1S3PA

Crystal structure of rat alpha-parvalbumin s55d/e59d mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIDEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Crystal Structure of a High-Affinity Variant of Rat alpha-Parvalbumin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s3pA00
2LHLA 2O5GA 1SCVA 1IRJA 3AKBA 3PSRA 4N1GA 5FYXA 3RM1A 5KU1A 3LLEA 1DMOA 3TUYC 1Y1UA 3I5IB 1ALVA 1M45A 4ZCVA 1XO5A 1EXRA 2AUCA 1NSHA 2F33A 1XVJA 2F2PA 1NCZA 3BUNB 1K93D 5AEQA 2LHIA 1XYDA 1K94A 2M29A 1J1EA 1QV0A 2KAYA 5JOLA 3EK8A 1J1DA 2LLUA 1AHRA 3AAJA 3CR5X 1UP5A 4I5KA 1B8RA 1PSBA 1OMVA 5HLOA 1DJGA 1A03A 1JWDA 1S3PA 1PULA 1K90D 1YUTA 1QX2A 1DJIA 2BE4A 4C0KA 4USLA 3EKHA 2M7LA 3JVTB 1NWDA 3BUWB 2KSPA 3BOWA 2I18A 1B8CA 2CCMA 1SRAA 3D0YA 4ICBA 4F0ZB 1S1EA 2ZNDA 3TS5B 4AQJA 2LMVA 1QLSA 1DGUA 1CM1A 1N0YA 1W7IB 3JVTC 2M97A 4MN0A 3EVVA 5PALA 2P6BB 2Y4QA 5AFPA 4ETOA 3DF0B 2LP2A 3GK2A 1AVSA 4MZKA 1DJXA 2JNFA 1TOPA 1V1GA 3SIBA 2IS9A 4HSZA 2KQ6A 1M39A 1D1OA 1F71A 1KFUL 2G9BA 3NSOA 4DIRA 2L0PA 3I5FC 4YGBB 1LXFC 1UHNA 1UHKA 5G08A 3LCPC 3CGAA 1OQPA 2JC2A 1MUXA 5DKRA 3OX6A 3KHEA 1SCMB 4QJ4B 1KK8B 2M9GA 5B8IB 1A75A 1KFUS 2BL0C 5AANA 5I2OA 2WCBA 1NIWA 1NYAA 2M7NA 4AOMA 4DUQA 4D1EA 3IF7A 3C1VA 1SCMC 3EVRA 4OR9B 2BBNA 1KK8C 5HKWA 1QVIZ 1R2UA 2KDHA 2PVBA 3VRPA 1CNPA 3GK4X 1OOJA 2JT0A 1AUIB 1QX5B 1TNXA 2MBXA 4C0LA 1TNPA 3O2PA 1LVCD 3GK1A 2AAOA 1SMGA 2GGZA 4MRYA 1IJ6A 1MXEA 2CNPA 1S36A 1PVBA 2LMTA 1QASA 2WC8A 2JWWA 3PFVA 3PLFB 1BMOA 1CFCA 3CLNA 1NCXA 3TDUA 1F8HA 4U8DA 1BJFA 1M31A 1TNWA 2F3YA 2BBMA 2ZNEA 2L4HA 1DGVA 3HX4A 3TDIA 4PHNA 4ORAB 1DF0B 1J7PA 1FI5A 2MHHA 1ZUZA 2HQWA 1OZOA 3M0WA 4C0JA 2PMYA 1FI6A 1JF2A 2WCFA 3A4UB 1SL8A 3PALA 1JF0A 1U5IB 1Y1XA 4YGDB 1CTRA 2KHNA 1PK0D 2H61C 1LKJA 1UURA 4N1FA 4PALA 1RROA 4YBHB 4Q04A 4P2YB 2JQ6A 2KQYA 4CFQA 2MRDA 3EVUA 2M49B 2EHBA 2BKHB 3OB2B 5KTYA 1NX1A 1JFJA 1KQMB 2KAXA 1IGVA 2BECA 3D10A 1K9PA 3CS1A 1BG1A 2KGBC 3CZTX 2GV5A 1KQMC 2OTGB 5HLVA 3SG3A 2KFGA 4MZLA 2KI6C 1CFFA 1QX7A 2SASA 2OTGC 2KBIA 2KYFA 1EG4A 4PHKA 1EL4A 3TUYB 2K61A 2ZN8A 1G4YR 1S26D 4XYNA 4A4BA 4CLNA 3EK7A 2CTNA 1OSAA 1SK6D 1EH2A 2JTTA 1UHIA 2E6WA 2M1UA 3OHMB 3BQ3A 5HKYA 2CXJA 1BODA 5KSZA 1RTP1 3SG7A 3DD4A 3CR2A 3SG4A 5CSJA 3ICBA 1J7RA 1X02A 2I94A 4YGCB 1UHJA 1B9AA 1RK9A 1SBJA 4CIDA 3O4YA 1QV1A 4YGEB 2LUCA 4GBAA 3WXAA 1CDPA 3I5HB 2JNXA 3EK4A 2NLNA 4OV2A 1B1GA 5CSFA 2DOQA 3RLZA 1XK4A 2LE9B 2BKIB 3I5HC 1XFXO 2WNDA 3FIAA 4I5NB 1JBAA 1CB1A 1OE9B 1CM4A 1WRZA 1YRUB 3IQQA 1QIWA 1K95A 4OCIA 4GFTA 3FS7A 5AXIA 1SYMA 1SR6B 4UPGA 1WDCB 2D8NA 2LAPA 1NX2A 2I2RE 2ISDA 1C7WA 4GAOA 1SR6C 1FBVA 1WDCC 2BE6A 2ZRSA 3WHUB 1TRFA 3I5FB 3BOWB 4MZJA 1NX3A 1WRLA 3I5GB 1HQVA 3D0YB 4ORBB 2Y1NA 4L9MA 1YRTB 1YVLA 1HT9A 2CBLA 1J7OA 1KFXL 1TIZA 1E8AA 3KPXA 3I5GC 2JXLA 1B7TY 3O78A 2O60A 2LC5A 2K7DA 2BL0B 1NP8A 2ZRTA 4NQGA 1LA3A 1WRKA 2NZ0A 1SY9A 2JTZA 2JULA 2KBMA 2Q91A 1KK7Y 4PE7A 1A29A 4YI8A 4DCKA 1K2HA 2LVKA 3VRRA 5K89A 5AERA 1XFVO 2BCXA 1FPWA 1GGZA 1IWQA 1KFXS 5ER5A 3QRXA 2KI4B 4WQ3A 1RFJA 4GGFA 5I2QA 1BOCA 3MSEB 4CPVA 2KI4C 3LK1A 1G8IA 1CMFA 1A75B 2EC6C 4E68A 1B47A 1CLMA 4MSPA 1BR4B 1WY9A 1S6IA 3PATA 1F4OA 4ZCUA 4JQ0D 1F4QA 1PVAA 3VRQA 2LUXA 3SIAA 3SG6A 1V1FA 2ZN9A 1S5GY 2Y5IA 2PALA 3DVKA 1AP4A 1SKTA 1L7ZA 1DJZA 1RJVA 1Y0VH 3FWBA 3NSKA 1TNQA 2MLFC 3VROA 2L4IA 1CDNA 1IH0A 1DTLA 3HCMA 2K2FA 3PN7B 1K9KA 3EKJA 1DT7B 1QTXA 1K96A 2FCEA 1MQ1A 2L51A 3KF9A 1YUUA 2K0JA 3F45A 4MVFA 3PN7C 2Y1MA 4HRHA 5GQQC 2FJUB 1U5IA 4I5LB 2MAZA 1NPQA 1FF1A 3NSLA 1ZMZA 2LANA 4GNKB 4MRXA 1WLZA 5DKNA 2QPTA 1UWOA 2WOSA 1M46A 2HETA 1KWOC 1G33A 1C07A 2MA2A 2LCPA 3KO0A 1OMDA 1B8LA 2KI6D 2NCOA 2L98A 2QACA 1BR1B 4CFRA 3TDZA 1QS7A 1GQMA 1YX7A 1KSOA 2AMIA 2R2IA 1AJ4A 4MBEA 2K8MB 1TCFA 2PRUA 2JOJA 2KYCA 4GGNA 2E30A 4XJKA 1K8UA 2SCPA 3E3RA 1ALWA 1CDLA 1IKUA 2KNEA 2EGDA 1DJWA 3WHTB 1N2DA 1PRWA 1YURA 3CR4X 4IL1A 1L2OB 1OZSA 1YUSA 1PALA 5BPJA 3TZ1A 3K21A 4DRWA 3NXAA 4I5JA 1IQ3A 1C7VA 4OVNF 1JC2A 1L2OC 4M2QA 1JUOA 1WLMA 1BT6A 1CFDA 1J55A 1ZOTB 3KEVA 2WCEA 5I8NA 2G2BA 5D7FA 3BXKA 1EG3A 1QATA 4M2OA 4YRUA 4MLWA 4FQOA 4HREE 1M63B 1IQ5A 1JFKA 1LA0A 1NUBA 3VGOA 2L50A 3O6BA 1QVIY 3CWGA 3GOFA 1TCOB 3I5IC 2RGIA 3IQOA 1A4PA 1SL9A 1VRKA 2LLSA 2PSRA 3OB1B 2F3ZA 2LVIA 2COLB 4BY5A 4OKHA 4P5OE 3WNXB 4NDBA 2JXCA 4PE4A 5HYDA 2JT8A 3ZNIA 1JSAA 1ZFSA 2WORA 1XK4C 1SL7A 1MF8B 4M2PA 1CFPA 2MLEC 2BCBA 1GJYA 1ODBA 2HQ8A 3BUOB 1KCYA 2FCDA 3DVMA 4PHMA 3SG5A 1H4BA 1YX8A 1TTXA 3DF0A 1F55A 5I2LA 1LINA 2LVVA 1R6PA 1OMRA 1QJTA 2KAVA 4A4CA 1XFZO 1B4CA 4AQIA 2GGMA 1YTZC 2KGRA 1UHHA 1MXLC 1RWYA 5CSIA 4BY4A 4PCWA 1QXPA 3TS5C 2K7CA 4QJ3B 5F6TA 3PM8A 2F2OA 1SW8A 3ZWHA 1F70A 1CDMA 4GUKA 2ZFDA 4TNCA 3NSIA 3BUMB 1BLQA 2KFFA 5D69A 5DKQA 2I7AA 2JU0A 2EC6B 4DS7A 1BU3A 1NCYA 2PASA 1Q80A 3BYAA 5HKZA 5J3XA 1YVHA 4YGAA 1UUSA 2NXQA 1ZACA 3OP0A 4WRIA 2ZKMX 2L5XB 3H4SE 1CMGA 1AJ5A 4FTGA 1H8BA 2CT9A 4MEWA 1A2XA 1W7JB 2VRGA 1XA5A 1SNLA 1DVIA 1K9UA 1PSRA 2MJWB 2M3WA 2Q4UA 3JTDB 2KOTA 4GGFC 3LK0A 5IBWA 2H2KA 2B1UA 1F54A 1DJYA 3JTDC 2HF5A 1DJHA 3OX5A 1XFUO 3DVJA 3LL8B 1DF0A 1XFWO 5CPVA 2H61A 3AKAA 1RECA 1QLKA 3BUXB 2LM5A 1FW4A 1KWOB 2LV7A 1MHOA 4PHJA 4YI9A 4QJ5B 2M1KB 1MWNA 2LMUA 1B7TZ 1TN4A 1Y1AA 2JZIA 1AK8A 1EJ3A 2BCAA 2K7OA 2V53A 2M0RA 1CLBA 1J7QA 2FOTA 4HRGA 2JPTA 1KK7Z 2L2EA 3AAKA 1N65A 2KFHA 5CSNA 5ER4X 3A8RA 1QIVA 2LP3A 1S6JA 4WQ2A 2LNKA 1XFYO 1KQVA 3SG2A 1BF5A 1SPYA 4JPZB 1GGWA 2HPSA 4GPLB 1MR8A 2JRFA 4PE1A 1CLLA 2LLTA 4N5XA 1IG5A 2TN4A 1KSMA 2OS8B 2K7BA 2M8UA 3CTNA 5JJGA 1Y6WA 2K2AA 1CKKA 2OPOA 1S6CA 1IJ5A 4PDZA 1NX0A 4ORCB 4NDDA 2LVJA 2OS8C 1YR5A 2NCPA 2F8PA 2JT3A 4NDCA 4PE0A 5TNCA 3DVEA 3SJSA 2A4JA 4JWQA 4R1EA 4XJKB 1S5GZ 3VRNA 3FWCA
