2MHHA

Solution structure of a ef-hand domain from sea urchin polycystin-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'GGLVPRGSHMASKRDKIADIQEALAHADANADQHLDFDEWRQELKCRGHADADIEAVFAKYDVDGDRVLDAEEQMKMAHDLEGQKSDLNNQLAELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycystic kidney disease protein 2
publication title The number and location of EF hand motifs dictates the calcium dependence of polycystin-2 function.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Metal binding protein
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2mhhA00
1J1EA 2BCBA 4BY5A 4HRHA 2L98A 2JNXA 2LANA 4GAOA 1AP4A 1MUXA 2BE4A 1KQVA 5DKQA 1S6CA 2MJWB 4PCWA 1HQVA 1YR5A 1MF8B 4CFQA 1AUIB 2HETA 1S3PA 1TCOB 2LVVA 1SL8A 4PE1A 4DCKA 4FTGA 1TOPA 1TN4A 1SYMA 1UHHA 2JU0A 3NXAA 1QIWA 3DVMA 2JTZA 2SASA 1CLLA 3FWCA 1CFCA 3ICBA 2ZN8A 2BECA 4I5KA 1GGZA 1X02A 1OQPA 3FS7A 5CSIA 1J7QA 1YUUA 3VRNA 3I5HC 3LLEA 3PN7B 1BF5A 1LA3A 2WORA 4NDCA 1CLMA 1DGVA 2LP3A 1TTXA 1H8BA 4JWQA 1OMVA 1XFZO 1G8IA 1GGWA 1XYDA 2KI6C 1ZUZA 1NPQA 1LA0A 3TUYC 5AANA 1PULA 1FW4A 2WCFA 3DF0B 2JOJA 1PVAA 1SL7A 1DJXA 2MAZA 3I5HB 4QJ3B 4HRGA 1CMGA 2M9GA 1QV0A 5TNCA 5DKNA 3SG3A 3TDZA 4UPGA 2LUXA 4YGAA 2RGIA 2MA2A 3VGOA 5KU1A 1B8RA 2LCPA 4XJKB 3TUYB 3VRQA 4TNCA 1YX8A 5JJGA 2P6BB 1B7TY 2LMUA 2KNEA 4MN0A 2L51A 2SCPA 1W7IB 4E68A 1CFPA 1TNWA 2PASA 4N5XA 1CTRA 1ALWA 3PM8A 1IG5A 4OR9B 1U5IB 3VROA 2Q91A 1TNPA 3SG7A 2JXCA 2K2FA 3EKHA 1Y0VH 1Y1UA 4MEWA 1KWOC 2F3ZA 2Y1NA 4AQIA 2F3YA 2OS8B 3D0YB 1KK7Y 1SCMC 4JQ0D 1QTXA 4M2QA 4PDZA 2M3WA 4GUKA 1YURA 1B9AA 1UHNA 2WC8A 2O60A 5DKRA 2JWWA 1JWDA 3DVEA 4CFRA 3M0WA 3EVRA 2JULA 4GGFC 4NQGA 1A29A 1A75A 1WRKA 1S5GY 2JRFA 1XFYO 1JF2A 3DVJA 3OX5A 1KWOB 4MSPA 2NCPA 1WLMA 2JC2A 3BUMB 1CDNA 4L9MA 1D1OA 2ZRSA 2LC5A 3DF0A 1YX7A 2BBMA 4PHJA 3LL8B 1F4QA 2IS9A 3JVTB 4I5JA 1EXRA 3TS5C 4USLA 3JTDC 1BR4B 2PRUA 2KOTA 2NZ0A 4WQ2A 1FI5A 1IH0A 1FPWA 1CDPA 2R2IA 4XJKA 1YUTA 2HF5A 2ISDA 2Q4UA 2L2EA 5HLOA 1UUSA 1J55A 1DJIA 1TIZA 3CR5X 3WXAA 3TDUA 1B1GA 4AOMA 2BCAA 3LCPC 2HQ8A 1EJ3A 1YUSA 4IL1A 1U5IA 4PE7A 1K9UA 5I2OA 1AHRA 3BOWB 1UHIA 4AQJA 3A8RA 1PRWA 1S36A 1K8UA 5I8NA 1TNQA 3D0YA 4HREE 3CR2A 2JT0A 3A4UB 3O6BA 1IGVA 2LMTA 3I5GC 4GGNA 1KK7Z 5I2LA 1YVLA 1PK0D 1QASA 2BL0C 1RWYA 2GGMA 4GBAA 1PVBA 1CM4A 1C7WA 1K2HA 5AEQA 1WLZA 2BKIB 1S6JA 5ER5A 1F54A 1S5GZ 2KBIA 1OE9B 3I5GB 1QX5B 2K7OA 1L2OB 2PMYA 1K95A 2CT9A 2JXLA 4OV2A 1QJTA 2K8MB 1EL4A 2M29A 4GGFA 1SK6D 1HT9A 2KSPA 1BLQA 1FF1A 1IWQA 1S1EA 3EK4A 1LINA 1M45A 3H4SE 3HCMA 2COLB 4YI9A 1K94A 1LXFC 5HKWA 5ER4X 5HKYA 1SPYA 1CM1A 2K61A 2MLFC 4A4BA 4QJ4B 2BKHB 3SIAA 1IRJA 2V53A 1A75B 3NSIA 3O2PA 5F6TA 2F2PA 2DOQA 2BE6A 3TZ1A 3EK7A 5CSFA 3ZWHA 5GQQC 2I2RE 2QPTA 3BOWA 3PSRA 2F8PA 3OX6A 1H4BA 3LK0A 1QVIY 1B47A 2F2OA 1JFKA 2AAOA 2LV7A 4ZCVA 3GK2A 1AJ5A 4DS7A 5AFPA 2JPTA 3DVKA 2K7DA 4PE0A 4U8DA 5CSJA 5AERA 2JQ6A 2JT3A 3SG2A 1CFDA 3KF9A 2KI4C 1B8CA 1F4OA 3CR4X 2LNKA 4FQOA 1CLBA 2E30A 1QLSA 1KQMC 4YGDB 3CTNA 2AUCA 1GQMA 2KI6D 1QATA 4C0KA 3D10A 4M2PA 4A4CA 1QIVA 1SL9A 1TCFA 2LVKA 1IQ5A 2CNPA 2LVIA 1BODA 2EC6C 1MHOA 1M46A 2M1KB 2KAXA 1QV1A 1UHKA 2KGRA 3O78A 2H61C 1WRLA 4NDDA 1SKTA 3NSOA 1J7PA 3BYAA 1IJ6A 3OHMB 3KHEA 4YRUA 4MVFA 5D7FA 1JFJA 1DJHA 1M63B 1R6PA 2B1UA 2KHNA 2JZIA 3EVVA 1DF0B 1MXLC 4WRIA 5FYXA 3AKAA 3IQOA 1ODBA 2Y5IA 1UHJA 5HKZA 1E8AA 1R2UA 3K21A 2LP2A 1UWOA 1WRZA 2EHBA 1KK8C 3I5FC 1SCMB 3EK8A 1S6IA 4NDBA 2LLSA 2KYFA 1SRAA 2E6WA 5JOLA 1JF0A 2M7NA 1CB1A 1J7OA 3ZNIA 1QVIZ 3BXKA 2WCEA 1F70A 1DTLA 1XFXO 1BMOA 1XFUO 2G2BA 1B4CA 1XO5A 4PHKA 1CDLA 1JBAA 1Y1XA 2JNFA 2KBMA 1SMGA 2LMVA 2GV5A 1TRFA 2KAVA 2L4IA 2ZNDA 3OB2B 4CLNA 3TS5B 1UURA 3JTDB 1OSAA 1DMOA 5HLVA 4YGBB 2PSRA 2BBNA 3IQQA 1RFJA 1CFFA 3SG5A 5K89A 1Y6WA 1S26D 2MRDA 1XK4C 2PVBA 1J7RA 1KFUS 1XVJA 2L0PA 1CNPA 4YGCB 2D8NA 2LLTA 1NIWA 3EKJA 1DF0A 3KEVA 3SJSA 3GK1A 5CPVA 3F45A 1A2XA 1NYAA 2LM5A 3CS1A 1JC2A 3KPXA 2M97A 1CDMA 2LAPA 2H61A 1OOJA 1K9PA 1RJVA 2I18A 2KAYA 1Y1AA 1LKJA 1NSHA 2CTNA 1NX1A 2L4HA 3PATA 4ETOA 3PLFB 2BL0B 1NX2A 1MQ1A 1SNLA 1DGUA 4C0JA 4N1FA 2WNDA 1L7ZA 3KO0A 3VRRA 1YRUB 1LVCD 4N1GA 5HYDA 1KFXS 4P5OE 5IBWA 4MZKA 4R1EA 4MLWA 4ZCUA 2M7LA 3AKBA 5I2QA 1NWDA 1MXEA 1SY9A 2EGDA 2K7CA 1QX7A 2LE9B 3RM1A 3C1VA 2KFGA 1K96A 1MWNA 3BUNB 3NSLA 2AMIA 1WDCC 2KQ6A 2M0RA 1KCYA 3PN7C 3WHTB 3PFVA 4PHMA 1QXPA 4ORAB 1F8HA 1KFUL 4DUQA 2KFHA 1A03A 1KSOA 2I94A 2FCEA 4WQ3A 2LHIA 4MZLA 1YVHA 1G33A 4CIDA 3O4YA 3FWBA 2CBLA 4CPVA 4D1EA 5G08A 2FJUB 4F0ZB 1Q80A 1OMDA 1XFVO 4MBEA 2QACA 2K0JA 1DVIA 1W7JB 1WDCB 2ZRTA 1ZOTB 1A4PA 3NSKA 2M49B 1DJWA 1OZSA 3DD4A 1EG4A 1CMFA 2F33A 3SG4A 3I5IC 5PALA 2LVJA 1XK4A 1DT7B 1K93D 1XA5A 2LUCA 3GOFA 4M2OA 1YTZC 2BCXA 3WNXB 2NLNA 1SCVA 4MZJA 2ZKMX 3MSEB 4ORBB 2KI4B 1BT6A 1OMRA 2NXQA 3GK4X 1UP5A 3CGAA 1KFXL 3I5IB 2O5GA 4PE4A 1RK9A 5BPJA 3HX4A 1KQMB 4JPZB 1AJ4A 4GNKB 1NCYA 4OVNF 1M39A 1MR8A 1SBJA 3SG6A 3CWGA 4BY4A 4OCIA 1DJGA 3FIAA 2L5XB 2OS8C 4PHNA 1M31A 2ZNEA 1NCZA 1V1FA 2EC6B 2KGBC 4PALA 1WY9A 1ZMZA 3BQ3A 1DJYA 5KTYA 2I7AA 4ICBA 2ZFDA 2A4JA 2NCOA 1FBVA 2ZN9A 2VRGA 3LK1A 2JTTA 1J1DA 1PSRA 3WHUB 4OKHA 3BUWB 3AAKA 2TN4A 2M1UA 1KK8B 3I5FB 3QRXA 1BJFA 4Q04A 5J3XA 1C7VA 1G4YR 2CXJA 1BR1B 2MBXA 1JSAA 1IQ3A 3VRPA 1F71A 1GJYA 1K90D 5B8IB 4GPLB 3JVTC 2WCBA 1EH2A 2G9BA 1NX3A 4XYNA 4P2YB 1SW8A 1CKKA 2OTGC 1B8LA 1RROA 2M8UA 1RECA 2H2KA 4C0LA 2KYCA 1N65A 1N0YA 4ORCB 3CLNA 1BU3A 1QX2A 1VRKA 2LHLA 4YGEB 2Y4QA 1ZFSA 1YRTB 5AXIA 1DJZA 1EG3A 1IKUA 1ZACA 1NX0A 2FOTA 2KQYA 1QLKA 4I5NB 3BUOB 1AK8A 1JUOA 4MRYA 3TDIA 4GFTA 4DRWA 1F55A 1PSBA 2MHHA 2OTGB 2CCMA 3OB1B 3BUXB 3CZTX 2HQWA 1QS7A 3IF7A 5KSZA 2GGZA 1FI6A 2FCDA 1BG1A 4DIRA 1IJ5A 2OPOA 1ALVA 2L50A 1SR6C 1RTP1 1B7TZ 1KSMA 3E3RA 4YI8A 3RLZA 2WOSA 3AAJA 2K7BA 2KDHA 2KFFA 2LLUA 2Y1MA 1V1GA 1TNXA 1K9KA 2PALA 3PALA 4YBHB 1BOCA 1PALA 3SIBA 5D69A 4MRXA 3OP0A 1N2DA 4QJ5B 2MLEC 1SR6B 2K2AA 1XFWO 4HSZA 5CSNA 1C07A 1OZOA 1L2OC 1NUBA 3EVUA 1AVSA 2HPSA 1NCXA 4I5LB 1NP8A 2JT8A
