 1M31A 3AAJA 4M2PA 4N1FA 2K7CA 3HX4A 2JQ6A 2QPTA 4CLNA 1SBJA 3JVTC 1TRFA 2PVBA 4F0ZB 2JNFA 4PHNA 3CR5X 4ETOA 1PVAA 4GBAA 1S6JA 4GGFC 1W7IB 2KI4B 2LLSA 2JU0A 1CLMA 5HYDA 1AJ4A 3DF0A 1YUTA 2KFHA 2Y5IA 3A4UB 1DJIA 1G33A 1J55A 4YGBB 1B9AA 1K9PA 1SR6B 2ZRSA 1A2XA 1K2HA 1QVIZ 1JC2A 1SY9A 1DGUA 1J7PA 1OE9B 4M2OA 2KAVA 2VRGA 3BUOB 3NXAA 3CR4X 4NDCA 3VRNA 3VRPA 1JBAA 2LHLA 1AUIB 1LINA 1OOJA 1S5GZ 2ZNEA 2ZKMX 1K96A 2K7DA 4MRXA 2NXQA 1B7TY 2BECA 5FYXA 4MRYA 2M1UA 3PM8A 2MHHA 4AOMA 1SW8A 1CNPA 2AMIA 1PVBA 3ZWHA 1F54A 4WRIA 3LLEA 2M7LA 4OKHA 1MHOA 2ZRTA 3JTDB 4C0KA 3DVKA 2LMUA 2JT3A 1Y0VH 2CTNA 3O78A 4HRGA 5DKQA 5I2LA 1CFCA 3O4YA 1XFWO 3D10A 1OZSA 2KI4C 2L98A 1NPQA 2Y1MA 5GQQC 1DJWA 3EVUA 1IRJA 4PHMA 1ALWA 1MXLC 2HQWA 4YRUA 1NCZA 2CNPA 3O6BA 1IJ5A 1SR6C 2A4JA 1F4OA 1GGWA 1B1GA 2DOQA 1CDMA 1DJGA 1PULA 3PSRA 4WQ2A 4WQ3A 5I2QA 2NCPA 3WHTB 1F8HA 2TN4A 5IBWA 1QJTA 1CM1A 1SL8A 3EK4A 4ZCUA 2PRUA 1PRWA 5HKWA 4QJ5B 1BT6A 1U5IA 4A4CA 3I5GC 3LK1A 2ZFDA 1IKUA 1ZACA 4GGFA 2GGZA 3SG5A 5HLOA 1V1FA 2L2EA 2G9BA 2KSPA 2L4HA 3JTDC 4L9MA 1MWNA 1BR4B 1QX7A 1M46A 1EL4A 1M45A 2F2OA 1FPWA 1CB1A 1J1DA 1TCFA 2MBXA 1KK8B 4JWQA 1QXPA 1BR1B 5PALA 4I5LB 4YGEB 1MR8A 5I8NA 5CSJA 1DF0A 2MRDA 2O60A 1IJ6A 1RFJA 3I5FB 1XFXO 1QIVA 2KNEA 1EH2A 3AKBA 1FW4A 3D0YB 1S36A 4YBHB 4IL1A 5I2OA 2Q91A 1Q80A 1SCMB 1SL9A 2LP2A 1JFJA 1XA5A 2LM5A 2LE9B 1YUSA 2KQ6A 1F4QA 2M0RA 4MEWA 1CM4A 2ISDA 2LAPA 1D1OA 3NSLA 2LMTA 4GNKB 3BOWA 5BPJA 2LUCA 2HQ8A 3FWBA 1TN4A 1BLQA 1CDNA 4QJ3B 4MZJA 1IQ5A 2QACA 1NX3A 4I5JA 1JF0A 1KQVA 5D69A 3I5HC 1SPYA 3EVVA 2KDHA 3SJSA 1J7RA 2H2KA 4C0JA 3VRRA 1NWDA 3EK8A 2LUXA 3KF9A 1KK8C 2Q4UA 3NSOA 1OMVA 3PALA 2BCXA 1WLMA 4ICBA 4DRWA 1NX2A 1UHJA 4NQGA 1J1EA 2COLB 3VRQA 1TNWA 4PE4A 2FCDA 3FIAA 5F6TA 3I5FC 2WC8A 3LK0A 3OX6A 1PSBA 4D1EA 4QJ4B 1CFDA 2JRFA 1GJYA 2Y1NA 2JOJA 2BCAA 1RTP1 1N0YA 1Y1UA 3CLNA 1JUOA 1SCMC 1CMGA 3H4SE 2JXLA 3CTNA 3I5HB 4CFRA 2WNDA 1IWQA 4I5NB 1SYMA 1N2DA 5D7FA 2JWWA 1NCYA 1QLSA 2NZ0A 5DKRA 2NLNA 5AEQA 2ZNDA 1HQVA 4OV2A 1Y6WA 4MLWA 4CPVA 4FTGA 4OVNF 3EK7A 3AKAA 4M2QA 2Y4QA 1JWDA 3TZ1A 2KBMA 1QIWA 1AJ5A 1TCOB 2KBIA 4HREE 3C1VA 5AERA 1M63B 2KAXA 2O5GA 2BE6A 2JC2A 2NCOA 2E30A 1C7WA 1KFUL 2F3ZA 1JFKA 2LANA 2LVKA 1BODA 5ER5A 1WDCB 1KFUS 1F70A 2OS8B 2CT9A 5CSNA 4DUQA 3CWGA 4BY4A 1B8CA 1MUXA 4PCWA 5HKZA 5JJGA 3AAKA 3SIBA 4MZKA 4E68A 3GK1A 1TTXA 3K21A 1QLKA 4MVFA 4XJKA 5B8IB 1F71A 1EG4A 1ZUZA 2LVJA 1HT9A 2V53A 1NYAA 1NSHA 1XO5A 1GGZA 1NUBA 2L51A 4PDZA 1A29A 1CDPA 1H8BA 5HLVA 3ZNIA 1MXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG5 A;  1QV0 A;  2LVI A;  3GK2 A;  4YI8 A;  1DMO A;  1AVS A;  1UWO A;  4A4B A;  1KCY A;  1K9U A;  1QX2 A;  2IS9 A;  1Y1A A;  4YGC B;  1B4C A;  2F3Y A;  2M8U A;  1KSM A;  5KSZ A;  2I2R E;  2KFG A;  2WOR A;  3QRX A;  3EKJ A;  2K7O A;  1PAL A;  1KWO B;  1LKJ A;  2KFF A;  3PAT A;  4GAO A;  1WRL A;  2BE4 A;  4JQ0 D;  1SCV A;  1YTZ C;  3PN7 B;  1XVJ A;  3CS1 A;  1N65 A;  1AHR A;  2OTG B;  1IGV A;  2LHI A;  3LL8 B;  3GOF A;  3D0Y A;  5TNC A;  2RGI A;  1QX5 B;  2JXC A;  2F2P A;  2M97 A;  4PE0 A;  2P6B B;  1WDC C;  1QS7 A;  2OS8 C;  1B8R A;  2AAO A;  1OZO A;  2BBM A;  2MLE C;  2CCM A;  1R2U A;  4P2Y B;  2L50 A;  1CFF A;  2R2I A;  1FI5 A;  1DT7 B;  2M9G A;  1S3P A;  1A75 B;  4MN0 A;  5KU1 A;  1BG1 A;  1LA3 A;  2K2F A;  2FJU B;  3DVJ A;  2CXJ A;  2BL0 B;  1KQM B;  1KK7 Z;  1CTR A;  2LCP A;  2BKH B;  1BJF A;  3IQO A;  1TNQ A;  1UP5 A;  1BU3 A;  1DJZ A;  3TDI A;  3BQ3 A;  3LCP C;  3SG2 A;  2KAY A;  