chains in the Genus database with same CATH superfamily
2LHLA 2O5GA 1SCVA 1IRJA 3AKBA 3PSRA 4N1GA 5FYXA 3RM1A 5KU1A 3LLEA 1DMOA 3TUYC 1Y1UA 3I5IB 1ALVA 1M45A 4ZCVA 1XO5A 1EXRA 2AUCA 1NSHA 2F33A 1XVJA 2KPHA 2F2PA 1NCZA 3BUNB 1K93D 5AEQA 2LHIA 1XYDA 1K94A 2M29A 1J1EA 1QV0A 2KAYA 5JOLA 3EK8A 1J1DA 2LLUA 1AHRA 3AAJA 3CR5X 1UP5A 4I5KA 1B8RA 1PSBA 1OMVA 2BNXA 5HLOA 1DJGA 1A03A 1JWDA 1S3PA 1PULA 1K90D 1YUTA 1QX2A 1W9ZA 1DJIA 2BE4A 4C0KA 4USLA 1OOHA 3EKHA 2M7LA 3JVTB 1NWDA 3BUWB 2KSPA 3BOWA 2I18A 1B8CA 2CCMA 1SRAA 3D0YA 4ICBA 4F0ZB 1S1EA 2ZNDA 3TS5B 4AQJA 2LMVA 1QLSA 1DGUA 1CM1A 1N0YA 1W7IB 3JVTC 2M97A 4INWA 3EVVA 4MN0A 2P6BB 2Y4QA 5PALA 5AFPA 2ERBA 3D77A 4ETOA 3DF0B 2LP2A 3GK2A 3CDNA 1AVSA 3L4LA 4MZKA 3B87A 1DJXA 2JNFA 1TOPA 1V1GA 3DZTA 2IS9A 4HSZA 2KQ6A 1M39A 1DELA 3SIBA 1D1OA 1KFUL 2G9BA 3NSOA 4DIRA 2L0PA 3CZ1A 2H8VA 4KYNA 3I5FC 4YGBB 1LXFC 1UHNA 1UHKA 5G08A 1GM0A 3LCPC 2WCLA 3CGAA 1OQPA 2JC2A 1MUXA 5DKRA 3VB1A 3OX6A 2QEVA 3KHEA 1ORGA 1SCMB 4QJ4B 1KK8B 2M9GA 5B8IB 1A75A 1KFUS 2BL0C 3PM2A 5AANA 2WCBA 5I2OA 1NIWA 1NYAA 2M7NA 4AOMA 4DUQA 4D1EA 3IF7A 3C1VA 1SCMC 3EVRA 4OR9B 2BBNA 1KK8C 5HKWA 1QVIZ 1R2UA 2KDHA 2PVBA 3VRPA 3RZSA 1CNPA 3GK4X 1OOJA 2JT0A 3OBVA 1AUIB 1QX5B 1TNXA 2MBXA 4C0LA 1TNPA 3O2PA 1LVCD 2P70A 3GK1A 2AAOA 2WCHA 1SMGA 2FJYA 2GGZA 4MRYA 1IJ6A 1MXEA 1PVBA 1S36A 2CNPA 2LMTA 1QASA 2WC8A 2JWWA 3PFVA 3PLFB 1BMOA 1CFCA 3CLNA 1NCXA 3TDUA 1F8HA 4U8DA 1BJFA 1M31A 1TNWA 2F3YA 2BBMA 1OOIX 2ZNEA 2L4HA 1DGVA 3HX4A 3TDIA 4PHNA 4ORAB 1DF0B 1J7PA 1FI5A 2MHHA 1ZUZA 2HQWA 1OZOA 3M0WA 4C0JA 2PMYA 1FI6A 1JF2A 2WCFA 3A4UB 3D76A 1SL8A 3PALA 1JF0A 1U5IB 1Y1XA 5HL1A 4YGDB 1CTRA 2KHNA 1PK0D 2H61C 1LKJA 1UURA 2GTEA 4N1FA 1RROA 4PALA 4YBHB 4Q04A 4P2YB 2JQ6A 2KQYA 3IVTA 4CFQA 2MRDA 3EVUA 2M49B 2EHBA 2BKHB 3OB2B 5KTYA 5D3OA 1NX1A 1P28A 1KQMB 2KAXA 1JFJA 1IGVA 2BECA 3D75A 2KLEA 3D10A 1K9PA 2WCJA 3CS1A 1BG1A 2KGBC 3CZTX 2GV5A 1KQMC 2OTGB 5HLVA 3SG3A 2KFGA 4MZLA 3K1EA 2KI6C 1CFFA 1QX7A 2SASA 3BFHA 2OTGC 2KBIA 2KYFA 1EG4A 4PHKA 1EL4A 3TUYB 2K61A 2ZN8A 1G4YR 1S26D 3NHTA 4XYNA 4A4BA 3EK7A 2CTNA 4CLNA 1OSAA 3FE8A 1SK6D 1EH2A 2JTTA 2WC5A 1UHIA 1Z4HA 2E6WA 2M1UA 3OHMB 3BQ3A 5HKYA 1TUZA 2L5YA 2CXJA 1BODA 5KSZA 1RTP1 3SG7A 3DD4A 3CR2A 4F7FA 3SG4A 5CSJA 3ICBA 1J7RA 1X02A 3CZ2A 3FE9A 2I94A 5FI2A 4YGCB 1UHJA 1B9AA 1RK9A 1SBJA 3BFBA 3O4YA 1QV1A 4YGEB 2LUCA 4GBAA 4CIDA 3D74A 3WXAA 1CDPA 3I5HB 2JNXA 3EK4A 2NLNA 4OV2A 3DY9A 3R1VA 5CSFA 1B1GA 2DOQA 3RLZA 1XK4A 2LE9B 2BKIB 3I5HC 1XFXO 2QEOA 2WNDA 3FIAA 4I5NB 1JBAA 3D78A 1CB1A 1OE9B 1CM4A 1WRZA 1YRUB 3IQQA 1QIWA 1K95A 4OCIA 4GFTA 3FS7A 1C3YA 5AXIA 1SYMA 1SR6B 4UPGA 1WDCB 4OZDA 2D8NA 2LAPA 1C3ZA 1NX2A 2I2RE 2ISDA 1C7WA 4GAOA 1SR6C 1FBVA 1WDCC 2BE6A 2ZRSA 3WHUB 1TRFA 3I5FB 3BOWB 4MZJA 1NX3A 1WRLA 3I5GB 1HQVA 3D0YB 4ORBB 2Y1NA 4L9MA 1YRTB 1YVLA 1HT9A 2CBLA 1J7OA 3DXLA 1KFXL 1TIZA 1E8AA 3KPXA 3I5GC 2JXLA 1B7TY 3O78A 2O60A 3UO9A 2LC5A 2K7DA 2BL0B 1NP8A 2ZRTA 4NQGA 1LA3A 1WRKA 2NZ0A 1SY9A 2JTZA 2JULA 2KBMA 2Q91A 1KK7Y 4PE7A 1A29A 4YI8A 4DCKA 1K2HA 2LVKA 3VRRA 3SS5A 3QMEA 5K89A 5AERA 1XFVO 2BCXA 1FPWA 1GGZA 1T14A 1IWQA 1KFXS 5ER5A 3S0BA 3QRXA 2KI4B 4WQ3A 3S0AA 1RFJA 2KLDA 4GGFA 5I2QA 1BOCA 3MSEB 4CPVA 2KI4C 2PYQA 1G8IA 3LK1A 1CMFA 1A75B 2EC6C 4E68A 5FI6A 1B47A 1OW4A 1CLMA 4MSPA 3S0GA 1BR4B 1WY9A 1S6IA 3PATA 1F4OA 3S0EA 4ZCUA 1LS8A 4JQ0D 1F4QA 1PVAA 5FI7A 2LUXA 2QDIA 3SIAA 3VRQA 3SG6A 1V1FA 1OOFA 2ZN9A 1S5GY 2Y5IA 2PALA 3DVKA 3CYZA 1AP4A 1SKTA 1L7ZA 1DJZA 1RJVA 1Y0VH 3FWBA 3NSKA 1TNQA 2MLFC 2WCKA 3VROA 2L4IA 3B86A 1CDNA 1IH0A 1DTLA 3HCMA 2K2FA 3PN7B 1K9KA 3EKJA 1DT7B 1QTXA 5DICA 1K96A 2FCEA 1MQ1A 2L51A 3KF9A 1YUUA 2K0JA 3F45A 4MVFA 3OGNA 3PN7C 2Y1MA 4HRHA 5GQQC 3B7AA 2FJUB 1U5IA 4I5LB 2MAZA 1NPQA 4JD9A 1FF1A 3NSLA 1ZMZA 2LANA 4GNKB 4MRXA 1WLZA 5DKNA 2QPTA 1UWOA 2WOSA 1M46A 2HETA 1KWOC 1G33A 1C07A 2MA2A 2LCPA 3KO0A 1OMDA 1B8LA 2KI6D 2NCOA 2L98A 2QACA 1DC1A 1BR1B 4CFRA 3TDZA 1DEKA 1QS7A 1GQMA 1OOGA 1YX7A 1KSOA 2AMIA 2R2IA 1AJ4A 4MBEA 2K8MB 1TCFA 3L47A 2PRUA 2JOJA 2KYCA 4GGNA 4JKTA 2E30A 4XJKA 1K8UA 2SCPA 3E3RA 1ALWA 1CDLA 1IKUA 2KNEA 2EGDA 1DJWA 3WHTB 1N2DA 1PRWA 1YURA 3CR4X 4IL1A 1L2OB 4IJ7A 1OZSA 1YUSA 1PALA 3UNWA 5BPJA 3TZ1A 3K21A 4DRWA 3NXAA 4I5JA 1IQ3A 3B88A 1C7VA 4OVNF 1JC2A 1L2OC 3R72A 4M2QA 1JUOA 1WLMA 1BT6A 1CFDA 1J55A 1ZOTB 3KEVA 2WCEA 2BAPA 2G2BA 5D7FA 5I8NA 3B6XA 3BXKA 1EG3A 1QATA 4M2OA 4YRUA 4MLWA 4FQOA 4HREE 1M63B 1IQ5A 1JFKA 1LA0A 1NUBA 4FQTA 3VGOA 3R1OA 2L50A 3O6BA 1QVIY 3CWGA 3GOFA 1TCOB 3I5IC 2RGIA 3IQOA 1A4PA 1SL9A 1VRKA 2LLSA 3O4XA 2PSRA 3OB1B 2F3ZA 2LVIA 2COLB 4BY5A 4OKHA 4P5OE 3WNXB 4NDBA 2JXCA 4PE4A 5HYDA 2JT8A 3ZNIA 1JSAA 1ZFSA 2WORA 3S0FA 1XK4C 1SL7A 1MF8B 4M2PA 1CFPA 2YGUA 2MLEC 1GJYA 1ODBA 2BCBA 3N7HA 2HQ8A 3BUOB 1KCYA 2FCDA 3DVMA 4PHMA 3SG5A 3PJIA 1YX8A 1H4BA 1TTXA 3DF0A 1F55A 5I2LA 1LINA 4INXA 3NHIA 2LVVA 3CZ0A 1R6PA 1OMRA 1QJTA 2KAVA 2L2CA 3BJHA 4A4CA 1XFZO 1B4CA 4AQIA 2GGMA 1YTZC 2KGRA 1QWVA 3BFAA 1UHHA 1MXLC 1RWYA 5CSIA 4BY4A 4PCWA 1QXPA 3TS5C 2K7CA 4QJ3B 3R1PA 3PM8A 5F6TA 2F2OA 1SW8A 2WCMA 3ZWHA 1F70A 1CDMA 