2KBMA

Ca-s100a1 interacting with trtk12
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-2
publication title Solution structure of Ca-S100A1-TRTK12
rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 21
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kbmA00
3LLEA 2CBLA 1B1GA 1JUOA 1AUIB 2EC6B 3CTNA 1JFKA 1B7TY 2BL0C 2HQWA 4MSPA 2NCPA 2LMTA 2JQ6A 2O5GA 1K90D 2NZ0A 2JOJA 1JBAA 1WRKA 1K96A 2MRDA 4QJ5B 4P5OE 4PE0A 1V1FA 3E3RA 4PCWA 5AFPA 3M0WA 1J7OA 1L7ZA 1DTLA 1YVLA 5F6TA 1LA3A 1J55A 2WNDA 1TNPA 1C07A 2KAXA 4DCKA 3TDZA 3PN7B 1SMGA 3CS1A 1K93D 1MQ1A 1K2HA 3EVRA 1XYDA 1GGZA 1SCMC 1Y0VH 1NIWA 1DJHA 2OTGB 3RM1A 1XFVO 1RECA 3AAJA 3PLFB 1RROA 2F2OA 1YURA 2ZFDA 1AJ5A 4I5JA 1SR6C 4YI8A 1BLQA 2L98A 1CTRA 4JQ0D 4XJKB 2K7CA 4GAOA 1IJ6A 1PSRA 1QXPA 1KK8B 2EC6C 1OE9B 1A29A 2ISDA 1SCVA 3HCMA 2ZNEA 3GK4X 2VRGA 1AK8A 1MR8A 3VRPA 4AOMA 4YGCB 3SG4A 1K9PA 2K7BA 3H4SE 2I94A 3BXKA 1RTP1 1ODBA 4WRIA 3I5GB 3BOWB 2JWWA 4YGDB 4C0JA 2P6BB 2DOQA 1S3PA 1B7TZ 1PVAA 3BUMB 4OCIA 3TUYB 2I2RE 2OTGC 5HYDA 1BR4B 4PHNA 1YR5A 2KSPA 4YI9A 1HQVA 2JRFA 5BPJA 1GQMA 3ZNIA 1DJGA 2JXLA 2M1KB 1JWDA 1M39A 3FS7A 4Q04A 2BE6A 2LHIA 1CDPA 1K94A 1RFJA 1KK8C 2L5XB 3O78A 4DUQA 1Q80A 5KSZA 2LNKA 2ZN8A 1UHJA 1SW8A 2NLNA 2KGRA 2M7LA 1J7PA 2QACA 3A8RA 2F3YA 2JZIA 2A4JA 1SL7A 1QVIY 1Y6WA 4PHMA 1QATA 3AKBA 1N2DA 2O60A 3OP0A 4CFRA 1BR1B 2FJUB 2R2IA 3I5GC 1QV1A 3ICBA 5I8NA 1OZOA 1YX8A 3D0YB 2K7DA 5CPVA 1FF1A 1M46A 1YUSA 1MF8B 1QTXA 2L51A 3K21A 1TN4A 3TUYC 1TOPA 2LHLA 1SBJA 3DVJA 1NP8A 1ALVA 3CGAA 1ZOTB 3BUWB 4P2YB 1PRWA 3CLNA 1CMFA 1M31A 2PSRA 1OMDA 1BMOA 4YBHB 2KGBC 2CT9A 4CLNA 1MHOA 2K0JA 1G8IA 3A4UB 4MZLA 1RJVA 3I5IB 1R6PA 1SL9A 3LK1A 1UUSA 1CM4A 1V1GA 4WQ3A 1NPQA 3DVEA 4OVNF 1IQ5A 2CCMA 4FQOA 4PDZA 1KCYA 1DJZA 1A03A 1UHNA 3CR5X 2JU0A 2F33A 1U5IA 1FI6A 2LLUA 1HT9A 3PM8A 4NDDA 2KQ6A 1NCZA 5PALA 1S26D 3DF0A 1QVIZ 2BCAA 3VRNA 4E68A 3QRXA 2K8MB 2AMIA 2KFFA 2KYFA 1XK4C 4ORBB 3SIBA 1BG1A 1QV0A 1WLMA 1TIZA 1G33A 4I5NB 1IRJA 2F8PA 4WQ2A 1UHIA 1BT6A 2HF5A 2LUCA 2LMVA 3IQQA 1GJYA 3I5IC 1Y1AA 1DGUA 4TNCA 3NSOA 1F71A 1SL8A 2B1UA 1DJXA 5IBWA 1A75A 3CZTX 1E8AA 2ZKMX 1NSHA 2KQYA 1F4OA 1LA0A 4UPGA 1DJWA 1TCFA 1LINA 2KAYA 3SJSA 1LVCD 2L0PA 1S6CA 2FOTA 2KOTA 1QS7A 4PE4A 4QJ4B 2HPSA 1FBVA 2JT3A 2L2EA 1FW4A 3RLZA 3F45A 1TNXA 5AERA 2M0RA 2L50A 1SPYA 4NDBA 1ZUZA 4ORCB 1C7WA 4GBAA 3LL8B 2K7OA 2BE4A 3CR2A 1EJ3A 3TDIA 2F3ZA 4I5LB 1WDCB 2KBIA 1EH2A 1WRLA 1WRZA 1BU3A 1F8HA 1KQVA 1XFYO 5I2QA 1XFZO 1YUTA 2LP3A 1DGVA 4XYNA 1XFXO 5I2LA 1H8BA 4PE7A 3PALA 3WHUB 2MJWB 2KBMA 5CSNA 1CDNA 2RGIA 1FI5A 4OV2A 1OQPA 1JSAA 1JF2A 2M9GA 1YRUB 1QIWA 1TTXA 3SG6A 1YUUA 4MRXA 3OB1B 1IGVA 2BECA 1N0YA 2Y4QA 1CMGA 4DRWA 3OX5A 1BOCA 1KQMB 1DJYA 1W7IB 2KI4B 1K8UA 1B8RA 1CNPA 2K2AA 4CIDA 5D69A 1MXEA 2GV5A 2E6WA 2PASA 3DVKA 2COLB 2KFGA 1F70A 3DD4A 5D7FA 1NX3A 1BODA 1FPWA 2Q4UA 1TCOB 1NX1A 1KK7Y 2BBMA 4IL1A 2SASA 1JF0A 1B8CA 2Y1NA 1OOJA 3VGOA 1DT7B 1WDCC 4GGFA 3EKHA 1YX7A 2NXQA 1UHKA 3SG3A 4ETOA 2I18A 2H61A 3EKJA 5HKYA 1L2OB 2H2KA 5GQQC 1CFFA 4MEWA 1SRAA 1UWOA 1S1EA 3OB2B 5AXIA 2NCOA 