1S3PA

Crystal structure of rat alpha-parvalbumin s55d/e59d mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIDEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords Parvalbumin alpha
publication title Crystal Structure of a High-Affinity Variant of Rat alpha-Parvalbumin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s3pA00
2NCPA 1JWDA 3BXKA 1KQMB 1BJFA 1IJ5A 4YBHB 4BY4A 1IH0A 3ZNIA 1QJTA 1PRWA 1FF1A 3KF9A 5HKZA 2FOTA 2FCEA 1PSBA 1NCZA 1SY9A 2LVKA 5DKNA 1QIWA 2JT3A 1NUBA 2KFFA 4JWQA 1J55A 3DVEA 1CDNA 4NQGA 1CDMA 1UHKA 2PMYA 5HLVA 2KI6D 2M49B 5HKYA 4TNCA 1G8IA 1KCYA 3EKJA 1ODBA 1QX2A 2L98A 3BUWB 1N0YA 1SBJA 2AAOA 4XYNA 1SR6B 3EVUA 4GFTA 1PVAA 3AKBA 1F8HA 3TS5C 1YRTB 2KI6C 1ZMZA 1M45A 2KBMA 3VRNA 1AVSA 1Y1UA 3EVRA 1SL9A 5HLOA 1BG1A 1R6PA 1ZUZA 2CTNA 2H61A 1F71A 2AUCA 3SJSA 4GBAA 1KWOB 3SG2A 1F4OA 4JPZB 1S1EA 1JF0A 1PVBA 1N65A 3PFVA 1SCVA 2HPSA 1IQ3A 1Y1XA 1D1OA 1DVIA 2GGMA 1Y0VH 1UHHA 1KK7Y 1WLMA 1YUTA 2LLUA 2PRUA 5DKRA 1XFUO 2BCXA 2I7AA 4M2OA 3HX4A 1SL8A 1XYDA 1LINA 1XFVO 2OTGC 3SG3A 1B8CA 3BYAA 1K90D 3DF0A 1NIWA 3CZTX 2JTTA 4XJKA 1QLSA 2MLEC 3PALA 2M1KB 2I94A 1GGWA 1TNPA 3I5IC 3O2PA 2H61C 2JU0A 2MAZA 1CTRA 3EVVA 4YGEB 3OP0A 1LXFC 2Y1MA 1IJ6A 1G33A 3IQOA 4I5KA 2WCEA 3OX5A 1JBAA 1WRKA 3A8RA 1EG4A 1DJYA 1J7PA 2KDHA 4NDBA 1WDCB 3DD4A 1CFPA 1S36A 2JT8A 3RM1A 3K21A 2KFGA 4AOMA 4GGFA 1XVJA 1FPWA 2KGBC 5KSZA 1RJVA 5I2QA 2KQYA 4PHMA 2LCPA 1DF0A 4MZKA 4MZLA 4PE1A 2K7BA 1J1EA 1QASA 3VRPA 1K9PA 4N1GA 1PULA 1WY9A 1SK6D 1DGUA 1LA3A 1CKKA 3O6BA 2MRDA 4AQJA 2KQ6A 1EH2A 1DJZA 3WXAA 2H2KA 4UPGA 2JC2A 2KNEA 2ZN9A 4IL1A 2HETA 2LNKA 1QLKA 3BUOB 1CB1A 1B7TZ 3TUYC 1JF2A 4MN0A 1TCOB 4YGBB 1RROA 1BODA 1HT9A 2M0RA 1OE9B 1OZSA 3PSRA 2KBIA 3OHMB 1A75A 4QJ3B 5CSJA 5HKWA 2FJUB 3I5HC 3D10A 4OVNF 2M8UA 2KAXA 1MHOA 2LHLA 4MBEA 4XJKB 4HRGA 4CFRA 2KI4C 1B8LA 1UHNA 1KSMA 4A4BA 3RLZA 5F6TA 2JT0A 4D1EA 1CDPA 3EKHA 1AJ4A 4JQ0D 1S6JA 2SASA 4R1EA 1M31A 5FYXA 4ORCB 1F4QA 4DUQA 5D69A 4ZCVA 3CLNA 5CSNA 2F3YA 1WLZA 1YRUB 1L2OC 1XFXO 2BCBA 1JFJA 1RFJA 2KGRA 4WQ2A 1KFXL 1SCMB 4F0ZB 3AKAA 1AK8A 1S6IA 3VROA 1K96A 1TIZA 1W7JB 2K7OA 2LLTA 1J7OA 1CFFA 1B1GA 1FI5A 2LUXA 2LM5A 1N2DA 1OOJA 2K2AA 3JVTC 2F2PA 4GAOA 1AUIB 3PN7B 1SR6C 4YGDB 2BE4A 2WC8A 1DF0B 1C7WA 2EC6C 1CMGA 4AQIA 3VRRA 1QTXA 2WCFA 2BL0B 2OS8B 1DMOA 1ALWA 3TDUA 1C07A 2KOTA 2Q4UA 1SKTA 1QVIZ 1XO5A 1ZACA 1TCFA 1KWOC 2M97A 3AAJA 4PE4A 2G2BA 4U8DA 2LMUA 1M46A 2G9BA 1RECA 3OB1B 2AMIA 5IBWA 1QIVA 2Y5IA 5ER4X 1UP5A 1Y1AA 4PDZA 3VGOA 2Y1NA 1S5GY 4GPLB 3NSKA 5J3XA 4DCKA 2HQWA 3GK1A 3SG4A 1MUXA 2K0JA 4GUKA 3H4SE 1MXEA 1J7RA 4M2PA 1MXLC 1WRLA 1IQ5A 3CR4X 2HQ8A 1MR8A 2LMTA 3BUMB 2PSRA 1TTXA 1B9AA 1EXRA 3CTNA 3I5GB 3TS5B 2Y4QA 3DVKA 1XFZO 4CPVA 4P5OE 3FWBA 1ALVA 2KFHA 3BOWA 2PVBA 1KK8C 4PE0A 1B47A 1IWQA 1A2XA 2PALA 1EJ3A 1SRAA 3A4UB 3D0YA 1E8AA 4ICBA 1M63B 3CGAA 3CWGA 2DOQA 4YI9A 2JULA 2MJWB 2CCMA 4YGAA 1BF5A 1OSAA 4PCWA 1NCYA 4NDDA 1RK9A 1X02A 5KU1A 1TN4A 2NZ0A 2QACA 5PALA 3LL8B 3NSLA 1PSRA 3FIAA 1RWYA 2M7NA 1BR1B 5G08A 2OTGB 2EHBA 2ZFDA 4PHNA 1LA0A 2LVIA 2D8NA 3EK4A 4MSPA 2JPTA 1UUSA 1IGVA 2LMVA 1OMRA 2M1UA 3TDIA 1JUOA 5B8IB 2CXJA 1MWNA 2EGDA 4E68A 1EG3A 5D7FA 1CM1A 1W7IB 1QX7A 2WORA 1S3PA 2QPTA 1A29A 4WQ3A 1QXPA 2OPOA 4QJ4B 1NX3A 1R2UA 2LE9B 3NXAA 1BT6A 3GOFA 3CR2A 1U5IA 2CBLA 1TRFA 2Q91A 4ORBB 1M39A 5AXIA 3JTDC 1H8BA 1DJWA 1JFKA 3FWCA 2F2OA 4DS7A 1J1DA 2ZN8A 3SG5A 4DIRA 3I5FB 1WRZA 3DF0B 2SCPA 4YRUA 3LCPC 2NCOA 3PATA 4I5LB 2JNFA 4OR9B 4MRYA 5I2OA 3TZ1A 4Q04A 5JOLA 1L7ZA 4HSZA 1YR5A 1NPQA 3NSOA 2HF5A 1XFYO 4CIDA 3D0YB 5AEQA 1KQMC 1ZFSA 1NX0A 2LC5A 1BMOA 3DVJA 2K2FA 2LLSA 2ZRSA 3LK0A 1OZOA 1XK4A 1DJGA 1DJXA 5AANA 4MRXA 1GQMA 1XA5A 2M7LA 3E3RA 3TUYB 3VRQA 3OB2B 4QJ5B 2WOSA 1K9UA 1CFDA 5CSIA 1SMGA 2JNXA 2KYFA 3EK7A 3I5HB 1FW4A 1YX7A 2L4IA 5TNCA 3WNXB 2KI4B 1KK7Z 2ISDA 1AP4A 3FS7A 4MLWA 4NDCA 2I2RE 4P2YB 4CFQA 3O78A 1CMFA 1AJ5A 5CSFA 1CLBA 1B8RA 1IG5A 1B7TY 1OMDA 1QV0A 1TNXA 1OMVA 1XK4C 1F55A 3CS1A 4OKHA 1CLLA 1L2OB 5CPVA 2KHNA 2MA2A 1U5IB 2K7CA 2ZRTA 1SL7A 2JRFA 1J7QA 3BUXB 1BOCA 5I8NA 3HCMA 4PHKA 1SW8A 4HRHA 1F70A 1DJIA 4WRIA 2CNPA 1A75B 2K7DA 2MHHA 3ZWHA 3KPXA 2JXLA 4MVFA 1F54A 2L0PA 4MZJA 2I18A 3JVTB 4FTGA 1TNQA 4N1FA 3WHUB 2ZNDA 3O4YA 2KAVA 3I5GC 2EC6B 2L51A 4ETOA 5DKQA 1VRKA 1NYAA 2R2IA 5ER5A 3SG6A 5AFPA 1NX2A 4ZCUA 2JOJA 5GQQC 1TNWA 1KFXS 2LUCA 1YURA 2L2EA 1FBVA 1CLMA 2PASA 3IQQA 1LKJA 4GNKB 1YTZC 3GK2A 2MLFC 3IF7A 1G4YR 3KO0A 1YUUA 1CM4A 1K93D 1Q80A 2GV5A 1B4CA 4C0LA 3ICBA 4ORAB 2F8PA 3GK4X 1CFCA 3LK1A 1GJYA 3LLEA 3PLFB 4PALA 3DVMA 1OQPA 2B1UA 1EL4A 2LAPA 1MF8B 2BKIB 5KTYA 1WDCC 4I5JA 1QS7A 1RTP1 2RGIA 1AHRA 2ZKMX 1K2HA 4L9MA 2WNDA 1KFUL 2KAYA 3SIBA 1K9KA 1JSAA 2JXCA 2BECA 1QVIY 2BE6A 4OCIA 1UHJA 4YGCB 1FI6A 1NSHA 1NX1A 2JTZA 2CT9A 4USLA 2F33A 3OX6A 1DJHA 1TOPA 1YVLA 1UURA 1BU3A 4CLNA 3QRXA 4YI8A 2LV7A 1V1GA 3EK8A 3I5IB 2LHIA 1KK8B 2WCBA 2FCDA 2O5GA 1V1FA 4OV2A 2KSPA 2M9GA 4GGNA 2MBXA 1QX5B 1S26D 1DGVA 4PHJA 2M3WA 2LP2A 1A4PA 1LVCD 2L5XB 2BKHB 1CNPA 3KHEA 1H4BA 4C0JA 1PK0D 5AERA 1SPYA 2A4JA 2KYCA 1NWDA 1KSOA 3M0WA 4FQOA 1Y6WA 1DTLA 2JWWA 3I5FC 1BLQA 1QV1A 3TDZA 1UWOA 2K61A 4I5NB 2ZNEA 1MQ1A 2COLB 3WHTB 5JJGA 4N5XA 5BPJA 1SNLA 4C0KA 1DT7B 1SYMA 3CR5X 1A03A 3KEVA 2LP3A 5I2LA 1KQVA 1K95A 3BOWB 1YX8A 4MEWA 3F45A 2BBMA 2VRGA 3BQ3A 4M2QA 3SG7A 1BR4B 5K89A 1HQVA 2O60A 2BCAA 1JC2A 3BUNB 2IS9A 2V53A 4A4CA 1SCMC 2LANA 1K94A 1NP8A 1KFUS 1YUSA 1IRJA 3NSIA 1C7VA 5HYDA 1QATA 1XFWO 2TN4A 1NCXA 3JTDB 4PE7A 2LVJA 4GGFC 1S6CA 2P6BB 3MSEB 2LVVA 2F3ZA 3PM8A 2E30A 3SIAA 3PN7C 1CDLA 1IKUA 2M29A 1PALA 1S5GZ 3C1VA 2L4HA 4DRWA 1K8UA 1YVHA 2BBNA 2E6WA 2L50A 4HREE 2GGZA 1UHIA 1GGZA 2JQ6A 3AAKA 2JZIA 2BL0C 2NLNA 2OS8C 4BY5A 2K8MB 1ZOTB 2NXQA