chains in the Genus database with same CATH superfamily
1J1EA 2BCBA 3QMEA 4BY5A 4HRHA 3B88A 2L98A 2JNXA 2LANA 4GAOA 1AP4A 1MUXA 2BE4A 1KQVA 5DKQA 1S6CA 2MJWB 4PCWA 1DC1A 1HQVA 1YR5A 1MF8B 4CFQA 4F7FA 1AUIB 2HETA 1S3PA 1TCOB 2LVVA 1SL8A 4PE1A 4DCKA 4FTGA 1TOPA 1TN4A 1SYMA 1UHHA 2JU0A 3NXAA 1QIWA 2ERBA 2JTZA 2QEHA 1CLLA 2SASA 3DVMA 3FWCA 3ICBA 1CFCA 2ZN8A 2BECA 4I5KA 3S0GA 1GGZA 1X02A 1OQPA 3FS7A 5CSIA 1J7QA 1YUUA 3VRNA 3I5HC 3LLEA 3PN7B 1BF5A 1LA3A 2WORA 4NDCA 2QDIA 1CLMA 1DGVA 2LP3A 1TTXA 1H8BA 3Q8IA 4JWQA 5D3OA 1OMVA 1XFZO 1G8IA 1GGWA 1XYDA 3CZ0A 2KI6C 1ZUZA 1NPQA 1LA0A 3TUYC 5AANA 1PULA 1FW4A 2WCFA 3DF0B 1DQEA 2JOJA 1PVAA 1SL7A 1DJXA 2MAZA 3I5HB 4QJ3B 3BJHA 4HRGA 3NHIA 1CMGA 2M9GA 1QV0A 5TNCA 5DKNA 3D78A 3SG3A 3TDZA 4UPGA 2LUXA 4YGAA 1ORGA 2K60A 2RGIA 2MA2A 3VGOA 5KU1A 2QEVA 1B8RA 2LCPA 4XJKB 3TUYB 3VRQA 4TNCA 1YX8A 5JJGA 2P6BB 1B7TY 3BFHA 2LMUA 1LS8A 2KNEA 4MN0A 2L51A 2SCPA 1W7IB 4E68A 1P28A 1CFPA 1TNWA 2PASA 4N5XA 1CTRA 1ALWA 3PM8A 2WCLA 1IG5A 4OR9B 1U5IB 3VROA 2Q91A 1TNPA 3SG7A 2JXCA 2K2FA 3EKHA 1Y0VH 3B87A 1Y1UA 4MEWA 1KWOC 2F3ZA 2Y1NA 4AQIA 2F3YA 2OS8B 3D0YB 1KK7Y 1SCMC 4JQ0D 1QTXA 4M2QA 4PDZA 2M3WA 4GUKA 1YURA 1B9AA 1UHNA 2WC8A 3DXLA 3V2LA 2O60A 5DKRA 2JWWA 1JWDA 3DVEA 4CFRA 3M0WA 3EVRA 2JULA 4GGFC 4NQGA 1A29A 1A75A 1WRKA 1S5GY 2JRFA 1XFYO 1JF2A 3DVJA 3OX5A 1KWOB 3R1VA 4MSPA 2NCPA 1WLMA 2JC2A 3BUMB 5FI2A 1CDNA 4L9MA 1D1OA 2ZRSA 2LC5A 3DF0A 1YX7A 2BBMA 5FI6A 4PHJA 3LL8B 1F4QA 3BFBA 2IS9A 3JVTB 4I5JA 1EXRA 3TS5C 4USLA 3JTDC 3RZSA 1BR4B 2PRUA 2KOTA 2NZ0A 4WQ2A 1FI5A 1IH0A 1FPWA 1CDPA 2R2IA 3OBVA 1YUTA 4XJKA 2HF5A 2WC5A 3PM2A 1W9ZA 1TWOA 1C3ZA 2Q4UA 2ISDA 2L2EA 5HLOA 1UUSA 2BAPA 1J55A 1DJIA 1TIZA 3CR5X 3WXAA 3TDUA 1B1GA 4AOMA 2BCAA 3LCPC 2HQ8A 1EJ3A 1YUSA 4IL1A 1U5IA 4PE7A 1K9UA 3L47A 5I2OA 1AHRA 3BOWB 1UHIA 4AQJA 3A8RA 1PRWA 1S36A 1K8UA 3OGNA 5I8NA 1TNQA 3D0YA 4HREE 3CR2A 1T14A 2JT0A 3A4UB 3O6BA 1IGVA 2LMTA 3I5GC 4GGNA 1KK7Z 4INXA 4INWA 5I2LA 1YVLA 1PK0D 2JPOA 1QASA 2BL0C 4IJ7A 1RWYA 2GGMA 4GBAA 1PVBA 3N7HA 1CM4A 1C7WA 1OOIX 1K2HA 5AEQA 1WLZA 2BKIB 1S6JA 5ER5A 2FJYA 1F54A 1S5GZ 2KBIA 1OE9B 2P70A 3I5GB 1QX5B 2K7OA 1L2OB 2PMYA 1K95A 2CT9A 2JXLA 4OV2A 1QJTA 2K8MB 1EL4A 2M29A 4GGFA 1SK6D 1HT9A 2KSPA 1BLQA 3FE9A 1FF1A 1IWQA 1S1EA 3EK4A 1LINA 1M45A 3H4SE 3HCMA 2COLB 4YI9A 1K94A 1LXFC 5HKWA 5ER4X 5HKYA 1SPYA 1CM1A 2K61A 2MLFC 4A4BA 4QJ4B 2BKHB 3SIAA 1IRJA 2L5YA 2V53A 1A75B 3NSIA 3O2PA 5F6TA 2F2PA 2DOQA 2BE6A 3TZ1A 3EK7A 5CSFA 3ZWHA 5GQQC 2I2RE 2QPTA 3BOWA 3D75A 3D76A 2F8PA 3OX6A 3PSRA 1H4BA 3LK0A 1QVIY 1B47A 2F2OA 4JD9A 1JFKA 2AAOA 2LV7A 4ZCVA 1DELA 3GK2A 1AJ5A 2H8VA 4DS7A 5AFPA 2JPTA 3VB1A 3DVKA 2K7DA 4PE0A 4U8DA 5CSJA 5AERA 2JQ6A 2JT3A 3FE8A 3SG2A 1CFDA 3KF9A 3PJIA 2KI4C 1B8CA 3FE6A 1F4OA 3CR4X 2LNKA 5FI7A 4FQOA 3SS5A 1CLBA 2WCHA 3DYEA 2E30A 1QLSA 1KQMC 4YGDB 3CTNA 2AUCA 3CZ1A 3R1PA 1GQMA 3UNWA 2KI6D 1QATA 4C0KA 3D10A 4M2PA 4A4CA 1QIVA 1SL9A 1TCFA 2LVKA 1IQ5A 2CNPA 2LVIA 1BODA 2EC6C 1MHOA 1M46A 2M1KB 2KAXA 1QV1A 1UHKA 2KGRA 2WC6A 3O78A 2BNXA 1WRLA 2H61C 4NDDA 1SKTA 3NSOA 1J7PA 3BYAA 1C3YA 1IJ6A 3OHMB 3KHEA 4YRUA 4MVFA 5D7FA 1JFJA 1DJHA 1M63B 1R6PA 2B1UA 3DY9A 2KHNA 2JZIA 3EVVA 1DF0B 1MXLC 4WRIA 5FYXA 3AKAA 3IQOA 1ODBA 2Y5IA 1UHJA 3NGVA 1E8AA 5HKZA 1R2UA 3K21A 2LP2A 1UWOA 1WRZA 2EHBA 1KK8C 3I5FC 1SCMB 3EK8A 1S6IA 3EG5B 4NDBA 2LLSA 2KYFA 1SRAA 2E6WA 5JOLA 3B86A 3D77A 1JF0A 2M7NA 1CB1A 5DICA 3S0AA 1J7OA 1OOGA 3ZNIA 3S0DA 1QVIZ 3BXKA 2QEOA 2WCEA 1F70A 1DTLA 1XFXO 1BMOA 2PQLA 1XFUO 2G2BA 1B4CA 1XO5A 4PHKA 1CDLA 1JBAA 1C7VA 1Y1XA 2JNFA 2KBMA 1SMGA 2LMVA 2GV5A 3D74A 1TRFA 2KAVA 2L4IA 2ZNDA 3OB2B 4CLNA 3TS5B 1UURA 3JTDB 3SS4A 1OSAA 2KLEA 1DMOA 5HLVA 4YGBB 2PSRA 2BBNA 3IQQA 1RFJA 1CFFA 3SG5A 5K89A 1Y6WA 1S26D 2MRDA 1XK4C 2PVBA 1J7RA 1KFUS 1XVJA 3CDNA 2L0PA 1CNPA 4YGCB 2D8NA 2LLTA 1NIWA 3EKJA 1DF0A 3KEVA 3SJSA 3R1OA 3GK1A 5CPVA 3F45A 1A2XA 1NYAA 2LM5A 3CS1A 1JC2A 3KPXA 2M97A 1CDMA 2LAPA 2H61A 1OOJA 1K9PA 1RJVA 2I18A 2KAYA 1Y1AA 1LKJA 1NSHA 2CTNA 4OZDA 1NX1A 1QWVA 2L4HA 3PATA 4ETOA 3PLFB 2BL0B 1NX2A 1MQ1A 1SNLA 1DGUA 2WCKA 4C0JA 4N1FA 2WNDA 1L7ZA 1IIOA 2L2CA 3KO0A 3VRRA 1YRUB 1LVCD 4N1GA 5HYDA 1KFXS 4P5OE 5IBWA 2WCJA 4MZKA 1DEKA 4MLWA 4R1EA 4ZCUA 3AKBA 2M7LA 5I2QA 1NWDA 3SS3A 1MXEA 1SY9A 2EGDA 2K7CA 3IVTA 1QX7A 2LE9B 3RM1A 3C1VA 2KFGA 1K96A 1MWNA 3BUNB 3NSLA 2AMIA 1WDCC 2KQ6A 2M0RA 1KCYA 3PN7C 3WHTB 3PFVA 4PHMA 1QXPA 4ORAB 1F8HA 1KFUL 4JKTA 4DUQA 2KFHA 1A03A 1KSOA 2I94A 3O4XA 2FCEA 4WQ3A 2LHIA 4MZLA 1YVHA 1G33A 4CIDA 3O4YA 3FWBA 2CBLA 4CPVA 4D1EA 5G08A 3S0FA 2FJUB 4F0ZB 1Q80A 1OMDA 1XFVO 4MBEA 2QACA 2K0JA 1DVIA 1W7JB 1WDCB 2ZRTA 1ZOTB 1A4PA 5EL2A 3NSKA 2M49B 1DJWA 1OZSA 3DD4A 1EG4A 1CMFA 2F33A 3SG4A 3I5IC 3D73A 2LVJA 5PALA 1XK4A 3UO9A 1K93D 1XA5A 1DT7B 2LUCA 3GOFA 4M2OA 3CYZA 1YTZC 2BCXA 3WNXB 2NLNA 1SCVA 4MZJA 2ZKMX 3MSEB 4ORBB 2KI4B 1BT6A 1OMRA 3B6XA 