3IQOA 3VRQA 1QJTA 4M2OA 1ZMZA 3I5HB 2F2PA 4HREE 1KWOC 1B47A 1R2UA 1PVBA 1AVSA 2JC2A 1KQMC 2Y5IA 3BUOB 2KI4C 2ZNDA 2CNPA 2KNEA 1CFCA 1QLKA 3PSRA 4HRHA 3BQ3A 4M2PA 4YRUA 1LXFC 1UP5A 1QX7A 4A4CA 5K89A 2EHBA 3JVTB 2LANA 3KHEA 2M8UA 1CFPA 3ZWHA 1KFXL 2G9BA 2I7AA 3SIAA 4DS7A 1IH0A 1DF0A 5TNCA 2LVJA 2MHHA 2FCEA 1PALA 2IS9A 1CB1A 5J3XA 1TRFA 1AJ4A 3VROA 3NSIA 4CPVA 5KTYA 1CLBA 5G08A 1ZFSA 1RK9A 5ER4X 1L2OC 1KSOA 4QJ3B 2KI6D 1KK7Z 3EVUA 2M1UA 1K95A 1QLSA 3I5HC 5AANA 4R1EA 1G4YR 4JWQA 4ZCVA 1UURA 1Y1UA 2ZN9A 3GOFA 1PK0D 1KFUL 2BKHB 2QPTA 1W7JB 2JT0A 4PE1A 1AP4A 5DKRA 1IQ3A 1C7VA 1MUXA 4N1GA 1CDLA 2PRUA 4BY4A 4D1EA 2PVBA 3JVTC 1OMVA 3NSKA 4JPZB 4L9MA 5AEQA 1CLMA 4MN0A 2LAPA 1IKUA 1EG3A 2BKIB 2OS8C 1GGWA 2LUXA 1SK6D 1CLLA 4USLA 2Q91A 1U5IB 3O6BA 1YTZC 3I5FB 3MSEB 3KF9A 2BCXA 4AQIA 1NUBA 4YGAA 5CSIA 1OMRA 2HQ8A 1SYMA 3DF0B 1SNLA 4YGBB 1SKTA 1RWYA 1F55A 1QX2A 3FIAA 3FWBA 1S36A 3O2PA 1NX2A 3PFVA 1DJIA 1CM1A 1K9UA 4ICBA 5HKZA 1PSBA 2E30A 4XJKA 3EK7A 4A4BA 3TDUA 3AKAA 2OPOA 4PHJA 2JT8A 2KYCA 1J1DA 2M49B 2LV7A 1S5GY 1PULA 2L4IA 2LVVA 2MBXA 2JULA 4BY5A 2MLFC 2JTTA 2PALA 4MZKA 1A75B 1M63B 3CR4X 1X02A 2AUCA 3TS5B 1XFUO 3BOWA 3SG2A 3D10A 4N5XA 2BBNA 2M29A 3I5FC 1H4BA 2EGDA 3NXAA 4C0LA 1NWDA 1AHRA 5DKNA 1KWOB 4OR9B 2SCPA 1J7RA 1YRTB 1QASA 2LP2A 1N65A 5HLOA 2K61A 3OHMB 1K9KA 4AQJA 3KEVA 1KFXS 4GFTA 1J7QA 3WNXB 1OZSA 5JJGA 3DVMA 2GGMA 1Y1XA 3WHTB 4GPLB 2KI6C 1QX5B 4NQGA 2MLEC 2BCBA 4M2QA 5ER5A 1ZACA 3PATA 3SG5A 4F0ZB 2M7NA 2CTNA 3BUNB 1ALWA 1XA5A 2WCBA 1F54A 2JTZA 3PN7C 2JXCA 4MVFA 1JFJA 5KU1A 1J1EA 3HX4A 1KSMA 3TS5C 2LMUA 1MWNA 3AAKA 1NCXA 1WLZA 2FCDA 1EXRA 1B9AA 1NX0A 2LC5A 1YVHA 3D0YA 4CFQA 3TZ1A 1NYAA 2WC8A 1KFUS 1F4QA 1CFDA 2M97A 2Y1MA 4PHKA 1BJFA 4YGEB 1S5GZ 3CWGA 1LKJA 4PALA 1IG5A 2KFHA 2L4HA 2PMYA 5I2OA 1JC2A 2MAZA 1D1OA 2WORA 1DMOA 4C0KA 2LE9B 3IF7A 4DIRA 4ORAB 4GGNA 1DVIA 4GNKB 1XK4A 2LCPA 1TNWA 2KDHA 3EVVA 1XVJA 3FWCA 3GK2A 3GK1A 3EK4A 4NDCA 2M3WA 3VRRA 1MXLC 3JTDB 2TN4A 1IJ5A 3KPXA 2LM5A 2LVKA 4U8DA 2GGZA 2KAVA 4HSZA 2OS8B 2JNFA 2G2BA 2JPTA 1A2XA 3LCPC 5HKWA 2JNXA 3LK0A 3EK8A 2LLTA 1XFWO 2MA2A 2K2FA 2KHNA 5FYXA 1SY9A 1OSAA 2V53A 1B4CA 4OKHA 1VRKA 2ZRTA 5CSJA 2WCEA 2BL0B 5JOLA 4MZJA 3BYAA 2HETA 2LLSA 1B8LA 1UHHA 1XO5A 4MLWA 2AAOA 1S6JA 2WCFA 3WXAA 3OX6A 4FTGA 1QIVA 4HRGA 5B8IB 1BF5A 4ZCUA 1WY9A 1DF0B 1EG4A 4GGFC 1EL4A 1IWQA 4MRYA 4I5KA 1A4PA 2WOSA 2CXJA 3JTDC 3SG7A 3BUXB 4N1FA 2H61C 2ZRSA 1M45A 4MBEA 3NSLA 5HLVA 1SCMB 5DKQA 2LVIA 4GUKA 3KO0A 5CSFA 2D8NA 3C1VA 1NCYA 1S6IA 1SR6B 3O4YA 1CKKA 1TNQA 1CDMA
chains in the Genus database with same CATH superfamily
3LLEA 2CBLA 1B1GA 1JUOA 1AUIB 2EC6B 3CTNA 3QMEA 1JFKA 1B7TY 2BL0C 2HQWA 3BFBA 2NCPA 2LMTA 4MSPA 2JQ6A 2O5GA 1K90D 3R1OA 2NZ0A 2JOJA 1JBAA 1WRKA 1K96A 2MRDA 4QJ5B 4P5OE 4PE0A 1V1FA 3E3RA 4PCWA 5AFPA 3M0WA 1J7OA 1L7ZA 1DTLA 1YVLA 5F6TA 1LA3A 1J55A 2WNDA 1TNPA 1C07A 2KAXA 4DCKA 3TDZA 3PN7B 1SMGA 3BFAA 3CS1A 1K93D 1MQ1A 1K2HA 3EVRA 1XYDA 1TUZA 1GGZA 1SCMC 2BNXA 1Y0VH 1NIWA 1DJHA 2OTGB 3RM1A 3CYZA 1XFVO 1RECA 3AAJA 3PLFB 1RROA 2F2OA 1YURA 2ZFDA 1AJ5A 2PYQA 