4GUKA 2ZFDA 3D73A 4TNCA 3NSIA 2JPOA 3BUMB 3V2LA 5I94A 2KFFA 5D69A 5DKQA 2I7AA 2JU0A 2QEBA 1BLQA 1DQEA 2EC6B 5EL2A 1BU3A 1NCYA 2PASA 1Q80A 3SS4A 4DS7A 3BYAA 3EG5B 5HKZA 5J3XA 1YVHA 4YGAA 1UUSA 2NXQA 1ZACA 3OP0A 2QEHA 3L4AA 4WRIA 2ZKMX 2L5XB 3H4SE 1CMGA 1AJ5A 4FTGA 1H8BA 2CT9A 2P71A 4MEWA 1A2XA 1W7JB 2VRGA 1XA5A 1SNLA 1DVIA 1K9UA 1PSRA 2MJWB 2M3WA 2Q4UA 3JTDB 2KOTA 4GGFC 3LK0A 5IBWA 2H2KA 2B1UA 3FE6A 1F54A 1DJYA 1TUJA 3JTDC 2HF5A 1DJHA 3OX5A 1XFUO 3DVJA 3LL8B 1DF0A 3CABA 1XFWO 5CPVA 2H61A 3AKAA 3Q8IA 1RECA 1IIOA 1QLKA 3BUXB 2LM5A 1FW4A 1KWOB 2LV7A 1MHOA 3NGVA 4PHJA 4YI9A 4QJ5B 2WC6A 2M1KB 4PT1A 1MWNA 2LMUA 1B7TZ 1TN4A 1Y1AA 2JZIA 3SS3A 1AK8A 1EJ3A 1Z2CB 2BCAA 2K7OA 1XFRA 2V53A 2M0RA 3DYEA 1J7QA 1CLBA 1F71A 2FOTA 4HRGA 2JPTA 1KK7Z 2L2EA 3AAKA 1N65A 2KFHA 5CSNA 5ER4X 3A8RA 1QIVA 2LP3A 1S6JA 4WQ2A 2LNKA 1SSEB 1XFYO 1KQVA 3SG2A 1BF5A 1SPYA 4JPZB 1GGWA 2HPSA 4GPLB 1MR8A 2PQLA 2JRFA 2K60A 4PE1A 1CLLA 2LLTA 4N5XA 1IG5A 2TN4A 1KSMA 2OS8B 2K7BA 2M8UA 3CTNA 5JJGA 1Y6WA 2K2AA 1CKKA 2OPOA 1S6CA 1IJ5A 4PDZA 3S0DA 1NX0A 4ORCB 4NDDA 2LVJA 2OS8C 1TWOA 1YR5A 2NCPA 2F8PA 2JT3A 4NDCA 4PE0A 5TNCA 3DVEA 3SJSA 2A4JA 4JWQA 4R1EA 4XJKB 1S5GZ 3VRNA 3FWCA
chains in the Genus database with same CATH topology
2LHLA 2O5GA 1SCVA 1IRJA 3AKBA 3PSRA 4N1GA 5FYXA 3RM1A 5KU1A 3LLEA 1DMOA 3TUYC 1Y1UA 3I5IB 1ALVA 1M45A 4ZCVA 1XO5A 1EXRA 2AUCA 1NSHA 2F33A 1XVJA 2F2PA 1NCZA 3BUNB 1K93D 5AEQA 2LHIA 1XYDA 1K94A 2M29A 1J1EA 1QV0A 2KAYA 5JOLA 3EK8A 1J1DA 2LLUA 1AHRA 3AAJA 3CR5X 1UP5A 4I5KA 1B8RA 1PSBA 1OMVA 5HLOA 1DJGA 1A03A 1JWDA 1S3PA 1PULA 1K90D 1YUTA 1QX2A 1DJIA 2BE4A 4C0KA 4USLA 3EKHA 2M7LA 3JVTB 1NWDA 3BUWB 2KSPA 3BOWA 2I18A 1B8CA 2CCMA 1SRAA 3D0YA 4ICBA 4F0ZB 1S1EA 2ZNDA 3TS5B 4AQJA 2LMVA 1QLSA 1DGUA 1CM1A 1N0YA 1W7IB 3JVTC 2M97A 4MN0A 3EVVA 5PALA 2P6BB 2Y4QA 5AFPA 4ETOA 3DF0B 2LP2A 3GK2A 1AVSA 4MZKA 1DJXA 2JNFA 1TOPA 1V1GA 3SIBA 2IS9A 4HSZA 2KQ6A 1M39A 1D1OA 1F71A 1KFUL 2G9BA 3NSOA 4DIRA 2L0PA 3I5FC 4YGBB 1LXFC 1UHNA 1UHKA 5G08A 3LCPC 3CGAA 1OQPA 2JC2A 1MUXA 5DKRA 3OX6A 3KHEA 1SCMB 4QJ4B 1KK8B 2M9GA 5B8IB 1A75A 1KFUS 2BL0C 5AANA 5I2OA 2WCBA 1NIWA 1NYAA 2M7NA 4AOMA 4DUQA 4D1EA 3IF7A 3C1VA 1SCMC 3EVRA 4OR9B 2BBNA 1KK8C 5HKWA 1QVIZ 1R2UA 2KDHA 2PVBA 3VRPA 1CNPA 3GK4X 1OOJA 2JT0A 1AUIB 1QX5B 1TNXA 2MBXA 4C0LA 1TNPA 3O2PA 1LVCD 3GK1A 2AAOA 1SMGA 2GGZA 4MRYA 1IJ6A 1MXEA 2CNPA 1S36A 1PVBA 2LMTA 1QASA 2WC8A 2JWWA 3PFVA 3PLFB 1BMOA 1CFCA 3CLNA 1NCXA 3TDUA 1F8HA 4U8DA 1BJFA 1M31A 1TNWA 2F3YA 2BBMA 2ZNEA 2L4HA 1DGVA 3HX4A 3TDIA 4PHNA 4ORAB 1DF0B 1J7PA 1FI5A 2MHHA 1ZUZA 2HQWA 1OZOA 3M0WA 4C0JA 2PMYA 1FI6A 1JF2A 2WCFA 3A4UB 1SL8A 3PALA 1JF0A 1U5IB 1Y1XA 4YGDB 1CTRA 2KHNA 1PK0D 2H61C 1LKJA 1UURA 4N1FA 4PALA 1RROA 4YBHB 4Q04A 4P2YB 2JQ6A 2KQYA 4CFQA 2MRDA 3EVUA 2M49B 2EHBA 2BKHB 3OB2B 5KTYA 1NX1A 1JFJA 1KQMB 2KAXA 1IGVA 2BECA 3D10A 1K9PA 3CS1A 1BG1A 2KGBC 3CZTX 2GV5A 1KQMC 2OTGB 5HLVA 3SG3A 2KFGA 4MZLA 2KI6C 1CFFA 1QX7A 2SASA 2OTGC 2KBIA 2KYFA 1EG4A 4PHKA 1EL4A 3TUYB 2K61A 2ZN8A 1G4YR 1S26D 4XYNA 4A4BA 4CLNA 3EK7A 2CTNA 1OSAA 1SK6D 1EH2A 2JTTA 1UHIA 2E6WA 2M1UA 3OHMB 3BQ3A 5HKYA 2CXJA 1BODA 5KSZA 1RTP1 3SG7A 3DD4A 3CR2A 3SG4A 5CSJA 3ICBA 1J7RA 1X02A 2I94A 4YGCB 1UHJA 1B9AA 1RK9A 1SBJA 4CIDA 3O4YA 1QV1A 4YGEB 2LUCA 4GBAA 3WXAA 1CDPA 3I5HB 2JNXA 3EK4A 2NLNA 4OV2A 1B1GA 5CSFA 2DOQA 3RLZA 1XK4A 2LE9B 2BKIB 3I5HC 1XFXO 2WNDA 3FIAA 4I5NB 1JBAA 1CB1A 1OE9B 1CM4A 1WRZA 1YRUB 3IQQA 1QIWA 1K95A 4OCIA 4GFTA 3FS7A 5AXIA 1SYMA 1SR6B 4UPGA 1WDCB 2D8NA 2LAPA 1NX2A 2I2RE 2ISDA 1C7WA 4GAOA 1SR6C 1FBVA 1WDCC 2BE6A 2ZRSA 3WHUB 1TRFA 3I5FB 3BOWB 4MZJA 1NX3A 1WRLA 3I5GB 1HQVA 3D0YB 4ORBB 2Y1NA 4L9MA 1YRTB 1YVLA 1HT9A 2CBLA 1J7OA 1KFXL 1TIZA 1E8AA 3KPXA 3I5GC 2JXLA 1B7TY 3O78A 2O60A 2LC5A 2K7DA 2BL0B 1NP8A 2ZRTA 4NQGA 1LA3A 1WRKA 2NZ0A 1SY9A 2JTZA 2JULA 2KBMA 2Q91A 1KK7Y 4PE7A 1A29A 4YI8A 4DCKA 1K2HA 2LVKA 3VRRA 5K89A 5AERA 1XFVO 2BCXA 1FPWA 1GGZA 1IWQA 1KFXS 5ER5A 3QRXA 2KI4B 4WQ3A 1RFJA 4GGFA 5I2QA 1BOCA 3MSEB 4CPVA 2KI4C 3LK1A 1G8IA 1CMFA 1A75B 2EC6C 4E68A 1B47A 1CLMA 4MSPA 1BR4B 1WY9A 1S6IA 3PATA 1F4OA 4ZCUA 4JQ0D 1F4QA 1PVAA 3VRQA 2LUXA 3SIAA 3SG6A 1V1FA 2ZN9A 1S5GY 2Y5IA 2PALA 3DVKA 1AP4A 1SKTA 1L7ZA 1DJZA 1RJVA 1Y0VH 3FWBA 3NSKA 1TNQA 2MLFC 3VROA 2L4IA 1CDNA 1IH0A 1DTLA 3HCMA 2K2FA 3PN7B 1K9KA 3EKJA 1DT7B 1QTXA 1K96A 2FCEA 1MQ1A 2L51A 3KF9A 1YUUA 2K0JA 3F45A 4MVFA 3PN7C 2Y1MA 4HRHA 5GQQC 2FJUB 1U5IA 4I5LB 2MAZA 1NPQA 1FF1A 3NSLA 1ZMZA 2LANA 4GNKB 4MRXA 1WLZA 5DKNA 2QPTA 1UWOA 2WOSA 1M46A 2HETA 1KWOC 1G33A 1C07A 2MA2A 2LCPA 3KO0A 1OMDA 1B8LA 2KI6D 2NCOA 2L98A 2QACA 1BR1B 4CFRA 3TDZA 1QS7A 1GQMA 1YX7A 1KSOA 2AMIA 2R2IA 1AJ4A 4MBEA 2K8MB 1TCFA 2PRUA 2JOJA 2KYCA 4GGNA 2E30A 4XJKA 1K8UA 2SCPA 3E3RA 1ALWA 1CDLA 1IKUA 2KNEA 2EGDA 1DJWA 3WHTB 1N2DA 1PRWA 1YURA 3CR4X 4IL1A 1L2OB 1OZSA 1YUSA 1PALA 5BPJA 3TZ1A 3K21A 4DRWA 3NXAA 4I5JA 1IQ3A 1C7VA 4OVNF 1JC2A 1L2OC 4M2QA 1JUOA 1WLMA 1BT6A 1CFDA 1J55A 1ZOTB 3KEVA 2WCEA 5I8NA 2G2BA 5D7FA 3BXKA 1EG3A 1QATA 4M2OA 4YRUA 4MLWA 4FQOA 4HREE 1M63B 1IQ5A 1JFKA 1LA0A 1NUBA 3VGOA 2L50A 3O6BA 1QVIY 3CWGA 3GOFA 1TCOB 3I5IC 2RGIA 3IQOA 1A4PA 1SL9A 1VRKA 2LLSA 2PSRA 3OB1B 2F3ZA 2LVIA 2COLB 4BY5A 4OKHA 4P5OE 3WNXB 4NDBA 2JXCA 4PE4A 5HYDA 2JT8A 3ZNIA 1JSAA 1ZFSA 2WORA 1XK4C 1SL7A 1MF8B 4M2PA 1CFPA 2MLEC 2BCBA 1GJYA 1ODBA 2HQ8A 3BUOB 1KCYA 2FCDA 3DVMA 4PHMA 3SG5A 