1S6I A;  4FQO A;  1CKK A;  1EG3 A;  1EJ3 A;  3WNX B;  2MA2 A;  2JTZ A;  1PSR A;  1XFV O;  1YVH A;  1KWO C;  3JVT B;  5ER4 X;  5K89 A;  1DGV A;  1CLB A;  1X02 A;  2HET A;  2WCB A;  1MQ1 A;  1TOP A;  1U5I B;  1XYD A;  3O2P A;  4PHK A;  2KI6 D;  2I7A A;  2KGB C;  4GUK A;  1UHN A;  1CMF A;  1FF1 A;  1OMR A;  1YX7 A;  1UHH A;  1L7Z A;  2PAS A;  3KO0 A;  2JNX A;  1RRO A;  3OX5 A;  1J7O A;  4ORA B;  1B8L A;  1K95 A;  3E3R A;  1RWY A;  3BUM B;  1LVC D;  2L5X B;  1REC A;  2KYF A;  1KFX L;  2SCP A;  4GFT A;  4ZCV A;  3TS5 B;  4AQI A;  1UUS A;  4PE1 A;  1KFX S;  1YVL A;  1XFU O;  3VGO A;  3BUW B;  1CLL A;  4R1E A;  3FWC A;  2LVV A;  1B47 A;  3TDZ A;  1IQ3 A;  1K94 A;  2JT8 A;  4C0L A;  2BL0 C;  2PMY A;  1KQM C;  3BXK A;  3DD4 A;  1XK4 C;  1E8A A;  1FBV A;  4YGA A;  1NP8 A;  1FI6 A;  3I5I B;  3SG6 A;  1QAS A;  4MSP A;  3GK4 X;  1OMD A;  1DJY A;  1YX8 A;  5HKY A;  1NX0 A;  2F33 A;  2HPS A;  1AP4 A;  4DIR A;  3NSK A;  3HCM A;  2JPT A;  1B7T Z;  3BOW B;  1L2O B;  5CPV A;  3RM1 A;  1LXF C;  1OSA A;  3SIA A;  2MLF C;  3M0W A;  3VRO A;  1ZMZ A;  1WY9 A;  2LLU A;  3OB1 B;  2LC5 A;  1C7V A;  2K2A A;  2M29 A;  1H4B A;  1NX1 A;  2EC6 B;  2BKI B;  4GGN A;  4GPL B;  2WOS A;  3PLF B;  1W7J B;  1V1G A;  2KQY A;  3TS5 C;  4HSZ A;  2HF5 A;  5DKN A;  2LMV A;  1QVI Y;  2M7N A;  1RJV A;  3BUN B;  2EGD A;  2KHN A;  4CFQ A;  3IF7 A;  3BYA A;  2MAZ A;  1S5G Y;  3WHU B;  1TNX A;  3IQQ A;  1MF8 B;  1QV1 A;  3WXA A;  4DS7 A;  3DF0 B;  1C07 A;  3I5I C;  4I5K A;  2H61 C;  3I5G B;  4PAL A;  2BBN A;  3SG4 A;  1K9K A;  4MZL A;  2LNK A;  3OB2 B;  2WCF A;  2ZN8 A;  1EXR A;  4PHJ A;  3KPX A;  2CBL A;  2LV7 A;  3KHE A;  1K8U A;  1L2O C;  2ZN9 A;  5AXI A;  3TUY B;  1SK6 D;  4MBE A;  1ZOT B;  3SG3 A;  2BCB A;  3TDU A;  1A75 A;  2KOT A;  4HRH A;  5J3X A;  1S6C A;  3EVR A;  1SKT A;  2EC6 C;  1A03 A;  1CFP A;  4N1G A;  3FS7 A;  3RLZ A;  1NIW A;  1S26 D;  2K7B A;  2AUC A;  1XK4 A;  1A4P A;  1WRK A;  2PAL A;  1S1E A;  2F8P A;  1YR5 A;  2L0P A;  2GV5 A;  1K90 D;  4PE7 A;  3ICB A;  3F45 A;  4Q04 A;  3CGA A;  2WCE A;  4OR9 B;  2JZI A;  4UPG A;  3PFV A;  3CR2 A;  4JPZ B;  1IH0 A;  1QTX A;  1RK9 A;  1DJX A;  2I94 A;  4XJK B;  1G4Y R;  3SG7 A;  1PK0 D;  2B1U A;  2LP3 A;  3DVM A;  3CZT X;  3OHM B;  4P5O E;  4BY5 A;  4DCK A;  3MSE B;  5JOL A;  1J7Q A;  2SAS A;  4USL A;  4ORB B;  3EKH A;  1JSA A;  1OQP A;  1YUU A;  1ALV A;  1TNP A;  4AQJ A;  1BMO A;  2KGR A;  1DJH A;  1GQM A;  3TUY C;  2MJW B;  2M49 B;  2K61 A;  2L4I A;  5G08 A;  5KTY A;  4U8D A;  1UUR A;  1ZFS A;  2M3W A;  1K93 D;  2PSR A;  4YI9 A;  4TNC A;  2FOT A;  3DVE A;  1YUR A;  3PN7 C;  2D8N A;  2OTG C;  1F55 A;  1SMG A;  2KYC A;  3BUX B;  1KK7 Y;  1JF2 A;  2H61 A;  2M1K B;  1QAT A;  1SRA A;  1VRK A;  1WLZ A;  1SNL A;  1YRT B;  2G2B A;  2K0J A;  3KEV A;  3OP0 A;  4XYN A;  4OCI A;  1TIZ A;  2OPO A;  1M39 A;  1YRU B;  2E6W A;  1UHK A;  2I18 A;  1DF0 B;  2JT0 A;  2JTT A;  3A8R A;  1DTL A;  2FCE A;  2GGM A;  1LA0 A;  1BF5 A;  1NCX A;  5AAN A;  4NDD A;  4YGD B;  1KSO A;  1AK8 A;  5CSF A;  4CID A;  5AFP A;  4N5X A;  4NDB A;  1SL7 A;  1UHI A;  1ODB A;  1DVI A;  1CDL A;  1XFY O;  2LLT A;  4ORC B;  2EHB A;  5CSI A;  2KI6 C;  1BOC A;  1WRZ A;  1XFZ O;  2JUL A;  1G8I A;  3NSI A;  1Y1X A;  1R6P A;  2K8M B;  1M31 A;  3AAJ A;  4M2P A;  4N1F A;  2K7C A;  3HX4 A;  2JQ6 A;  2QPT A;  4CLN A;  1SBJ A;  3JVT C;  1TRF A;  2PVB A;  4F0Z B;  2JNF A;  4PHN A;  3CR5 X;  4ETO A;  1PVA A;  4GBA A;  1S6J A;  4GGF C;  