4I5JA 1SR6C 4YI8A 1BLQA 2L98A 1CTRA 4JQ0D 4XJKB 2K7CA 4GAOA 1IJ6A 1PSRA 1QXPA 1KK8B 2EC6C 2WC6A 1OE9B 1A29A 2ISDA 1SCVA 3HCMA 2ZNEA 2KPHA 3GK4X 2VRGA 1AK8A 1MR8A 3VRPA 4AOMA 4YGCB 3SG4A 1K9PA 2K7BA 3H4SE 3V2LA 2I94A 3BXKA 1RTP1 1ODBA 4WRIA 2QDIA 3BOWB 3I5GB 3SS3A 2JWWA 4YGDB 4C0JA 2P6BB 2DOQA 4F7FA 1S3PA 1B7TZ 1PVAA 3BUMB 3B7AA 4OCIA 3TUYB 2I2RE 2OTGC 5HYDA 1BR4B 4PHNA 1YR5A 2KSPA 4YI9A 1HQVA 2JRFA 5BPJA 1GQMA 1OOIX 3ZNIA 1DJGA 2JXLA 1C3YA 2M1KB 1JWDA 1M39A 3S0GA 3FS7A 4Q04A 2BE6A 2LHIA 1CDPA 1K94A 1RFJA 1KK8C 2L5XB 3O78A 4DUQA 1Q80A 5KSZA 2LNKA 2ZN8A 1UHJA 1SW8A 2NLNA 2KGRA 2M7LA 1J7PA 2QACA 3A8RA 3CZ1A 2F3YA 2JZIA 2A4JA 1Z4HA 1SL7A 1QVIY 1Y6WA 4PHMA 1QATA 3AKBA 1N2DA 2O60A 3OP0A 4CFRA 1BR1B 2FJUB 2JPOA 2R2IA 3I5GC 1OOHA 1QV1A 3DYEA 3ICBA 5I8NA 1OZOA 1YX8A 3D0YB 2K7DA 5CPVA 1FF1A 1M46A 1YUSA 1MF8B 1QTXA 2L51A 2K60A 1TN4A 3K21A 3NGVA 3TUYC 1TOPA 3UO9A 2LHLA 1SBJA 1IIOA 3DVJA 1NP8A 1ALVA 3CGAA 1ZOTB 3BUWB 4P2YB 1PRWA 3CLNA 1CMFA 1M31A 2PSRA 1OMDA 1BMOA 4YBHB 2KGBC 3SS5A 3O4XA 2CT9A 4CLNA 1MHOA 2K0JA 1G8IA 3A4UB 3DZTA 4MZLA 1RJVA 3I5IB 1R6PA 1SL9A 3LK1A 1UUSA 1CM4A 3R72A 1V1GA 4WQ3A 1NPQA 3D76A 3DVEA 4OVNF 1IQ5A 2CCMA 1XFRA 4FQOA 4PDZA 1KCYA 1DJZA 1A03A 1UHNA 3CR5X 2JU0A 2F33A 1U5IA 1FI6A 2LLUA 1HT9A 3PM8A 4NDDA 2KQ6A 3R1VA 1NCZA 5PALA 1S26D 3DF0A 1QVIZ 2BCAA 3VRNA 4E68A 3SS4A 3QRXA 2K8MB 2AMIA 2KFFA 2KYFA 1XK4C 4ORBB 3SIBA 1BG1A 1QV0A 1WLMA 1TIZA 1DQEA 3S0FA 1G33A 4I5NB 1DC1A 1IRJA 2F8PA 4WQ2A 1UHIA 1BT6A 2HF5A 2LUCA 2WCMA 3BJHA 3RZSA 2LMVA 3IQQA 1GJYA 3I5IC 1Y1AA 1DGUA 4TNCA 3NSOA 1F71A 1DEKA 1SL8A 2B1UA 1DJXA 5IBWA 1A75A 3CZTX 1E8AA 2ZKMX 1NSHA 2KQYA 1F4OA 1LA0A 4UPGA 1DJWA 1TCFA 1LINA 2KAYA 3SJSA 1LVCD 2L0PA 1S6CA 2FOTA 2KOTA 1QS7A 4PE4A 4QJ4B 2HPSA 5HL1A 3S0EA 1FBVA 2JT3A 2L2EA 1FW4A 3RLZA 3K1EA 3F45A 1TNXA 5AERA 2M0RA 2L50A 1SPYA 4NDBA 1ZUZA 4ORCB 1C7WA 4GBAA 3LL8B 2K7OA 3L47A 2BE4A 2WCJA 3CR2A 1EJ3A 3TDIA 2F3ZA 2KLDA 4I5LB 1WDCB 2KBIA 1EH2A 1WRLA 1WRZA 1BU3A 1F8HA 1KQVA 1XFYO 5I2QA 1XFZO 1YUTA 2LP3A 1DGVA 4XYNA 1XFXO 5I2LA 1H8BA 3B88A 3PALA 4PE7A 2MJWB 2KBMA 5CSNA 3WHUB 2RGIA 1CDNA 1FI5A 4OV2A 1OQPA 1JSAA 1JF2A 2M9GA 1YRUB 2QEOA 1QIWA 1TTXA 3SG6A 1YUUA 3D73A 4MRXA 5DICA 3OB1B 2H8VA 1IGVA 2BECA 1N0YA 2Y4QA 1CMGA 4DRWA 3OX5A 1BOCA 1KQMB 1DJYA 1W7IB 2KI4B 1K8UA 1B8RA 3EG5B 3PJIA 4JKTA 1CNPA 2K2AA 4CIDA 5D69A 1MXEA 2GV5A 2E6WA 2PASA 3DVKA 2COLB 2KFGA 1F70A 3DD4A 5D7FA 1NX3A 1BODA 1FPWA 2Q4UA 1TCOB 1Z2CB 1NX1A 1KK7Y 2BBMA 4IL1A 2SASA 1JF0A 1B8CA 2Y1NA 1OOJA 3VGOA 5FI7A 1DT7B 1WDCC 4GGFA 3EKHA 1YX7A 2NXQA 1UHKA 3SG3A 4ETOA 2I18A 2H61A 3EKJA 5HKYA 1L2OB 2H2KA 5GQQC 1CFFA 4MEWA 1SRAA 1UWOA 1S1EA 3DY9A 1W9ZA 2NCOA 3IQOA 3N7HA 3OB2B 5AXIA 3VRQA 1QJTA 4M2OA 1ZMZA 3I5HB 2F2PA 4HREE 1KWOC 1B47A 1R2UA 1PVBA 1AVSA 2JC2A 1KQMC 2Y5IA 3BUOB 2KI4C 2ZNDA 2CNPA 4INWA 2KNEA 1CFCA 1QLKA 3PSRA 3CZ0A 4HRHA 3BQ3A 4M2PA 4YRUA 1LXFC 1UP5A 1QX7A 4A4CA 5K89A 2EHBA 3JVTB 2LANA 3KHEA 2M8UA 5FI6A 1CFPA 3ZWHA 2BAPA 1KFXL 2G9BA 2I7AA 3SIAA 4DS7A 1IH0A 1DF0A 5TNCA 2LVJA 3DXLA 2MHHA 2FCEA 1PALA 2IS9A 1CB1A 5J3XA 