1H4BA 1YX8A 1TTXA 3DF0A 1F55A 5I2LA 1LINA 2LVVA 1R6PA 1OMRA 1QJTA 2KAVA 4A4CA 1XFZO 1B4CA 4AQIA 2GGMA 1YTZC 2KGRA 1UHHA 1MXLC 1RWYA 5CSIA 4BY4A 4PCWA 1QXPA 3TS5C 2K7CA 4QJ3B 5F6TA 3PM8A 2F2OA 1SW8A 3ZWHA 1F70A 1CDMA 4GUKA 2ZFDA 4TNCA 3NSIA 3BUMB 1BLQA 2KFFA 5D69A 5DKQA 2I7AA 2JU0A 2EC6B 4DS7A 1BU3A 1NCYA 2PASA 1Q80A 3BYAA 5HKZA 5J3XA 1YVHA 4YGAA 1UUSA 2NXQA 1ZACA 3OP0A 4WRIA 2ZKMX 2L5XB 3H4SE 1CMGA 1AJ5A 4FTGA 1H8BA 2CT9A 4MEWA 1A2XA 1W7JB 2VRGA 1XA5A 1SNLA 1DVIA 1K9UA 1PSRA 2MJWB 2M3WA 2Q4UA 3JTDB 2KOTA 4GGFC 3LK0A 5IBWA 2H2KA 2B1UA 1F54A 1DJYA 3JTDC 2HF5A 1DJHA 3OX5A 1XFUO 3DVJA 3LL8B 1DF0A 1XFWO 5CPVA 2H61A 3AKAA 1RECA 1QLKA 3BUXB 2LM5A 1FW4A 1KWOB 2LV7A 1MHOA 4PHJA 4YI9A 4QJ5B 2M1KB 1MWNA 2LMUA 1B7TZ 1TN4A 1Y1AA 2JZIA 1AK8A 1EJ3A 2BCAA 2K7OA 2V53A 2M0RA 1CLBA 1J7QA 2FOTA 4HRGA 2JPTA 1KK7Z 2L2EA 3AAKA 1N65A 2KFHA 5CSNA 5ER4X 3A8RA 1QIVA 2LP3A 1S6JA 4WQ2A 2LNKA 1XFYO 1KQVA 3SG2A 1BF5A 1SPYA 4JPZB 1GGWA 2HPSA 4GPLB 1MR8A 2JRFA 4PE1A 1CLLA 2LLTA 4N5XA 1IG5A 2TN4A 1KSMA 2OS8B 2K7BA 2M8UA 3CTNA 5JJGA 1Y6WA 2K2AA 1CKKA 2OPOA 1S6CA 1IJ5A 4PDZA 1NX0A 4ORCB 4NDDA 2LVJA 2OS8C 1YR5A 2NCPA 2F8PA 2JT3A 4NDCA 4PE0A 5TNCA 3DVEA 3SJSA 2A4JA 4JWQA 4R1EA 4XJKB 1S5GZ 3VRNA 3FWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHL A;  2O5G A;  1SCV A;  1IRJ A;  3AKB A;  3PSR A;  4N1G A;  5FYX A;  3RM1 A;  5KU1 A;  3LLE A;  1DMO A;  3TUY C;  1Y1U A;  3I5I B;  1ALV A;  1M45 A;  4ZCV A;  1XO5 A;  1EXR A;  2AUC A;  1NSH A;  2F33 A;  1XVJ A;  2F2P A;  1NCZ A;  3BUN B;  1K93 D;  5AEQ A;  2LHI A;  1XYD A;  1K94 A;  2M29 A;  1J1E A;  1QV0 A;  2KAY A;  5JOL A;  3EK8 A;  1J1D A;  2LLU A;  1AHR A;  3AAJ A;  3CR5 X;  1UP5 A;  4I5K A;  1B8R A;  1PSB A;  1OMV A;  5HLO A;  1DJG A;  1A03 A;  1JWD A;  1S3P A;  1PUL A;  1K90 D;  1YUT A;  1QX2 A;  1DJI A;  2BE4 A;  4C0K A;  4USL A;  3EKH A;  2M7L A;  3JVT B;  1NWD A;  3BUW B;  2KSP A;  3BOW A;  2I18 A;  1B8C A;  2CCM A;  1SRA A;  3D0Y A;  4ICB A;  4F0Z B;  1S1E A;  2ZND A;  3TS5 B;  4AQJ A;  2LMV A;  1QLS A;  1DGU A;  1CM1 A;  1N0Y A;  1W7I B;  3JVT C;  2M97 A;  4MN0 A;  3EVV A;  5PAL A;  2P6B B;  2Y4Q A;  5AFP A;  4ETO A;  3DF0 B;  2LP2 A;  3GK2 A;  1AVS A;  4MZK A;  1DJX A;  2JNF A;  1TOP A;  1V1G A;  3SIB A;  2IS9 A;  4HSZ A;  2KQ6 A;  1M39 A;  1D1O A;  1F71 A;  1KFU L;  2G9B A;  3NSO A;  4DIR A;  2L0P A;  3I5F C;  4YGB B;  1LXF C;  1UHN A;  1UHK A;  5G08 A;  3LCP C;  3CGA A;  1OQP A;  2JC2 A;  1MUX A;  5DKR A;  3OX6 A;  3KHE A;  1SCM B;  4QJ4 B;  1KK8 B;  2M9G A;  5B8I B;  1A75 A;  1KFU S;  2BL0 C;  5AAN A;  5I2O A;  2WCB A;  1NIW A;  1NYA A;  2M7N A;  4AOM A;  4DUQ A;  4D1E A;  3IF7 A;  3C1V A;  1SCM C;  3EVR A;  4OR9 B;  2BBN A;  1KK8 C;  5HKW A;  1QVI Z;  1R2U A;  2KDH A;  2PVB A;  3VRP A;  1CNP A;  3GK4 X;  1OOJ A;  2JT0 A;  1AUI B;  1QX5 B;  1TNX A;  2MBX A;  4C0L A;  1TNP A;  3O2P A;  1LVC D;  3GK1 A;  2AAO A;  1SMG A;  2GGZ A;  4MRY A;  1IJ6 A;  1MXE A;  2CNP A;  1S36 A;  1PVB A;  2LMT A;  1QAS A;  2WC8 A;  2JWW A;  3PFV A;  3PLF B;  1BMO A;  1CFC A;  3CLN A;  1NCX A;  3TDU A;  1F8H A;  4U8D A;  1BJF A;  1M31 A;  1TNW A;  2F3Y A;  2BBM A;  2ZNE A;  2L4H A;  1DGV A;  3HX4 A;  3TDI A;  4PHN A;  4ORA B;  1DF0 B;  1J7P A;  1FI5 A;  2MHH A;  1ZUZ A;  2HQW A;  1OZO A;  3M0W A;  4C0J A;  2PMY A;  1FI6 A;  1JF2 A;  2WCF A;  3A4U B;  1SL8 A;  3PAL A;  1JF0 A;  1U5I B;  1Y1X A;  4YGD B;  1CTR A;  2KHN A;  1PK0 D;  2H61 C;  1LKJ A;  1UUR A;  4N1F A;  4PAL A;  1RRO A;  4YBH B;  4Q04 A;  4P2Y B;  2JQ6 A;  2KQY A;  4CFQ A;  2MRD A;  3EVU A;  2M49 B;  2EHB A;  2BKH B;  3OB2 B;  5KTY A;  1NX1 A;  1JFJ A;  1KQM B;  2KAX A;  1IGV A;  2BEC A;  3D10 A;  1K9P A;  3CS1 A;  1BG1 A;  2KGB C;  3CZT X;  2GV5 A;  1KQM C;  2OTG B;  5HLV A;  3SG3 A;  2KFG A;  4MZL A;  2KI6 C;  1CFF A;  1QX7 A;  2SAS A;  2OTG C;  2KBI A;  2KYF A;  1EG4 A;  4PHK A;  1EL4 A;  3TUY B;  2K61 A;  2ZN8 A;  1G4Y R;  1S26 D;  4XYN A;  4A4B A;  4CLN A;  3EK7 A;  2CTN A;  1OSA A;  1SK6 D;  1EH2 A;  2JTT A;  1UHI A;  2E6W A;  2M1U A;  3OHM B;  3BQ3 A;  5HKY A;  2CXJ A;  1BOD A;  5KSZ A;  1RTP 1;  3SG7 A;  3DD4 A;  3CR2 A;  3SG4 A;  5CSJ A;  3ICB A;  1J7R A;  1X02 A;  2I94 A;  4YGC B;  1UHJ A;  1B9A A;  1RK9 A;  1SBJ A;  4CID A;  3O4Y A;  1QV1 A;  4YGE B;  2LUC A;  4GBA A;  3WXA A;  1CDP A;  3I5H B;  2JNX A;  3EK4 A;  2NLN A;  4OV2 A;  1B1G A;  5CSF A;  2DOQ A;  3RLZ A;  1XK4 A;  2LE9 B;  2BKI B;  3I5H C;  1XFX O;  2WND A;  3FIA A;  4I5N B;  1JBA A;  1CB1 A;  1OE9 B;  1CM4 A;  1WRZ A;  1YRU B;  3IQQ A;  1QIW A;  1K95 A;  4OCI A;  4GFT A;  3FS7 A;  5AXI A;  1SYM A;  1SR6 B;  4UPG A;  1WDC B;  2D8N A;  2LAP A;  1NX2 A;  2I2R E;  2ISD A;  1C7W A;  4GAO A;  1SR6 C;  1FBV A;  1WDC C;  2BE6 A;  2ZRS A;  3WHU B;  1TRF A;  3I5F B;  3BOW B;  4MZJ A;  1NX3 A;  1WRL A;  3I5G B;  1HQV A;  3D0Y B;  4ORB B;  2Y1N A;  4L9M A;  1YRT B;  1YVL A;  1HT9 A;  2CBL A;  1J7O A;  1KFX L;  1TIZ A;  1E8A A;  3KPX A;  3I5G C;  2JXL A;  1B7T Y;  3O78 A;  2O60 A;  2LC5 A;  2K7D A;  2BL0 B;  1NP8 A;  2ZRT A;  4NQG A;  1LA3 A;  1WRK A;  2NZ0 A;  1SY9 A;  2JTZ A;  2JUL A;  2KBM A;  2Q91 A;  1KK7 Y;  4PE7 A;  1A29 A;  4YI8 A;  4DCK A;  1K2H A;  2LVK A;  3VRR A;  5K89 A;  5AER A;  1XFV O;  2BCX A;  1FPW A;  1GGZ A;  1IWQ A;  1KFX S;  5ER5 A;  3QRX A;  2KI4 B;  4WQ3 A;  1RFJ A;  