1W7I B;  2KI4 B;  2LLS A;  2JU0 A;  1CLM A;  5HYD A;  1AJ4 A;  3DF0 A;  1YUT A;  2KFH A;  2Y5I A;  3A4U B;  1DJI A;  1G33 A;  1J55 A;  4YGB B;  1B9A A;  1K9P A;  1SR6 B;  2ZRS A;  1A2X A;  1K2H A;  1QVI Z;  1JC2 A;  1SY9 A;  1DGU A;  1J7P A;  1OE9 B;  4M2O A;  2KAV A;  2VRG A;  3BUO B;  3NXA A;  3CR4 X;  4NDC A;  3VRN A;  3VRP A;  1JBA A;  2LHL A;  1AUI B;  1LIN A;  1OOJ A;  1S5G Z;  2ZNE A;  2ZKM X;  1K96 A;  2K7D A;  4MRX A;  2NXQ A;  1B7T Y;  2BEC A;  5FYX A;  4MRY A;  2M1U A;  3PM8 A;  2MHH A;  4AOM A;  1SW8 A;  1CNP A;  2AMI A;  1PVB A;  3ZWH A;  1F54 A;  4WRI A;  3LLE A;  2M7L A;  4OKH A;  1MHO A;  2ZRT A;  3JTD B;  4C0K A;  3DVK A;  2LMU A;  2JT3 A;  1Y0V H;  2CTN A;  3O78 A;  4HRG A;  5DKQ A;  5I2L A;  1CFC A;  3O4Y A;  1XFW O;  3D10 A;  1OZS A;  2KI4 C;  2L98 A;  1NPQ A;  2Y1M A;  5GQQ C;  1DJW A;  3EVU A;  1IRJ A;  4PHM A;  1ALW A;  1MXL C;  2HQW A;  4YRU A;  1NCZ A;  2CNP A;  3O6B A;  1IJ5 A;  1SR6 C;  2A4J A;  1F4O A;  1GGW A;  1B1G A;  2DOQ A;  1CDM A;  1DJG A;  1PUL A;  3PSR A;  4WQ2 A;  4WQ3 A;  5I2Q A;  2NCP A;  3WHT B;  1F8H A;  2TN4 A;  5IBW A;  1QJT A;  1CM1 A;  1SL8 A;  3EK4 A;  4ZCU A;  2PRU A;  1PRW A;  5HKW A;  4QJ5 B;  1BT6 A;  1U5I A;  4A4C A;  3I5G C;  3LK1 A;  2ZFD A;  1IKU A;  1ZAC A;  4GGF A;  2GGZ A;  3SG5 A;  5HLO A;  1V1F A;  2L2E A;  2G9B A;  2KSP A;  2L4H A;  3JTD C;  4L9M A;  1MWN A;  1BR4 B;  1QX7 A;  1M46 A;  1EL4 A;  1M45 A;  2F2O A;  1FPW A;  1CB1 A;  1J1D A;  1TCF A;  2MBX A;  1KK8 B;  4JWQ A;  1QXP A;  1BR1 B;  5PAL A;  4I5L B;  4YGE B;  1MR8 A;  5I8N A;  5CSJ A;  1DF0 A;  2MRD A;  2O60 A;  1IJ6 A;  1RFJ A;  3I5F B;  1XFX O;  1QIV A;  2KNE A;  1EH2 A;  3AKB A;  1FW4 A;  3D0Y B;  1S36 A;  4YBH B;  4IL1 A;  5I2O A;  2Q91 A;  1Q80 A;  1SCM B;  1SL9 A;  2LP2 A;  1JFJ A;  1XA5 A;  2LM5 A;  2LE9 B;  1YUS A;  2KQ6 A;  1F4Q A;  2M0R A;  4MEW A;  1CM4 A;  2ISD A;  2LAP A;  1D1O A;  3NSL A;  2LMT A;  4GNK B;  3BOW A;  5BPJ A;  2LUC A;  2HQ8 A;  3FWB A;  1TN4 A;  1BLQ A;  1CDN A;  4QJ3 B;  4MZJ A;  1IQ5 A;  2QAC A;  1NX3 A;  4I5J A;  1JF0 A;  1KQV A;  5D69 A;  3I5H C;  1SPY A;  3EVV A;  2KDH A;  3SJS A;  1J7R A;  2H2K A;  4C0J A;  3VRR A;  1NWD A;  3EK8 A;  2LUX A;  3KF9 A;  1KK8 C;  2Q4U A;  3NSO A;  1OMV A;  3PAL A;  2BCX A;  1WLM A;  4ICB A;  4DRW A;  1NX2 A;  1UHJ A;  4NQG A;  1J1E A;  2COL B;  3VRQ A;  1TNW A;  4PE4 A;  2FCD A;  3FIA A;  5F6T A;  3I5F C;  2WC8 A;  3LK0 A;  3OX6 A;  1PSB A;  4D1E A;  4QJ4 B;  1CFD A;  2JRF A;  1GJY A;  2Y1N A;  2JOJ A;  2BCA A;  1RTP 1;  1N0Y A;  1Y1U A;  3CLN A;  1JUO A;  1SCM C;  1CMG A;  3H4S E;  2JXL A;  3CTN A;  3I5H B;  4CFR A;  2WND A;  1IWQ A;  4I5N B;  1SYM A;  1N2D A;  5D7F A;  2JWW A;  1NCY A;  1QLS A;  2NZ0 A;  5DKR A;  2NLN A;  5AEQ A;  2ZND A;  1HQV A;  4OV2 A;  1Y6W A;  4MLW A;  4CPV A;  4FTG A;  4OVN F;  3EK7 A;  3AKA A;  4M2Q A;  2Y4Q A;  1JWD A;  3TZ1 A;  2KBM A;  1QIW A;  1AJ5 A;  1TCO B;  2KBI A;  4HRE E;  3C1V A;  5AER A;  1M63 B;  2KAX A;  2O5G A;  2BE6 A;  2JC2 A;  2NCO A;  2E30 A;  1C7W A;  1KFU L;  2F3Z A;  1JFK A;  2LAN A;  2LVK A;  1BOD A;  5ER5 A;  1WDC B;  1KFU S;  1F70 A;  2OS8 B;  2CT9 A;  5CSN A;  4DUQ A;  3CWG A;  4BY4 A;  1B8C A;  1MUX A;  4PCW A;  5HKZ A;  5JJG A;  3AAK A;  3SIB A;  4MZK A;  4E68 A;  3GK1 A;  1TTX A;  3K21 A;  1QLK A;  4MVF A;  4XJK A;  5B8I B;  1F71 A;  1EG4 A;  1ZUZ A;  2LVJ A;  1HT9 A;  2V53 A;  1NYA A;  1NSH A;  1XO5 A;  1GGZ A;  1NUB A;  2L51 A;  4PDZ A;  1A29 A;  1CDP A;  1H8B A;  5HLV A;  3ZNI A;  1MXE A; 