1TRFA 1AJ4A 3VROA 3NSIA 4CPVA 1TUJA 3IVTA 5G08A 5KTYA 1ZFSA 1RK9A 5ER4X 1CLBA 1L2OC 1KSOA 4QJ3B 2KI6D 2L5YA 1KK7Z 3D78A 3EVUA 2M1UA 1K95A 1QLSA 3I5HC 4YGEB 5AANA 2KLEA 4R1EA 2L2CA 1G4YR 4JWQA 4ZCVA 1ORGA 1UURA 1Y1UA 2ZN9A 3GOFA 1PK0D 1KFUL 2BKHB 2QPTA 1W7JB 2JT0A 4PE1A 1AP4A 5DKRA 1IQ3A 1C7VA 1MUXA 4N1GA 3L4AA 1P28A 1CDLA 1SSEB 5D3OA 2PRUA 4BY4A 4D1EA 2PVBA 3JVTC 1OMVA 3NSKA 1C3ZA 2WCLA 4JPZB 4L9MA 5AEQA 1CLMA 4MN0A 2LAPA 1IKUA 3CDNA 1EG3A 4JD9A 2BKIB 2OS8C 1GGWA 2LUXA 1SK6D 1CLLA 4USLA 1DELA 1U5IB 2Q91A 3O6BA 1YTZC 3I5FB 3MSEB 5I94A 3KF9A 2BCXA 4AQIA 1NUBA 4YGAA 5CSIA 3S0AA 1OMRA 2HQ8A 1SYMA 3DF0B 3L4LA 1SNLA 1OW4A 4YGBB 1SKTA 1RWYA 1F55A 1QX2A 3FIAA 3FWBA 1S36A 1OOGA 3O2PA 1NX2A 3PFVA 1DJIA 1CM1A 1K9UA 4ICBA 5HKZA 1PSBA 2E30A 4XJKA 4OZDA 3EK7A 2YGUA 4A4BA 3TDUA 3AKAA 2OPOA 4PHJA 3S0BA 2JT8A 3CABA 2KYCA 1J1DA 2M49B 1TWOA 2LV7A 1S5GY 1PULA 2L4IA 2LVVA 2P71A 2MBXA 2JULA 4BY5A 2MLFC 2JTTA 2PALA 4MZKA 1A75B 1M63B 3CR4X 1X02A 2AUCA 3TS5B 1XFUO 3BOWA 3SG2A 3D10A 4N5XA 2BBNA 2M29A 3I5FC 1H4BA 2EGDA 3NXAA 4C0LA 1NWDA 1AHRA 5DKNA 2QEHA 1KWOB 2WCHA 4OR9B 2SCPA 1J7RA 1YRTB 1QASA 2LP2A 1N65A 2WCKA 5HLOA 2K61A 3OHMB 1K9KA 4AQJA 3KEVA 1KFXS 4GFTA 1J7QA 3WNXB 1OZSA 5JJGA 3DVMA 4INXA 2P70A 2GGMA 1Y1XA 3WHTB 4GPLB 2KI6C 1QX5B 4NQGA 2MLEC 2BCBA 4M2QA 5ER5A 1ZACA 3PATA 3SG5A 4F0ZB 2M7NA 2CTNA 3BUNB 3PM2A 1ALWA 1XA5A 2WCBA 1F54A 2JTZA 3PN7C 2JXCA 4MVFA 1JFJA 5KU1A 1OOFA 3D77A 1J1EA 3HX4A 3D75A 1KSMA 1GM0A 3TS5C 2LMUA 1MWNA 2QEVA 3AAKA 1NCXA 1WLZA 2FCDA 3B6XA 1EXRA 1B9AA 1NX0A 2LC5A 3FE6A 1YVHA 3D0YA 4CFQA 3TZ1A 1NYAA 2WC8A 1KFUS 1F4QA 1CFDA 2M97A 2Y1MA 3FE9A 1BJFA 3B86A 3B87A 3OGNA 4PHKA 3S0DA 1S5GZ 3CWGA 3NHIA 1LKJA 4PALA 1IG5A 2FJYA 2KFHA 2L4HA 2PMYA 3FE8A 5I2OA 2PQLA 2MAZA 1D1OA 1JC2A 2WORA 1DMOA 3BFHA 4C0KA 2LE9B 3IF7A 4DIRA 4ORAB 4GGNA 1DVIA 3OBVA 4GNKB 1XK4A 2LCPA 1TNWA 2KDHA 3EVVA 1XVJA 3FWCA 3GK2A 3GK1A 3EK4A 4NDCA 2M3WA 3VRRA 1MXLC 3JTDB 5EL2A 4KYNA 2TN4A 1IJ5A 3KPXA 2LM5A 2LVKA 4U8DA 2GGZA 2KAVA 4HSZA 3CZ2A 2OS8B 2WC5A 2JNFA 2G2BA 2JPTA 1A2XA 3LCPC 5HKWA 2JNXA 3LK0A 3EK8A 2LLTA 1XFWO 2MA2A 2K2FA 2KHNA 5FYXA 1SY9A 1OSAA 2V53A 1B4CA 3R1PA 1QWVA 4OKHA 1VRKA 2ZRTA 2ERBA 5CSJA 2WCEA 1T14A 1LS8A 2BL0B 5JOLA 4MZJA 2GTEA 3BYAA 2HETA 2LLSA 1B8LA 1UHHA 1XO5A 4MLWA 2AAOA 1S6JA 2WCFA 4PT1A 3OX6A 4FTGA 1QIVA 4HRGA 3WXAA 5B8IB 1BF5A 4ZCUA 1WY9A 1DF0B 1EG4A 4GGFC 1EL4A 1IWQA 4MRYA 4I5KA 1A4PA 2WOSA 2CXJA 3JTDC 3SG7A 3BUXB 4N1FA 2H61C 3Q8IA 2ZRSA 1M45A 4MBEA 3NSLA 5HLVA 2QEBA 1SCMB 5DKQA 5FI2A 2LVIA 3D74A 4GUKA 3KO0A 3NHTA 5CSFA 2D8NA 3C1VA 1NCYA 4IJ7A 1S6IA 3UNWA 1SR6B 3O4YA 1CKKA 3VB1A 4FQTA 1TNQA 1CDMA
chains in the Genus database with same CATH topology