chains in the Genus database with same CATH superfamily
2NCPA 1JWDA 3BXKA 1KQMB 1BJFA 1IJ5A 4YBHB 4BY4A 1IH0A 3ZNIA 1QJTA 3RZSA 1PRWA 3CDNA 3KF9A 5FI6A 1FF1A 5HKZA 2K8MB 2FOTA 2FCEA 1PSBA 1NCZA 4KYNA 1SY9A 2LVKA 3S0DA 5DKNA 1QIWA 2JT3A 1NUBA 2KFFA 4JWQA 1J55A 3DVEA 1CDNA 4NQGA 1CDMA 1UHKA 2PMYA 5HLVA 2KI6D 2WCMA 5FI2A 3UNWA 2M49B 3L4LA 5HKYA 3VB1A 3IVTA 4TNCA 1G8IA 1KCYA 3EKJA 1ODBA 1QX2A 2L98A 3BUWB 1N0YA 1SBJA 2AAOA 4XYNA 1SR6B 3EVUA 4GFTA 1PVAA 1C3ZA 3AKBA 3BJHA 3TS5C 1F8HA 1YRTB 2KI6C 1ZMZA 1M45A 3S0AA 2KBMA 1ORGA 1AVSA 1Y1UA 3EVRA 3VRNA 1SL9A 5HLOA 1BG1A 1R6PA 1ZUZA 2CTNA 2KPHA 2H61A 1F71A 2AUCA 3SJSA 4GBAA 3B88A 1KWOB 3SG2A 1F4OA 4JPZB 1S1EA 1JF0A 1PVBA 1N65A 3PFVA 1SCVA 2HPSA 1IQ3A 1Y1XA 1D1OA 3CZ0A 2BNXA 1DVIA 2GGMA 1Y0VH 1UHHA 1KK7Y 1WLMA 1YUTA 2LLUA 2PRUA 3D73A 5DKRA 3PJIA 1XFUO 2BCXA 2I7AA 4M2OA 3HX4A 1SL8A 1XYDA 1LINA 1XFVO 2OTGC 3SG3A 1B8CA 3BYAA 1K90D 3DF0A 1Z4HA 1NIWA 3CZTX 2JTTA 4XJKA 1QLSA 2MLEC 2PYQA 3PALA 2M1KB 2I94A 1GGWA 1TNPA 3I5IC 3O2PA 2H61C 2JU0A 2MAZA 1CTRA 3EVVA 4YGEB 3OP0A 1LXFC 2Y1MA 1IJ6A 1G33A 3IQOA 4I5KA 4INXA 2WCEA 3OX5A 1JBAA 1WRKA 3A8RA 1EG4A 3B86A 1DJYA 1J7PA 2KDHA 4NDBA 1WDCB 3DD4A 1CFPA 1S36A 2JT8A 3RM1A 3K21A 3NGVA 2KFGA 4AOMA 2L2CA 4GGFA 1XVJA 1FPWA 2KGBC 5KSZA 1RJVA 2PQLA 5I2QA 2KQYA 4PHMA 2LCPA 1DF0A 4MZKA 4MZLA 4PE1A 2K7BA 1J1EA 1QASA 3VRPA 1K9PA 4N1GA 1PULA 1WY9A 1SK6D 1DGUA 1LA3A 1CKKA 3O6BA 2MRDA 4AQJA 2KQ6A 3SS5A 1EH2A 1DJZA 3PM2A 3WXAA 2H2KA 4JKTA 2JC2A 2KNEA 2ZN9A 4UPGA 5EL2A 4IL1A 2HETA 2LNKA 3UO9A 1QLKA 3BUOB 1CB1A 1B7TZ 3FE9A 3TUYC 1JF2A 4MN0A 1TCOB 4YGBB 1RROA 4JD9A 1BODA 1HT9A 2M0RA 1OE9B 3R1VA 1OZSA 3PSRA 2KBIA 1P28A 3NHTA 1TWOA 1A75A 3FE8A 3OHMB 4QJ3B 5CSJA 5HKWA 2FJUB 3I5HC 3D10A 4OVNF 2M8UA 2KAXA 1MHOA 2LHLA 3B7AA 4MBEA 4XJKB 4HRGA 5D3OA 4INWA 4CFRA 2KI4C 1B8LA 1UHNA 1KSMA 4A4BA 3RLZA 5F6TA 2JT0A 4D1EA 1CDPA 3EKHA 1AJ4A 4JQ0D 1S6JA 1DC1A 2SASA 4R1EA 1M31A 5FYXA 4ORCB 1F4QA 4DUQA 5D69A 4ZCVA 1OW4A 3CLNA 5CSNA 2WCHA 2F3YA 1WLZA 1YRUB 1L2OC 2P71A 1XFXO 2BCBA 1JFJA 1RFJA 2KGRA 4WQ2A 1KFXL 1SCMB 4F0ZB 3AKAA 1AK8A 1S6IA 3VROA 4PT1A 1K96A 1TIZA 1W7JB 2K7OA 2LLTA 2WCJA 1J7OA 1CFFA 1B1GA 2KLEA 1FI5A 2LUXA 2LM5A 1N2DA 1OOJA 2K2AA 3JVTC 2F2PA 4GAOA 1AUIB 3PN7B 1SR6C 4YGDB 2BE4A 2WC8A 1DF0B 1OOGA 1C7WA 1DELA 2EC6C 1CMGA 4AQIA 3VRRA 3CABA 1QTXA 2WCFA 2BL0B 2OS8B 1DMOA 1ALWA 3TDUA 1C07A 2KOTA 3SS4A 2Q4UA 1SKTA 1QVIZ 1XO5A 1ZACA 1TCFA 3B6XA 1KWOC 5DICA 2M97A 3AAJA 4PE4A 2G2BA 2WCKA 3D78A 4U8DA 2LMUA 1M46A 2G9BA 1RECA 3OB1B 2AMIA 5IBWA 1QIVA 2Y5IA 5ER4X 3R1PA 1UP5A 1Y1AA 4PDZA 3VGOA 3DZTA 2Y1NA 1S5GY 4GPLB 3NSKA 1TUJA 5J3XA 4DCKA 1C3YA 2HQWA 3GK1A 3SG4A 1MUXA 2K0JA 4GUKA 3D74A 3H4SE 1MXEA 4F7FA 3BFHA 1J7RA 5I94A 4M2PA 1MXLC 1WRLA 1IQ5A 3CR4X 2HQ8A 1MR8A 2LMTA 3BUMB 2PSRA 1TTXA 1B9AA 1EXRA 2QDIA 3CTNA 3I5GB 2Y4QA 3DVKA 1XFZO 3TS5B 4CPVA 4P5OE 3FWBA 1ALVA 2KFHA 3BOWA 3O4XA 2PVBA 1KK8C 3R1OA 4PE0A 1B47A 1IWQA 1A2XA 2PALA 1EJ3A 3BFAA 1SRAA 1T14A 3A4UB 3D0YA 1E8AA 4ICBA 1M63B 3CGAA 3CWGA 2DOQA 3K1EA 2ERBA 4YI9A 2JULA 2MJWB 2CCMA 4YGAA 1BF5A 1OSAA 4PCWA 1NCYA 4NDDA 3L47A 1RK9A 1X02A 5KU1A 1TN4A 2NZ0A 2QACA 5PALA 3LL8B 3NHIA 1PSRA 3FIAA 1RWYA 2M7NA 3NSLA 3S0BA 1BR1B 5G08A 3CYZA 2OTGB 3D76A 2EHBA 2ZFDA 4PHNA 1LA0A 2LVIA 2D8NA 3EK4A 4MSPA 2JPTA 1UUSA 1IGVA 2LMVA 1OMRA 1LS8A 2M1UA 3TDIA 1JUOA 5B8IB 2CXJA 1MWNA 2EGDA 4E68A 1EG3A 5D7FA 1CM1A 2WCLA 3EG5B 1W7IB 1QX7A 2WORA 1S3PA 3V2LA 2QPTA 1A29A 4WQ3A 1QXPA 4FQTA 2OPOA 4QJ4B 1NX3A 1R2UA 2LE9B 3NXAA 1BT6A 3GOFA 3CR2A 1U5IA 2CBLA 1TRFA 2Q91A 4ORBB 1M39A 5AXIA 3JTDC 1H8BA 1DJWA 1JFKA 2JPOA 3FWCA 2F2OA 4DS7A 1J1DA 3D75A 2GTEA 1QWVA 2ZN8A 3SG5A 4DIRA 3I5FB 1WRZA 3DF0B 2SCPA 4YRUA 3LCPC 2NCOA 3PATA 4I5LB 2JNFA 4OR9B 4MRYA 3S0GA 5I2OA 4IJ7A 3TZ1A 4Q04A 5JOLA 1L7ZA 4HSZA 1Z2CB 1YR5A 1NPQA 3NSOA 2HF5A 1XFYO 4CIDA 3D0YB 5AEQA 1KQMC 1ZFSA 1NX0A 2LC5A 1BMOA 3DVJA 1OOFA 2K2FA 2LLSA 1GM0A 2ZRSA 3LK0A 1OZOA 1XK4A 1DJGA 3D77A 1DJXA 5AANA 4MRXA 3S0FA 1GQMA 1XA5A 2M7LA 3E3RA 2QEVA 3TUYB 3OB2B 3VRQA 4QJ5B 2WOSA 3QMEA 1K9UA 1CFDA 2H8VA 5CSIA 1SMGA 2JNXA 2KYFA 3EK7A 3I5HB 1FW4A 1YX7A 2L4IA 5TNCA 3WNXB 2KI4B 1KK7Z 2ISDA 3DYEA 3L4AA 1AP4A 3FS7A 4MLWA 4NDCA 2I2RE 4P2YB 4CFQA 3O78A 1CMFA 1AJ5A 1XFRA 3Q8IA 5CSFA 1CLBA 1B8RA 2KLDA 1IG5A 1B7TY 1OMDA 1QV0A 1TNXA 1OMVA 1XK4C 1F55A 3CS1A 4OKHA 1CLLA 1L2OB 5CPVA 2KHNA 2MA2A 1U5IB 1TUZA 2K7CA 2ZRTA 1SL7A 2JRFA 1J7QA 3BUXB 1BOCA 5I8NA 3HCMA 4PHKA 1SW8A 4HRHA 1F70A 1DJIA 4WRIA 1A75B 2CNPA 2K7DA 2MHHA 3ZWHA 3KPXA 2JXLA 4MVFA 1F54A 2L0PA 4MZJA 2I18A 3JVTB 4FTGA 2WC6A 1TNQA 4N1FA 3WHUB 2ZNDA 3O4YA 2KAVA 3N7HA 2FJYA 3I5GC 2EC6B 2L51A 4ETOA 5DKQA 1VRKA 2L5YA 1NYAA 2R2IA 5ER5A 3SG6A 5AFPA 1NX2A 4ZCUA 2JOJA 3OGNA 3R72A 1TNWA 5GQQC 1KFXS 2LUCA 3DY9A 5FI7A 1YURA 2L2EA 1FBVA 1CLMA 2PASA 3IQQA 1LKJA 4GNKB 1YTZC 3FE6A 3GK2A 2MLFC 3IF7A 1G4YR 3KO0A 1YUUA 1CM4A 1K93D 1Q80A 2GV5A 1B4CA 3B87A 4C0LA 3ICBA 4ORAB 4OZDA 2F8PA 3GK4X 1CFCA 3LK1A 1GJYA 3LLEA 3PLFB 4PALA 3DVMA 5HL1A 1OQPA 3CZ2A 2B1UA 1EL4A 2LAPA 1MF8B 2BKIB 5KTYA 1WDCC 