#chains in the Genus database with same CATH topology
 1IG5 A;  1QV0 A;  2LVI A;  3GK2 A;  4YI8 A;  1DMO A;  1AVS A;  1UWO A;  2P70 A;  4A4B A;  1KCY A;  1K9U A;  1QX2 A;  2IS9 A;  1Y1A A;  4YGC B;  1B4C A;  2F3Y A;  3K1E A;  2M8U A;  1KSM A;  5KSZ A;  2I2R E;  2KFG A;  2WOR A;  3QRX A;  2P71 A;  3EKJ A;  2K7O A;  1PAL A;  1KWO B;  1LKJ A;  2KFF A;  3PAT A;  4GAO A;  3NGV A;  1WRL A;  2BE4 A;  4JQ0 D;  1SCV A;  1YTZ C;  3PN7 B;  1XVJ A;  3CS1 A;  1N65 A;  1AHR A;  2OTG B;  1IGV A;  2LHI A;  3D76 A;  3LL8 B;  1IIO A;  3GOF A;  3D0Y A;  5TNC A;  2RGI A;  1QX5 B;  2JXC A;  2F2P A;  2M97 A;  4PE0 A;  2P6B B;  2WCH A;  1WDC C;  1QS7 A;  2OS8 C;  1B8R A;  2AAO A;  1OZO A;  2BBM A;  2MLE C;  2CCM A;  1R2U A;  4P2Y B;  2L50 A;  1CFF A;  2R2I A;  1FI5 A;  1DT7 B;  2M9G A;  3QME A;  1S3P A;  1A75 B;  4MN0 A;  5KU1 A;  1BG1 A;  1LA3 A;  2KLE A;  2K2F A;  2FJU B;  3DVJ A;  3PM2 A;  2CXJ A;  2BL0 B;  1KQM B;  1KK7 Z;  3BJH A;  1CTR A;  2LCP A;  2BKH B;  1BJF A;  3IQO A;  1TNQ A;  3R1O A;  3DYE A;  1UP5 A;  1BU3 A;  1DJZ A;  3TDI A;  3BQ3 A;  3LCP C;  3SG2 A;  2KAY A;  1S6I A;  4FQO A;  1CKK A;  1EG3 A;  1EJ3 A;  3WNX B;  2MA2 A;  2JTZ A;  1PSR A;  1XFV O;  1YVH A;  1KWO C;  3JVT B;  5ER4 X;  5K89 A;  1C3Y A;  1DGV A;  1CLB A;  1X02 A;  2HET A;  2WCB A;  4IJ7 A;  1MQ1 A;  1TOP A;  1U5I B;  1XYD A;  3O2P A;  4PHK A;  2KI6 D;  2I7A A;  2KGB C;  4GUK A;  1UHN A;  2K60 A;  3B88 A;  1CMF A;  1FF1 A;  1OMR A;  1YX7 A;  1UHH A;  1L7Z A;  2PAS A;  3KO0 A;  2JNX A;  1RRO A;  3OX5 A;  1J7O A;  4ORA B;  1B8L A;  1K95 A;  3D74 A;  1RWY A;  3BUM B;  1LVC D;  2L5X B;  1REC A;  2KYF A;  1KFX L;  2SCP A;  3CZ0 A;  4GFT A;  4ZCV A;  3TS5 B;  4AQI A;  1UUS A;  4PE1 A;  1KFX S;  1YVL A;  1XFU O;  3VGO A;  3BUW B;  5FI7 A;  1CLL A;  4R1E A;  2WC6 A;  3D77 A;  3FWC A;  2LVV A;  1B47 A;  3TDZ A;  3S0D A;  1IQ3 A;  1K94 A;  2JT8 A;  3ZNI A;  1DC1 A;  1GM0 A;  4C0L A;  2BL0 C;  2PMY A;  1KQM C;  3BXK A;  3DD4 A;  1XK4 C;  1E8A A;  1FBV A;  4YGA A;  1NP8 A;  1FI6 A;  3I5I B;  3SG6 A;  1QAS A;  4MSP A;  3GK4 X;  3D73 A;  1OMD A;  1DJY A;  1YX8 A;  5HKY A;  1NX0 A;  2F33 A;  2HPS A;  3S0B A;  1AP4 A;  4DIR A;  3NSK A;  3DXL A;  3HCM A;  2JPT A;  3R72 A;  1B7T Z;  3BOW B;  1L2O B;  5CPV A;  3RM1 A;  1LXF C;  1OSA A;  3SIA A;  2MLF C;  3M0W A;  2KPH A;  3VRO A;  1ZMZ A;  1WY9 A;  2LLU A;  3OB1 B;  2LC5 A;  1C7V A;  1Z4H A;  2K2A A;  2M29 A;  1H4B A;  1NX1 A;  1TWO A;  2EC6 B;  2BKI B;  4GGN A;  3L4L A;  4GPL B;  2WOS A;  3PLF B;  1W7J B;  2PYQ A;  1SSE B;  1V1G A;  2BNX A;  2KQY A;  3TS5 C;  3UO9 A;  1C3Z A;  4HSZ A;  2HF5 A;  5DKN A;  2LMV A;  3CZ2 A;  1QVI Y;  2M7N A;  1RJV A;  2WCM A;  3BUN B;  2EGD A;  5EL2 A;  5HL1 A;  2KHN A;  4CFQ A;  3IF7 A;  3BYA A;  2MAZ A;  1S5G Y;  3WHU B;  1TNX A;  3IQQ A;  1MF8 B;  1QV1 A;  3WXA A;  4DS7 A;  2FJY A;  2L5Y A;  2WCJ A;  3DF0 B;  1C07 A;  3I5I C;  4I5K A;  2H61 C;  3I5G B;  3NHT A;  4PAL A;  2BBN A;  3SG4 A;  1K9K A;  4MZL A;  2LNK A;  3OB2 B;  2WCF A;  2ZN8 A;  1EXR A;  4PHJ A;  2BAP A;  3KPX A;  2CBL A;  2LV7 A;  3CZ1 A;  3KHE A;  1K8U A;  1L2O C;  2ZN9 A;  5AXI A;  3TUY B;  1SK6 D;  4MBE A;  1ZOT B;  5FI6 A;  2BCB A;  3SG3 A;  3TDU A;  1A75 A;  2KOT A;  4HRH A;  5J3X A;  1S6C A;  3EVR A;  1SKT A;  2EC6 C;  1A03 A;  1LS8 A;  1CFP A;  4N1G A;  3FS7 A;  3RLZ A;  1NIW A;  1S26 D;  2K7B A;  2AUC A;  5DIC A;  1XK4 A;  1A4P A;  1WRK A;  