3LLEA 2CBLA 1B1GA 1JUOA 1AUIB 2EC6B 3CTNA 1JFKA 1B7TY 2BL0C 2HQWA 4MSPA 2NCPA 2LMTA 2JQ6A 2O5GA 1K90D 2NZ0A 2JOJA 1JBAA 1WRKA 1K96A 2MRDA 4QJ5B 4P5OE 4PE0A 1V1FA 3E3RA 4PCWA 5AFPA 3M0WA 1J7OA 1L7ZA 1DTLA 1YVLA 5F6TA 1LA3A 1J55A 2WNDA 1TNPA 1C07A 2KAXA 4DCKA 3TDZA 3PN7B 1SMGA 3CS1A 1K93D 1MQ1A 1K2HA 3EVRA 1XYDA 1GGZA 1SCMC 1Y0VH 1NIWA 1DJHA 2OTGB 3RM1A 1XFVO 1RECA 3AAJA 3PLFB 1RROA 2F2OA 1YURA 2ZFDA 1AJ5A 4I5JA 1SR6C 4YI8A 1BLQA 2L98A 1CTRA 4JQ0D 4XJKB 2K7CA 4GAOA 1IJ6A 1PSRA 1QXPA 1KK8B 2EC6C 1OE9B 1A29A 2ISDA 1SCVA 3HCMA 2ZNEA 3GK4X 2VRGA 1AK8A 1MR8A 3VRPA 4AOMA 4YGCB 3SG4A 1K9PA 2K7BA 3H4SE 2I94A 3BXKA 1RTP1 1ODBA 4WRIA 3I5GB 3BOWB 2JWWA 4YGDB 4C0JA 2P6BB 2DOQA 1S3PA 1B7TZ 1PVAA 3BUMB 4OCIA 3TUYB 2I2RE 2OTGC 5HYDA 1BR4B 4PHNA 1YR5A 2KSPA 4YI9A 1HQVA 2JRFA 5BPJA 1GQMA 3ZNIA 1DJGA 2JXLA 2M1KB 1JWDA 1M39A 3FS7A 4Q04A 2BE6A 2LHIA 1CDPA 1K94A 1RFJA 1KK8C 2L5XB 3O78A 4DUQA 1Q80A 5KSZA 2LNKA 2ZN8A 1UHJA 1SW8A 2NLNA 2KGRA 2M7LA 1J7PA 2QACA 3A8RA 2F3YA 2JZIA 2A4JA 1SL7A 1QVIY 1Y6WA 4PHMA 1QATA 3AKBA 1N2DA 2O60A 3OP0A 4CFRA 1BR1B 2FJUB 2R2IA 3I5GC 1QV1A 3ICBA 5I8NA 1OZOA 1YX8A 3D0YB 2K7DA 5CPVA 1FF1A 1M46A 1YUSA 1MF8B 1QTXA 2L51A 3K21A 1TN4A 3TUYC 1TOPA 2LHLA 1SBJA 3DVJA 1NP8A 1ALVA 3CGAA 1ZOTB 3BUWB 4P2YB 1PRWA 3CLNA 1CMFA 1M31A 2PSRA 1OMDA 1BMOA 4YBHB 2KGBC 2CT9A 4CLNA 1MHOA 2K0JA 1G8IA 3A4UB 4MZLA 1RJVA 3I5IB 1R6PA 1SL9A 3LK1A 1UUSA 1CM4A 1V1GA 4WQ3A 1NPQA 3DVEA 4OVNF 1IQ5A 2CCMA 4FQOA 4PDZA 1KCYA 1DJZA 1A03A 1UHNA 3CR5X 2JU0A 2F33A 1U5IA 1FI6A 2LLUA 1HT9A 3PM8A 4NDDA 2KQ6A 1NCZA 5PALA 1S26D 3DF0A 1QVIZ 2BCAA 3VRNA 4E68A 3QRXA 2K8MB 2AMIA 2KFFA 2KYFA 1XK4C 4ORBB 3SIBA 1BG1A 1QV0A 1WLMA 1TIZA 1G33A 4I5NB 1IRJA 2F8PA 4WQ2A 1UHIA 1BT6A 2HF5A 2LUCA 2LMVA 3IQQA 1GJYA 3I5IC 1Y1AA 1DGUA 4TNCA 3NSOA 1F71A 1SL8A 2B1UA 1DJXA 5IBWA 1A75A 3CZTX 1E8AA 2ZKMX 1NSHA 2KQYA 1F4OA 1LA0A 4UPGA 1DJWA 1TCFA 1LINA 2KAYA 3SJSA 1LVCD 2L0PA 1S6CA 2FOTA 2KOTA 1QS7A 4PE4A 4QJ4B 2HPSA 1FBVA 2JT3A 2L2EA 1FW4A 3RLZA 3F45A 1TNXA 5AERA 2M0RA 2L50A 1SPYA 4NDBA 1ZUZA 4ORCB 1C7WA 4GBAA 3LL8B 2K7OA 2BE4A 3CR2A 1EJ3A 3TDIA 2F3ZA 4I5LB 1WDCB 2KBIA 1EH2A 1WRLA 1WRZA 1BU3A 1F8HA 1KQVA 1XFYO 5I2QA 1XFZO 1YUTA 2LP3A 1DGVA 4XYNA 1XFXO 5I2LA 1H8BA 4PE7A 3PALA 3WHUB 2MJWB 2KBMA 5CSNA 1CDNA 2RGIA 1FI5A 4OV2A 1OQPA 1JSAA 1JF2A 2M9GA 1YRUB 1QIWA 1TTXA 3SG6A 1YUUA 4MRXA 3OB1B 1IGVA 2BECA 1N0YA 2Y4QA 1CMGA 4DRWA 3OX5A 1BOCA 1KQMB 1DJYA 1W7IB 2KI4B 1K8UA 1B8RA 1CNPA 2K2AA 4CIDA 5D69A 1MXEA 2GV5A 2E6WA 2PASA 3DVKA 2COLB 2KFGA 1F70A 3DD4A 5D7FA 1NX3A 1BODA 1FPWA 2Q4UA 1TCOB 1NX1A 1KK7Y 2BBMA 4IL1A 2SASA 1JF0A 1B8CA 2Y1NA 1OOJA 3VGOA 1DT7B 1WDCC 4GGFA 3EKHA 1YX7A 2NXQA 1UHKA 3SG3A 4ETOA 2I18A 2H61A 3EKJA 5HKYA 1L2OB 2H2KA 5GQQC 1CFFA 4MEWA 1SRAA 1UWOA 1S1EA 3OB2B 5AXIA 2NCOA 3IQOA 3VRQA 1QJTA 4M2OA 1ZMZA 3I5HB 2F2PA 4HREE 1KWOC 1B47A 1R2UA 1PVBA 1AVSA 2JC2A 1KQMC 2Y5IA 3BUOB 2KI4C 2ZNDA 2CNPA 2KNEA 1CFCA 1QLKA 3PSRA 4HRHA 3BQ3A 4M2PA 4YRUA 1LXFC 1UP5A 1QX7A 4A4CA 5K89A 2EHBA 3JVTB 2LANA 3KHEA 2M8UA 1CFPA 3ZWHA 1KFXL 2G9BA 2I7AA 3SIAA 4DS7A 1IH0A 1DF0A 5TNCA 2LVJA 2MHHA 2FCEA 1PALA 2IS9A 1CB1A 5J3XA 1TRFA 1AJ4A 3VROA 3NSIA 4CPVA 5KTYA 1CLBA 5G08A 1ZFSA 1RK9A 5ER4X 1L2OC 1KSOA 4QJ3B 2KI6D 1KK7Z 3EVUA 2M1UA 1K95A 1QLSA 3I5HC 5AANA 4R1EA 1G4YR 4JWQA 4ZCVA 1UURA 1Y1UA 2ZN9A 3GOFA 1PK0D 1KFUL 2BKHB 2QPTA 1W7JB 2JT0A 4PE1A 1AP4A 5DKRA 1IQ3A 1C7VA 1MUXA 4N1GA 1CDLA 2PRUA 4BY4A 4D1EA 2PVBA 3JVTC 1OMVA 3NSKA 