4I5JA 1QS7A 1RTP1 2RGIA 1AHRA 2ZKMX 1K2HA 4L9MA 2QEBA 2WNDA 1KFUL 2KAYA 3SIBA 1K9KA 1JSAA 2JXCA 2BECA 1QVIY 2BE6A 4OCIA 1UHJA 4YGCB 3S0EA 1FI6A 1NSHA 1NX1A 2JTZA 2QEOA 2CT9A 4USLA 2F33A 3OX6A 1DJHA 1TOPA 1YVLA 1UURA 1BU3A 4CLNA 3QRXA 4YI8A 2LV7A 1V1GA 3EK8A 3I5IB 2LHIA 1KK8B 2WCBA 3BFBA 2FCDA 2O5GA 3OBVA 1V1FA 4OV2A 2KSPA 2M9GA 4GGNA 2MBXA 1QX5B 1S26D 1DGVA 4PHJA 2M3WA 2LP2A 3SS3A 1A4PA 1LVCD 2L5XB 2BKHB 1CNPA 3KHEA 1DQEA 1H4BA 4C0JA 1PK0D 5AERA 3CZ1A 2P70A 1SPYA 2A4JA 2KYCA 1NWDA 1KSOA 3M0WA 4FQOA 1Y6WA 1DTLA 2JWWA 3I5FC 1BLQA 1QV1A 3TDZA 1UWOA 2K61A 4I5NB 2ZNEA 1MQ1A 2COLB 3WHTB 5JJGA 4N5XA 5BPJA 1SNLA 4C0KA 1DT7B 1SYMA 3CR5X 1A03A 3KEVA 2LP3A 5I2LA 1KQVA 3DXLA 1K95A 3BOWB 2QEHA 2K60A 1YX8A 4MEWA 1OOHA 2BBMA 3F45A 2VRGA 3BQ3A 4M2QA 3SG7A 1BR4B 5K89A 1HQVA 2O60A 2BCAA 1JC2A 1DEKA 1W9ZA 3BUNB 2IS9A 2V53A 4A4CA 1SCMC 2LANA 1K94A 1NP8A 1KFUS 1YUSA 1IRJA 3NSIA 1C7VA 5HYDA 1QATA 1XFWO 2TN4A 2YGUA 1NCXA 3JTDB 4PE7A 2LVJA 4GGFC 1S6CA 2P6BB 3MSEB 2LVVA 2F3ZA 3PM8A 2E30A 3SIAA 3PN7C 1CDLA 1IKUA 2M29A 1PALA 1S5GZ 3C1VA 2L4HA 4DRWA 1K8UA 1YVHA 2BBNA 2E6WA 2L50A 4HREE 2GGZA 1OOIX 1UHIA 1IIOA 1GGZA 2JQ6A 2WC5A 3AAKA 2JZIA 2BL0C 2NLNA 1SSEB 2OS8C 4BY5A 2BAPA 1ZOTB 2NXQA
chains in the Genus database with same CATH topology
2NCPA 1JWDA 3BXKA 1KQMB 1BJFA 1IJ5A 4YBHB 4BY4A 1IH0A 3ZNIA 1QJTA 1PRWA 1FF1A 3KF9A 5HKZA 2FOTA 2FCEA 1PSBA 1NCZA 1SY9A 2LVKA 5DKNA 1QIWA 2JT3A 1NUBA 2KFFA 4JWQA 1J55A 3DVEA 1CDNA 4NQGA 1CDMA 1UHKA 2PMYA 5HLVA 2KI6D 2M49B 5HKYA 4TNCA 1G8IA 1KCYA 3EKJA 1ODBA 1QX2A 2L98A 3BUWB 1N0YA 1SBJA 2AAOA 4XYNA 1SR6B 3EVUA 4GFTA 1PVAA 3AKBA 1F8HA 3TS5C 1YRTB 2KI6C 1ZMZA 1M45A 2KBMA 3VRNA 1AVSA 1Y1UA 3EVRA 1SL9A 5HLOA 1BG1A 1R6PA 1ZUZA 2CTNA 2H61A 1F71A 2AUCA 3SJSA 4GBAA 1KWOB 3SG2A 1F4OA 4JPZB 1S1EA 1JF0A 1PVBA 1N65A 3PFVA 1SCVA 2HPSA 1IQ3A 1Y1XA 1D1OA 1DVIA 2GGMA 1Y0VH 1UHHA 1KK7Y 1WLMA 1YUTA 2LLUA 2PRUA 5DKRA 1XFUO 2BCXA 2I7AA 4M2OA 3HX4A 1SL8A 1XYDA 1LINA 1XFVO 2OTGC 3SG3A 1B8CA 3BYAA 1K90D 3DF0A 1NIWA 3CZTX 2JTTA 4XJKA 1QLSA 2MLEC 3PALA 2M1KB 2I94A 1GGWA 1TNPA 3I5IC 3O2PA 2H61C 2JU0A 2MAZA 1CTRA 3EVVA 4YGEB 3OP0A 1LXFC 2Y1MA 1IJ6A 1G33A 3IQOA 4I5KA 2WCEA 3OX5A 1JBAA 1WRKA 3A8RA 1EG4A 1DJYA 1J7PA 2KDHA 4NDBA 1WDCB 3DD4A 1CFPA 1S36A 2JT8A 3RM1A 3K21A 2KFGA 4AOMA 4GGFA 1XVJA 1FPWA 2KGBC 5KSZA 1RJVA 5I2QA 2KQYA 4PHMA 2LCPA 1DF0A 4MZKA 4MZLA 4PE1A 2K7BA 1J1EA 1QASA 3VRPA 1K9PA 4N1GA 1PULA 1WY9A 1SK6D 1DGUA 1LA3A 1CKKA 3O6BA 2MRDA 4AQJA 2KQ6A 1EH2A 1DJZA 3WXAA 2H2KA 4UPGA 2JC2A 2KNEA 2ZN9A 4IL1A 2HETA 2LNKA 1QLKA 3BUOB 1CB1A 1B7TZ 3TUYC 1JF2A 4MN0A 1TCOB 4YGBB 1RROA 1BODA 1HT9A 2M0RA 1OE9B 1OZSA 3PSRA 2KBIA 3OHMB 1A75A 4QJ3B 5CSJA 5HKWA 2FJUB 3I5HC 3D10A 4OVNF 2M8UA 2KAXA 1MHOA 2LHLA 4MBEA 4XJKB 4HRGA 4CFRA 2KI4C 1B8LA 1UHNA 1KSMA 4A4BA 3RLZA 5F6TA 2JT0A 4D1EA 1CDPA 3EKHA 1AJ4A 4JQ0D 1S6JA 2SASA 4R1EA 1M31A 5FYXA 4ORCB 1F4QA 4DUQA 5D69A 4ZCVA 3CLNA 5CSNA 2F3YA 1WLZA 1YRUB 1L2OC 1XFXO 2BCBA 1JFJA 1RFJA 2KGRA 4WQ2A 1KFXL 1SCMB 4F0ZB 3AKAA 1AK8A 1S6IA 3VROA 1K96A 1TIZA 1W7JB 2K7OA 2LLTA 1J7OA 1CFFA 1B1GA 1FI5A 2LUXA 2LM5A 1N2DA 1OOJA 2K2AA 3JVTC 2F2PA 4GAOA 1AUIB 3PN7B 1SR6C 4YGDB 2BE4A 2WC8A 1DF0B 1C7WA 2EC6C 1CMGA 4AQIA 3VRRA 1QTXA 2WCFA 2BL0B 2OS8B 1DMOA 1ALWA 3TDUA 1C07A 2KOTA 2Q4UA 1SKTA 1QVIZ 1XO5A 1ZACA 1TCFA 1KWOC 2M97A 3AAJA 4PE4A 2G2BA 4U8DA 2LMUA 1M46A 2G9BA 1RECA 3OB1B 2AMIA 5IBWA 1QIVA 2Y5IA 5ER4X 1UP5A 1Y1AA 4PDZA 3VGOA 2Y1NA 1S5GY 4GPLB 3NSKA 5J3XA 4DCKA 2HQWA 3GK1A 3SG4A 1MUXA 2K0JA 4GUKA 3H4SE 1MXEA 1J7RA 4M2PA 1MXLC 1WRLA 1IQ5A 3CR4X 2HQ8A 1MR8A 2LMTA 3BUMB 2PSRA 1TTXA 1B9AA 1EXRA 3CTNA 3I5GB 3TS5B 2Y4QA 3DVKA 1XFZO 4CPVA 4P5OE 3FWBA 1ALVA 2KFHA 3BOWA 2PVBA 1KK8C 4PE0A 1B47A 1IWQA 1A2XA 2PALA 1EJ3A 1SRAA 3A4UB 3D0YA 1E8AA 4ICBA 1M63B 3CGAA 3CWGA 2DOQA 4YI9A 2JULA 2MJWB 2CCMA 4YGAA 1BF5A 1OSAA 4PCWA 1NCYA 4NDDA 1RK9A 1X02A 5KU1A 1TN4A 2NZ0A 2QACA 5PALA 3LL8B 3NSLA 1PSRA 3FIAA 1RWYA 2M7NA 1BR1B 5G08A 2OTGB 2EHBA 2ZFDA 4PHNA 1LA0A 2LVIA 2D8NA 3EK4A 4MSPA 2JPTA 1UUSA 1IGVA 2LMVA 1OMRA 2M1UA 3TDIA 1JUOA 5B8IB 2CXJA 1MWNA 2EGDA 4E68A 1EG3A 5D7FA 1CM1A 1W7IB 1QX7A 2WORA 1S3PA 2QPTA 1A29A 4WQ3A 1QXPA 2OPOA 4QJ4B 1NX3A 1R2UA 2LE9B 3NXAA 1BT6A 3GOFA 3CR2A 1U5IA 2CBLA 1TRFA 2Q91A 4ORBB 1M39A 5AXIA 3JTDC 1H8BA 1DJWA 1JFKA 3FWCA 2F2OA 4DS7A 1J1DA 2ZN8A 3SG5A 4DIRA 3I5FB 1WRZA 3DF0B 2SCPA 4YRUA 3LCPC 2NCOA 3PATA 4I5LB 2JNFA 4OR9B 4MRYA 5I2OA 3TZ1A 4Q04A 5JOLA 1L7ZA 4HSZA 1YR5A 1NPQA 3NSOA 2HF5A 1XFYO 4CIDA 3D0YB 5AEQA 1KQMC 1ZFSA 1NX0A 2LC5A 1BMOA 3DVJA 2K2FA 2LLSA 2ZRSA 3LK0A 1OZOA 1XK4A 1DJGA 1DJXA 5AANA 4MRXA 1GQMA 1XA5A 2M7LA 3E3RA 3TUYB 3VRQA 3OB2B 4QJ5B 2WOSA 1K9UA 1CFDA 5CSIA 1SMGA 2JNXA 2KYFA 3EK7A 3I5HB 1FW4A 1YX7A 2L4IA 5TNCA 3WNXB 2KI4B 1KK7Z 2ISDA 1AP4A 3FS7A 4MLWA 4NDCA 2I2RE 4P2YB 4CFQA 3O78A 1CMFA 1AJ5A 5CSFA 1CLBA 1B8RA 1IG5A 1B7TY 1OMDA 1QV0A 1TNXA 1OMVA 1XK4C 1F55A 3CS1A 4OKHA 1CLLA 1L2OB 5CPVA 2KHNA 2MA2A 1U5IB 2K7CA 2ZRTA 1SL7A 2JRFA 1J7QA 3BUXB 1BOCA 5I8NA 3HCMA 4PHKA 1SW8A 4HRHA 1F70A 1DJIA 4WRIA 2CNPA 1A75B 2K7DA 2MHHA 3ZWHA 3KPXA 2JXLA 4MVFA 1F54A 2L0PA 4MZJA 2I18A 3JVTB 4FTGA 1TNQA 4N1FA 3WHUB 2ZNDA 3O4YA 2KAVA 3I5GC 2EC6B 2L51A 4ETOA 5DKQA 1VRKA 1NYAA 2R2IA 5ER5A 3SG6A 5AFPA 1NX2A 4ZCUA 2JOJA 5GQQC 1TNWA 1KFXS 2LUCA 1YURA 2L2EA 1FBVA 1CLMA 2PASA 3IQQA 1LKJA 4GNKB 1YTZC 3GK2A 2MLFC 3IF7A 1G4YR 3KO0A 