2NXQA 3GK4X 1UP5A 3CGAA 2QEBA 1KFXL 3I5IB 2O5GA 4PE4A 3S0EA 1RK9A 5BPJA 3HX4A 3BFAA 1KQMB 1SSEB 4JPZB 1AJ4A 4GNKB 1NCYA 4OVNF 1M39A 1MR8A 1SBJA 3SG6A 2KPHA 3B7AA 3CWGA 3L4LA 4BY4A 3R72A 4OCIA 1DJGA 3FIAA 2L5XB 2OS8C 4PHNA 1M31A 2ZNEA 1NCZA 1V1FA 2EC6B 2KGBC 4PALA 1WY9A 1ZMZA 3BQ3A 2PYQA 1DJYA 5KTYA 1TUJA 2I7AA 4ICBA 2ZFDA 2A4JA 2NCOA 1FBVA 2ZN9A 2VRGA 3K1EA 3L4AA 2JTTA 3LK1A 4PT1A 1OW4A 1J1DA 1PSRA 2YGUA 3WHUB 4OKHA 3BUWB 3AAKA 2TN4A 2M1UA 1KK8B 3CZ2A 3I5FB 1BJFA 3QRXA 4Q04A 5J3XA 1G4YR 2CXJA 1BR1B 2MBXA 1JSAA 1IQ3A 3VRPA 1F71A 1GJYA 1K90D 1Z4HA 5B8IB 4GPLB 1XFRA 4FQTA 5HL1A 3JVTC 2WCBA 1EH2A 2G9BA 1NX3A 4XYNA 4P2YB 1SW8A 1CKKA 2OTGC 1B8LA 1RROA 2M8UA 1RECA 2H2KA 4C0LA 2KYCA 1N65A 1N0YA 4ORCB 3CLNA 1BU3A 1QX2A 1VRKA 2LHLA 4YGEB 2Y4QA 1ZFSA 1YRTB 5AXIA 1DJZA 1EG3A 1IKUA 1ZACA 1NX0A 2FOTA 2KQYA 1QLKA 4I5NB 3BUOB 1AK8A 1JUOA 4MRYA 3TDIA 1Z2CB 4GFTA 4DRWA 1F55A 1PSBA 2MHHA 2OTGB 2CCMA 3OB1B 3BUXB 3CZTX 5I94A 2HQWA 1QS7A 3IF7A 5KSZA 2GGZA 1FI6A 2FCDA 3DZTA 1BG1A 3CABA 4DIRA 1IJ5A 2OPOA 1ALVA 2L50A 1SR6C 1RTP1 1B7TZ 1KSMA 3E3RA 4YI8A 3RLZA 2WOSA 2P71A 3AAJA 2GTEA 2K7BA 2KDHA 2KFFA 3S0BA 2LLUA 2Y1MA 1V1GA 1GM0A 1TNXA 1K9KA 2PALA 3PALA 4YBHB 1OOHA 2WCMA 1OOFA 1PALA 3NHTA 2KLDA 5D69A 3SIBA 4MRXA 1BOCA 3OP0A 1N2DA 4QJ5B 2MLEC 1SR6B 1TUZA 2K2AA 1XFWO 4HSZA 5CSNA 1C07A 1OZOA 1L2OC 1NUBA 3EVUA 1AVSA 2HPSA 1NCXA 4KYNA 4I5LB 1NP8A 2JT8A
chains in the Genus database with same CATH topology
1J1EA 2BCBA 4BY5A 4HRHA 2L98A 2JNXA 2LANA 4GAOA 1AP4A 1MUXA 2BE4A 1KQVA 5DKQA 1S6CA 2MJWB 4PCWA 1HQVA 1YR5A 1MF8B 4CFQA 1AUIB 2HETA 1S3PA 1TCOB 2LVVA 1SL8A 4PE1A 4DCKA 4FTGA 1TOPA 1TN4A 1SYMA 1UHHA 2JU0A 3NXAA 1QIWA 3DVMA 2JTZA 2SASA 1CLLA 3FWCA 1CFCA 3ICBA 2ZN8A 2BECA 4I5KA 1GGZA 1X02A 1OQPA 3FS7A 5CSIA 1J7QA 1YUUA 3VRNA 3I5HC 3LLEA 3PN7B 1BF5A 1LA3A 2WORA 4NDCA 1CLMA 1DGVA 2LP3A 1TTXA 1H8BA 4JWQA 1OMVA 1XFZO 1G8IA 1GGWA 1XYDA 2KI6C 1ZUZA 1NPQA 1LA0A 3TUYC 5AANA 1PULA 1FW4A 2WCFA 3DF0B 2JOJA 1PVAA 1SL7A 1DJXA 2MAZA 3I5HB 4QJ3B 4HRGA 1CMGA 2M9GA 1QV0A 5TNCA 5DKNA 3SG3A 3TDZA 4UPGA 2LUXA 4YGAA 2RGIA 2MA2A 3VGOA 5KU1A 1B8RA 2LCPA 4XJKB 3TUYB 3VRQA 4TNCA 1YX8A 5JJGA 2P6BB 1B7TY 2LMUA 2KNEA 4MN0A 2L51A 2SCPA 1W7IB 4E68A 1CFPA 1TNWA 2PASA 4N5XA 1CTRA 1ALWA 3PM8A 1IG5A 4OR9B 1U5IB 3VROA 2Q91A 1TNPA 3SG7A 2JXCA 2K2FA 3EKHA 1Y0VH 1Y1UA 4MEWA 1KWOC 2F3ZA 2Y1NA 4AQIA 2F3YA 2OS8B 3D0YB 1KK7Y 1SCMC 4JQ0D 1QTXA 4M2QA 4PDZA 2M3WA 4GUKA 1YURA 1B9AA 1UHNA 2WC8A 2O60A 5DKRA 2JWWA 1JWDA 3DVEA 4CFRA 3M0WA 3EVRA 2JULA 4GGFC 4NQGA 1A29A 1A75A 1WRKA 1S5GY 2JRFA 1XFYO 1JF2A 3DVJA 3OX5A 1KWOB 4MSPA 2NCPA 1WLMA 2JC2A 3BUMB 1CDNA 4L9MA 1D1OA 2ZRSA 2LC5A 3DF0A 1YX7A 2BBMA 4PHJA 3LL8B 1F4QA 2IS9A 3JVTB 4I5JA 1EXRA 3TS5C 4USLA 3JTDC 1BR4B 2PRUA 2KOTA 2NZ0A 4WQ2A 1FI5A 1IH0A 1FPWA 1CDPA 2R2IA 4XJKA 1YUTA 2HF5A 2ISDA 2Q4UA 2L2EA 5HLOA 1UUSA 1J55A 1DJIA 1TIZA 3CR5X 3WXAA 3TDUA 1B1GA 4AOMA 2BCAA 3LCPC 2HQ8A 1EJ3A 1YUSA 4IL1A 1U5IA 4PE7A 1K9UA 5I2OA 1AHRA 3BOWB 1UHIA 4AQJA 3A8RA 1PRWA 1S36A 1K8UA 5I8NA 1TNQA 3D0YA 4HREE 3CR2A 2JT0A 3A4UB 3O6BA 1IGVA 2LMTA 3I5GC 4GGNA 1KK7Z 5I2LA 1YVLA 1PK0D 1QASA 2BL0C 1RWYA 2GGMA 4GBAA 1PVBA 1CM4A 1C7WA 1K2HA 5AEQA 1WLZA 2BKIB 1S6JA 5ER5A 1F54A 1S5GZ 2KBIA 1OE9B 3I5GB 1QX5B 2K7OA 1L2OB 2PMYA 1K95A 2CT9A 2JXLA 4OV2A 1QJTA 2K8MB 1EL4A 2M29A 4GGFA 1SK6D 1HT9A 2KSPA 1BLQA 1FF1A 1IWQA 1S1EA 3EK4A 1LINA 1M45A 3H4SE 3HCMA 2COLB 4YI9A 1K94A 1LXFC 5HKWA 5ER4X 5HKYA 1SPYA 1CM1A 2K61A 2MLFC 4A4BA 4QJ4B 2BKHB 3SIAA 1IRJA 2V53A 1A75B 3NSIA 3O2PA 5F6TA 2F2PA 2DOQA 2BE6A 3TZ1A 3EK7A 5CSFA 3ZWHA 5GQQC 2I2RE 2QPTA 3BOWA 3PSRA 2F8PA 3OX6A 1H4BA 3LK0A 1QVIY 1B47A 2F2OA 1JFKA 2AAOA 2LV7A 4ZCVA 3GK2A 1AJ5A 4DS7A 5AFPA 2JPTA 3DVKA 2K7DA 4PE0A 4U8DA 5CSJA 5AERA 2JQ6A 2JT3A 3SG2A 1CFDA 3KF9A 2KI4C 1B8CA 1F4OA 3CR4X 2LNKA 4FQOA 1CLBA 2E30A 1QLSA 1KQMC 4YGDB 3CTNA 2AUCA 1GQMA 2KI6D 1QATA 4C0KA 3D10A 4M2PA 4A4CA 1QIVA 1SL9A 1TCFA 2LVKA 1IQ5A 2CNPA 2LVIA 1BODA 2EC6C 1MHOA 1M46A 2M1KB 2KAXA 1QV1A 1UHKA 2KGRA 3O78A 2H61C 1WRLA 4NDDA 1SKTA 3NSOA 1J7PA 3BYAA 1IJ6A 3OHMB 3KHEA 4YRUA 4MVFA 5D7FA 1JFJA 1DJHA 1M63B 1R6PA 2B1UA 2KHNA 2JZIA 3EVVA 1DF0B 1MXLC 4WRIA 5FYXA 3AKAA 3IQOA 1ODBA 2Y5IA 1UHJA 5HKZA 1E8AA 1R2UA 3K21A 2LP2A 1UWOA 1WRZA 2EHBA 1KK8C 3I5FC 1SCMB 3EK8A 1S6IA 4NDBA 2LLSA 2KYFA 1SRAA 2E6WA 5JOLA 1JF0A 2M7NA 1CB1A 1J7OA 3ZNIA 1QVIZ 3BXKA 2WCEA 1F70A 1DTLA 1XFXO 1BMOA 1XFUO 2G2BA 1B4CA 1XO5A 4PHKA 1CDLA 1JBAA 1Y1XA 2JNFA 2KBMA 1SMGA 2LMVA 2GV5A 1TRFA 2KAVA 2L4IA 2ZNDA 3OB2B 4CLNA 3TS5B 1UURA 3JTDB 1OSAA 1DMOA 5HLVA 4YGBB 2PSRA 2BBNA 3IQQA 1RFJA 1CFFA 3SG5A 5K89A 1Y6WA 1S26D 2MRDA 1XK4C 2PVBA 1J7RA 1KFUS 1XVJA 2L0PA 1CNPA 4YGCB 2D8NA 2LLTA 1NIWA 3EKJA 1DF0A 3KEVA 3SJSA 3GK1A 5CPVA 3F45A 1A2XA 1NYAA 2LM5A 3CS1A 1JC2A 3KPXA 2M97A 1CDMA 2LAPA 2H61A 1OOJA 1K9PA 1RJVA 2I18A 2KAYA 1Y1AA 1LKJA 1NSHA 2CTNA 1NX1A 2L4HA 3PATA 4ETOA 3PLFB 2BL0B 1NX2A 1MQ1A 1SNLA 1DGUA 4C0JA 4N1FA 2WNDA 1L7ZA 3KO0A 3VRRA 1YRUB 1LVCD 4N1GA 5HYDA 1KFXS 4P5OE 5IBWA 4MZKA 4R1EA 4MLWA 4ZCUA 2M7LA 3AKBA 5I2QA 1NWDA 1MXEA 1SY9A 2EGDA 2K7CA 1QX7A 2LE9B 3RM1A 3C1VA 2KFGA 1K96A 1MWNA 3BUNB 3NSLA 2AMIA 1WDCC 2KQ6A 2M0RA 1KCYA 3PN7C 3WHTB 3PFVA 4PHMA 1QXPA 4ORAB 1F8HA 1KFUL 4DUQA 2KFHA 1A03A 1KSOA 2I94A 2FCEA 4WQ3A 2LHIA 4MZLA 1YVHA 1G33A 4CIDA 3O4YA 3FWBA 2CBLA 4CPVA 4D1EA 5G08A 2FJUB 4F0ZB 1Q80A 1OMDA 1XFVO 4MBEA 2QACA 2K0JA 1DVIA 1W7JB 