2PAL A;  1S1E A;  2F8P A;  1YR5 A;  2L0P A;  3DZT A;  2GV5 A;  1K90 D;  4PE7 A;  3ICB A;  3F45 A;  4Q04 A;  3CGA A;  2WCE A;  4OR9 B;  2JZI A;  4UPG A;  3PFV A;  3CR2 A;  4JPZ B;  1IH0 A;  1QTX A;  1RK9 A;  1DJX A;  2I94 A;  4XJK B;  1G4Y R;  3D75 A;  3NHI A;  3SG7 A;  1PK0 D;  2B1U A;  2H8V A;  2LP3 A;  3S0E A;  3DVM A;  3CZT X;  3OHM B;  4P5O E;  4INW A;  4BY5 A;  5I94 A;  4DCK A;  3MSE B;  4PT1 A;  5JOL A;  1J7Q A;  2SAS A;  4USL A;  3PJI A;  4ORB B;  3EKH A;  1JSA A;  1OQP A;  1YUU A;  1ALV A;  2PQL A;  1TNP A;  4AQJ A;  1BMO A;  2KGR A;  3FE9 A;  1DJH A;  1GQM A;  3TUY C;  2MJW B;  3N7H A;  2M49 B;  2K61 A;  2L4I A;  1W9Z A;  5G08 A;  5KTY A;  4U8D A;  1UUR A;  1ZFS A;  2M3W A;  1K93 D;  2PSR A;  4YI9 A;  4TNC A;  1TUJ A;  2KLD A;  2FOT A;  3DVE A;  1YUR A;  3PN7 C;  2D8N A;  2OTG C;  1F55 A;  1SMG A;  2KYC A;  3BUX B;  1KK7 Y;  3B7A A;  1JF2 A;  2H61 A;  2M1K B;  1QAT A;  1SRA A;  1VRK A;  1WLZ A;  1SNL A;  1YRT B;  2G2B A;  2K0J A;  3KEV A;  3OP0 A;  4XYN A;  4OCI A;  3DY9 A;  1TIZ A;  3S0F A;  2OPO A;  1M39 A;  1YRU B;  2E6W A;  1UHK A;  2I18 A;  1DF0 B;  2JT0 A;  2JTT A;  2L2C A;  3A8R A;  1DTL A;  2FCE A;  2GGM A;  1LA0 A;  1BF5 A;  1NCX A;  1OOH A;  5AAN A;  4NDD A;  4YGD B;  1KSO A;  1AK8 A;  5CSF A;  4CID A;  5AFP A;  1ORG A;  4N5X A;  4NDB A;  1SL7 A;  1UHI A;  1ODB A;  1DVI A;  1CDL A;  4CLN A;  1XFY O;  2LLT A;  3BFB A;  4ORC B;  2EHB A;  3OGN A;  2KI6 C;  5CSI A;  1WRZ A;  1XFZ O;  2JUL A;  3CDN A;  1BOC A;  1G8I A;  3NSI A;  1Y1X A;  1R6P A;  2K8M B;  1M31 A;  3AAJ A;  4M2P A;  4N1F A;  2K7C A;  3HX4 A;  2JQ6 A;  2QPT A;  1Z2C B;  1SBJ A;  3JVT C;  1DQE A;  1TRF A;  2PVB A;  3E3R A;  4F0Z B;  2JNF A;  2QEO A;  4PHN A;  3CR5 X;  4ETO A;  1PVA A;  4GBA A;  1S6J A;  3B86 A;  1W7I B;  2KI4 B;  4GGF C;  2LLS A;  2JU0 A;  1CLM A;  5HYD A;  1AJ4 A;  3DF0 A;  1YUT A;  2KFH A;  2Y5I A;  3A4U B;  1DJI A;  1G33 A;  1J55 A;  4YGB B;  1B9A A;  1K9P A;  1SR6 B;  2ZRS A;  1A2X A;  2WCL A;  1K2H A;  1QVI Z;  1JC2 A;  1SY9 A;  1DGU A;  1J7P A;  1OE9 B;  4M2O A;  2KAV A;  2VRG A;  3BUO B;  3NXA A;  3CR4 X;  4NDC A;  3VRN A;  1QWV A;  3VRP A;  1JBA A;  2LHL A;  1AUI B;  1LIN A;  1OOJ A;  1S5G Z;  2ZNE A;  4F7F A;  2ZKM X;  1K96 A;  2K7D A;  3CYZ A;  4MRX A;  2QEH A;  2NXQ A;  1B7T Y;  2BEC A;  5FYX A;  4MRY A;  2M1U A;  3PM8 A;  4JD9 A;  2MHH A;  4FQT A;  4AOM A;  1SW8 A;  1CNP A;  2AMI A;  1PVB A;  3ZWH A;  1F54 A;  4WRI A;  3LLE A;  2M7L A;  4OKH A;  1MHO A;  2ZRT A;  3JTD B;  4C0K A;  3DVK A;  2LMU A;  2JT3 A;  1Y0V H;  2CTN A;  3O78 A;  4HRG A;  5DKQ A;  5I2L A;  3SS3 A;  1CFC A;  3O4Y A;  1XFW O;  3D10 A;  1OZS A;  2ERB A;  2KI4 C;  2L98 A;  1NPQ A;  2Y1M A;  5GQQ C;  1DJW A;  3EVU A;  1IRJ A;  2WCK A;  1ALW A;  4PHM A;  1MXL C;  2HQW A;  4YRU A;  1NCZ A;  3CAB A;  3SS5 A;  2CNP A;  3O6B A;  1IJ5 A;  1SR6 C;  2A4J A;  1F4O A;  1GGW A;  1B1G A;  2DOQ A;  1CDM A;  1DJG A;  1PUL A;  3PSR A;  4WQ2 A;  4WQ3 A;  5I2Q A;  2NCP A;  3WHT B;  1F8H A;  1XFR A;  3V2L A;  3D78 A;  2TN4 A;  5IBW A;  1QJT A;  1CM1 A;  1SL8 A;  2QEB A;  3EK4 A;  4ZCU A;  2PRU A;  1PRW A;  5HKW A;  4QJ5 B;  5D3O A;  1BT6 A;  1U5I A;  4A4C A;  3I5G C;  3LK1 A;  2ZFD A;  1DEL A;  3B87 A;  1IKU A;  1ZAC A;  3L47 A;  4GGF A;  2JPO A;  3O4X A;  2GGZ A;  4KYN A;  5HLO A;  3SG5 A;  1V1F A;  3B6X A;  2L2E A;  2G9B A;  2KSP A;  2L4H A;  3JTD C;  4L9M A;  1MWN A;  1BR4 B;  1QX7 A;  1M46 A;  5FI2 A;  1EL4 A;  1M45 A;  2F2O