1YUUA 1CM4A 1K93D 1Q80A 2GV5A 1B4CA 4C0LA 3ICBA 4ORAB 2F8PA 3GK4X 1CFCA 3LK1A 1GJYA 3LLEA 3PLFB 4PALA 3DVMA 1OQPA 2B1UA 1EL4A 2LAPA 1MF8B 2BKIB 5KTYA 1WDCC 4I5JA 1QS7A 1RTP1 2RGIA 1AHRA 2ZKMX 1K2HA 4L9MA 2WNDA 1KFUL 2KAYA 3SIBA 1K9KA 1JSAA 2JXCA 2BECA 1QVIY 2BE6A 4OCIA 1UHJA 4YGCB 1FI6A 1NSHA 1NX1A 2JTZA 2CT9A 4USLA 2F33A 3OX6A 1DJHA 1TOPA 1YVLA 1UURA 1BU3A 4CLNA 3QRXA 4YI8A 2LV7A 1V1GA 3EK8A 3I5IB 2LHIA 1KK8B 2WCBA 2FCDA 2O5GA 1V1FA 4OV2A 2KSPA 2M9GA 4GGNA 2MBXA 1QX5B 1S26D 1DGVA 4PHJA 2M3WA 2LP2A 1A4PA 1LVCD 2L5XB 2BKHB 1CNPA 3KHEA 1H4BA 4C0JA 1PK0D 5AERA 1SPYA 2A4JA 2KYCA 1NWDA 1KSOA 3M0WA 4FQOA 1Y6WA 1DTLA 2JWWA 3I5FC 1BLQA 1QV1A 3TDZA 1UWOA 2K61A 4I5NB 2ZNEA 1MQ1A 2COLB 3WHTB 5JJGA 4N5XA 5BPJA 1SNLA 4C0KA 1DT7B 1SYMA 3CR5X 1A03A 3KEVA 2LP3A 5I2LA 1KQVA 1K95A 3BOWB 1YX8A 4MEWA 3F45A 2BBMA 2VRGA 3BQ3A 4M2QA 3SG7A 1BR4B 5K89A 1HQVA 2O60A 2BCAA 1JC2A 3BUNB 2IS9A 2V53A 4A4CA 1SCMC 2LANA 1K94A 1NP8A 1KFUS 1YUSA 1IRJA 3NSIA 1C7VA 5HYDA 1QATA 1XFWO 2TN4A 1NCXA 3JTDB 4PE7A 2LVJA 4GGFC 1S6CA 2P6BB 3MSEB 2LVVA 2F3ZA 3PM8A 2E30A 3SIAA 3PN7C 1CDLA 1IKUA 2M29A 1PALA 1S5GZ 3C1VA 2L4HA 4DRWA 1K8UA 1YVHA 2BBNA 2E6WA 2L50A 4HREE 2GGZA 1UHIA 1GGZA 2JQ6A 3AAKA 2JZIA 2BL0C 2NLNA 2OS8C 4BY5A 2K8MB 1ZOTB 2NXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCP A;  1JWD A;  3BXK A;  1KQM B;  1BJF A;  1IJ5 A;  4YBH B;  4BY4 A;  1IH0 A;  3ZNI A;  1QJT A;  1PRW A;  1FF1 A;  3KF9 A;  5HKZ A;  2FOT A;  2FCE A;  1PSB A;  1NCZ A;  1SY9 A;  2LVK A;  5DKN A;  1QIW A;  2JT3 A;  1NUB A;  2KFF A;  4JWQ A;  1J55 A;  3DVE A;  1CDN A;  4NQG A;  1CDM A;  1UHK A;  2PMY A;  5HLV A;  2KI6 D;  2M49 B;  5HKY A;  4TNC A;  1G8I A;  1KCY A;  3EKJ A;  1ODB A;  1QX2 A;  2L98 A;  3BUW B;  1N0Y A;  1SBJ A;  2AAO A;  4XYN A;  1SR6 B;  3EVU A;  4GFT A;  1PVA A;  3AKB A;  1F8H A;  3TS5 C;  1YRT B;  2KI6 C;  1ZMZ A;  1M45 A;  2KBM A;  3VRN A;  1AVS A;  1Y1U A;  3EVR A;  1SL9 A;  5HLO A;  1BG1 A;  1R6P A;  1ZUZ A;  2CTN A;  2H61 A;  1F71 A;  2AUC A;  3SJS A;  4GBA A;  1KWO B;  3SG2 A;  1F4O A;  4JPZ B;  1S1E A;  1JF0 A;  1PVB A;  1N65 A;  3PFV A;  1SCV A;  2HPS A;  1IQ3 A;  1Y1X A;  1D1O A;  1DVI A;  2GGM A;  1Y0V H;  1UHH A;  1KK7 Y;  1WLM A;  1YUT A;  2LLU A;  2PRU A;  5DKR A;  1XFU O;  2BCX A;  2I7A A;  4M2O A;  3HX4 A;  1SL8 A;  1XYD A;  1LIN A;  1XFV O;  2OTG C;  3SG3 A;  1B8C A;  3BYA A;  1K90 D;  3DF0 A;  1NIW A;  3CZT X;  2JTT A;  4XJK A;  1QLS A;  2MLE C;  3PAL A;  2M1K B;  2I94 A;  1GGW A;  1TNP A;  3I5I C;  3O2P A;  2H61 C;  2JU0 A;  2MAZ A;  1CTR A;  3EVV A;  4YGE B;  3OP0 A;  1LXF C;  2Y1M A;  1IJ6 A;  1G33 A;  3IQO A;  4I5K A;  2WCE A;  3OX5 A;  1JBA A;  1WRK A;  3A8R A;  1EG4 A;  1DJY A;  1J7P A;  2KDH A;  4NDB A;  1WDC B;  3DD4 A;  1CFP A;  1S36 A;  2JT8 A;  3RM1 A;  3K21 A;  2KFG A;  4AOM A;  4GGF A;  1XVJ A;  1FPW A;  2KGB C;  5KSZ A;  1RJV A;  5I2Q A;  2KQY A;  4PHM A;  2LCP A;  1DF0 A;  4MZK A;  4MZL A;  4PE1 A;  2K7B A;  1J1E A;  1QAS A;  3VRP A;  1K9P A;  4N1G A;  1PUL A;  1WY9 A;  1SK6 D;  1DGU A;  1LA3 A;  1CKK A;  3O6B A;  2MRD A;  4AQJ A;  2KQ6 A;  1EH2 A;  1DJZ A;  3WXA A;  2H2K A;  4UPG A;  2JC2 A;  2KNE A;  2ZN9 A;  4IL1 A;  2HET A;  2LNK A;  1QLK A;  3BUO B;  1CB1 A;  1B7T Z;  3TUY C;  1JF2 A;  4MN0 A;  1TCO B;  4YGB B;  1RRO A;  1BOD A;  1HT9 A;  2M0R A;  1OE9 B;  1OZS A;  3PSR A;  2KBI A;  3OHM B;  1A75 A;  4QJ3 B;  5CSJ A;  5HKW A;  2FJU B;  3I5H C;  3D10 A;  4OVN F;  2M8U A;  2KAX A;  1MHO A;  2LHL A;  4MBE A;  4XJK B;  4HRG A;  4CFR A;  2KI4 C;  1B8L A;  1UHN A;  1KSM A;  4A4B A;  3RLZ A;  5F6T A;  2JT0 A;  4D1E A;  1CDP A;  3EKH A;  1AJ4 A;  4JQ0 D;  1S6J A;  2SAS A;  4R1E A;  1M31 A;  5FYX A;  4ORC B;  1F4Q A;  4DUQ A;  5D69 A;  4ZCV A;  3CLN A;  5CSN A;  2F3Y A;  1WLZ A;  1YRU B;  1L2O C;  1XFX O;  2BCB A;  1JFJ A;  1RFJ A;  2KGR A;  4WQ2 A;  1KFX L;  1SCM B;  4F0Z B;  3AKA A;  1AK8 A;  1S6I A;  3VRO A;  1K96 A;  1TIZ A;  1W7J B;  2K7O A;  2LLT A;  1J7O A;  1CFF A;  1B1G A;  1FI5 A;  2LUX A;  2LM5 A;  1N2D A;  1OOJ A;  2K2A A;  3JVT C;  2F2P A;  4GAO A;  1AUI B;  3PN7 B;  1SR6 C;  4YGD B;  2BE4 A;  2WC8 A;  1DF0 B;  1C7W A;  2EC6 C;  1CMG A;  4AQI A;  3VRR A;  1QTX A;  2WCF A;  2BL0 B;  2OS8 B;  1DMO A;  1ALW A;  3TDU A;  1C07 A;  2KOT A;  2Q4U A;  1SKT A;  1QVI Z;  1XO5 A;  1ZAC A;  1TCF A;  1KWO C;  2M97 A;  3AAJ A;  4PE4 A;  2G2B A;  4U8D A;  2LMU A;  1M46 A;  2G9B A;  1REC A;  3OB1 B;  2AMI A;  5IBW A;  1QIV A;  2Y5I A;  5ER4 X;  1UP5 A;  1Y1A A;  4PDZ A;  3VGO A;  2Y1N A;  1S5G Y;  4GPL B;  3NSK A;  5J3X A;  4DCK A;  2HQW A;  3GK1 A;  3SG4 A;  1MUX A;  2K0J A;  4GUK A;  3H4S E;  1MXE A;  1J7R A;  4M2P A;  1MXL C;  1WRL A;  1IQ5 A;  3CR4 X;  2HQ8 A;  1MR8 A;  2LMT A;  3BUM B;  2PSR A;  1TTX A;  1B9A A;  1EXR A;  3CTN A;  3I5G B;  3TS5 B;  2Y4Q A;  3DVK A;  1XFZ O;  4CPV A;  4P5O E;  3FWB A;  1ALV A;  2KFH A;  3BOW A;  2PVB A;  1KK8 C;  4PE0 A;  1B47 A;  1IWQ A;  1A2X A;  2PAL A;  1EJ3 A;  1SRA A;  3A4U B;  3D0Y A;  1E8A A;  4ICB A;  1M63 B;  3CGA A;  3CWG A;  2DOQ A;  4YI9 A;  2JUL A;  2MJW B;  2CCM A;  4YGA A;  1BF5 A;  1OSA A;  4PCW A;  1NCY A;  4NDD A;  1RK9 A;  1X02 A;  5KU1 A;  1TN4 A;  2NZ0 A;  2QAC A;  5PAL A;  3LL8 B;  3NSL A;  1PSR A;  3FIA A;  1RWY A;  2M7N A;  1BR1 B;  5G08 A;  2OTG B;  2EHB A;  2ZFD A;  4PHN A;  1LA0 