4GGF A;  5I2Q A;  1BOC A;  3MSE B;  4CPV A;  2KI4 C;  3LK1 A;  1G8I A;  1CMF A;  1A75 B;  2EC6 C;  4E68 A;  1B47 A;  1CLM A;  4MSP A;  1BR4 B;  1WY9 A;  1S6I A;  3PAT A;  1F4O A;  4ZCU A;  4JQ0 D;  1F4Q A;  1PVA A;  3VRQ A;  2LUX A;  3SIA A;  3SG6 A;  1V1F A;  2ZN9 A;  1S5G Y;  2Y5I A;  2PAL A;  3DVK A;  1AP4 A;  1SKT A;  1L7Z A;  1DJZ A;  1RJV A;  1Y0V H;  3FWB A;  3NSK A;  1TNQ A;  2MLF C;  3VRO A;  2L4I A;  1CDN A;  1IH0 A;  1DTL A;  3HCM A;  2K2F A;  3PN7 B;  1K9K A;  3EKJ A;  1DT7 B;  1QTX A;  1K96 A;  2FCE A;  1MQ1 A;  2L51 A;  3KF9 A;  1YUU A;  2K0J A;  3F45 A;  4MVF A;  3PN7 C;  2Y1M A;  4HRH A;  5GQQ C;  2FJU B;  1U5I A;  4I5L B;  2MAZ A;  1NPQ A;  1FF1 A;  3NSL A;  1ZMZ A;  2LAN A;  4GNK B;  4MRX A;  1WLZ A;  5DKN A;  2QPT A;  1UWO A;  2WOS A;  1M46 A;  2HET A;  1KWO C;  1G33 A;  1C07 A;  2MA2 A;  2LCP A;  3KO0 A;  1OMD A;  1B8L A;  2KI6 D;  2NCO A;  2L98 A;  2QAC A;  1BR1 B;  4CFR A;  3TDZ A;  1QS7 A;  1GQM A;  1YX7 A;  1KSO A;  2AMI A;  2R2I A;  1AJ4 A;  4MBE A;  2K8M B;  1TCF A;  2PRU A;  2JOJ A;  2KYC A;  4GGN A;  2E30 A;  4XJK A;  1K8U A;  2SCP A;  3E3R A;  1ALW A;  1CDL A;  1IKU A;  2KNE A;  2EGD A;  1DJW A;  3WHT B;  1N2D A;  1PRW A;  1YUR A;  3CR4 X;  4IL1 A;  1L2O B;  1OZS A;  1YUS A;  1PAL A;  5BPJ A;  3TZ1 A;  3K21 A;  4DRW A;  3NXA A;  4I5J A;  1IQ3 A;  1C7V A;  4OVN F;  1JC2 A;  1L2O C;  4M2Q A;  1JUO A;  1WLM A;  1BT6 A;  1CFD A;  1J55 A;  1ZOT B;  3KEV A;  2WCE A;  5I8N A;  2G2B A;  5D7F A;  3BXK A;  1EG3 A;  1QAT A;  4M2O A;  4YRU A;  4MLW A;  4FQO A;  4HRE E;  1M63 B;  1IQ5 A;  1JFK A;  1LA0 A;  1NUB A;  3VGO A;  2L50 A;  3O6B A;  1QVI Y;  3CWG A;  3GOF A;  1TCO B;  3I5I C;  2RGI A;  3IQO A;  1A4P A;  1SL9 A;  1VRK A;  2LLS A;  2PSR A;  3OB1 B;  2F3Z A;  2LVI A;  2COL B;  4BY5 A;  4OKH A;  4P5O E;  3WNX B;  4NDB A;  2JXC A;  4PE4 A;  5HYD A;  2JT8 A;  3ZNI A;  1JSA A;  1ZFS A;  2WOR A;  1XK4 C;  1SL7 A;  1MF8 B;  4M2P A;  1CFP A;  2MLE C;  2BCB A;  1GJY A;  1ODB A;  2HQ8 A;  3BUO B;  1KCY A;  2FCD A;  3DVM A;  4PHM A;  3SG5 A;  1H4B A;  1YX8 A;  1TTX A;  3DF0 A;  1F55 A;  5I2L A;  1LIN A;  2LVV A;  1R6P A;  1OMR A;  1QJT A;  2KAV A;  4A4C A;  1XFZ O;  1B4C A;  4AQI A;  2GGM A;  1YTZ C;  2KGR A;  1UHH A;  1MXL C;  1RWY A;  5CSI A;  4BY4 A;  4PCW A;  1QXP A;  3TS5 C;  2K7C A;  4QJ3 B;  5F6T A;  3PM8 A;  2F2O A;  1SW8 A;  3ZWH A;  1F70 A;  1CDM A;  4GUK A;  2ZFD A;  4TNC A;  3NSI A;  3BUM B;  1BLQ A;  2KFF A;  5D69 A;  5DKQ A;  2I7A A;  2JU0 A;  2EC6 B;  4DS7 A;  1BU3 A;  1NCY A;  2PAS A;  1Q80 A;  3BYA A;  5HKZ A;  5J3X A;  1YVH A;  4YGA A;  1UUS A;  2NXQ A;  1ZAC A;  3OP0 A;  4WRI A;  2ZKM X;  2L5X B;  3H4S E;  1CMG A;  1AJ5 A;  4FTG A;  1H8B A;  2CT9 A;  4MEW A;  1A2X A;  1W7J B;  2VRG A;  1XA5 A;  1SNL A;  1DVI A;  1K9U A;  1PSR A;  2MJW B;  2M3W A;  2Q4U A;  3JTD B;  2KOT A;  4GGF C;  3LK0 A;  5IBW A;  2H2K A;  2B1U A;  1F54 A;  1DJY A;  3JTD C;  2HF5 A;  1DJH A;  3OX5 A;  1XFU O;  3DVJ A;  3LL8 B;  1DF0 A;  1XFW O;  5CPV A;  2H61 A;  3AKA A;  1REC A;  1QLK A;  3BUX B;  2LM5 A;  1FW4 A;  1KWO B;  2LV7 A;  1MHO A;  4PHJ A;  4YI9 A;  4QJ5 B;  2M1K B;  1MWN A;  2LMU A;  1B7T Z;  1TN4 A;  1Y1A A;  2JZI A;  1AK8 A;  1EJ3 A;  2BCA A;  2K7O A;  2V53 A;  2M0R A;  1CLB A;  1J7Q A;  2FOT A;  4HRG A;  2JPT A;  1KK7 Z;  2L2E A;  3AAK A;  1N65 A;  2KFH A;  5CSN A;  5ER4 X;  3A8R A;  1QIV A;  2LP3 A;  1S6J A;  4WQ2 A;  2LNK A;  1XFY O;  1KQV A;  3SG2 A;  1BF5 A;  1SPY A;  4JPZ B;  1GGW A;  2HPS A;  4GPL B;  1MR8 A;  2JRF A;  4PE1 A;  1CLL A;  2LLT A;  4N5X A;  1IG5 A;  2TN4 A;  1KSM A;  2OS8 B;  2K7B A;  2M8U A;  3CTN A;  5JJG A;  1Y6W A;  2K2A A;  1CKK A;  2OPO A;  1S6C A;  1IJ5 A;  4PDZ A;  1NX0 A;  4ORC B;  4NDD A;  2LVJ A;  2OS8 C;  1YR5 A;  2NCP A;  2F8P A;  2JT3 A;  4NDC A;  4PE0 A;  5TNC A;  3DVE A;  3SJS A;  2A4J A;  4JWQ A;  4R1E A;  4XJK B;  1S5G Z;  3VRN A;  3FWC A; 
#chains in the Genus database with same CATH topology
 2LHL A;  2O5G A;  1SCV A;  1IRJ A;  3AKB A;  3PSR A;  4N1G A;  5FYX A;  3RM1 A;  5KU1 A;  3LLE A;  1DMO A;  3TUY C;  1Y1U A;  3I5I B;  1ALV A;  1M45 A;  4ZCV A;  1XO5 A;  1EXR A;  2AUC A;  1NSH A;  2F33 A;  1XVJ A;  2KPH A;  2F2P A;  1NCZ A;  3BUN B;  1K93 D;  5AEQ A;  2LHI A;  1XYD A;  1K94 A;  2M29 A;  1J1E A;  1QV0 A;  2KAY A;  5JOL A;  3EK8 A;  1J1D A;  2LLU A;  1AHR A;  3AAJ A;  3CR5 X;  1UP5 A;  4I5K A;  1B8R A;  1PSB A;  1OMV A;  2BNX A;  5HLO A;  1DJG A;  1A03 A;  1JWD A;  1S3P A;  1PUL A;  1K90 D;  1YUT A;  1QX2 A;  1W9Z A;  1DJI A;  2BE4 A;  4C0K A;  4USL A;  1OOH A;  3EKH A;  2M7L A;  3JVT B;  1NWD A;  3BUW B;  2KSP A;  3BOW A;  2I18 A;  1B8C A;  2CCM A;  1SRA A;  3D0Y A;  4ICB A;  4F0Z B;  1S1E A;  2ZND A;  3TS5 B;  4AQJ A;  2LMV A;  1QLS A;  1DGU A;  1CM1 A;  1N0Y A;  1W7I B;  3JVT C;  2M97 A;  4INW A;  3EVV A;  4MN0 A;  2P6B B;  2Y4Q A;  5PAL A;  5AFP A;  2ERB A;  3D77 A;  4ETO A;  3DF0 B;  2LP2 A;  3GK2 A;  3CDN A;  1AVS A;  3L4L A;  4MZK A;  3B87 A;  1DJX A;  2JNF A;  1TOP A;  1V1G A;  3DZT A;  2IS9 A;  4HSZ A;  2KQ6 A;  1M39 A;  1DEL A;  3SIB A;  1D1O A;  1KFU L;  2G9B A;  3NSO A;  4DIR A;  2L0P A;  3CZ1 A;  2H8V A;  4KYN A;  3I5F C;  4YGB B;  1LXF C;  1UHN A;  1UHK A;  5G08 A;  1GM0 A;  3LCP C;  2WCL A;  3CGA A;  1OQP A;  2JC2 A;  1MUX A;  5DKR A;  3VB1 