A;  3VB1 A;  1CB1 A;  1J1D A;  1TCF A;  3FE6 A;  2MBX A;  1FPW A;  1KK8 B;  4JWQ A;  1QXP A;  1BR1 B;  5PAL A;  3Q8I A;  3EG5 B;  3R1V A;  4I5L B;  4YGE B;  1MR8 A;  5I8N A;  5CSJ A;  1DF0 A;  2MRD A;  2WC5 A;  2O60 A;  1IJ6 A;  1DEK A;  1RFJ A;  3I5F B;  1XFX O;  1QIV A;  2KNE A;  1EH2 A;  3AKB A;  1FW4 A;  3D0Y B;  1S36 A;  4YBH B;  4IL1 A;  3L4A A;  2Q91 A;  1Q80 A;  1SCM B;  1SL9 A;  2LP2 A;  5I2O A;  1JFJ A;  1XA5 A;  3S0A A;  2LM5 A;  2LE9 B;  2YGU A;  1YUS A;  2KQ6 A;  1F4Q A;  2M0R A;  4MEW A;  1CM4 A;  2ISD A;  2LAP A;  3R1P A;  1D1O A;  3NSL A;  3OBV A;  2LMT A;  4GNK B;  3BOW A;  5BPJ A;  2LUC A;  1OOG A;  2HQ8 A;  3FWB A;  1TN4 A;  1BLQ A;  1CDN A;  4QJ3 B;  4MZJ A;  1IQ5 A;  2QAC A;  1NX3 A;  4I5J A;  1JF0 A;  1KQV A;  5D69 A;  3SS4 A;  3I5H C;  1SPY A;  3EVV A;  2KDH A;  3SJS A;  1J7R A;  2H2K A;  4C0J A;  3VRR A;  1NWD A;  3EK8 A;  2LUX A;  3KF9 A;  1KK8 C;  2Q4U A;  3NSO A;  1OMV A;  3PAL A;  2BCX A;  1WLM A;  4ICB A;  3RZS A;  4DRW A;  1NX2 A;  1UHJ A;  4NQG A;  3IVT A;  1OOF A;  1J1E A;  2COL B;  3BFA A;  1TNW A;  4PE4 A;  3VRQ A;  2FCD A;  3FIA A;  5F6T A;  3I5F C;  2WC8 A;  3FE8 A;  2QEV A;  3LK0 A;  1PSB A;  3OX6 A;  4D1E A;  4QJ4 B;  1CFD A;  2JRF A;  1GJY A;  2Y1N A;  2JOJ A;  3UNW A;  2BCA A;  1RTP 1;  1N0Y A;  1Y1U A;  3CLN A;  1JUO A;  1SCM C;  1CMG A;  3H4S E;  2JXL A;  3BFH A;  3CTN A;  3I5H B;  4CFR A;  2WND A;  1IWQ A;  4I5N B;  1SYM A;  1N2D A;  5D7F A;  2JWW A;  1NCY A;  1QLS A;  2NZ0 A;  4INX A;  5DKR A;  2NLN A;  5AEQ A;  2ZND A;  1HQV A;  4OV2 A;  1Y6W A;  4MLW A;  4CPV A;  4FTG A;  4OVN F;  3EK7 A;  3AKA A;  4M2Q A;  2Y4Q A;  1TUZ A;  4OZD A;  1JWD A;  2GTE A;  3TZ1 A;  2KBM A;  1QIW A;  1AJ5 A;  1TCO B;  2KBI A;  4HRE E;  3C1V A;  5AER A;  1M63 B;  2KAX A;  2O5G A;  2BE6 A;  2JC2 A;  4JKT A;  2NCO A;  2E30 A;  1C7W A;  1KFU L;  2F3Z A;  1JFK A;  2LAN A;  2LVK A;  1BOD A;  5ER5 A;  1WDC B;  1KFU S;  1F70 A;  2OS8 B;  2CT9 A;  1P28 A;  5CSN A;  4DUQ A;  3CWG A;  4BY4 A;  1B8C A;  1MUX A;  4PCW A;  5HKZ A;  5JJG A;  3AAK A;  3SIB A;  4MZK A;  4E68 A;  3GK1 A;  1TTX A;  1OW4 A;  1QLK A;  3K21 A;  4MVF A;  4XJK A;  5B8I B;  1F71 A;  1EG4 A;  1ZUZ A;  2LVJ A;  1HT9 A;  2QDI A;  2V53 A;  1NYA A;  1NSH A;  1OOI X;  1XO5 A;  3S0G A;  1GGZ A;  1NUB A;  2L51 A;  4PDZ A;  1A29 A;  1CDP A;  1H8B A;  5HLV A;  1T14 A;  1MXE A; 
#chains in the Genus database with same CATH homology
 1IG5 A;  1QV0 A;  2LVI A;  3GK2 A;  4YI8 A;  1DMO A;  1AVS A;  1UWO A;  4A4B A;  1KCY A;  1K9U A;  1QX2 A;  2IS9 A;  1Y1A A;  4YGC B;  1B4C A;  2F3Y A;  2M8U A;  1KSM A;  5KSZ A;  2I2R E;  2KFG A;  2WOR A;  3QRX A;  3EKJ A;  2K7O A;  1PAL A;  1KWO B;  1LKJ A;  2KFF A;  3PAT A;  4GAO A;  1WRL A;  2BE4 A;  4JQ0 D;  1SCV A;  1YTZ C;  3PN7 B;  1XVJ A;  3CS1 A;  1N65 A;  1AHR A;  2OTG B;  1IGV A;  2LHI A;  3LL8 B;  3GOF A;  3D0Y A;  5TNC A;  2RGI A;  1QX5 B;  2JXC A;  2F2P A;  2M97 A;  4PE0 A;  2P6B B;  1WDC C;  1QS7 A;  2OS8 C;  1B8R A;  2AAO A;  1OZO A;  2BBM A;  2MLE C;  2CCM A;  1R2U A;  4P2Y B;  2L50 A;  1CFF A;  2R2I A;  1FI5 A;  1DT7 B;  2M9G A;  1S3P A;  1A75 B;  4MN0 A;  5KU1 A;  1BG1 A;  1LA3 A;  2K2F A;  2FJU B;  3DVJ A;  2CXJ A;  2BL0 B;  1KQM B;  1KK7 Z;  1CTR A;  2LCP A;  2BKH B;  1BJF A;  3IQO A;  1TNQ A;  1UP5 A;  1BU3 A;  1DJZ A;  3TDI A;  3BQ3 A;  3LCP C;  3SG2 A;  2KAY A;  1S6I A;  4FQO A;  1CKK A;  1EG3 A;  1EJ3 A;  3WNX B;  2MA2 A;  2JTZ A;  1PSR A;  1XFV O;  1YVH A;  