A;  2LVI A;  2D8N A;  3EK4 A;  4MSP A;  2JPT A;  1UUS A;  1IGV A;  2LMV A;  1OMR A;  2M1U A;  3TDI A;  1JUO A;  5B8I B;  2CXJ A;  1MWN A;  2EGD A;  4E68 A;  1EG3 A;  5D7F A;  1CM1 A;  1W7I B;  1QX7 A;  2WOR A;  1S3P A;  2QPT A;  1A29 A;  4WQ3 A;  1QXP A;  2OPO A;  4QJ4 B;  1NX3 A;  1R2U A;  2LE9 B;  3NXA A;  1BT6 A;  3GOF A;  3CR2 A;  1U5I A;  2CBL A;  1TRF A;  2Q91 A;  4ORB B;  1M39 A;  5AXI A;  3JTD C;  1H8B A;  1DJW A;  1JFK A;  3FWC A;  2F2O A;  4DS7 A;  1J1D A;  2ZN8 A;  3SG5 A;  4DIR A;  3I5F B;  1WRZ A;  3DF0 B;  2SCP A;  4YRU A;  3LCP C;  2NCO A;  3PAT A;  4I5L B;  2JNF A;  4OR9 B;  4MRY A;  5I2O A;  3TZ1 A;  4Q04 A;  5JOL A;  1L7Z A;  4HSZ A;  1YR5 A;  1NPQ A;  3NSO A;  2HF5 A;  1XFY O;  4CID A;  3D0Y B;  5AEQ A;  1KQM C;  1ZFS A;  1NX0 A;  2LC5 A;  1BMO A;  3DVJ A;  2K2F A;  2LLS A;  2ZRS A;  3LK0 A;  1OZO A;  1XK4 A;  1DJG A;  1DJX A;  5AAN A;  4MRX A;  1GQM A;  1XA5 A;  2M7L A;  3E3R A;  3TUY B;  3VRQ A;  3OB2 B;  4QJ5 B;  2WOS A;  1K9U A;  1CFD A;  5CSI A;  1SMG A;  2JNX A;  2KYF A;  3EK7 A;  3I5H B;  1FW4 A;  1YX7 A;  2L4I A;  5TNC A;  3WNX B;  2KI4 B;  1KK7 Z;  2ISD A;  1AP4 A;  3FS7 A;  4MLW A;  4NDC A;  2I2R E;  4P2Y B;  4CFQ A;  3O78 A;  1CMF A;  1AJ5 A;  5CSF A;  1CLB A;  1B8R A;  1IG5 A;  1B7T Y;  1OMD A;  1QV0 A;  1TNX A;  1OMV A;  1XK4 C;  1F55 A;  3CS1 A;  4OKH A;  1CLL A;  1L2O B;  5CPV A;  2KHN A;  2MA2 A;  1U5I B;  2K7C A;  2ZRT A;  1SL7 A;  2JRF A;  1J7Q A;  3BUX B;  1BOC A;  5I8N A;  3HCM A;  4PHK A;  1SW8 A;  4HRH A;  1F70 A;  1DJI A;  4WRI A;  2CNP A;  1A75 B;  2K7D A;  2MHH A;  3ZWH A;  3KPX A;  2JXL A;  4MVF A;  1F54 A;  2L0P A;  4MZJ A;  2I18 A;  3JVT B;  4FTG A;  1TNQ A;  4N1F A;  3WHU B;  2ZND A;  3O4Y A;  2KAV A;  3I5G C;  2EC6 B;  2L51 A;  4ETO A;  5DKQ A;  1VRK A;  1NYA A;  2R2I A;  5ER5 A;  3SG6 A;  5AFP A;  1NX2 A;  4ZCU A;  2JOJ A;  5GQQ C;  1TNW A;  1KFX S;  2LUC A;  1YUR A;  2L2E A;  1FBV A;  1CLM A;  2PAS A;  3IQQ A;  1LKJ A;  4GNK B;  1YTZ C;  3GK2 A;  2MLF C;  3IF7 A;  1G4Y R;  3KO0 A;  1YUU A;  1CM4 A;  1K93 D;  1Q80 A;  2GV5 A;  1B4C A;  4C0L A;  3ICB A;  4ORA B;  2F8P A;  3GK4 X;  1CFC A;  3LK1 A;  1GJY A;  3LLE A;  3PLF B;  4PAL A;  3DVM A;  1OQP A;  2B1U A;  1EL4 A;  2LAP A;  1MF8 B;  2BKI B;  5KTY A;  1WDC C;  4I5J A;  1QS7 A;  1RTP 1;  2RGI A;  1AHR A;  2ZKM X;  1K2H A;  4L9M A;  2WND A;  1KFU L;  2KAY A;  3SIB A;  1K9K A;  1JSA A;  2JXC A;  2BEC A;  1QVI Y;  2BE6 A;  4OCI A;  1UHJ A;  4YGC B;  1FI6 A;  1NSH A;  1NX1 A;  2JTZ A;  2CT9 A;  4USL A;  2F33 A;  3OX6 A;  1DJH A;  1TOP A;  1YVL A;  1UUR A;  1BU3 A;  4CLN A;  3QRX A;  4YI8 A;  2LV7 A;  1V1G A;  3EK8 A;  3I5I B;  2LHI A;  1KK8 B;  2WCB A;  2FCD A;  2O5G A;  1V1F A;  4OV2 A;  2KSP A;  2M9G A;  4GGN A;  2MBX A;  1QX5 B;  1S26 D;  1DGV A;  4PHJ A;  2M3W A;  2LP2 A;  1A4P A;  1LVC D;  2L5X B;  2BKH B;  1CNP A;  3KHE A;  1H4B A;  4C0J A;  1PK0 D;  5AER A;  1SPY A;  2A4J A;  2KYC A;  1NWD A;  1KSO A;  3M0W A;  4FQO A;  1Y6W A;  1DTL A;  2JWW A;  3I5F C;  1BLQ A;  1QV1 A;  3TDZ A;  1UWO A;  2K61 A;  4I5N B;  2ZNE A;  1MQ1 A;  2COL B;  3WHT B;  5JJG A;  4N5X A;  5BPJ A;  1SNL A;  4C0K A;  1DT7 B;  1SYM A;  3CR5 X;  1A03 A;  3KEV A;  2LP3 A;  5I2L A;  1KQV A;  1K95 A;  3BOW B;  1YX8 A;  4MEW A;  3F45 A;  2BBM A;  2VRG A;  3BQ3 A;  4M2Q A;  3SG7 A;  1BR4 B;  5K89 A;  1HQV A;  2O60 A;  2BCA A;  1JC2 A;  3BUN B;  2IS9 A;  2V53 A;  4A4C A;  1SCM C;  2LAN A;  1K94 A;  1NP8 A;  1KFU S;  1YUS A;  1IRJ A;  3NSI A;  1C7V A;  5HYD A;  1QAT A;  1XFW O;  2TN4 A;  1NCX A;  3JTD B;  4PE7 A;  2LVJ A;  4GGF C;  1S6C A;  2P6B B;  3MSE B;  2LVV A;  2F3Z A;  3PM8 A;  2E30 A;  3SIA A;  3PN7 C;  1CDL A;  1IKU A;  2M29 A;  1PAL A;  1S5G Z;  3C1V A;  2L4H A;  4DRW A;  1K8U A;  1YVH A;  2BBN A;  2E6W A;  2L50 A;  4HRE E;  2GGZ A;  1UHI A;  1GGZ A;  2JQ6 A;  3AAK A;  2JZI A;  2BL0 C;  2NLN A;  2OS8 C;  4BY5 A;  2K8M B;  1ZOT B;  2NXQ A; 
#chains in the Genus database with same CATH topology
 2NCP A;  1JWD A;  3BXK A;  1KQM B;  1BJF A;  1IJ5 A;  4YBH B;  4BY4 A;  1IH0 A;  3ZNI A;  1QJT A;  3RZS A;  1PRW A;  3CDN A;  3KF9 A;  5FI6 A;  1FF1 A;  5HKZ A;  2K8M B;  2FOT A;  2FCE A;  1PSB A;  1NCZ A;  4KYN A;  1SY9 A;  2LVK A;  3S0D A;  5DKN A;  1QIW A;  2JT3 A;  1NUB A;  2KFF A;  4JWQ A;  1J55 A;  3DVE A;  1CDN A;  4NQG A;  1CDM A;  1UHK A;  2PMY A;  5HLV A;  2KI6 D;  2WCM A;  5FI2 A;  3UNW A;  2M49 B;  3L4L A;  5HKY A;  3VB1 A;  3IVT A;  4TNC A;  1G8I A;  1KCY A;  3EKJ A;  1ODB A;  1QX2 A;  2L98 A;  3BUW B;  1N0Y A;  1SBJ A;  2AAO A;  4XYN A;  1SR6 B;  3EVU A;  4GFT A;  1PVA A;  1C3Z A;  3AKB A;  3BJH A;  3TS5 C;  1F8H A;  1YRT B;  2KI6 C;  1ZMZ A;  1M45 A;  3S0A A;  2KBM A;  1ORG A;  1AVS A;  1Y1U A;  3EVR A;  3VRN A;  1SL9 A;  5HLO A;  1BG1 A;  1R6P A;  1ZUZ A;  2CTN A;  2KPH A;  2H61 A;  1F71 A;  2AUC A;  3SJS A;  4GBA A;  3B88 A;  1KWO B;  3SG2 A;  1F4O A;  4JPZ B;  1S1E A;  1JF0 A;  1PVB A;  1N65 A;  3PFV A;  1SCV A;  2HPS A;  1IQ3 A;  1Y1X A;  1D1O A;  3CZ0 A;  2BNX A;  1DVI A;  2GGM A;  1Y0V H;  1UHH A;  1KK7 Y;  1WLM A;  1YUT A;  2LLU A;  2PRU A;  3D73 A;  5DKR A;  3PJI A;  1XFU O;  2BCX A;  2I7A A;  4M2O A;  3HX4 A;  1SL8 A;  1XYD A;  1LIN A;  1XFV O;  2OTG C;  3SG3 A;  1B8C A;  3BYA A;  1K90 D;  3DF0 A;  1Z4H A;  1NIW A;  3CZT X;  2JTT A;  