A;  3OX6 A;  2QEV A;  3KHE A;  1ORG A;  1SCM B;  4QJ4 B;  1KK8 B;  2M9G A;  5B8I B;  1A75 A;  1KFU S;  2BL0 C;  3PM2 A;  5AAN A;  2WCB A;  5I2O A;  1NIW A;  1NYA A;  2M7N A;  4AOM A;  4DUQ A;  4D1E A;  3IF7 A;  3C1V A;  1SCM C;  3EVR A;  4OR9 B;  2BBN A;  1KK8 C;  5HKW A;  1QVI Z;  1R2U A;  2KDH A;  2PVB A;  3VRP A;  3RZS A;  1CNP A;  3GK4 X;  1OOJ A;  2JT0 A;  3OBV A;  1AUI B;  1QX5 B;  1TNX A;  2MBX A;  4C0L A;  1TNP A;  3O2P A;  1LVC D;  2P70 A;  3GK1 A;  2AAO A;  2WCH A;  1SMG A;  2FJY A;  2GGZ A;  4MRY A;  1IJ6 A;  1MXE A;  1PVB A;  1S36 A;  2CNP A;  2LMT A;  1QAS A;  2WC8 A;  2JWW A;  3PFV A;  3PLF B;  1BMO A;  1CFC A;  3CLN A;  1NCX A;  3TDU A;  1F8H A;  4U8D A;  1BJF A;  1M31 A;  1TNW A;  2F3Y A;  2BBM A;  1OOI X;  2ZNE A;  2L4H A;  1DGV A;  3HX4 A;  3TDI A;  4PHN A;  4ORA B;  1DF0 B;  1J7P A;  1FI5 A;  2MHH A;  1ZUZ A;  2HQW A;  1OZO A;  3M0W A;  4C0J A;  2PMY A;  1FI6 A;  1JF2 A;  2WCF A;  3A4U B;  3D76 A;  1SL8 A;  3PAL A;  1JF0 A;  1U5I B;  1Y1X A;  5HL1 A;  4YGD B;  1CTR A;  2KHN A;  1PK0 D;  2H61 C;  1LKJ A;  1UUR A;  2GTE A;  4N1F A;  1RRO A;  4PAL A;  4YBH B;  4Q04 A;  4P2Y B;  2JQ6 A;  2KQY A;  3IVT A;  4CFQ A;  2MRD A;  3EVU A;  2M49 B;  2EHB A;  2BKH B;  3OB2 B;  5KTY A;  5D3O A;  1NX1 A;  1P28 A;  1KQM B;  2KAX A;  1JFJ A;  1IGV A;  2BEC A;  3D75 A;  2KLE A;  3D10 A;  1K9P A;  2WCJ A;  3CS1 A;  1BG1 A;  2KGB C;  3CZT X;  2GV5 A;  1KQM C;  2OTG B;  5HLV A;  3SG3 A;  2KFG A;  4MZL A;  3K1E A;  2KI6 C;  1CFF A;  1QX7 A;  2SAS A;  3BFH A;  2OTG C;  2KBI A;  2KYF A;  1EG4 A;  4PHK A;  1EL4 A;  3TUY B;  2K61 A;  2ZN8 A;  1G4Y R;  1S26 D;  3NHT A;  4XYN A;  4A4B A;  3EK7 A;  2CTN A;  4CLN A;  1OSA A;  3FE8 A;  1SK6 D;  1EH2 A;  2JTT A;  2WC5 A;  1UHI A;  1Z4H A;  2E6W A;  2M1U A;  3OHM B;  3BQ3 A;  5HKY A;  1TUZ A;  2L5Y A;  2CXJ A;  1BOD A;  5KSZ A;  1RTP 1;  3SG7 A;  3DD4 A;  3CR2 A;  4F7F A;  3SG4 A;  5CSJ A;  3ICB A;  1J7R A;  1X02 A;  3CZ2 A;  3FE9 A;  2I94 A;  5FI2 A;  4YGC B;  1UHJ A;  1B9A A;  1RK9 A;  1SBJ A;  3BFB A;  3O4Y A;  1QV1 A;  4YGE B;  2LUC A;  4GBA A;  4CID A;  3D74 A;  3WXA A;  1CDP A;  3I5H B;  2JNX A;  3EK4 A;  2NLN A;  4OV2 A;  3DY9 A;  3R1V A;  5CSF A;  1B1G A;  2DOQ A;  3RLZ A;  1XK4 A;  2LE9 B;  2BKI B;  3I5H C;  1XFX O;  2QEO A;  2WND A;  3FIA A;  4I5N B;  1JBA A;  3D78 A;  1CB1 A;  1OE9 B;  1CM4 A;  1WRZ A;  1YRU B;  3IQQ A;  1QIW A;  1K95 A;  4OCI A;  4GFT A;  3FS7 A;  1C3Y A;  5AXI A;  1SYM A;  1SR6 B;  4UPG A;  1WDC B;  4OZD A;  2D8N A;  2LAP A;  1C3Z A;  1NX2 A;  2I2R E;  2ISD A;  1C7W A;  4GAO A;  1SR6 C;  1FBV A;  1WDC C;  2BE6 A;  2ZRS A;  3WHU B;  1TRF A;  3I5F B;  3BOW B;  4MZJ A;  1NX3 A;  1WRL A;  3I5G B;  1HQV A;  3D0Y B;  4ORB B;  2Y1N A;  4L9M A;  1YRT B;  1YVL A;  1HT9 A;  2CBL A;  1J7O A;  3DXL A;  1KFX L;  1TIZ A;  1E8A A;  3KPX A;  3I5G C;  2JXL A;  1B7T Y;  3O78 A;  2O60 A;  3UO9 A;  2LC5 A;  2K7D A;  2BL0 B;  1NP8 A;  2ZRT A;  4NQG A;  1LA3 A;  1WRK A;  2NZ0 A;  1SY9 A;  2JTZ A;  2JUL A;  2KBM A;  2Q91 A;  1KK7 Y;  4PE7 A;  1A29 A;  4YI8 A;  4DCK A;  1K2H A;  2LVK A;  3VRR A;  3SS5 A;  3QME A;  5K89 A;  5AER A;  1XFV O;  2BCX A;  1FPW A;  1GGZ A;  1T14 A;  1IWQ A;  1KFX S;  5ER5 A;  3S0B A;  3QRX A;  2KI4 B;  4WQ3 A;  3S0A A;  1RFJ A;  2KLD A;  4GGF A;  5I2Q A;  1BOC A;  3MSE B;  4CPV A;  2KI4 C;  2PYQ A;  1G8I A;  3LK1 A;  1CMF A;  1A75 B;  2EC6 C;  4E68 A;  5FI6 A;  1B47 A;  1OW4 A;  1CLM A;  4MSP A;  3S0G A;  1BR4 B;  1WY9 A;  1S6I A;  3PAT A;  1F4O A;  3S0E A;  4ZCU A;  1LS8 A;  4JQ0 D;  1F4Q A;  1PVA A;  5FI7 A;  2LUX A;  2QDI A;  3SIA A;  3VRQ A;  3SG6 A;  1V1F A;  1OOF A;  2ZN9 A;  1S5G Y;  2Y5I A;  2PAL A;  3DVK A;  3CYZ A;  1AP4 A;  1SKT A;  1L7Z A;  1DJZ A;  1RJV A;  1Y0V H;  3FWB A;  3NSK A;  1TNQ A;  2MLF C;  2WCK A;  3VRO A;  2L4I A;  3B86 A;  1CDN A;  1IH0 A;  1DTL A;  3HCM A;  2K2F A;  3PN7 B;  1K9K A;  3EKJ A;  1DT7 B;  1QTX A;  5DIC A;  1K96 A;  2FCE A;  1MQ1 A;  2L51 A;  3KF9 A;  1YUU A;  2K0J A;  3F45 A;  4MVF A;  3OGN A;  3PN7 C;  2Y1M A;  4HRH A;  5GQQ C;  3B7A A;  2FJU B;  1U5I A;  4I5L B;  2MAZ A;  1NPQ A;  4JD9 A;  1FF1 A;  3NSL A;  1ZMZ A;  2LAN A;  4GNK B;  4MRX A;  1WLZ A;  5DKN A;  2QPT A;  1UWO A;  2WOS A;  1M46 A;  2HET A;  1KWO C;  1G33 A;  1C07 A;  2MA2 A;  2LCP A;  3KO0 A;  1OMD A;  1B8L A;  2KI6 D;  2NCO A;  2L98 A;  2QAC A;  1DC1 A;  1BR1 B;  4CFR A;  3TDZ A;  1DEK A;  1QS7 A;  1GQM A;  1OOG A;  1YX7 A;  1KSO A;  2AMI A;  2R2I A;  1AJ4 A;  4MBE A;  2K8M B;  1TCF A;  3L47 A;  2PRU A;  2JOJ A;  2KYC A;  4GGN A;  4JKT A;  2E30 A;  4XJK A;  1K8U A;  2SCP A;  3E3R A;  1ALW A;  1CDL A;  1IKU A;  2KNE A;  2EGD A;  1DJW A;  3WHT B;  1N2D A;  1PRW A;  1YUR A;  3CR4 X;  4IL1 A;  1L2O B;  4IJ7 A;  1OZS A;  1YUS A;  1PAL A;  3UNW A;  5BPJ A;  3TZ1 A;  3K21 A;  4DRW A;  3NXA A;  4I5J A;  1IQ3 A;  3B88 A;  1C7V A;  4OVN F;  1JC2 A;  1L2O C;  3R72 A;  4M2Q A;  1JUO A;  1WLM A;  1BT6 A;  1CFD A;  1J55 A;  1ZOT B;  3KEV A;  2WCE A;  2BAP A;  2G2B A;  5D7F A;  5I8N A;  3B6X A;  3BXK A;  1EG3 A;  1QAT A;  4M2O A;  4YRU A;  4MLW A;  4FQO A;  4HRE E;  1M63 B;  1IQ5 A;  1JFK A;  1LA0 A;  1NUB A;  4FQT A;  3VGO A;  3R1O A;  2L50 A;  3O6B A;  1QVI Y;  3CWG A;  3GOF A;  1TCO B;  3I5I C;  2RGI A;  3IQO A;  1A4P A;  1SL9 A;  1VRK A;  2LLS A;  