4JPZB 4L9MA 5AEQA 1CLMA 4MN0A 2LAPA 1IKUA 1EG3A 2BKIB 2OS8C 1GGWA 2LUXA 1SK6D 1CLLA 4USLA 2Q91A 1U5IB 3O6BA 1YTZC 3I5FB 3MSEB 3KF9A 2BCXA 4AQIA 1NUBA 4YGAA 5CSIA 1OMRA 2HQ8A 1SYMA 3DF0B 1SNLA 4YGBB 1SKTA 1RWYA 1F55A 1QX2A 3FIAA 3FWBA 1S36A 3O2PA 1NX2A 3PFVA 1DJIA 1CM1A 1K9UA 4ICBA 5HKZA 1PSBA 2E30A 4XJKA 3EK7A 4A4BA 3TDUA 3AKAA 2OPOA 4PHJA 2JT8A 2KYCA 1J1DA 2M49B 2LV7A 1S5GY 1PULA 2L4IA 2LVVA 2MBXA 2JULA 4BY5A 2MLFC 2JTTA 2PALA 4MZKA 1A75B 1M63B 3CR4X 1X02A 2AUCA 3TS5B 1XFUO 3BOWA 3SG2A 3D10A 4N5XA 2BBNA 2M29A 3I5FC 1H4BA 2EGDA 3NXAA 4C0LA 1NWDA 1AHRA 5DKNA 1KWOB 4OR9B 2SCPA 1J7RA 1YRTB 1QASA 2LP2A 1N65A 5HLOA 2K61A 3OHMB 1K9KA 4AQJA 3KEVA 1KFXS 4GFTA 1J7QA 3WNXB 1OZSA 5JJGA 3DVMA 2GGMA 1Y1XA 3WHTB 4GPLB 2KI6C 1QX5B 4NQGA 2MLEC 2BCBA 4M2QA 5ER5A 1ZACA 3PATA 3SG5A 4F0ZB 2M7NA 2CTNA 3BUNB 1ALWA 1XA5A 2WCBA 1F54A 2JTZA 3PN7C 2JXCA 4MVFA 1JFJA 5KU1A 1J1EA 3HX4A 1KSMA 3TS5C 2LMUA 1MWNA 3AAKA 1NCXA 1WLZA 2FCDA 1EXRA 1B9AA 1NX0A 2LC5A 1YVHA 3D0YA 4CFQA 3TZ1A 1NYAA 2WC8A 1KFUS 1F4QA 1CFDA 2M97A 2Y1MA 4PHKA 1BJFA 4YGEB 1S5GZ 3CWGA 1LKJA 4PALA 1IG5A 2KFHA 2L4HA 2PMYA 5I2OA 1JC2A 2MAZA 1D1OA 2WORA 1DMOA 4C0KA 2LE9B 3IF7A 4DIRA 4ORAB 4GGNA 1DVIA 4GNKB 1XK4A 2LCPA 1TNWA 2KDHA 3EVVA 1XVJA 3FWCA 3GK2A 3GK1A 3EK4A 4NDCA 2M3WA 3VRRA 1MXLC 3JTDB 2TN4A 1IJ5A 3KPXA 2LM5A 2LVKA 4U8DA 2GGZA 2KAVA 4HSZA 2OS8B 2JNFA 2G2BA 2JPTA 1A2XA 3LCPC 5HKWA 2JNXA 3LK0A 3EK8A 2LLTA 1XFWO 2MA2A 2K2FA 2KHNA 5FYXA 1SY9A 1OSAA 2V53A 1B4CA 4OKHA 1VRKA 2ZRTA 5CSJA 2WCEA 2BL0B 5JOLA 4MZJA 3BYAA 2HETA 2LLSA 1B8LA 1UHHA 1XO5A 4MLWA 2AAOA 1S6JA 2WCFA 3WXAA 3OX6A 4FTGA 1QIVA 4HRGA 5B8IB 1BF5A 4ZCUA 1WY9A 1DF0B 1EG4A 4GGFC 1EL4A 1IWQA 4MRYA 4I5KA 1A4PA 2WOSA 2CXJA 3JTDC 3SG7A 3BUXB 4N1FA 2H61C 2ZRSA 1M45A 4MBEA 3NSLA 5HLVA 1SCMB 5DKQA 2LVIA 4GUKA 3KO0A 5CSFA 2D8NA 3C1VA 1NCYA 1S6IA 1SR6B 3O4YA 1CKKA 1TNQA 1CDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLE A;  2CBL A;  1B1G A;  1JUO A;  1AUI B;  2EC6 B;  3CTN A;  1JFK A;  1B7T Y;  2BL0 C;  2HQW A;  4MSP A;  2NCP A;  2LMT A;  2JQ6 A;  2O5G A;  1K90 D;  2NZ0 A;  2JOJ A;  1JBA A;  1WRK A;  1K96 A;  2MRD A;  4QJ5 B;  4P5O E;  4PE0 A;  1V1F A;  3E3R A;  4PCW A;  5AFP A;  3M0W A;  1J7O A;  1L7Z A;  1DTL A;  1YVL A;  5F6T A;  1LA3 A;  1J55 A;  2WND A;  1TNP A;  1C07 A;  2KAX A;  4DCK A;  3TDZ A;  3PN7 B;  1SMG A;  3CS1 A;  1K93 D;  1MQ1 A;  1K2H A;  3EVR A;  1XYD A;  1GGZ A;  1SCM C;  1Y0V H;  1NIW A;  1DJH A;  2OTG B;  3RM1 A;  1XFV O;  1REC A;  3AAJ A;  3PLF B;  1RRO A;  2F2O A;  1YUR A;  2ZFD A;  1AJ5 A;  4I5J A;  1SR6 C;  4YI8 A;  1BLQ A;  2L98 A;  1CTR A;  4JQ0 D;  4XJK B;  2K7C A;  4GAO A;  1IJ6 A;  1PSR A;  1QXP A;  1KK8 B;  2EC6 C;  1OE9 B;  1A29 A;  2ISD A;  1SCV A;  3HCM A;  2ZNE A;  3GK4 X;  2VRG A;  1AK8 A;  1MR8 A;  3VRP A;  4AOM A;  4YGC B;  3SG4 A;  1K9P A;  2K7B A;  3H4S E;  2I94 A;  3BXK A;  1RTP 1;  1ODB A;  4WRI A;  3I5G B;  3BOW B;  2JWW A;  4YGD B;  4C0J A;  2P6B B;  2DOQ A;  1S3P A;  1B7T Z;  1PVA A;  3BUM B;  4OCI A;  3TUY B;  2I2R E;  2OTG C;  5HYD A;  1BR4 