4XJK A;  1QLS A;  2MLE C;  2PYQ A;  3PAL A;  2M1K B;  2I94 A;  1GGW A;  1TNP A;  3I5I C;  3O2P A;  2H61 C;  2JU0 A;  2MAZ A;  1CTR A;  3EVV A;  4YGE B;  3OP0 A;  1LXF C;  2Y1M A;  1IJ6 A;  1G33 A;  3IQO A;  4I5K A;  4INX A;  2WCE A;  3OX5 A;  1JBA A;  1WRK A;  3A8R A;  1EG4 A;  3B86 A;  1DJY A;  1J7P A;  2KDH A;  4NDB A;  1WDC B;  3DD4 A;  1CFP A;  1S36 A;  2JT8 A;  3RM1 A;  3K21 A;  3NGV A;  2KFG A;  4AOM A;  2L2C A;  4GGF A;  1XVJ A;  1FPW A;  2KGB C;  5KSZ A;  1RJV A;  2PQL A;  5I2Q A;  2KQY A;  4PHM A;  2LCP A;  1DF0 A;  4MZK A;  4MZL A;  4PE1 A;  2K7B A;  1J1E A;  1QAS A;  3VRP A;  1K9P A;  4N1G A;  1PUL A;  1WY9 A;  1SK6 D;  1DGU A;  1LA3 A;  1CKK A;  3O6B A;  2MRD A;  4AQJ A;  2KQ6 A;  3SS5 A;  1EH2 A;  1DJZ A;  3PM2 A;  3WXA A;  2H2K A;  4JKT A;  2JC2 A;  2KNE A;  2ZN9 A;  4UPG A;  5EL2 A;  4IL1 A;  2HET A;  2LNK A;  3UO9 A;  1QLK A;  3BUO B;  1CB1 A;  1B7T Z;  3FE9 A;  3TUY C;  1JF2 A;  4MN0 A;  1TCO B;  4YGB B;  1RRO A;  4JD9 A;  1BOD A;  1HT9 A;  2M0R A;  1OE9 B;  3R1V A;  1OZS A;  3PSR A;  2KBI A;  1P28 A;  3NHT A;  1TWO A;  1A75 A;  3FE8 A;  3OHM B;  4QJ3 B;  5CSJ A;  5HKW A;  2FJU B;  3I5H C;  3D10 A;  4OVN F;  2M8U A;  2KAX A;  1MHO A;  2LHL A;  3B7A A;  4MBE A;  4XJK B;  4HRG A;  5D3O A;  4INW A;  4CFR A;  2KI4 C;  1B8L A;  1UHN A;  1KSM A;  4A4B A;  3RLZ A;  5F6T A;  2JT0 A;  4D1E A;  1CDP A;  3EKH A;  1AJ4 A;  4JQ0 D;  1S6J A;  1DC1 A;  2SAS A;  4R1E A;  1M31 A;  5FYX A;  4ORC B;  1F4Q A;  4DUQ A;  5D69 A;  4ZCV A;  1OW4 A;  3CLN A;  5CSN A;  2WCH A;  2F3Y A;  1WLZ A;  1YRU B;  1L2O C;  2P71 A;  1XFX O;  2BCB A;  1JFJ A;  1RFJ A;  2KGR A;  4WQ2 A;  1KFX L;  1SCM B;  4F0Z B;  3AKA A;  1AK8 A;  1S6I A;  3VRO A;  4PT1 A;  1K96 A;  1TIZ A;  1W7J B;  2K7O A;  2LLT A;  2WCJ A;  1J7O A;  1CFF A;  1B1G A;  2KLE A;  1FI5 A;  2LUX A;  2LM5 A;  1N2D A;  1OOJ A;  2K2A A;  3JVT C;  2F2P A;  4GAO A;  1AUI B;  3PN7 B;  1SR6 C;  4YGD B;  2BE4 A;  2WC8 A;  1DF0 B;  1OOG A;  1C7W A;  1DEL A;  2EC6 C;  1CMG A;  4AQI A;  3VRR A;  3CAB A;  1QTX A;  2WCF A;  2BL0 B;  2OS8 B;  1DMO A;  1ALW A;  3TDU A;  1C07 A;  2KOT A;  3SS4 A;  2Q4U A;  1SKT A;  1QVI Z;  1XO5 A;  1ZAC A;  1TCF A;  3B6X A;  1KWO C;  5DIC A;  2M97 A;  3AAJ A;  4PE4 A;  2G2B A;  2WCK A;  3D78 A;  4U8D A;  2LMU A;  1M46 A;  2G9B A;  1REC A;  3OB1 B;  2AMI A;  5IBW A;  1QIV A;  2Y5I A;  5ER4 X;  3R1P A;  1UP5 A;  1Y1A A;  4PDZ A;  3VGO A;  3DZT A;  2Y1N A;  1S5G Y;  4GPL B;  3NSK A;  1TUJ A;  5J3X A;  4DCK A;  1C3Y A;  2HQW A;  3GK1 A;  3SG4 A;  1MUX A;  2K0J A;  4GUK A;  3D74 A;  3H4S E;  1MXE A;  4F7F A;  3BFH A;  1J7R A;  5I94 A;  4M2P A;  1MXL C;  1WRL A;  1IQ5 A;  3CR4 X;  2HQ8 A;  1MR8 A;  2LMT A;  3BUM B;  2PSR A;  1TTX A;  1B9A A;  1EXR A;  2QDI A;  3CTN A;  3I5G B;  2Y4Q A;  3DVK A;  1XFZ O;  3TS5 B;  4CPV A;  4P5O E;  3FWB A;  1ALV A;  2KFH A;  3BOW A;  3O4X A;  2PVB A;  1KK8 C;  3R1O A;  4PE0 A;  1B47 A;  1IWQ A;  1A2X A;  2PAL A;  1EJ3 A;  3BFA A;  1SRA A;  1T14 A;  3A4U B;  3D0Y A;  1E8A A;  4ICB A;  1M63 B;  3CGA A;  3CWG A;  2DOQ A;  3K1E A;  2ERB A;  4YI9 A;  2JUL A;  2MJW B;  2CCM A;  4YGA A;  1BF5 A;  1OSA A;  4PCW A;  1NCY A;  4NDD A;  3L47 A;  1RK9 A;  1X02 A;  5KU1 A;  1TN4 A;  2NZ0 A;  2QAC A;  5PAL A;  3LL8 B;  3NHI A;  1PSR A;  3FIA A;  1RWY A;  2M7N A;  3NSL A;  3S0B A;  1BR1 B;  5G08 A;  3CYZ A;  2OTG B;  3D76 A;  2EHB A;  2ZFD A;  4PHN A;  1LA0 A;  2LVI A;  2D8N A;  3EK4 A;  4MSP A;  2JPT A;  1UUS A;  1IGV A;  2LMV A;  1OMR A;  1LS8 A;  2M1U A;  3TDI A;  1JUO A;  5B8I B;  2CXJ A;  1MWN A;  2EGD A;  4E68 A;  1EG3 A;  5D7F A;  1CM1 A;  2WCL A;  3EG5 B;  1W7I B;  1QX7 A;  2WOR A;  1S3P A;  3V2L A;  2QPT A;  1A29 A;  4WQ3 A;  1QXP A;  4FQT A;  2OPO A;  4QJ4 B;  1NX3 A;  1R2U A;  2LE9 B;  3NXA A;  1BT6 A;  3GOF A;  3CR2 A;  1U5I A;  2CBL A;  1TRF A;  2Q91 A;  4ORB B;  1M39 A;  5AXI A;  3JTD C;  1H8B A;  1DJW A;  1JFK A;  2JPO A;  3FWC A;  2F2O A;  4DS7 A;  1J1D A;  3D75 A;  2GTE A;  1QWV A;  2ZN8 A;  3SG5 A;  4DIR A;  3I5F B;  1WRZ A;  3DF0 B;  2SCP A;  4YRU A;  3LCP C;  2NCO A;  3PAT A;  4I5L B;  2JNF A;  4OR9 B;  4MRY A;  3S0G A;  5I2O A;  4IJ7 A;  3TZ1 A;  4Q04 A;  5JOL A;  1L7Z A;  4HSZ A;  1Z2C B;  1YR5 A;  1NPQ A;  3NSO A;  2HF5 A;  1XFY O;  4CID A;  3D0Y B;  5AEQ A;  1KQM C;  1ZFS A;  1NX0 A;  2LC5 A;  1BMO A;  3DVJ A;  1OOF A;  2K2F A;  2LLS A;  1GM0 A;  2ZRS A;  3LK0 A;  1OZO A;  1XK4 A;  1DJG A;  3D77 A;  1DJX A;  5AAN A;  4MRX A;  3S0F A;  1GQM A;  1XA5 A;  2M7L A;  3E3R A;  2QEV A;  3TUY B;  3OB2 B;  3VRQ A;  4QJ5 B;  2WOS A;  3QME A;  1K9U A;  1CFD A;  2H8V A;  5CSI A;  1SMG A;  2JNX A;  2KYF A;  3EK7 A;  3I5H B;  1FW4 A;  1YX7 A;  2L4I A;  5TNC A;  3WNX B;  2KI4 B;  1KK7 Z;  2ISD A;  3DYE A;  3L4A A;  1AP4 A;  3FS7 A;  4MLW A;  4NDC A;  2I2R E;  4P2Y B;  4CFQ A;  3O78 A;  1CMF A;  1AJ5 A;  1XFR A;  3Q8I A;  5CSF A;  1CLB A;  1B8R A;  2KLD A;  1IG5 A;  1B7T Y;  1OMD A;  1QV0 A;  1TNX A;  1OMV A;  1XK4 C;  1F55 A;  3CS1 A;  4OKH A;  1CLL A;  1L2O B;  5CPV A;  2KHN A;  2MA2 A;  1U5I B;  1TUZ A;  2K7C A;  2ZRT A;  1SL7 A;  2JRF A;  1J7Q A;  3BUX B;  1BOC A;  5I8N A;  3HCM A;  4PHK A;  1SW8 A;  4HRH A;  1F70 A;  1DJI A;  4WRI A;  1A75 B;  2CNP A;  2K7D A;  2MHH A;  3ZWH A;  3KPX A;  2JXL A;  4MVF A;  1F54 A;  2L0P A;  4MZJ A;  