1KWO C;  3JVT B;  5ER4 X;  5K89 A;  1DGV A;  1CLB A;  1X02 A;  2HET A;  2WCB A;  1MQ1 A;  1TOP A;  1U5I B;  1XYD A;  3O2P A;  4PHK A;  2KI6 D;  2I7A A;  2KGB C;  4GUK A;  1UHN A;  1CMF A;  1FF1 A;  1OMR A;  1YX7 A;  1UHH A;  1L7Z A;  2PAS A;  3KO0 A;  2JNX A;  1RRO A;  3OX5 A;  1J7O A;  4ORA B;  1B8L A;  1K95 A;  3E3R A;  1RWY A;  3BUM B;  1LVC D;  2L5X B;  1REC A;  2KYF A;  1KFX L;  2SCP A;  4GFT A;  4ZCV A;  3TS5 B;  4AQI A;  1UUS A;  4PE1 A;  1KFX S;  1YVL A;  1XFU O;  3VGO A;  3BUW B;  1CLL A;  4R1E A;  3FWC A;  2LVV A;  1B47 A;  3TDZ A;  1IQ3 A;  1K94 A;  2JT8 A;  4C0L A;  2BL0 C;  2PMY A;  1KQM C;  3BXK A;  3DD4 A;  1XK4 C;  1E8A A;  1FBV A;  4YGA A;  1NP8 A;  1FI6 A;  3I5I B;  3SG6 A;  1QAS A;  4MSP A;  3GK4 X;  1OMD A;  1DJY A;  1YX8 A;  5HKY A;  1NX0 A;  2F33 A;  2HPS A;  1AP4 A;  4DIR A;  3NSK A;  3HCM A;  2JPT A;  1B7T Z;  3BOW B;  1L2O B;  5CPV A;  3RM1 A;  1LXF C;  1OSA A;  3SIA A;  2MLF C;  3M0W A;  3VRO A;  1ZMZ A;  1WY9 A;  2LLU A;  3OB1 B;  2LC5 A;  1C7V A;  2K2A A;  2M29 A;  1H4B A;  1NX1 A;  2EC6 B;  2BKI B;  4GGN A;  4GPL B;  2WOS A;  3PLF B;  1W7J B;  1V1G A;  2KQY A;  3TS5 C;  4HSZ A;  2HF5 A;  5DKN A;  2LMV A;  1QVI Y;  2M7N A;  1RJV A;  3BUN B;  2EGD A;  2KHN A;  4CFQ A;  3IF7 A;  3BYA A;  2MAZ A;  1S5G Y;  3WHU B;  1TNX A;  3IQQ A;  1MF8 B;  1QV1 A;  3WXA A;  4DS7 A;  3DF0 B;  1C07 A;  3I5I C;  4I5K A;  2H61 C;  3I5G B;  4PAL A;  2BBN A;  3SG4 A;  1K9K A;  4MZL A;  2LNK A;  3OB2 B;  2WCF A;  2ZN8 A;  1EXR A;  4PHJ A;  3KPX A;  2CBL A;  2LV7 A;  3KHE A;  1K8U A;  1L2O C;  2ZN9 A;  5AXI A;  3TUY B;  1SK6 D;  4MBE A;  1ZOT B;  3SG3 A;  2BCB A;  3TDU A;  1A75 A;  2KOT A;  4HRH A;  5J3X A;  1S6C A;  3EVR A;  1SKT A;  2EC6 C;  1A03 A;  1CFP A;  4N1G A;  3FS7 A;  3RLZ A;  1NIW A;  1S26 D;  2K7B A;  2AUC A;  1XK4 A;  1A4P A;  1WRK A;  2PAL A;  1S1E A;  2F8P A;  1YR5 A;  2L0P A;  2GV5 A;  1K90 D;  4PE7 A;  3ICB A;  3F45 A;  4Q04 A;  3CGA A;  2WCE A;  4OR9 B;  2JZI A;  4UPG A;  3PFV A;  3CR2 A;  4JPZ B;  1IH0 A;  1QTX A;  1RK9 A;  1DJX A;  2I94 A;  4XJK B;  1G4Y R;  3SG7 A;  1PK0 D;  2B1U A;  2LP3 A;  3DVM A;  3CZT X;  3OHM B;  4P5O E;  4BY5 A;  4DCK A;  3MSE B;  5JOL A;  1J7Q A;  2SAS A;  4USL A;  4ORB B;  3EKH A;  1JSA A;  1OQP A;  1YUU A;  1ALV A;  1TNP A;  4AQJ A;  1BMO A;  2KGR A;  1DJH A;  1GQM A;  3TUY C;  2MJW B;  2M49 B;  2K61 A;  2L4I A;  5G08 A;  5KTY A;  4U8D A;  1UUR A;  1ZFS A;  2M3W A;  1K93 D;  2PSR A;  4YI9 A;  4TNC A;  2FOT A;  3DVE A;  1YUR A;  3PN7 C;  2D8N A;  2OTG C;  1F55 A;  1SMG A;  2KYC A;  3BUX B;  1KK7 Y;  1JF2 A;  2H61 A;  2M1K B;  1QAT A;  1SRA A;  1VRK A;  1WLZ A;  1SNL A;  1YRT B;  2G2B A;  2K0J A;  3KEV A;  3OP0 A;  4XYN A;  4OCI A;  1TIZ A;  2OPO A;  1M39 A;  1YRU B;  2E6W A;  1UHK A;  2I18 A;  1DF0 B;  2JT0 A;  2JTT A;  3A8R A;  1DTL A;  2FCE A;  2GGM A;  1LA0 A;  1BF5 A;  1NCX A;  5AAN A;  4NDD A;  4YGD B;  1KSO A;  1AK8 A;  5CSF A;  4CID A;  5AFP A;  4N5X A;  4NDB A;  1SL7 A;  1UHI A;  1ODB A;  1DVI A;  1CDL A;  1XFY O;  2LLT A;  4ORC B;  2EHB A;  5CSI A;  2KI6 C;  1BOC A;  1WRZ A;  1XFZ O;  2JUL A;  1G8I A;  3NSI A;  1Y1X A;  1R6P A;  2K8M B;  1M31 A;  3AAJ A;  4M2P A;  4N1F A;  2K7C A;  3HX4 A;  2JQ6 A;  2QPT A;  4CLN A;  1SBJ A;  3JVT C;  1TRF A;  2PVB A;  4F0Z B;  2JNF A;  4PHN A;  3CR5 X;  4ETO A;  1PVA A;  4GBA A;  1S6J A;  4GGF C;  1W7I B;  2KI4 B;  2LLS A;  2JU0 A;  1CLM A;  5HYD A;  1AJ4 A;  3DF0 A;  1YUT A;  2KFH A;  2Y5I A;  