1WDCB 2ZRTA 1ZOTB 1A4PA 3NSKA 2M49B 1DJWA 1OZSA 3DD4A 1EG4A 1CMFA 2F33A 3SG4A 3I5IC 5PALA 2LVJA 1XK4A 1DT7B 1K93D 1XA5A 2LUCA 3GOFA 4M2OA 1YTZC 2BCXA 3WNXB 2NLNA 1SCVA 4MZJA 2ZKMX 3MSEB 4ORBB 2KI4B 1BT6A 1OMRA 2NXQA 3GK4X 1UP5A 3CGAA 1KFXL 3I5IB 2O5GA 4PE4A 1RK9A 5BPJA 3HX4A 1KQMB 4JPZB 1AJ4A 4GNKB 1NCYA 4OVNF 1M39A 1MR8A 1SBJA 3SG6A 3CWGA 4BY4A 4OCIA 1DJGA 3FIAA 2L5XB 2OS8C 4PHNA 1M31A 2ZNEA 1NCZA 1V1FA 2EC6B 2KGBC 4PALA 1WY9A 1ZMZA 3BQ3A 1DJYA 5KTYA 2I7AA 4ICBA 2ZFDA 2A4JA 2NCOA 1FBVA 2ZN9A 2VRGA 3LK1A 2JTTA 1J1DA 1PSRA 3WHUB 4OKHA 3BUWB 3AAKA 2TN4A 2M1UA 1KK8B 3I5FB 3QRXA 1BJFA 4Q04A 5J3XA 1C7VA 1G4YR 2CXJA 1BR1B 2MBXA 1JSAA 1IQ3A 3VRPA 1F71A 1GJYA 1K90D 5B8IB 4GPLB 3JVTC 2WCBA 1EH2A 2G9BA 1NX3A 4XYNA 4P2YB 1SW8A 1CKKA 2OTGC 1B8LA 1RROA 2M8UA 1RECA 2H2KA 4C0LA 2KYCA 1N65A 1N0YA 4ORCB 3CLNA 1BU3A 1QX2A 1VRKA 2LHLA 4YGEB 2Y4QA 1ZFSA 1YRTB 5AXIA 1DJZA 1EG3A 1IKUA 1ZACA 1NX0A 2FOTA 2KQYA 1QLKA 4I5NB 3BUOB 1AK8A 1JUOA 4MRYA 3TDIA 4GFTA 4DRWA 1F55A 1PSBA 2MHHA 2OTGB 2CCMA 3OB1B 3BUXB 3CZTX 2HQWA 1QS7A 3IF7A 5KSZA 2GGZA 1FI6A 2FCDA 1BG1A 4DIRA 1IJ5A 2OPOA 1ALVA 2L50A 1SR6C 1RTP1 1B7TZ 1KSMA 3E3RA 4YI8A 3RLZA 2WOSA 3AAJA 2K7BA 2KDHA 2KFFA 2LLUA 2Y1MA 1V1GA 1TNXA 1K9KA 2PALA 3PALA 4YBHB 1BOCA 1PALA 3SIBA 5D69A 4MRXA 3OP0A 1N2DA 4QJ5B 2MLEC 1SR6B 2K2AA 1XFWO 4HSZA 5CSNA 1C07A 1OZOA 1L2OC 1NUBA 3EVUA 1AVSA 2HPSA 1NCXA 4I5LB 1NP8A 2JT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E A;  2BCB A;  4BY5 A;  4HRH A;  2L98 A;  2JNX A;  2LAN A;  4GAO A;  1AP4 A;  1MUX A;  2BE4 A;  1KQV A;  5DKQ A;  1S6C A;  2MJW B;  4PCW A;  1HQV A;  1YR5 A;  1MF8 B;  4CFQ A;  1AUI B;  2HET A;  1S3P A;  1TCO B;  2LVV A;  1SL8 A;  4PE1 A;  4DCK A;  4FTG A;  1TOP A;  1TN4 A;  1SYM A;  1UHH A;  2JU0 A;  3NXA A;  1QIW A;  3DVM A;  2JTZ A;  2SAS A;  1CLL A;  3FWC A;  1CFC A;  3ICB A;  2ZN8 A;  2BEC A;  4I5K A;  1GGZ A;  1X02 A;  1OQP A;  3FS7 A;  5CSI A;  1J7Q A;  1YUU A;  3VRN A;  3I5H C;  3LLE A;  3PN7 B;  1BF5 A;  1LA3 A;  2WOR A;  4NDC A;  1CLM A;  1DGV A;  2LP3 A;  1TTX A;  1H8B A;  4JWQ A;  1OMV A;  1XFZ O;  1G8I A;  1GGW A;  1XYD A;  2KI6 C;  1ZUZ A;  1NPQ A;  1LA0 A;  3TUY C;  5AAN A;  1PUL A;  1FW4 A;  2WCF A;  3DF0 B;  2JOJ A;  1PVA A;  1SL7 A;  1DJX A;  2MAZ A;  3I5H B;  4QJ3 B;  4HRG A;  1CMG A;  2M9G A;  1QV0 A;  5TNC A;  5DKN A;  3SG3 A;  3TDZ A;  4UPG A;  2LUX A;  4YGA A;  2RGI A;  2MA2 A;  3VGO A;  5KU1 A;  1B8R A;  2LCP A;  4XJK B;  3TUY B;  3VRQ A;  4TNC A;  1YX8 A;  5JJG A;  2P6B B;  1B7T Y;  2LMU A;  2KNE A;  4MN0 A;  2L51 A;  2SCP A;  1W7I B;  4E68 A;  1CFP A;  1TNW A;  2PAS A;  4N5X A;  1CTR A;  1ALW A;  3PM8 A;  1IG5 A;  4OR9 B;  1U5I B;  3VRO A;  2Q91 A;  1TNP A;  3SG7 A;  2JXC A;  2K2F A;  3EKH A;  1Y0V H;  1Y1U A;  4MEW A;  1KWO C;  2F3Z A;  2Y1N A;  4AQI A;  2F3Y A;  2OS8 B;  3D0Y B;  1KK7 Y;  1SCM C;  4JQ0 D;  1QTX A;  4M2Q A;  4PDZ A;  2M3W A;  4GUK A;  1YUR A;  1B9A A;  1UHN A;  2WC8 A;  2O60 A;  5DKR A;  2JWW A;  1JWD A;  3DVE A;  4CFR A;  3M0W A;  3EVR A;  2JUL A;  4GGF C;  4NQG A;  1A29 A;  1A75 A;  1WRK A;  1S5G Y;  2JRF A;  1XFY O;  1JF2 A;  3DVJ A;  3OX5 A;  1KWO B;  4MSP A;  2NCP A;  1WLM A;  2JC2 A;  3BUM B;  1CDN A;  4L9M A;  1D1O A;  2ZRS A;  2LC5 A;  3DF0 A;  1YX7 A;  2BBM A;  4PHJ A;  3LL8 B;  1F4Q A;  2IS9 A;  3JVT B;  4I5J A;  1EXR A;  3TS5 C;  4USL A;  3JTD C;  1BR4 B;  2PRU A;  2KOT A;  2NZ0 A;  4WQ2 A;  1FI5 A;  1IH0 A;  1FPW A;  1CDP A;  2R2I A;  4XJK A;  1YUT A;  2HF5 A;  2ISD A;  2Q4U A;  2L2E A;  5HLO A;  1UUS A;  1J55 A;  1DJI A;  1TIZ A;  3CR5 X;  3WXA A;  3TDU A;  1B1G A;  4AOM A;  2BCA A;  3LCP C;  2HQ8 A;  1EJ3 A;  1YUS A;  4IL1 A;  1U5I A;  4PE7 A;  1K9U A;  5I2O A;  1AHR A;  3BOW B;  1UHI A;  4AQJ A;  3A8R A;  1PRW A;  1S36 A;  1K8U A;  5I8N A;  1TNQ A;  3D0Y A;  4HRE E;  3CR2 A;  2JT0 A;  3A4U B;  3O6B A;  1IGV A;  2LMT A;  3I5G C;  4GGN A;  1KK7 Z;  5I2L A;  1YVL A;  1PK0 D;  1QAS A;  2BL0 C;  1RWY A;  2GGM A;  4GBA A;  1PVB A;  1CM4 A;  1C7W A;  1K2H A;  5AEQ A;  1WLZ A;  2BKI B;  1S6J A;  5ER5 A;  1F54 A;  1S5G Z;  2KBI A;  1OE9 B;  3I5G B;  1QX5 B;  2K7O A;  1L2O B;  2PMY A;  1K95 A;  2CT9 A;  2JXL A;  4OV2 A;  1QJT A;  2K8M B;  1EL4 A;  2M29 A;  4GGF A;  1SK6 D;  1HT9 A;  2KSP A;  1BLQ A;  1FF1 A;  1IWQ A;  1S1E A;  3EK4 A;  1LIN A;  1M45 A;  3H4S E;  3HCM A;  2COL B;  4YI9 A;  1K94 A;  1LXF C;  5HKW A;  5ER4 X;  5HKY A;  1SPY A;  1CM1 A;  2K61 A;  2MLF C;  4A4B A;  4QJ4 B;  2BKH B;  3SIA A;  1IRJ A;  2V53 A;  1A75 B;  3NSI A;  3O2P A;  5F6T A;  2F2P A;  2DOQ A;  2BE6 A;  3TZ1 A;  3EK7 A;  5CSF A;  3ZWH A;  5GQQ C;  2I2R E;  2QPT A;  3BOW A;  3PSR A;  2F8P A;  3OX6 A;  1H4B A;  3LK0 A;  1QVI Y;  1B47 A;  2F2O A;  1JFK A;  2AAO A;  2LV7 A;  4ZCV A;  3GK2 A;  1AJ5 A;  4DS7 A;  5AFP A;  2JPT A;  3DVK A;  2K7D A;  4PE0 A;  4U8D A;  5CSJ A;  5AER A;  2JQ6 A;  2JT3 A;  3SG2 A;  1CFD A;  3KF9 A;  2KI4 C;  1B8C A;  1F4O A;  3CR4 X;  2LNK A;  4FQO A;  1CLB A;  2E30 A;  1QLS A;  1KQM C;  4YGD B;  3CTN A;  2AUC A;  1GQM A;  2KI6 D;  1QAT A;  4C0K A;  3D10 A;  4M2P A;  4A4C A;  1QIV A;  1SL9 A;  1TCF A;  2LVK A;  1IQ5 A;  2CNP A;  2LVI A;  1BOD A;  2EC6 C;  1MHO A;  1M46 A;  2M1K B;  2KAX A;  1QV1 A;  1UHK A;  2KGR A;  3O78 A;  2H61 C;  1WRL A;  4NDD A;  1SKT A;  3NSO A;  1J7P A;  3BYA A;  1IJ6 A;  3OHM B;  3KHE A;  4YRU A;  4MVF