2I18 A;  3JVT B;  4FTG A;  2WC6 A;  1TNQ A;  4N1F A;  3WHU B;  2ZND A;  3O4Y A;  2KAV A;  3N7H A;  2FJY A;  3I5G C;  2EC6 B;  2L51 A;  4ETO A;  5DKQ A;  1VRK A;  2L5Y A;  1NYA A;  2R2I A;  5ER5 A;  3SG6 A;  5AFP A;  1NX2 A;  4ZCU A;  2JOJ A;  3OGN A;  3R72 A;  1TNW A;  5GQQ C;  1KFX S;  2LUC A;  3DY9 A;  5FI7 A;  1YUR A;  2L2E A;  1FBV A;  1CLM A;  2PAS A;  3IQQ A;  1LKJ A;  4GNK B;  1YTZ C;  3FE6 A;  3GK2 A;  2MLF C;  3IF7 A;  1G4Y R;  3KO0 A;  1YUU A;  1CM4 A;  1K93 D;  1Q80 A;  2GV5 A;  1B4C A;  3B87 A;  4C0L A;  3ICB A;  4ORA B;  4OZD A;  2F8P A;  3GK4 X;  1CFC A;  3LK1 A;  1GJY A;  3LLE A;  3PLF B;  4PAL A;  3DVM A;  5HL1 A;  1OQP A;  3CZ2 A;  2B1U A;  1EL4 A;  2LAP A;  1MF8 B;  2BKI B;  5KTY A;  1WDC C;  4I5J A;  1QS7 A;  1RTP 1;  2RGI A;  1AHR A;  2ZKM X;  1K2H A;  4L9M A;  2QEB A;  2WND A;  1KFU L;  2KAY A;  3SIB A;  1K9K A;  1JSA A;  2JXC A;  2BEC A;  1QVI Y;  2BE6 A;  4OCI A;  1UHJ A;  4YGC B;  3S0E A;  1FI6 A;  1NSH A;  1NX1 A;  2JTZ A;  2QEO A;  2CT9 A;  4USL A;  2F33 A;  3OX6 A;  1DJH A;  1TOP A;  1YVL A;  1UUR A;  1BU3 A;  4CLN A;  3QRX A;  4YI8 A;  2LV7 A;  1V1G A;  3EK8 A;  3I5I B;  2LHI A;  1KK8 B;  2WCB A;  3BFB A;  2FCD A;  2O5G A;  3OBV A;  1V1F A;  4OV2 A;  2KSP A;  2M9G A;  4GGN A;  2MBX A;  1QX5 B;  1S26 D;  1DGV A;  4PHJ A;  2M3W A;  2LP2 A;  3SS3 A;  1A4P A;  1LVC D;  2L5X B;  2BKH B;  1CNP A;  3KHE A;  1DQE A;  1H4B A;  4C0J A;  1PK0 D;  5AER A;  3CZ1 A;  2P70 A;  1SPY A;  2A4J A;  2KYC A;  1NWD A;  1KSO A;  3M0W A;  4FQO A;  1Y6W A;  1DTL A;  2JWW A;  3I5F C;  1BLQ A;  1QV1 A;  3TDZ A;  1UWO A;  2K61 A;  4I5N B;  2ZNE A;  1MQ1 A;  2COL B;  3WHT B;  5JJG A;  4N5X A;  5BPJ A;  1SNL A;  4C0K A;  1DT7 B;  1SYM A;  3CR5 X;  1A03 A;  3KEV A;  2LP3 A;  5I2L A;  1KQV A;  3DXL A;  1K95 A;  3BOW B;  2QEH A;  2K60 A;  1YX8 A;  4MEW A;  1OOH A;  2BBM A;  3F45 A;  2VRG A;  3BQ3 A;  4M2Q A;  3SG7 A;  1BR4 B;  5K89 A;  1HQV A;  2O60 A;  2BCA A;  1JC2 A;  1DEK A;  1W9Z A;  3BUN B;  2IS9 A;  2V53 A;  4A4C A;  1SCM C;  2LAN A;  1K94 A;  1NP8 A;  1KFU S;  1YUS A;  1IRJ A;  3NSI A;  1C7V A;  5HYD A;  1QAT A;  1XFW O;  2TN4 A;  2YGU A;  1NCX A;  3JTD B;  4PE7 A;  2LVJ A;  4GGF C;  1S6C A;  2P6B B;  3MSE B;  2LVV A;  2F3Z A;  3PM8 A;  2E30 A;  3SIA A;  3PN7 C;  1CDL A;  1IKU A;  2M29 A;  1PAL A;  1S5G Z;  3C1V A;  2L4H A;  4DRW A;  1K8U A;  1YVH A;  2BBN A;  2E6W A;  2L50 A;  4HRE E;  2GGZ A;  1OOI X;  1UHI A;  1IIO A;  1GGZ A;  2JQ6 A;  2WC5 A;  3AAK A;  2JZI A;  2BL0 C;  2NLN A;  1SSE B;  2OS8 C;  4BY5 A;  2BAP A;  1ZOT B;  2NXQ A; 
#chains in the Genus database with same CATH homology
 2NCP A;  1JWD A;  3BXK A;  1KQM B;  1BJF A;  1IJ5 A;  4YBH B;  4BY4 A;  1IH0 A;  3ZNI A;  1QJT A;  1PRW A;  1FF1 A;  3KF9 A;  5HKZ A;  2FOT A;  2FCE A;  1PSB A;  1NCZ A;  1SY9 A;  2LVK A;  5DKN A;  1QIW A;  2JT3 A;  1NUB A;  2KFF A;  4JWQ A;  1J55 A;  3DVE A;  1CDN A;  4NQG A;  1CDM A;  1UHK A;  2PMY A;  5HLV A;  2KI6 D;  2M49 B;  5HKY A;  4TNC A;  1G8I A;  1KCY A;  3EKJ A;  1ODB A;  1QX2 A;  2L98 A;  3BUW B;  1N0Y A;  1SBJ A;  2AAO A;  4XYN A;  1SR6 B;  3EVU A;  4GFT A;  1PVA A;  3AKB A;  1F8H A;  3TS5 C;  1YRT B;  2KI6 C;  1ZMZ A;  1M45 A;  2KBM A;  3VRN A;  1AVS A;  1Y1U A;  3EVR A;  1SL9 A;  5HLO A;  1BG1 A;  1R6P A;  1ZUZ A;  2CTN A;  2H61 A;  1F71 A;  2AUC A;  3SJS A;  4GBA A;  1KWO B;  3SG2 A;  1F4O A;  4JPZ B;  1S1E A;  1JF0 A;  1PVB A;  1N65 A;  3PFV A;  1SCV A;  2HPS A;  1IQ3 A;  1Y1X A;  1D1O A;  1DVI A;  2GGM A;  1Y0V H;  1UHH A;  1KK7 Y;  1WLM A;  1YUT A;  2LLU A;  2PRU A;  5DKR A;  1XFU O;  2BCX A;  2I7A A;  4M2O A;  3HX4 A;  1SL8 A;  1XYD A;  1LIN A;  1XFV O;  2OTG C;  3SG3 A;  1B8C A;  3BYA A;  1K90 D;  3DF0 A;  1NIW A;  3CZT X;  2JTT A;  4XJK A;  1QLS A;  2MLE C;  3PAL A;  2M1K B;  2I94 A;  1GGW A;  1TNP A;  3I5I C;  3O2P A;  2H61 C;  2JU0 A;  2MAZ A;  1CTR A;  3EVV A;  4YGE B;  3OP0 A;  1LXF C;  2Y1M A;  1IJ6 A;  1G33 A;  3IQO A;  4I5K A;  2WCE A;  3OX5 A;  1JBA A;  1WRK A;  3A8R A;  1EG4 A;  1DJY A;  1J7P A;  2KDH A;  4NDB A;  1WDC B;  3DD4 A;  1CFP A;  1S36 A;  2JT8 A;  3RM1 A;  3K21 A;  2KFG A;  4AOM A;  4GGF A;  1XVJ A;  1FPW A;  2KGB C;  5KSZ A;  1RJV A;  5I2Q A;  2KQY A;  4PHM A;  2LCP A;  1DF0 A;  4MZK A;  4MZL A;  4PE1 A;  2K7B A;  1J1E A;  1QAS A;  3VRP A;  1K9P A;  4N1G A;  1PUL A;  1WY9 A;  1SK6 D;  1DGU A;  1LA3 A;  1CKK A;  3O6B A;  2MRD A;  4AQJ A;  2KQ6 A;  1EH2 A;  1DJZ A;  3WXA A;  2H2K A;  4UPG A;  2JC2 A;  2KNE A;  2ZN9 A;  4IL1 A;  2HET A;  2LNK A;  1QLK A;  3BUO B;  1CB1 A;  1B7T Z;  3TUY C;  1JF2 A;  4MN0 A;  1TCO B;  4YGB B;  1RRO A;  1BOD A;  1HT9 A;  2M0R A;  1OE9 B;  1OZS A;  3PSR A;  2KBI A;  3OHM B;  1A75 A;  4QJ3 B;  5CSJ A;  5HKW A;  2FJU B;  3I5H C;  3D10 A;  4OVN F;  2M8U A;  2KAX A;  1MHO A;  2LHL A;  4MBE A;  4XJK B;  4HRG A;  4CFR A;  2KI4 C;  1B8L A;  1UHN A;  1KSM A;  4A4B A;  3RLZ A;  5F6T A;  2JT0 A;  4D1E A;  1CDP A;  3EKH A;  1AJ4 A;  4JQ0 D;  1S6J A;  2SAS A;  4R1E A;  1M31 A;  5FYX A;  4ORC B;  1F4Q A;  4DUQ A;  5D69 A;  4ZCV A;  3CLN A;  5CSN A;  2F3Y A;  1WLZ A;  1YRU B;  1L2O C;  1XFX O;  2BCB A;  1JFJ A;  1RFJ A;  2KGR A;  4WQ2 A;  1KFX L;  1SCM B;  4F0Z B;  3AKA A;  1AK8 A;  1S6I A;  3VRO A;  1K96 A;  1TIZ A;  1W7J B;  2K7O A;  2LLT A;  1J7O A;  1CFF A;  1B1G A;  