3O4X A;  2PSR A;  3OB1 B;  2F3Z A;  2LVI A;  2COL B;  4BY5 A;  4OKH A;  4P5O E;  3WNX B;  4NDB A;  2JXC A;  4PE4 A;  5HYD A;  2JT8 A;  3ZNI A;  1JSA A;  1ZFS A;  2WOR A;  3S0F A;  1XK4 C;  1SL7 A;  1MF8 B;  4M2P A;  1CFP A;  2YGU A;  2MLE C;  1GJY A;  1ODB A;  2BCB A;  3N7H A;  2HQ8 A;  3BUO B;  1KCY A;  2FCD A;  3DVM A;  4PHM A;  3SG5 A;  3PJI A;  1YX8 A;  1H4B A;  1TTX A;  3DF0 A;  1F55 A;  5I2L A;  1LIN A;  4INX A;  3NHI A;  2LVV A;  3CZ0 A;  1R6P A;  1OMR A;  1QJT A;  2KAV A;  2L2C A;  3BJH A;  4A4C A;  1XFZ O;  1B4C A;  4AQI A;  2GGM A;  1YTZ C;  2KGR A;  1QWV A;  3BFA A;  1UHH A;  1MXL C;  1RWY A;  5CSI A;  4BY4 A;  4PCW A;  1QXP A;  3TS5 C;  2K7C A;  4QJ3 B;  3R1P A;  3PM8 A;  5F6T A;  2F2O A;  1SW8 A;  2WCM A;  3ZWH A;  1F70 A;  1CDM A;  4GUK A;  2ZFD A;  3D73 A;  4TNC A;  3NSI A;  2JPO A;  3BUM B;  3V2L A;  5I94 A;  2KFF A;  5D69 A;  5DKQ A;  2I7A A;  2JU0 A;  2QEB A;  1BLQ A;  1DQE A;  2EC6 B;  5EL2 A;  1BU3 A;  1NCY A;  2PAS A;  1Q80 A;  3SS4 A;  4DS7 A;  3BYA A;  3EG5 B;  5HKZ A;  5J3X A;  1YVH A;  4YGA A;  1UUS A;  2NXQ A;  1ZAC A;  3OP0 A;  2QEH A;  3L4A A;  4WRI A;  2ZKM X;  2L5X B;  3H4S E;  1CMG A;  1AJ5 A;  4FTG A;  1H8B A;  2CT9 A;  2P71 A;  4MEW A;  1A2X A;  1W7J B;  2VRG A;  1XA5 A;  1SNL A;  1DVI A;  1K9U A;  1PSR A;  2MJW B;  2M3W A;  2Q4U A;  3JTD B;  2KOT A;  4GGF C;  3LK0 A;  5IBW A;  2H2K A;  2B1U A;  3FE6 A;  1F54 A;  1DJY A;  1TUJ A;  3JTD C;  2HF5 A;  1DJH A;  3OX5 A;  1XFU O;  3DVJ A;  3LL8 B;  1DF0 A;  3CAB A;  1XFW O;  5CPV A;  2H61 A;  3AKA A;  3Q8I A;  1REC A;  1IIO A;  1QLK A;  3BUX B;  2LM5 A;  1FW4 A;  1KWO B;  2LV7 A;  1MHO A;  3NGV A;  4PHJ A;  4YI9 A;  4QJ5 B;  2WC6 A;  2M1K B;  4PT1 A;  1MWN A;  2LMU A;  1B7T Z;  1TN4 A;  1Y1A A;  2JZI A;  3SS3 A;  1AK8 A;  1EJ3 A;  1Z2C B;  2BCA A;  2K7O A;  1XFR A;  2V53 A;  2M0R A;  3DYE A;  1J7Q A;  1CLB A;  1F71 A;  2FOT A;  4HRG A;  2JPT A;  1KK7 Z;  2L2E A;  3AAK A;  1N65 A;  2KFH A;  5CSN A;  5ER4 X;  3A8R A;  1QIV A;  2LP3 A;  1S6J A;  4WQ2 A;  2LNK A;  1SSE B;  1XFY O;  1KQV A;  3SG2 A;  1BF5 A;  1SPY A;  4JPZ B;  1GGW A;  2HPS A;  4GPL B;  1MR8 A;  2PQL A;  2JRF A;  2K60 A;  4PE1 A;  1CLL A;  2LLT A;  4N5X A;  1IG5 A;  2TN4 A;  1KSM A;  2OS8 B;  2K7B A;  2M8U A;  3CTN A;  5JJG A;  1Y6W A;  2K2A A;  1CKK A;  2OPO A;  1S6C A;  1IJ5 A;  4PDZ A;  3S0D A;  1NX0 A;  4ORC B;  4NDD A;  2LVJ A;  2OS8 C;  1TWO A;  1YR5 A;  2NCP A;  2F8P A;  2JT3 A;  4NDC A;  4PE0 A;  5TNC A;  3DVE A;  3SJS A;  2A4J A;  4JWQ A;  4R1E A;  4XJK B;  1S5G Z;  3VRN A;  3FWC A; 
#chains in the Genus database with same CATH homology
 2LHL A;  2O5G A;  1SCV A;  1IRJ A;  3AKB A;  3PSR A;  4N1G A;  5FYX A;  3RM1 A;  5KU1 A;  3LLE A;  1DMO A;  3TUY C;  1Y1U A;  3I5I B;  1ALV A;  1M45 A;  4ZCV A;  1XO5 A;  1EXR A;  2AUC A;  1NSH A;  2F33 A;  1XVJ A;  2F2P A;  1NCZ A;  3BUN B;  1K93 D;  5AEQ A;  2LHI A;  1XYD A;  1K94 A;  2M29 A;  1J1E A;  1QV0 A;  2KAY A;  5JOL A;  3EK8 A;  1J1D A;  2LLU A;  1AHR A;  3AAJ A;  3CR5 X;  1UP5 A;  4I5K A;  1B8R A;  1PSB A;  1OMV A;  5HLO A;  1DJG A;  1A03 A;  1JWD A;  1S3P A;  1PUL A;  1K90 D;  1YUT A;  1QX2 A;  1DJI A;  2BE4 A;  4C0K A;  4USL A;  3EKH A;  2M7L A;  3JVT B;  1NWD A;  3BUW B;  2KSP A;  3BOW A;  2I18 A;  1B8C A;  2CCM A;  1SRA A;  3D0Y A;  4ICB A;  4F0Z B;  1S1E A;  2ZND A;  3TS5 B;  4AQJ A;  2LMV A;  1QLS A;  1DGU A;  1CM1 A;  1N0Y A;  1W7I B;  3JVT C;  2M97 A;  4MN0 A;  3EVV A;  5PAL A;  2P6B B;  2Y4Q A;  5AFP A;  4ETO A;  3DF0 B;  2LP2 A;  3GK2 A;  1AVS A;  4MZK A;  1DJX A;  2JNF A;  1TOP A;  1V1G A;  3SIB A;  2IS9 A;  4HSZ A;  2KQ6 A;  1M39 A;  1D1O A;  1F71 A;  1KFU L;  2G9B A;  3NSO A;  4DIR A;  2L0P A;  3I5F C;  4YGB B;  1LXF C;  1UHN A;  1UHK A;  5G08 A;  3LCP C;  3CGA A;  1OQP A;  2JC2 A;  1MUX A;  5DKR A;  3OX6 A;  3KHE A;  1SCM B;  4QJ4 B;  1KK8 B;  2M9G A;  5B8I B;  1A75 A;  1KFU S;  2BL0 C;  5AAN A;  5I2O A;  2WCB A;  1NIW A;  1NYA A;  2M7N A;  4AOM A;  4DUQ A;  4D1E A;  3IF7 A;  3C1V A;  1SCM C;  3EVR A;  4OR9 B;  2BBN A;  1KK8 C;  5HKW A;  1QVI Z;  1R2U A;  2KDH A;  2PVB A;  3VRP A;  1CNP A;  3GK4 X;  1OOJ A;  2JT0 A;  1AUI B;  1QX5 B;  1TNX A;  2MBX A;  4C0L A;  1TNP A;  3O2P A;  1LVC D;  3GK1 A;  2AAO A;  1SMG A;  2GGZ A;  4MRY A;  1IJ6 A;  1MXE A;  2CNP A;  1S36 A;  1PVB A;  2LMT A;  1QAS A;  2WC8 A;  2JWW A;  3PFV A;  3PLF B;  1BMO A;  1CFC A;  3CLN A;  1NCX A;  3TDU A;  1F8H A;  4U8D A;  1BJF A;  1M31 A;  1TNW A;  2F3Y A;  2BBM A;  2ZNE A;  2L4H A;  1DGV A;  3HX4 A;  3TDI A;  4PHN A;  4ORA B;  1DF0 B;  1J7P A;  1FI5 A;  2MHH A;  1ZUZ A;  2HQW A;  1OZO A;  3M0W A;  4C0J A;  2PMY A;  1FI6 A;  1JF2 A;  2WCF A;  3A4U B;  1SL8 A;  3PAL A;  1JF0 A;  1U5I B;  1Y1X A;  4YGD B;  1CTR A;  2KHN A;  1PK0 D;  2H61 C;  1LKJ A;  1UUR A;  4N1F A;  4PAL A;  1RRO A;  4YBH B;  4Q04 A;  4P2Y B;  2JQ6 A;  2KQY A;  4CFQ A;  2MRD A;  3EVU A;  2M49 B;  2EHB A;  2BKH B;  3OB2 B;  5KTY A;  1NX1 A;  1JFJ A;  1KQM B;  2KAX A;  1IGV A;  2BEC A;  3D10 A;  1K9P A;  3CS1 A;  1BG1 A;  2KGB C;  3CZT X;  2GV5 A;  1KQM C;  2OTG B;  5HLV A;  3SG3 A;  2KFG A;  4MZL A;  2KI6 C;  1CFF A;  1QX7 A;  2SAS A;  2OTG C;  2KBI A;  2KYF A;  1EG4 A;  4PHK A;  1EL4 A;  3TUY B;  2K61 A;  2ZN8 A;  1G4Y R;  1S26 D;  4XYN A;  4A4B A;  4CLN A;  3EK7 A;  2CTN A;  