3A4U B;  1DJI A;  1G33 A;  1J55 A;  4YGB B;  1B9A A;  1K9P A;  1SR6 B;  2ZRS A;  1A2X A;  1K2H A;  1QVI Z;  1JC2 A;  1SY9 A;  1DGU A;  1J7P A;  1OE9 B;  4M2O A;  2KAV A;  2VRG A;  3BUO B;  3NXA A;  3CR4 X;  4NDC A;  3VRN A;  3VRP A;  1JBA A;  2LHL A;  1AUI B;  1LIN A;  1OOJ A;  1S5G Z;  2ZNE A;  2ZKM X;  1K96 A;  2K7D A;  4MRX A;  2NXQ A;  1B7T Y;  2BEC A;  5FYX A;  4MRY A;  2M1U A;  3PM8 A;  2MHH A;  4AOM A;  1SW8 A;  1CNP A;  2AMI A;  1PVB A;  3ZWH A;  1F54 A;  4WRI A;  3LLE A;  2M7L A;  4OKH A;  1MHO A;  2ZRT A;  3JTD B;  4C0K A;  3DVK A;  2LMU A;  2JT3 A;  1Y0V H;  2CTN A;  3O78 A;  4HRG A;  5DKQ A;  5I2L A;  1CFC A;  3O4Y A;  1XFW O;  3D10 A;  1OZS A;  2KI4 C;  2L98 A;  1NPQ A;  2Y1M A;  5GQQ C;  1DJW A;  3EVU A;  1IRJ A;  4PHM A;  1ALW A;  1MXL C;  2HQW A;  4YRU A;  1NCZ A;  2CNP A;  3O6B A;  1IJ5 A;  1SR6 C;  2A4J A;  1F4O A;  1GGW A;  1B1G A;  2DOQ A;  1CDM A;  1DJG A;  1PUL A;  3PSR A;  4WQ2 A;  4WQ3 A;  5I2Q A;  2NCP A;  3WHT B;  1F8H A;  2TN4 A;  5IBW A;  1QJT A;  1CM1 A;  1SL8 A;  3EK4 A;  4ZCU A;  2PRU A;  1PRW A;  5HKW A;  4QJ5 B;  1BT6 A;  1U5I A;  4A4C A;  3I5G C;  3LK1 A;  2ZFD A;  1IKU A;  1ZAC A;  4GGF A;  2GGZ A;  3SG5 A;  5HLO A;  1V1F A;  2L2E A;  2G9B A;  2KSP A;  2L4H A;  3JTD C;  4L9M A;  1MWN A;  1BR4 B;  1QX7 A;  1M46 A;  1EL4 A;  1M45 A;  2F2O A;  1FPW A;  1CB1 A;  1J1D A;  1TCF A;  2MBX A;  1KK8 B;  4JWQ A;  1QXP A;  1BR1 B;  5PAL A;  4I5L B;  4YGE B;  1MR8 A;  5I8N A;  5CSJ A;  1DF0 A;  2MRD A;  2O60 A;  1IJ6 A;  1RFJ A;  3I5F B;  1XFX O;  1QIV A;  2KNE A;  1EH2 A;  3AKB A;  1FW4 A;  3D0Y B;  1S36 A;  4YBH B;  4IL1 A;  5I2O A;  2Q91 A;  1Q80 A;  1SCM B;  1SL9 A;  2LP2 A;  1JFJ A;  1XA5 A;  2LM5 A;  2LE9 B;  1YUS A;  2KQ6 A;  1F4Q A;  2M0R A;  4MEW A;  1CM4 A;  2ISD A;  2LAP A;  1D1O A;  3NSL A;  2LMT A;  4GNK B;  3BOW A;  5BPJ A;  2LUC A;  2HQ8 A;  3FWB A;  1TN4 A;  1BLQ A;  1CDN A;  4QJ3 B;  4MZJ A;  1IQ5 A;  2QAC A;  1NX3 A;  4I5J A;  1JF0 A;  1KQV A;  5D69 A;  3I5H C;  1SPY A;  3EVV A;  2KDH A;  3SJS A;  1J7R A;  2H2K A;  4C0J A;  3VRR A;  1NWD A;  3EK8 A;  2LUX A;  3KF9 A;  1KK8 C;  2Q4U A;  3NSO A;  1OMV A;  3PAL A;  2BCX A;  1WLM A;  4ICB A;  4DRW A;  1NX2 A;  1UHJ A;  4NQG A;  1J1E A;  2COL B;  3VRQ A;  1TNW A;  4PE4 A;  2FCD A;  3FIA A;  5F6T A;  3I5F C;  2WC8 A;  3LK0 A;  3OX6 A;  1PSB A;  4D1E A;  4QJ4 B;  1CFD A;  2JRF A;  1GJY A;  2Y1N A;  2JOJ A;  2BCA A;  1RTP 1;  1N0Y A;  1Y1U A;  3CLN A;  1JUO A;  1SCM C;  1CMG A;  3H4S E;  2JXL A;  3CTN A;  3I5H B;  4CFR A;  2WND A;  1IWQ A;  4I5N B;  1SYM A;  1N2D A;  5D7F A;  2JWW A;  1NCY A;  1QLS A;  2NZ0 A;  5DKR A;  2NLN A;  5AEQ A;  2ZND A;  1HQV A;  4OV2 A;  1Y6W A;  4MLW A;  4CPV A;  4FTG A;  4OVN F;  3EK7 A;  3AKA A;  4M2Q A;  2Y4Q A;  1JWD A;  3TZ1 A;  2KBM A;  1QIW A;  1AJ5 A;  1TCO B;  2KBI A;  4HRE E;  3C1V A;  5AER A;  1M63 B;  2KAX A;  2O5G A;  2BE6 A;  2JC2 A;  2NCO A;  2E30 A;  1C7W A;  1KFU L;  2F3Z A;  1JFK A;  2LAN A;  2LVK A;  1BOD A;  5ER5 A;  1WDC B;  1KFU S;  1F70 A;  2OS8 B;  2CT9 A;  5CSN A;  4DUQ A;  3CWG A;  4BY4 A;  1B8C A;  1MUX A;  4PCW A;  5HKZ A;  5JJG A;  3AAK A;  3SIB A;  4MZK A;  4E68 A;  3GK1 A;  1TTX A;  3K21 A;  1QLK A;  4MVF A;  4XJK A;  5B8I B;  1F71 A;  1EG4 A;  1ZUZ A;  2LVJ A;  1HT9 A;  2V53 A;  1NYA A;  1NSH A;  1XO5 A;  1GGZ A;  1NUB A;  2L51 A;  4PDZ A;  1A29 A;  1CDP A;  1H8B A;  5HLV A;  3ZNI A;  1MXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...