1FI5 A;  2LUX A;  2LM5 A;  1N2D A;  1OOJ A;  2K2A A;  3JVT C;  2F2P A;  4GAO A;  1AUI B;  3PN7 B;  1SR6 C;  4YGD B;  2BE4 A;  2WC8 A;  1DF0 B;  1C7W A;  2EC6 C;  1CMG A;  4AQI A;  3VRR A;  1QTX A;  2WCF A;  2BL0 B;  2OS8 B;  1DMO A;  1ALW A;  3TDU A;  1C07 A;  2KOT A;  2Q4U A;  1SKT A;  1QVI Z;  1XO5 A;  1ZAC A;  1TCF A;  1KWO C;  2M97 A;  3AAJ A;  4PE4 A;  2G2B A;  4U8D A;  2LMU A;  1M46 A;  2G9B A;  1REC A;  3OB1 B;  2AMI A;  5IBW A;  1QIV A;  2Y5I A;  5ER4 X;  1UP5 A;  1Y1A A;  4PDZ A;  3VGO A;  2Y1N A;  1S5G Y;  4GPL B;  3NSK A;  5J3X A;  4DCK A;  2HQW A;  3GK1 A;  3SG4 A;  1MUX A;  2K0J A;  4GUK A;  3H4S E;  1MXE A;  1J7R A;  4M2P A;  1MXL C;  1WRL A;  1IQ5 A;  3CR4 X;  2HQ8 A;  1MR8 A;  2LMT A;  3BUM B;  2PSR A;  1TTX A;  1B9A A;  1EXR A;  3CTN A;  3I5G B;  3TS5 B;  2Y4Q A;  3DVK A;  1XFZ O;  4CPV A;  4P5O E;  3FWB A;  1ALV A;  2KFH A;  3BOW A;  2PVB A;  1KK8 C;  4PE0 A;  1B47 A;  1IWQ A;  1A2X A;  2PAL A;  1EJ3 A;  1SRA A;  3A4U B;  3D0Y A;  1E8A A;  4ICB A;  1M63 B;  3CGA A;  3CWG A;  2DOQ A;  4YI9 A;  2JUL A;  2MJW B;  2CCM A;  4YGA A;  1BF5 A;  1OSA A;  4PCW A;  1NCY A;  4NDD A;  1RK9 A;  1X02 A;  5KU1 A;  1TN4 A;  2NZ0 A;  2QAC A;  5PAL A;  3LL8 B;  3NSL A;  1PSR A;  3FIA A;  1RWY A;  2M7N A;  1BR1 B;  5G08 A;  2OTG B;  2EHB A;  2ZFD A;  4PHN A;  1LA0 A;  2LVI A;  2D8N A;  3EK4 A;  4MSP A;  2JPT A;  1UUS A;  1IGV A;  2LMV A;  1OMR A;  2M1U A;  3TDI A;  1JUO A;  5B8I B;  2CXJ A;  1MWN A;  2EGD A;  4E68 A;  1EG3 A;  5D7F A;  1CM1 A;  1W7I B;  1QX7 A;  2WOR A;  1S3P A;  2QPT A;  1A29 A;  4WQ3 A;  1QXP A;  2OPO A;  4QJ4 B;  1NX3 A;  1R2U A;  2LE9 B;  3NXA A;  1BT6 A;  3GOF A;  3CR2 A;  1U5I A;  2CBL A;  1TRF A;  2Q91 A;  4ORB B;  1M39 A;  5AXI A;  3JTD C;  1H8B A;  1DJW A;  1JFK A;  3FWC A;  2F2O A;  4DS7 A;  1J1D A;  2ZN8 A;  3SG5 A;  4DIR A;  3I5F B;  1WRZ A;  3DF0 B;  2SCP A;  4YRU A;  3LCP C;  2NCO A;  3PAT A;  4I5L B;  2JNF A;  4OR9 B;  4MRY A;  5I2O A;  3TZ1 A;  4Q04 A;  5JOL A;  1L7Z A;  4HSZ A;  1YR5 A;  1NPQ A;  3NSO A;  2HF5 A;  1XFY O;  4CID A;  3D0Y B;  5AEQ A;  1KQM C;  1ZFS A;  1NX0 A;  2LC5 A;  1BMO A;  3DVJ A;  2K2F A;  2LLS A;  2ZRS A;  3LK0 A;  1OZO A;  1XK4 A;  1DJG A;  1DJX A;  5AAN A;  4MRX A;  1GQM A;  1XA5 A;  2M7L A;  3E3R A;  3TUY B;  3VRQ A;  3OB2 B;  4QJ5 B;  2WOS A;  1K9U A;  1CFD A;  5CSI A;  1SMG A;  2JNX A;  2KYF A;  3EK7 A;  3I5H B;  1FW4 A;  1YX7 A;  2L4I A;  5TNC A;  3WNX B;  2KI4 B;  1KK7 Z;  2ISD A;  1AP4 A;  3FS7 A;  4MLW A;  4NDC A;  2I2R E;  4P2Y B;  4CFQ A;  3O78 A;  1CMF A;  1AJ5 A;  5CSF A;  1CLB A;  1B8R A;  1IG5 A;  1B7T Y;  1OMD A;  1QV0 A;  1TNX A;  1OMV A;  1XK4 C;  1F55 A;  3CS1 A;  4OKH A;  1CLL A;  1L2O B;  5CPV A;  2KHN A;  2MA2 A;  1U5I B;  2K7C A;  2ZRT A;  1SL7 A;  2JRF A;  1J7Q A;  3BUX B;  1BOC A;  5I8N A;  3HCM A;  4PHK A;  1SW8 A;  4HRH A;  1F70 A;  1DJI A;  4WRI A;  2CNP A;  1A75 B;  2K7D A;  2MHH A;  3ZWH A;  3KPX A;  2JXL A;  4MVF A;  1F54 A;  2L0P A;  4MZJ A;  2I18 A;  3JVT B;  4FTG A;  1TNQ A;  4N1F A;  3WHU B;  2ZND A;  3O4Y A;  2KAV A;  3I5G C;  2EC6 B;  2L51 A;  4ETO A;  5DKQ A;  1VRK A;  1NYA A;  2R2I A;  5ER5 A;  3SG6 A;  5AFP A;  1NX2 A;  4ZCU A;  2JOJ A;  5GQQ C;  1TNW A;  1KFX S;  2LUC A;  1YUR A;  2L2E A;  1FBV A;  1CLM A;  2PAS A;  3IQQ A;  1LKJ A;  4GNK B;  1YTZ C;  3GK2 A;  2MLF C;  3IF7 A;  1G4Y R;  3KO0 A;  1YUU A;  1CM4 A;  1K93 D;  1Q80 A;  2GV5 A;  1B4C A;  4C0L A;  3ICB A;  4ORA B;  2F8P A;  3GK4 X;  1CFC A;  3LK1 A;  1GJY A;  3LLE A;  3PLF B;  4PAL A;  3DVM A;  1OQP A;  2B1U A;  1EL4 A;  2LAP A;  1MF8 B;  2BKI B;  5KTY A;  1WDC C;  4I5J A;  1QS7 A;  1RTP 1;  2RGI A;  1AHR A;  2ZKM X;  1K2H A;  4L9M A;  2WND A;  1KFU L;  2KAY A;  3SIB A;  1K9K A;  1JSA A;  2JXC A;  2BEC A;  1QVI Y;  2BE6 A;  4OCI A;  1UHJ A;  4YGC B;  1FI6 A;  1NSH A;  1NX1 A;  2JTZ A;  2CT9 A;  4USL A;  2F33 A;  3OX6 A;  1DJH A;  1TOP A;  1YVL A;  1UUR A;  1BU3 A;  4CLN A;  3QRX A;  4YI8 A;  2LV7 A;  1V1G A;  3EK8 A;  3I5I B;  2LHI A;  1KK8 B;  2WCB A;  2FCD A;  2O5G A;  1V1F A;  4OV2 A;  2KSP A;  2M9G A;  4GGN A;  2MBX A;  1QX5 B;  1S26 D;  1DGV A;  4PHJ A;  2M3W A;  2LP2 A;  1A4P A;  1LVC D;  2L5X B;  2BKH B;  1CNP A;  3KHE A;  1H4B A;  4C0J A;  1PK0 D;  5AER A;  1SPY A;  2A4J A;  2KYC A;  1NWD A;  1KSO A;  3M0W A;  4FQO A;  1Y6W A;  1DTL A;  2JWW A;  3I5F C;  1BLQ A;  1QV1 A;  3TDZ A;  1UWO A;  2K61 A;  4I5N B;  2ZNE A;  1MQ1 A;  2COL B;  3WHT B;  5JJG A;  4N5X A;  5BPJ A;  1SNL A;  4C0K A;  1DT7 B;  1SYM A;  3CR5 X;  1A03 A;  3KEV A;  2LP3 A;  5I2L A;  1KQV A;  1K95 A;  3BOW B;  1YX8 A;  4MEW A;  3F45 A;  2BBM A;  2VRG A;  3BQ3 A;  4M2Q A;  3SG7 A;  1BR4 B;  5K89 A;  1HQV A;  2O60 A;  2BCA A;  1JC2 A;  3BUN B;  2IS9 A;  2V53 A;  4A4C A;  1SCM C;  2LAN A;  1K94 A;  1NP8 A;  1KFU S;  1YUS A;  1IRJ A;  3NSI A;  1C7V A;  5HYD A;  1QAT A;  1XFW O;  2TN4 A;  1NCX A;  3JTD B;  4PE7 A;  2LVJ A;  4GGF C;  1S6C A;  2P6B B;  3MSE B;  2LVV A;  2F3Z A;  3PM8 A;  2E30 A;  3SIA A;  3PN7 C;  1CDL A;  1IKU A;  2M29 A;  1PAL A;  1S5G Z;  3C1V A;  2L4H A;  4DRW A;  1K8U A;  1YVH A;  2BBN A;  2E6W A;  2L50 A;  4HRE E;  2GGZ A;  1UHI A;  1GGZ A;  2JQ6 A;  3AAK A;  2JZI A;  2BL0 C;  2NLN A;  2OS8 C;  4BY5 A;  2K8M B;  1ZOT B;  2NXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...