A;  5D7F A;  1JFJ A;  1DJH A;  1M63 B;  1R6P A;  2B1U A;  2KHN A;  2JZI A;  3EVV A;  1DF0 B;  1MXL C;  4WRI A;  5FYX A;  3AKA A;  3IQO A;  1ODB A;  2Y5I A;  1UHJ A;  5HKZ A;  1E8A A;  1R2U A;  3K21 A;  2LP2 A;  1UWO A;  1WRZ A;  2EHB A;  1KK8 C;  3I5F C;  1SCM B;  3EK8 A;  1S6I A;  4NDB A;  2LLS A;  2KYF A;  1SRA A;  2E6W A;  5JOL A;  1JF0 A;  2M7N A;  1CB1 A;  1J7O A;  3ZNI A;  1QVI Z;  3BXK A;  2WCE A;  1F70 A;  1DTL A;  1XFX O;  1BMO A;  1XFU O;  2G2B A;  1B4C A;  1XO5 A;  4PHK A;  1CDL A;  1JBA A;  1Y1X A;  2JNF A;  2KBM A;  1SMG A;  2LMV A;  2GV5 A;  1TRF A;  2KAV A;  2L4I A;  2ZND A;  3OB2 B;  4CLN A;  3TS5 B;  1UUR A;  3JTD B;  1OSA A;  1DMO A;  5HLV A;  4YGB B;  2PSR A;  2BBN A;  3IQQ A;  1RFJ A;  1CFF A;  3SG5 A;  5K89 A;  1Y6W A;  1S26 D;  2MRD A;  1XK4 C;  2PVB A;  1J7R A;  1KFU S;  1XVJ A;  2L0P A;  1CNP A;  4YGC B;  2D8N A;  2LLT A;  1NIW A;  3EKJ A;  1DF0 A;  3KEV A;  3SJS A;  3GK1 A;  5CPV A;  3F45 A;  1A2X A;  1NYA A;  2LM5 A;  3CS1 A;  1JC2 A;  3KPX A;  2M97 A;  1CDM A;  2LAP A;  2H61 A;  1OOJ A;  1K9P A;  1RJV A;  2I18 A;  2KAY A;  1Y1A A;  1LKJ A;  1NSH A;  2CTN A;  1NX1 A;  2L4H A;  3PAT A;  4ETO A;  3PLF B;  2BL0 B;  1NX2 A;  1MQ1 A;  1SNL A;  1DGU A;  4C0J A;  4N1F A;  2WND A;  1L7Z A;  3KO0 A;  3VRR A;  1YRU B;  1LVC D;  4N1G A;  5HYD A;  1KFX S;  4P5O E;  5IBW A;  4MZK A;  4R1E A;  4MLW A;  4ZCU A;  2M7L A;  3AKB A;  5I2Q A;  1NWD A;  1MXE A;  1SY9 A;  2EGD A;  2K7C A;  1QX7 A;  2LE9 B;  3RM1 A;  3C1V A;  2KFG A;  1K96 A;  1MWN A;  3BUN B;  3NSL A;  2AMI A;  1WDC C;  2KQ6 A;  2M0R A;  1KCY A;  3PN7 C;  3WHT B;  3PFV A;  4PHM A;  1QXP A;  4ORA B;  1F8H A;  1KFU L;  4DUQ A;  2KFH A;  1A03 A;  1KSO A;  2I94 A;  2FCE A;  4WQ3 A;  2LHI A;  4MZL A;  1YVH A;  1G33 A;  4CID A;  3O4Y A;  3FWB A;  2CBL A;  4CPV A;  4D1E A;  5G08 A;  2FJU B;  4F0Z B;  1Q80 A;  1OMD A;  1XFV O;  4MBE A;  2QAC A;  2K0J A;  1DVI A;  1W7J B;  1WDC B;  2ZRT A;  1ZOT B;  1A4P A;  3NSK A;  2M49 B;  1DJW A;  1OZS A;  3DD4 A;  1EG4 A;  1CMF A;  2F33 A;  3SG4 A;  3I5I C;  5PAL A;  2LVJ A;  1XK4 A;  1DT7 B;  1K93 D;  1XA5 A;  2LUC A;  3GOF A;  4M2O A;  1YTZ C;  2BCX A;  3WNX B;  2NLN A;  1SCV A;  4MZJ A;  2ZKM X;  3MSE B;  4ORB B;  2KI4 B;  1BT6 A;  1OMR A;  2NXQ A;  3GK4 X;  1UP5 A;  3CGA A;  1KFX L;  3I5I B;  2O5G A;  4PE4 A;  1RK9 A;  5BPJ A;  3HX4 A;  1KQM B;  4JPZ B;  1AJ4 A;  4GNK B;  1NCY A;  4OVN F;  1M39 A;  1MR8 A;  1SBJ A;  3SG6 A;  3CWG A;  4BY4 A;  4OCI A;  1DJG A;  3FIA A;  2L5X B;  2OS8 C;  4PHN A;  1M31 A;  2ZNE A;  1NCZ A;  1V1F A;  2EC6 B;  2KGB C;  4PAL A;  1WY9 A;  1ZMZ A;  3BQ3 A;  1DJY A;  5KTY A;  2I7A A;  4ICB A;  2ZFD A;  2A4J A;  2NCO A;  1FBV A;  2ZN9 A;  2VRG A;  3LK1 A;  2JTT A;  1J1D A;  1PSR A;  3WHU B;  4OKH A;  3BUW B;  3AAK A;  2TN4 A;  2M1U A;  1KK8 B;  3I5F B;  3QRX A;  1BJF A;  4Q04 A;  5J3X A;  1C7V A;  1G4Y R;  2CXJ A;  1BR1 B;  2MBX A;  1JSA A;  1IQ3 A;  3VRP A;  1F71 A;  1GJY A;  1K90 D;  5B8I B;  4GPL B;  3JVT C;  2WCB A;  1EH2 A;  2G9B A;  1NX3 A;  4XYN A;  4P2Y B;  1SW8 A;  1CKK A;  2OTG C;  1B8L A;  1RRO A;  2M8U A;  1REC A;  2H2K A;  4C0L A;  2KYC A;  1N65 A;  1N0Y A;  4ORC B;  3CLN A;  1BU3 A;  1QX2 A;  1VRK A;  2LHL A;  4YGE B;  2Y4Q A;  1ZFS A;  1YRT B;  5AXI A;  1DJZ A;  1EG3 A;  1IKU A;  1ZAC A;  1NX0 A;  2FOT A;  2KQY A;  1QLK A;  4I5N B;  3BUO B;  1AK8 A;  1JUO A;  4MRY A;  3TDI A;  4GFT A;  4DRW A;  1F55 A;  1PSB A;  2MHH A;  2OTG B;  2CCM A;  3OB1 B;  3BUX B;  3CZT X;  2HQW A;  1QS7 A;  3IF7 A;  5KSZ A;  2GGZ A;  1FI6 A;  2FCD A;  1BG1 A;  4DIR A;  1IJ5 A;  2OPO A;  1ALV A;  2L50 A;  1SR6 C;  1RTP 1;  1B7T Z;  1KSM A;  3E3R A;  4YI8 A;  3RLZ A;  2WOS A;  3AAJ A;  2K7B A;  2KDH A;  2KFF A;  2LLU A;  2Y1M A;  1V1G A;  1TNX A;  1K9K A;  2PAL A;  3PAL A;  4YBH B;  1BOC A;  1PAL A;  3SIB A;  5D69 A;  4MRX A;  3OP0 A;  1N2D A;  4QJ5 B;  2MLE C;  1SR6 B;  2K2A A;  1XFW O;  4HSZ A;  5CSN A;  1C07 A;  1OZO A;  1L2O C;  1NUB A;  3EVU A;  1AVS A;  2HPS A;  1NCX A;  4I5L B;  1NP8 A;  2JT8 A; 
#chains in the Genus database with same CATH topology
 1J1E A;  2BCB A;  3QME A;  4BY5 A;  4HRH A;  3B88 A;  2L98 A;  2JNX A;  2LAN A;  4GAO A;  1AP4 A;  1MUX A;  2BE4 A;  1KQV A;  5DKQ A;  1S6C A;  2MJW B;  4PCW A;  1DC1 A;  1HQV A;  1YR5 A;  1MF8 B;  4CFQ A;  4F7F A;  1AUI B;  2HET A;  1S3P A;  1TCO B;  2LVV A;  1SL8 A;  4PE1 A;  4DCK A;  4FTG A;  1TOP A;  1TN4 A;  1SYM A;  1UHH A;  2JU0 A;  3NXA A;  1QIW A;  2ERB A;  2JTZ A;  2QEH A;  1CLL A;  2SAS A;  3DVM A;  3FWC A;  3ICB A;  1CFC A;  2ZN8 A;  2BEC A;  4I5K A;  3S0G A;  1GGZ A;  1X02 A;  1OQP A;  3FS7 A;  5CSI A;  1J7Q A;  1YUU A;  3VRN A;  3I5H C;  3LLE A;  3PN7 B;  1BF5 A;  1LA3 A;  2WOR A;  4NDC A;  2QDI A;  1CLM A;  1DGV A;  2LP3 A;  1TTX A;  1H8B A;  3Q8I A;  4JWQ A;  5D3O A;  1OMV A;  1XFZ O;  1G8I A;  1GGW A;  1XYD A;  3CZ0 A;  2KI6 C;  1ZUZ A;  1NPQ A;  1LA0 A;  3TUY C;  5AAN A;  1PUL A;  1FW4 A;  2WCF A;  3DF0 B;  1DQE A;  2JOJ A;  1PVA A;  1SL7 A;  1DJX A;  2MAZ A;  3I5H B;  4QJ3 B;  3BJH A;  4HRG A;  3NHI A;  1CMG A;  2M9G A;  1QV0 A;  5TNC A;  5DKN A;  3D78 A;  3SG3 A;  3TDZ A;  4UPG A;  2LUX A;  4YGA A;  1ORG A;  2K60 A;  2RGI A;  2MA2 A;  3VGO A;  5KU1 A;  2QEV A;  1B8R A;  2LCP A;  4XJK B;  3TUY B;  3VRQ A;  4TNC A;  1YX8 A;  5JJG A;  2P6B B;  1B7T Y;  3BFH