B;  4PHN A;  1YR5 A;  2KSP A;  4YI9 A;  1HQV A;  2JRF A;  5BPJ A;  1GQM A;  3ZNI A;  1DJG A;  2JXL A;  2M1K B;  1JWD A;  1M39 A;  3FS7 A;  4Q04 A;  2BE6 A;  2LHI A;  1CDP A;  1K94 A;  1RFJ A;  1KK8 C;  2L5X B;  3O78 A;  4DUQ A;  1Q80 A;  5KSZ A;  2LNK A;  2ZN8 A;  1UHJ A;  1SW8 A;  2NLN A;  2KGR A;  2M7L A;  1J7P A;  2QAC A;  3A8R A;  2F3Y A;  2JZI A;  2A4J A;  1SL7 A;  1QVI Y;  1Y6W A;  4PHM A;  1QAT A;  3AKB A;  1N2D A;  2O60 A;  3OP0 A;  4CFR A;  1BR1 B;  2FJU B;  2R2I A;  3I5G C;  1QV1 A;  3ICB A;  5I8N A;  1OZO A;  1YX8 A;  3D0Y B;  2K7D A;  5CPV A;  1FF1 A;  1M46 A;  1YUS A;  1MF8 B;  1QTX A;  2L51 A;  3K21 A;  1TN4 A;  3TUY C;  1TOP A;  2LHL A;  1SBJ A;  3DVJ A;  1NP8 A;  1ALV A;  3CGA A;  1ZOT B;  3BUW B;  4P2Y B;  1PRW A;  3CLN A;  1CMF A;  1M31 A;  2PSR A;  1OMD A;  1BMO A;  4YBH B;  2KGB C;  2CT9 A;  4CLN A;  1MHO A;  2K0J A;  1G8I A;  3A4U B;  4MZL A;  1RJV A;  3I5I B;  1R6P A;  1SL9 A;  3LK1 A;  1UUS A;  1CM4 A;  1V1G A;  4WQ3 A;  1NPQ A;  3DVE A;  4OVN F;  1IQ5 A;  2CCM A;  4FQO A;  4PDZ A;  1KCY A;  1DJZ A;  1A03 A;  1UHN A;  3CR5 X;  2JU0 A;  2F33 A;  1U5I A;  1FI6 A;  2LLU A;  1HT9 A;  3PM8 A;  4NDD A;  2KQ6 A;  1NCZ A;  5PAL A;  1S26 D;  3DF0 A;  1QVI Z;  2BCA A;  3VRN A;  4E68 A;  3QRX A;  2K8M B;  2AMI A;  2KFF A;  2KYF A;  1XK4 C;  4ORB B;  3SIB A;  1BG1 A;  1QV0 A;  1WLM A;  1TIZ A;  1G33 A;  4I5N B;  1IRJ A;  2F8P A;  4WQ2 A;  1UHI A;  1BT6 A;  2HF5 A;  2LUC A;  2LMV A;  3IQQ A;  1GJY A;  3I5I C;  1Y1A A;  1DGU A;  4TNC A;  3NSO A;  1F71 A;  1SL8 A;  2B1U A;  1DJX A;  5IBW A;  1A75 A;  3CZT X;  1E8A A;  2ZKM X;  1NSH A;  2KQY A;  1F4O A;  1LA0 A;  4UPG A;  1DJW A;  1TCF A;  1LIN A;  2KAY A;  3SJS A;  1LVC D;  2L0P A;  1S6C A;  2FOT A;  2KOT A;  1QS7 A;  4PE4 A;  4QJ4 B;  2HPS A;  1FBV A;  2JT3 A;  2L2E A;  1FW4 A;  3RLZ A;  3F45 A;  1TNX A;  5AER A;  2M0R A;  2L50 A;  1SPY A;  4NDB A;  1ZUZ A;  4ORC B;  1C7W A;  4GBA A;  3LL8 B;  2K7O A;  2BE4 A;  3CR2 A;  1EJ3 A;  3TDI A;  2F3Z A;  4I5L B;  1WDC B;  2KBI A;  1EH2 A;  1WRL A;  1WRZ A;  1BU3 A;  1F8H A;  1KQV A;  1XFY O;  5I2Q A;  1XFZ O;  1YUT A;  2LP3 A;  1DGV A;  4XYN A;  1XFX O;  5I2L A;  1H8B A;  4PE7 A;  3PAL A;  3WHU B;  2MJW B;  2KBM A;  5CSN A;  1CDN A;  2RGI A;  1FI5 A;  4OV2 A;  1OQP A;  1JSA A;  1JF2 A;  2M9G A;  1YRU B;  1QIW A;  1TTX A;  3SG6 A;  1YUU A;  4MRX A;  3OB1 B;  1IGV A;  2BEC A;  1N0Y A;  2Y4Q A;  1CMG A;  4DRW A;  3OX5 A;  1BOC A;  1KQM B;  1DJY A;  1W7I B;  2KI4 B;  1K8U A;  1B8R A;  1CNP A;  2K2A A;  4CID A;  5D69 A;  1MXE A;  2GV5 A;  2E6W A;  2PAS A;  3DVK A;  2COL B;  2KFG A;  1F70 A;  3DD4 A;  5D7F A;  1NX3 A;  1BOD A;  1FPW A;  2Q4U A;  1TCO B;  1NX1 A;  1KK7 Y;  2BBM A;  4IL1 A;  2SAS A;  1JF0 A;  1B8C A;  2Y1N A;  1OOJ A;  3VGO A;  1DT7 B;  1WDC C;  4GGF A;  3EKH A;  1YX7 A;  2NXQ A;  1UHK A;  3SG3 A;  4ETO A;  2I18 A;  2H61 A;  3EKJ A;  5HKY A;  1L2O B;  2H2K A;  5GQQ C;  1CFF A;  4MEW A;  1SRA A;  1UWO A;  1S1E A;  3OB2 B;  5AXI A;  2NCO A;  3IQO A;  3VRQ A;  1QJT A;  4M2O A;  