1OSA A;  1SK6 D;  1EH2 A;  2JTT A;  1UHI A;  2E6W A;  2M1U A;  3OHM B;  3BQ3 A;  5HKY A;  2CXJ A;  1BOD A;  5KSZ A;  1RTP 1;  3SG7 A;  3DD4 A;  3CR2 A;  3SG4 A;  5CSJ A;  3ICB A;  1J7R A;  1X02 A;  2I94 A;  4YGC B;  1UHJ A;  1B9A A;  1RK9 A;  1SBJ A;  4CID A;  3O4Y A;  1QV1 A;  4YGE B;  2LUC A;  4GBA A;  3WXA A;  1CDP A;  3I5H B;  2JNX A;  3EK4 A;  2NLN A;  4OV2 A;  1B1G A;  5CSF A;  2DOQ A;  3RLZ A;  1XK4 A;  2LE9 B;  2BKI B;  3I5H C;  1XFX O;  2WND A;  3FIA A;  4I5N B;  1JBA A;  1CB1 A;  1OE9 B;  1CM4 A;  1WRZ A;  1YRU B;  3IQQ A;  1QIW A;  1K95 A;  4OCI A;  4GFT A;  3FS7 A;  5AXI A;  1SYM A;  1SR6 B;  4UPG A;  1WDC B;  2D8N A;  2LAP A;  1NX2 A;  2I2R E;  2ISD A;  1C7W A;  4GAO A;  1SR6 C;  1FBV A;  1WDC C;  2BE6 A;  2ZRS A;  3WHU B;  1TRF A;  3I5F B;  3BOW B;  4MZJ A;  1NX3 A;  1WRL A;  3I5G B;  1HQV A;  3D0Y B;  4ORB B;  2Y1N A;  4L9M A;  1YRT B;  1YVL A;  1HT9 A;  2CBL A;  1J7O A;  1KFX L;  1TIZ A;  1E8A A;  3KPX A;  3I5G C;  2JXL A;  1B7T Y;  3O78 A;  2O60 A;  2LC5 A;  2K7D A;  2BL0 B;  1NP8 A;  2ZRT A;  4NQG A;  1LA3 A;  1WRK A;  2NZ0 A;  1SY9 A;  2JTZ A;  2JUL A;  2KBM A;  2Q91 A;  1KK7 Y;  4PE7 A;  1A29 A;  4YI8 A;  4DCK A;  1K2H A;  2LVK A;  3VRR A;  5K89 A;  5AER A;  1XFV O;  2BCX A;  1FPW A;  1GGZ A;  1IWQ A;  1KFX S;  5ER5 A;  3QRX A;  2KI4 B;  4WQ3 A;  1RFJ A;  4GGF A;  5I2Q A;  1BOC A;  3MSE B;  4CPV A;  2KI4 C;  3LK1 A;  1G8I A;  1CMF A;  1A75 B;  2EC6 C;  4E68 A;  1B47 A;  1CLM A;  4MSP A;  1BR4 B;  1WY9 A;  1S6I A;  3PAT A;  1F4O A;  4ZCU A;  4JQ0 D;  1F4Q A;  1PVA A;  3VRQ A;  2LUX A;  3SIA A;  3SG6 A;  1V1F A;  2ZN9 A;  1S5G Y;  2Y5I A;  2PAL A;  3DVK A;  1AP4 A;  1SKT A;  1L7Z A;  1DJZ A;  1RJV A;  1Y0V H;  3FWB A;  3NSK A;  1TNQ A;  2MLF C;  3VRO A;  2L4I A;  1CDN A;  1IH0 A;  1DTL A;  3HCM A;  2K2F A;  3PN7 B;  1K9K A;  3EKJ A;  1DT7 B;  1QTX A;  1K96 A;  2FCE A;  1MQ1 A;  2L51 A;  3KF9 A;  1YUU A;  2K0J A;  3F45 A;  4MVF A;  3PN7 C;  2Y1M A;  4HRH A;  5GQQ C;  2FJU B;  1U5I A;  4I5L B;  2MAZ A;  1NPQ A;  1FF1 A;  3NSL A;  1ZMZ A;  2LAN A;  4GNK B;  4MRX A;  1WLZ A;  5DKN A;  2QPT A;  1UWO A;  2WOS A;  1M46 A;  2HET A;  1KWO C;  1G33 A;  1C07 A;  2MA2 A;  2LCP A;  3KO0 A;  1OMD A;  1B8L A;  2KI6 D;  2NCO A;  2L98 A;  2QAC A;  1BR1 B;  4CFR A;  3TDZ A;  1QS7 A;  1GQM A;  1YX7 A;  1KSO A;  2AMI A;  2R2I A;  1AJ4 A;  4MBE A;  2K8M B;  1TCF A;  2PRU A;  2JOJ A;  2KYC A;  4GGN A;  2E30 A;  4XJK A;  1K8U A;  2SCP A;  3E3R A;  1ALW A;  1CDL A;  1IKU A;  2KNE A;  2EGD A;  1DJW A;  3WHT B;  1N2D A;  1PRW A;  1YUR A;  3CR4 X;  4IL1 A;  1L2O B;  1OZS A;  1YUS A;  1PAL A;  5BPJ A;  3TZ1 A;  3K21 A;  4DRW A;  3NXA A;  4I5J A;  1IQ3 A;  1C7V A;  4OVN F;  1JC2 A;  1L2O C;  4M2Q A;  1JUO A;  1WLM A;  1BT6 A;  1CFD A;  1J55 A;  1ZOT B;  3KEV A;  2WCE A;  5I8N A;  2G2B A;  5D7F A;  3BXK A;  1EG3 A;  1QAT A;  4M2O A;  4YRU A;  4MLW A;  4FQO A;  4HRE E;  1M63 B;  1IQ5 A;  1JFK A;  1LA0 A;  1NUB A;  3VGO A;  2L50 A;  3O6B A;  1QVI Y;  3CWG A;  3GOF A;  1TCO B;  3I5I C;  2RGI A;  3IQO A;  1A4P A;  1SL9 A;  1VRK A;  2LLS A;  2PSR A;  3OB1 B;  2F3Z A;  2LVI A;  2COL B;  4BY5 A;  4OKH A;  4P5O E;  3WNX B;  4NDB A;  2JXC A;  4PE4 A;  5HYD A;  2JT8 A;  3ZNI A;  1JSA A;  1ZFS A;  2WOR A;  1XK4 C;  1SL7 A;  1MF8 B;  4M2P A;  1CFP A;  2MLE C;  2BCB A;  1GJY A;  1ODB A;  2HQ8 A;  3BUO B;  1KCY A;  2FCD A;  3DVM A;  4PHM A;  3SG5 A;  1H4B A;  1YX8 A;  1TTX A;  3DF0 A;  1F55 A;  5I2L A;  1LIN A;  2LVV A;  1R6P A;  1OMR A;  1QJT A;  2KAV A;  4A4C A;  1XFZ O;  1B4C A;  4AQI A;  2GGM A;  1YTZ C;  2KGR A;  1UHH A;  1MXL C;  1RWY A;  5CSI A;  4BY4 A;  4PCW A;  1QXP A;  3TS5 C;  2K7C A;  4QJ3 B;  5F6T A;  3PM8 A;  2F2O A;  1SW8 A;  3ZWH A;  1F70 A;  1CDM A;  4GUK A;  2ZFD A;  4TNC A;  3NSI A;  3BUM B;  1BLQ A;  2KFF A;  5D69 A;  5DKQ A;  2I7A A;  2JU0 A;  2EC6 B;  4DS7 A;  1BU3 A;  1NCY A;  2PAS A;  1Q80 A;  3BYA A;  5HKZ A;  5J3X A;  1YVH A;  4YGA A;  1UUS A;  2NXQ A;  1ZAC A;  3OP0 A;  4WRI A;  2ZKM X;  2L5X B;  3H4S E;  1CMG A;  1AJ5 A;  4FTG A;  1H8B A;  2CT9 A;  4MEW A;  1A2X A;  1W7J B;  2VRG A;  1XA5 A;  1SNL A;  1DVI A;  1K9U A;  1PSR A;  2MJW B;  2M3W A;  2Q4U A;  3JTD B;  2KOT A;  4GGF C;  3LK0 A;  5IBW A;  2H2K A;  2B1U A;  1F54 A;  1DJY A;  3JTD C;  2HF5 A;  1DJH A;  3OX5 A;  1XFU O;  3DVJ A;  3LL8 B;  1DF0 A;  1XFW O;  5CPV A;  2H61 A;  3AKA A;  1REC A;  1QLK A;  3BUX B;  2LM5 A;  1FW4 A;  1KWO B;  2LV7 A;  1MHO A;  4PHJ A;  4YI9 A;  4QJ5 B;  2M1K B;  1MWN A;  2LMU A;  1B7T Z;  1TN4 A;  1Y1A A;  2JZI A;  1AK8 A;  1EJ3 A;  2BCA A;  2K7O A;  2V53 A;  2M0R A;  1CLB A;  1J7Q A;  2FOT A;  4HRG A;  2JPT A;  1KK7 Z;  2L2E A;  3AAK A;  1N65 A;  2KFH A;  5CSN A;  5ER4 X;  3A8R A;  1QIV A;  2LP3 A;  1S6J A;  4WQ2 A;  2LNK A;  1XFY O;  1KQV A;  3SG2 A;  1BF5 A;  1SPY A;  4JPZ B;  1GGW A;  2HPS A;  4GPL B;  1MR8 A;  2JRF A;  4PE1 A;  1CLL A;  2LLT A;  4N5X A;  1IG5 A;  2TN4 A;  1KSM A;  2OS8 B;  2K7B A;  2M8U A;  3CTN A;  5JJG A;  1Y6W A;  2K2A A;  1CKK A;  2OPO A;  1S6C A;  1IJ5 A;  4PDZ A;  1NX0 A;  4ORC B;  4NDD A;  2LVJ A;  2OS8 C;  1YR5 A;  2NCP A;  2F8P A;  2JT3 A;  4NDC A;  4PE0 A;  5TNC A;  3DVE A;  3SJS A;  2A4J A;  4JWQ A;  4R1E A;  4XJK B;  1S5G Z;  3VRN A;  3FWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...