A;  2LMU A;  1LS8 A;  2KNE A;  4MN0 A;  2L51 A;  2SCP A;  1W7I B;  4E68 A;  1P28 A;  1CFP A;  1TNW A;  2PAS A;  4N5X A;  1CTR A;  1ALW A;  3PM8 A;  2WCL A;  1IG5 A;  4OR9 B;  1U5I B;  3VRO A;  2Q91 A;  1TNP A;  3SG7 A;  2JXC A;  2K2F A;  3EKH A;  1Y0V H;  3B87 A;  1Y1U A;  4MEW A;  1KWO C;  2F3Z A;  2Y1N A;  4AQI A;  2F3Y A;  2OS8 B;  3D0Y B;  1KK7 Y;  1SCM C;  4JQ0 D;  1QTX A;  4M2Q A;  4PDZ A;  2M3W A;  4GUK A;  1YUR A;  1B9A A;  1UHN A;  2WC8 A;  3DXL A;  3V2L A;  2O60 A;  5DKR A;  2JWW A;  1JWD A;  3DVE A;  4CFR A;  3M0W A;  3EVR A;  2JUL A;  4GGF C;  4NQG A;  1A29 A;  1A75 A;  1WRK A;  1S5G Y;  2JRF A;  1XFY O;  1JF2 A;  3DVJ A;  3OX5 A;  1KWO B;  3R1V A;  4MSP A;  2NCP A;  1WLM A;  2JC2 A;  3BUM B;  5FI2 A;  1CDN A;  4L9M A;  1D1O A;  2ZRS A;  2LC5 A;  3DF0 A;  1YX7 A;  2BBM A;  5FI6 A;  4PHJ A;  3LL8 B;  1F4Q A;  3BFB A;  2IS9 A;  3JVT B;  4I5J A;  1EXR A;  3TS5 C;  4USL A;  3JTD C;  3RZS A;  1BR4 B;  2PRU A;  2KOT A;  2NZ0 A;  4WQ2 A;  1FI5 A;  1IH0 A;  1FPW A;  1CDP A;  2R2I A;  3OBV A;  1YUT A;  4XJK A;  2HF5 A;  2WC5 A;  3PM2 A;  1W9Z A;  1TWO A;  1C3Z A;  2Q4U A;  2ISD A;  2L2E A;  5HLO A;  1UUS A;  2BAP A;  1J55 A;  1DJI A;  1TIZ A;  3CR5 X;  3WXA A;  3TDU A;  1B1G A;  4AOM A;  2BCA A;  3LCP C;  2HQ8 A;  1EJ3 A;  1YUS A;  4IL1 A;  1U5I A;  4PE7 A;  1K9U A;  3L47 A;  5I2O A;  1AHR A;  3BOW B;  1UHI A;  4AQJ A;  3A8R A;  1PRW A;  1S36 A;  1K8U A;  3OGN A;  5I8N A;  1TNQ A;  3D0Y A;  4HRE E;  3CR2 A;  1T14 A;  2JT0 A;  3A4U B;  3O6B A;  1IGV A;  2LMT A;  3I5G C;  4GGN A;  1KK7 Z;  4INX A;  4INW A;  5I2L A;  1YVL A;  1PK0 D;  2JPO A;  1QAS A;  2BL0 C;  4IJ7 A;  1RWY A;  2GGM A;  4GBA A;  1PVB A;  3N7H A;  1CM4 A;  1C7W A;  1OOI X;  1K2H A;  5AEQ A;  1WLZ A;  2BKI B;  1S6J A;  5ER5 A;  2FJY A;  1F54 A;  1S5G Z;  2KBI A;  1OE9 B;  2P70 A;  3I5G B;  1QX5 B;  2K7O A;  1L2O B;  2PMY A;  1K95 A;  2CT9 A;  2JXL A;  4OV2 A;  1QJT A;  2K8M B;  1EL4 A;  2M29 A;  4GGF A;  1SK6 D;  1HT9 A;  2KSP A;  1BLQ A;  3FE9 A;  1FF1 A;  1IWQ A;  1S1E A;  3EK4 A;  1LIN A;  1M45 A;  3H4S E;  3HCM A;  2COL B;  4YI9 A;  1K94 A;  1LXF C;  5HKW A;  5ER4 X;  5HKY A;  1SPY A;  1CM1 A;  2K61 A;  2MLF C;  4A4B A;  4QJ4 B;  2BKH B;  3SIA A;  1IRJ A;  2L5Y A;  2V53 A;  1A75 B;  3NSI A;  3O2P A;  5F6T A;  2F2P A;  2DOQ A;  2BE6 A;  3TZ1 A;  3EK7 A;  5CSF A;  3ZWH A;  5GQQ C;  2I2R E;  2QPT A;  3BOW A;  3D75 A;  3D76 A;  2F8P A;  3OX6 A;  3PSR A;  1H4B A;  3LK0 A;  1QVI Y;  1B47 A;  2F2O A;  4JD9 A;  1JFK A;  2AAO A;  2LV7 A;  4ZCV A;  1DEL A;  3GK2 A;  1AJ5 A;  2H8V A;  4DS7 A;  5AFP A;  2JPT A;  3VB1 A;  3DVK A;  2K7D A;  4PE0 A;  4U8D A;  5CSJ A;  5AER A;  2JQ6 A;  2JT3 A;  3FE8 A;  3SG2 A;  1CFD A;  3KF9 A;  3PJI A;  2KI4 C;  1B8C A;  3FE6 A;  1F4O A;  3CR4 X;  2LNK A;  5FI7 A;  4FQO A;  3SS5 A;  1CLB A;  2WCH A;  3DYE A;  2E30 A;  1QLS A;  1KQM C;  4YGD B;  3CTN A;  2AUC A;  3CZ1 A;  3R1P A;  1GQM A;  3UNW A;  2KI6 D;  1QAT A;  4C0K A;  3D10 A;  4M2P A;  4A4C A;  1QIV A;  1SL9 A;  1TCF A;  2LVK A;  1IQ5 A;  2CNP A;  2LVI A;  1BOD A;  2EC6 C;  1MHO A;  1M46 A;  2M1K B;  2KAX A;  1QV1 A;  1UHK A;  2KGR A;  2WC6 A;  3O78 A;  2BNX A;  1WRL A;  2H61 C;  4NDD A;  1SKT A;  3NSO A;  1J7P A;  3BYA A;  1C3Y A;  1IJ6 A;  3OHM B;  3KHE A;  4YRU A;  4MVF A;  5D7F A;  1JFJ A;  1DJH A;  1M63 B;  1R6P A;  2B1U A;  3DY9 A;  2KHN A;  2JZI A;  3EVV A;  1DF0 B;  1MXL C;  4WRI A;  5FYX A;  3AKA A;  3IQO A;  1ODB A;  2Y5I A;  1UHJ A;  3NGV A;  1E8A A;  5HKZ A;  1R2U A;  3K21 A;  2LP2 A;  1UWO A;  1WRZ A;  2EHB A;  1KK8 C;  3I5F C;  1SCM B;  3EK8 A;  1S6I A;  3EG5 B;  4NDB A;  2LLS A;  2KYF A;  1SRA A;  2E6W A;  5JOL A;  3B86 A;  3D77 A;  1JF0 A;  2M7N A;  1CB1 A;  5DIC A;  3S0A A;  1J7O A;  1OOG A;  3ZNI A;  3S0D A;  1QVI Z;  3BXK A;  2QEO A;  2WCE A;  1F70 A;  1DTL A;  1XFX O;  1BMO A;  2PQL A;  1XFU O;  2G2B A;  1B4C A;  1XO5 A;  4PHK A;  1CDL A;  1JBA A;  1C7V A;  1Y1X A;  2JNF A;  2KBM A;  1SMG A;  2LMV A;  2GV5 A;  3D74 A;  1TRF A;  2KAV A;  2L4I A;  2ZND A;  3OB2 B;  4CLN A;  3TS5 B;  1UUR A;  3JTD B;  3SS4 A;  1OSA A;  2KLE A;  1DMO A;  5HLV A;  4YGB B;  2PSR A;  2BBN A;  3IQQ A;  1RFJ A;  1CFF A;  3SG5 A;  5K89 A;  1Y6W A;  1S26 D;  2MRD A;  1XK4 C;  2PVB A;  1J7R A;  1KFU S;  1XVJ A;  3CDN A;  2L0P A;  1CNP A;  4YGC B;  2D8N A;  2LLT A;  1NIW A;  3EKJ A;  1DF0 A;  3KEV A;  3SJS A;  3R1O A;  3GK1 A;  5CPV A;  3F45 A;  1A2X A;  1NYA A;  2LM5 A;  3CS1 A;  1JC2 A;  3KPX A;  2M97 A;  1CDM A;  2LAP A;  2H61 A;  1OOJ A;  1K9P A;  1RJV A;  2I18 A;  2KAY A;  1Y1A A;  1LKJ A;  1NSH A;  2CTN A;  4OZD A;  1NX1 A;  1QWV A;  2L4H A;  3PAT A;  4ETO A;  3PLF B;  2BL0 B;  1NX2 A;  1MQ1 A;  1SNL A;  1DGU A;  2WCK A;  4C0J A;  4N1F A;  2WND A;  1L7Z A;  1IIO A;  2L2C A;  3KO0 A;  3VRR A;  1YRU B;  1LVC D;  4N1G A;  5HYD A;  1KFX S;  4P5O E;  5IBW A;  2WCJ A;  4MZK A;  1DEK A;  4MLW A;  4R1E A;  4ZCU A;  3AKB A;  2M7L A;  5I2Q A;  1NWD A;  3SS3 A;  1MXE A;  1SY9 A;  2EGD A;  2K7C A;  3IVT A;  1QX7 A;  2LE9 B;  3RM1 A;  3C1V A;  2KFG A;  1K96 A;  1MWN A;  3BUN B;  3NSL A;  2AMI A;  1WDC C;  2KQ6 A;  2M0R A;  1KCY A;  3PN7 C;  3WHT B;  3PFV A;  4PHM A;  1QXP A;  4ORA B;  1F8H A;  1KFU L;  4JKT A;  4DUQ A;  2KFH A;  1A03 A;  1KSO A;  2I94 A;  3O4X A;  2FCE A;  4WQ3 A;  2LHI A;  4MZL A;  1YVH A;  1G33 A;  4CID A;  3O4Y A;  3FWB A;  2CBL A;  4CPV A;  4D1E A;  5G08 A;  3S0F A;  2FJU B;  4F0Z B;  1Q80 A;  1OMD A;  1XFV O;  4MBE A;  2QAC A;  2K0J A;  1DVI A;  1W7J B;  1WDC B;  2ZRT A;  1ZOT B;  1A4P A;  5EL2 A;  3NSK A;  2M49 B;  1DJW A;  1OZS A;  3DD4 A;  1EG4 A;  1CMF A;  2F33 A;  3SG4 A;  3I5I C;  3D73 A;  2LVJ A;  5PAL A;  1XK4 A;  3UO9 A;  1K93 D;  1XA5 A;  1DT7 B;  2LUC A;  3GOF A;  4M2O A;  3CYZ A;  1YTZ C;  2BCX A;  3WNX B;  2NLN A;  1SCV A;  4MZJ A;  2ZKM X;  3MSE B;  4ORB B;  2KI4 B;  1BT6 A;  1OMR A;  3B6X A;  2NXQ A;  3GK4 X;  1UP5 A;  3CGA A;  2QEB A;  1KFX L;  3I5I B;  2O5G A;  4PE4 A;  3S0E A;  1RK9 A;  5BPJ A;  3HX4 A;  3BFA A;  1KQM B;  1SSE B;  4JPZ B;  1AJ4 A;  4GNK B;  1NCY A;  4OVN F;  1M39 A;  1MR8 A;  1SBJ A;  3SG6 A;  2KPH A;  3B7A A;  3CWG A;  3L4L A;  4BY4 A;  3R72 A;  4OCI A;  1DJG A;  3FIA A;  2L5X B;  2OS8 C;  4PHN A;  1M31 A;  2ZNE A;  1NCZ A;  1V1F A;  2EC6 B;  2KGB C;  4PAL A;  1WY9 A;  1ZMZ A;  3BQ3 A;  2PYQ A;  1DJY A;  5KTY A;  1TUJ A;  2I7A A;  4ICB A;  2ZFD A;  2A4J A;  2NCO A;  1FBV A;  2ZN9 A;  2VRG A;  3K1E A;  3L4A A;  2JTT A;  3LK1 A;  4PT1 A;  1OW4 A;  1J1D A;  1PSR A;  2YGU A;  3WHU B;  4OKH A;  3BUW B;  3AAK A;  2TN4 A;  2M1U A;  1KK8 B;  3CZ2 A;  3I5F B;  1BJF A;  3QRX A;  4Q04 A;  5J3X A;  1G4Y R;  2CXJ A;  1BR1 B;  2MBX A;  1JSA A;  1IQ3 A;  3VRP A;  1F71 A;  1GJY A;  1K90 D;  1Z4H A;  5B8I B;  4GPL B;  1XFR A;  4FQT A;  5HL1 A;  3JVT C;  2WCB A;  1EH2 A;  2G9B A;  1NX3 A;  4XYN A;  4P2Y B;  1SW8 A;  1CKK A;  2OTG C;  1B8L A;  1RRO A;  2M8U A;  1REC A;  2H2K A;  4C0L A;  2KYC A;  1N65 A;  1N0Y A;  4ORC B;  3CLN A;  1BU3 A;  1QX2 A;  1VRK A;  2LHL A;  4YGE B;  2Y4Q A;  1ZFS A;  1YRT B;  5AXI A;  1DJZ A;  1EG3 A;  1IKU A;  1ZAC A;  1NX0 A;  2FOT A;  2KQY A;  1QLK A;  4I5N B;  3BUO B;  1AK8 A;  1JUO A;  4MRY A;  3TDI A;  1Z2C B;  4GFT A;  4DRW A;  1F55 A;  1PSB A;  2MHH A;  2OTG B;  2CCM A;  3OB1 B;  3BUX B;  3CZT X;  5I94 A;  2HQW A;  1QS7 A;  3IF7 A;  5KSZ A;  2GGZ A;  1FI6 A;  2FCD A;  3DZT A;  1BG1 A;  3CAB A;  4DIR A;  1IJ5 A;  2OPO A;  1ALV A;  2L50 A;  1SR6 C;  1RTP 1;  1B7T Z;  1KSM A;  3E3R A;  4YI8 A;  3RLZ A;  2WOS A;  2P71 A;  3AAJ A;  2GTE A;  2K7B A;  2KDH A;  2KFF A;  3S0B A;  2LLU A;  2Y1M A;  1V1G A;  1GM0 A;  1TNX A;  1K9K A;  2PAL A;  3PAL A;  4YBH B;  1OOH A;  2WCM A;  1OOF A;  1PAL A;  3NHT A;  2KLD A;  5D69 A;  3SIB A;  4MRX A;  1BOC A;  3OP0 A;  1N2D A;  4QJ5 B;  2MLE C;  1SR6 B;  1TUZ A;  2K2A A;  1XFW O;  4HSZ A;  5CSN A;  1C07 A;  1OZO A;  1L2O C;  1NUB A;  3EVU A;  1AVS A;  2HPS A;  1NCX A;  4KYN A;  4I5L B;  1NP8 A;  2JT8 A; 
#chains in the Genus database with same CATH homology
 1J1E A;  2BCB A;  4BY5 A;  4HRH A;  2L98 A;  2JNX A;  2LAN A;  4GAO A;  1AP4 A;  1MUX A;  2BE4 A;  1KQV A;  5DKQ A;  1S6C A;  2MJW B;  4PCW A;  1HQV A;  1YR5 A;  1MF8 B;  4CFQ A;  1AUI B;  2HET A;  1S3P A;  1TCO B;  2LVV A;  1SL8 A;  4PE1 A;  4DCK A;  4FTG A;  1TOP A;  1TN4 A;  1SYM A;  1UHH A;  2JU0 A;  3NXA A;  1QIW A;  3DVM A;  2JTZ A;  2SAS A;  1CLL A;  3FWC A;  1CFC A;  3ICB A;  2ZN8 A;  2BEC A;  4I5K A;  1GGZ A;  1X02 A;  1OQP A;  3FS7 A;  5CSI A;  1J7Q A;  1YUU A;  3VRN A;  3I5H C;  3LLE A;  3PN7 B;  1BF5 A;  1LA3 A;  2WOR A;  4NDC A;  1CLM A;  1DGV A;  2LP3 A;  1TTX A;  1H8B A;  4JWQ A;  1OMV A;  1XFZ O;  1G8I A;  1GGW A;  1XYD A;  2KI6 C;  1ZUZ A;  1NPQ A;  1LA0 A;  3TUY C;  5AAN A;  1PUL A;  1FW4 A;  2WCF A;  3DF0 B;  2JOJ A;  1PVA A;  1SL7 A;  1DJX A;  2MAZ A;  3I5H B;  4QJ3 B;  4HRG A;  1CMG A;  2M9G A;  1QV0 A;  5TNC A;  5DKN A;  3SG3 A;  3TDZ A;  4UPG A;  2LUX A;  4YGA A;  2RGI A;  2MA2 A;  3VGO A;  5KU1 A;  1B8R A;  2LCP A;  4XJK B;  3TUY B;  3VRQ A;  4TNC A;  1YX8 A;  5JJG A;  2P6B B;  1B7T Y;  2LMU A;  2KNE A;  4MN0 A;  2L51 A;  2SCP A;  1W7I B;  4E68 A;  1CFP A;  1TNW A;  2PAS A;  4N5X A;  1CTR A;  1ALW A;  3PM8 A;  1IG5 A;  4OR9 B;  1U5I B;  3VRO A;  2Q91 A;  1TNP A;  3SG7 A;  2JXC A;  2K2F A;  3EKH A;  1Y0V H;  1Y1U A;  4MEW A;  1KWO C;  2F3Z A;  2Y1N A;  4AQI A;  2F3Y A;  2OS8 B;  3D0Y B;  1KK7 Y;  1SCM C;  4JQ0 D;  1QTX A;  4M2Q A;  4PDZ A;  2M3W A;  4GUK A;  1YUR A;  1B9A A;  1UHN A;  2WC8 A;  2O60 A;  5DKR A;  2JWW A;  1JWD A;  3DVE A;  4CFR A;  3M0W A;  3EVR A;  2JUL A;  4GGF C;  4NQG A;  1A29 A;  1A75 A;  1WRK A;  1S5G Y;  2JRF A;  1XFY O;  1JF2 A;  3DVJ A;  3OX5 A;  1KWO B;  4MSP A;  2NCP A;  1WLM A;  2JC2 A;  3BUM B;  1CDN A;  4L9M A;  1D1O A;  2ZRS A;  2LC5 A;  3DF0 A;  1YX7 A;  2BBM A;  4PHJ A;  3LL8 B;  1F4Q A;  2IS9 A;  3JVT B;  4I5J A;  1EXR A;  3TS5 C;  4USL A;  3JTD C;  1BR4 B;  2PRU A;  2KOT A;  2NZ0 A;  4WQ2 A;  1FI5 A;  1IH0 A;  1FPW A;  1CDP A;  2R2I A;  4XJK A;  1YUT A;  2HF5 A;  2ISD A;  2Q4U A;  2L2E A;  5HLO A;  1UUS A;  1J55 A;  1DJI A;  1TIZ A;  3CR5 X;  3WXA A;  3TDU A;  1B1G A;  4AOM A;  2BCA A;  3LCP C;  2HQ8 A;  1EJ3 A;  1YUS A;  4IL1 A;  1U5I A;  4PE7 A;  1K9U A;  5I2O A;  1AHR A;  3BOW B;  1UHI A;  4AQJ A;  3A8R A;  1PRW A;  1S36 A;  1K8U A;  5I8N A;  1TNQ A;  3D0Y A;  4HRE E;  3CR2 A;  2JT0 A;  3A4U B;  3O6B A;  1IGV A;  2LMT A;  3I5G C;  4GGN A;  1KK7 Z;  5I2L A;  1YVL A;  1PK0 D;  1QAS A;  2BL0 C;  1RWY A;  2GGM A;  4GBA A;  1PVB A;  1CM4 A;  1C7W A;  1K2H A;  5AEQ A;  1WLZ A;  2BKI B;  1S6J A;  5ER5 A;  1F54 A;  1S5G Z;  2KBI A;  1OE9 B;  3I5G B;  1QX5 B;  2K7O A;  1L2O B;  2PMY A;  1K95 A;  2CT9 A;  2JXL A;  4OV2 A;  1QJT A;  2K8M B;  1EL4 A;  2M29 A;  4GGF A;  1SK6 D;  1HT9 A;  2KSP A;  1BLQ A;  1FF1 A;  1IWQ A;  1S1E A;  3EK4 A;  1LIN A;  1M45 A;  3H4S E;  3HCM A;  2COL B;  4YI9 A;  1K94 A;  1LXF C;  5HKW A;  5ER4 X;  5HKY A;  1SPY A;  1CM1 A;  2K61 A;  2MLF C;  4A4B A;  4QJ4 B;  2BKH B;  3SIA A;  1IRJ A;  2V53 A;  1A75 B;  3NSI A;  3O2P A;  5F6T A;  2F2P A;  2DOQ A;  2BE6 A;  3TZ1 A;  3EK7 A;  5CSF A;  3ZWH A;  5GQQ C;  2I2R E;  2QPT A;  3BOW A;  3PSR A;  2F8P A;  3OX6 A;  1H4B A;  3LK0 A;  1QVI Y;  1B47 A;  2F2O A;  1JFK A;  2AAO A;  2LV7 A;  4ZCV A;  3GK2 A;  1AJ5 A;  4DS7 A;  5AFP A;  2JPT A;  3DVK A;  2K7D A;  4PE0 A;  4U8D A;  5CSJ A;  5AER A;  2JQ6 A;  2JT3 A;  3SG2 A;  1CFD A;  3KF9 A;  2KI4 C;  1B8C A;  1F4O A;  3CR4 X;  2LNK A;  4FQO A;  1CLB A;  2E30 A;  1QLS A;  1KQM C;  4YGD B;  3CTN A;  2AUC A;  1GQM A;  2KI6 D;  1QAT A;  4C0K A;  3D10 A;  4M2P A;  4A4C A;  1QIV A;  1SL9 A;  1TCF A;  2LVK A;  1IQ5 A;  2CNP A;  2LVI A;  1BOD A;  2EC6 C;  1MHO A;  1M46 A;  2M1K B;  2KAX A;  1QV1 A;  1UHK A;  2KGR A;  3O78 A;  2H61 C;  1WRL A;  4NDD A;  1SKT A;  3NSO A;  1J7P A;  3BYA A;  1IJ6 A;  3OHM B;  3KHE A;  4YRU A;  4MVF A;  5D7F A;  1JFJ A;  1DJH A;  1M63 B;  1R6P A;  2B1U A;  2KHN A;  2JZI A;  3EVV A;  1DF0 B;  1MXL C;  4WRI A;  5FYX A;  3AKA A;  3IQO A;  1ODB A;  2Y5I A;  1UHJ A;  5HKZ A;  1E8A A;  1R2U A;  3K21 A;  2LP2 A;  1UWO A;  1WRZ A;  2EHB A;  1KK8 C;  3I5F C;  1SCM B;  3EK8 A;  1S6I A;  4NDB A;  2LLS A;  2KYF A;  1SRA A;  2E6W A;  5JOL A;  1JF0 A;  2M7N A;  1CB1 A;  1J7O A;  3ZNI A;  1QVI Z;  3BXK A;  2WCE A;  1F70 A;  1DTL A;  1XFX O;  1BMO A;  1XFU O;  2G2B A;  1B4C A;  1XO5 A;  4PHK A;  1CDL A;  1JBA A;  1Y1X A;  2JNF A;  2KBM A;  1SMG A;  2LMV A;  2GV5 A;  1TRF A;  2KAV A;  2L4I A;  2ZND A;  3OB2 B;  4CLN A;  3TS5 B;  1UUR A;  3JTD B;  1OSA A;  1DMO A;  5HLV A;  4YGB B;  2PSR A;  2BBN A;  3IQQ A;  1RFJ A;  1CFF A;  3SG5 A;  5K89 A;  1Y6W A;  1S26 D;  2MRD A;  1XK4 C;  2PVB A;  1J7R A;  1KFU S;  1XVJ A;  2L0P A;  1CNP A;  4YGC B;  2D8N A;  2LLT A;  1NIW A;  3EKJ A;  1DF0 A;  3KEV A;  3SJS A;  3GK1 A;  5CPV A;  3F45 A;  1A2X A;  1NYA A;  2LM5 A;  3CS1 A;  1JC2 A;  3KPX A;  2M97 A;  1CDM A;  2LAP A;  2H61 A;  1OOJ A;  1K9P A;  1RJV A;  2I18 A;  2KAY A;  1Y1A A;  1LKJ A;  1NSH A;  2CTN A;  1NX1 A;  2L4H A;  3PAT A;  4ETO A;  3PLF B;  2BL0 B;  1NX2 A;  1MQ1 A;  1SNL A;  1DGU A;  4C0J A;  4N1F A;  2WND A;  1L7Z A;  3KO0 A;  3VRR A;  1YRU B;  1LVC D;  4N1G A;  5HYD A;  1KFX S;  4P5O E;  5IBW A;  4MZK A;  4R1E A;  4MLW A;  4ZCU A;  2M7L A;  3AKB A;  5I2Q A;  1NWD A;  1MXE A;  1SY9 A;  2EGD A;  2K7C A;  1QX7 A;  2LE9 B;  3RM1 A;  3C1V A;  2KFG A;  1K96 A;  1MWN A;  3BUN B;  3NSL A;  2AMI A;  1WDC C;  2KQ6 A;  2M0R A;  1KCY A;  3PN7 C;  3WHT B;  3PFV A;  4PHM A;  1QXP A;  4ORA B;  1F8H A;  1KFU L;  4DUQ A;  2KFH A;  1A03 A;  1KSO A;  2I94 A;  2FCE A;  4WQ3 A;  2LHI A;  4MZL A;  1YVH A;  1G33 A;  4CID A;  3O4Y A;  3FWB A;  2CBL A;  4CPV A;  4D1E A;  5G08 A;  2FJU B;  4F0Z B;  1Q80 A;  1OMD A;  1XFV O;  4MBE A;  2QAC A;  2K0J A;  1DVI A;  1W7J B;  1WDC B;  2ZRT A;  1ZOT B;  1A4P A;  3NSK A;  2M49 B;  1DJW A;  1OZS A;  3DD4 A;  1EG4 A;  1CMF A;  2F33 A;  3SG4 A;  3I5I C;  5PAL A;  2LVJ A;  1XK4 A;  1DT7 B;  1K93 D;  1XA5 A;  2LUC A;  3GOF A;  4M2O A;  1YTZ C;  2BCX A;  3WNX B;  2NLN A;  1SCV A;  4MZJ A;  2ZKM X;  3MSE B;  4ORB B;  2KI4 B;  1BT6 A;  1OMR A;  2NXQ A;  3GK4 X;  1UP5 A;  3CGA A;  1KFX L;  3I5I B;  2O5G A;  4PE4 A;  1RK9 A;  5BPJ A;  3HX4 A;  1KQM B;  4JPZ B;  1AJ4 A;  4GNK B;  1NCY A;  4OVN F;  1M39 A;  1MR8 A;  1SBJ A;  3SG6 A;  3CWG A;  4BY4 A;  4OCI A;  1DJG A;  3FIA A;  2L5X B;  2OS8 C;  4PHN A;  1M31 A;  2ZNE A;  1NCZ A;  1V1F A;  2EC6 B;  2KGB C;  4PAL A;  1WY9 A;  1ZMZ A;  3BQ3 A;  1DJY A;  5KTY A;  2I7A A;  4ICB A;  2ZFD A;  2A4J A;  2NCO A;  1FBV A;  2ZN9 A;  2VRG A;  3LK1 A;  2JTT A;  1J1D A;  1PSR A;  3WHU B;  4OKH A;  3BUW B;  3AAK A;  2TN4 A;  2M1U A;  1KK8 B;  3I5F B;  3QRX A;  1BJF A;  4Q04 A;  5J3X A;  1C7V A;  1G4Y R;  2CXJ A;  1BR1 B;  2MBX A;  1JSA A;  1IQ3 A;  3VRP A;  1F71 A;  1GJY A;  1K90 D;  5B8I B;  4GPL B;  3JVT C;  2WCB A;  1EH2 A;  2G9B A;  1NX3 A;  4XYN A;  4P2Y B;  1SW8 A;  1CKK A;  2OTG C;  1B8L A;  1RRO A;  2M8U A;  1REC A;  2H2K A;  4C0L A;  2KYC A;  1N65 A;  1N0Y A;  4ORC B;  3CLN A;  1BU3 A;  1QX2 A;  1VRK A;  2LHL A;  4YGE B;  2Y4Q A;  1ZFS A;  1YRT B;  5AXI A;  1DJZ A;  1EG3 A;  1IKU A;  1ZAC A;  1NX0 A;  2FOT A;  2KQY A;  1QLK A;  4I5N B;  3BUO B;  1AK8 A;  1JUO A;  4MRY A;  3TDI A;  4GFT A;  4DRW A;  1F55 A;  1PSB A;  2MHH A;  2OTG B;  2CCM A;  3OB1 B;  3BUX B;  3CZT X;  2HQW A;  1QS7 A;  3IF7 A;  5KSZ A;  2GGZ A;  1FI6 A;  2FCD A;  1BG1 A;  4DIR A;  1IJ5 A;  2OPO A;  1ALV A;  2L50 A;  1SR6 C;  1RTP 1;  1B7T Z;  1KSM A;  3E3R A;  4YI8 A;  3RLZ A;  2WOS A;  3AAJ A;  2K7B A;  2KDH A;  2KFF A;  2LLU A;  2Y1M A;  1V1G A;  1TNX A;  1K9K A;  2PAL A;  3PAL A;  4YBH B;  1BOC A;  1PAL A;  3SIB A;  5D69 A;  4MRX A;  3OP0 A;  1N2D A;  4QJ5 B;  2MLE C;  1SR6 B;  2K2A A;  1XFW O;  4HSZ A;  5CSN A;  1C07 A;  1OZO A;  1L2O C;  1NUB A;  3EVU A;  1AVS A;  2HPS A;  1NCX A;  4I5L B;  1NP8 A;  2JT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...