1ZMZ A;  3I5H B;  2F2P A;  4HRE E;  1KWO C;  1B47 A;  1R2U A;  1PVB A;  1AVS A;  2JC2 A;  1KQM C;  2Y5I A;  3BUO B;  2KI4 C;  2ZND A;  2CNP A;  2KNE A;  1CFC A;  1QLK A;  3PSR A;  4HRH A;  3BQ3 A;  4M2P A;  4YRU A;  1LXF C;  1UP5 A;  1QX7 A;  4A4C A;  5K89 A;  2EHB A;  3JVT B;  2LAN A;  3KHE A;  2M8U A;  1CFP A;  3ZWH A;  1KFX L;  2G9B A;  2I7A A;  3SIA A;  4DS7 A;  1IH0 A;  1DF0 A;  5TNC A;  2LVJ A;  2MHH A;  2FCE A;  1PAL A;  2IS9 A;  1CB1 A;  5J3X A;  1TRF A;  1AJ4 A;  3VRO A;  3NSI A;  4CPV A;  5KTY A;  1CLB A;  5G08 A;  1ZFS A;  1RK9 A;  5ER4 X;  1L2O C;  1KSO A;  4QJ3 B;  2KI6 D;  1KK7 Z;  3EVU A;  2M1U A;  1K95 A;  1QLS A;  3I5H C;  5AAN A;  4R1E A;  1G4Y R;  4JWQ A;  4ZCV A;  1UUR A;  1Y1U A;  2ZN9 A;  3GOF A;  1PK0 D;  1KFU L;  2BKH B;  2QPT A;  1W7J B;  2JT0 A;  4PE1 A;  1AP4 A;  5DKR A;  1IQ3 A;  1C7V A;  1MUX A;  4N1G A;  1CDL A;  2PRU A;  4BY4 A;  4D1E A;  2PVB A;  3JVT C;  1OMV A;  3NSK A;  4JPZ B;  4L9M A;  5AEQ A;  1CLM A;  4MN0 A;  2LAP A;  1IKU A;  1EG3 A;  2BKI B;  2OS8 C;  1GGW A;  2LUX A;  1SK6 D;  1CLL A;  4USL A;  2Q91 A;  1U5I B;  3O6B A;  1YTZ C;  3I5F B;  3MSE B;  3KF9 A;  2BCX A;  4AQI A;  1NUB A;  4YGA A;  5CSI A;  1OMR A;  2HQ8 A;  1SYM A;  3DF0 B;  1SNL A;  4YGB B;  1SKT A;  1RWY A;  1F55 A;  1QX2 A;  3FIA A;  3FWB A;  1S36 A;  3O2P A;  1NX2 A;  3PFV A;  1DJI A;  1CM1 A;  1K9U A;  4ICB A;  5HKZ A;  1PSB A;  2E30 A;  4XJK A;  3EK7 A;  4A4B A;  3TDU A;  3AKA A;  2OPO A;  4PHJ A;  2JT8 A;  2KYC A;  1J1D A;  2M49 B;  2LV7 A;  1S5G Y;  1PUL A;  2L4I A;  2LVV A;  2MBX A;  2JUL A;  4BY5 A;  2MLF C;  2JTT A;  2PAL A;  4MZK A;  1A75 B;  1M63 B;  3CR4 X;  1X02 A;  2AUC A;  3TS5 B;  1XFU O;  3BOW A;  3SG2 A;  3D10 A;  4N5X A;  2BBN A;  2M29 A;  3I5F C;  1H4B A;  2EGD A;  3NXA A;  4C0L A;  1NWD A;  1AHR A;  5DKN A;  1KWO B;  4OR9 B;  2SCP A;  1J7R A;  1YRT B;  1QAS A;  2LP2 A;  1N65 A;  5HLO A;  2K61 A;  3OHM B;  1K9K A;  4AQJ A;  3KEV A;  1KFX S;  4GFT A;  1J7Q A;  3WNX B;  1OZS A;  5JJG A;  3DVM A;  2GGM A;  1Y1X A;  3WHT B;  4GPL B;  2KI6 C;  1QX5 B;  4NQG A;  2MLE C;  2BCB A;  4M2Q A;  5ER5 A;  1ZAC A;  3PAT A;  3SG5 A;  4F0Z B;  2M7N A;  2CTN A;  3BUN B;  1ALW A;  1XA5 A;  2WCB A;  1F54 A;  2JTZ A;  3PN7 C;  2JXC A;  4MVF A;  1JFJ A;  5KU1 A;  1J1E A;  3HX4 A;  1KSM A;  3TS5 C;  2LMU A;  1MWN A;  3AAK A;  1NCX A;  1WLZ A;  2FCD A;  1EXR A;  1B9A A;  1NX0 A;  2LC5 A;  1YVH A;  3D0Y A;  4CFQ A;  3TZ1 A;  1NYA A;  2WC8 A;  1KFU S;  1F4Q A;  1CFD A;  2M97 A;  2Y1M A;  4PHK A;  1BJF A;  4YGE B;  1S5G Z;  3CWG A;  1LKJ A;  4PAL A;  1IG5 A;  2KFH A;  2L4H A;  2PMY A;  5I2O A;  1JC2 A;  2MAZ A;  1D1O A;  2WOR A;  1DMO A;  4C0K A;  2LE9 B;  3IF7 A;  4DIR A;  4ORA B;  4GGN A;  1DVI A;  4GNK B;  1XK4 A;  2LCP A;  1TNW A;  2KDH A;  3EVV A;  1XVJ A;  3FWC A;  3GK2 A;  3GK1 A;  3EK4 A;  4NDC A;  2M3W A;  3VRR A;  1MXL C;  3JTD B;  2TN4 A;  1IJ5 A;  3KPX A;  2LM5 A;  2LVK A;  4U8D A;  2GGZ A;  2KAV A;  4HSZ A;  2OS8 B;  2JNF A;  2G2B A;  2JPT A;  1A2X A;  3LCP C;  5HKW A;  2JNX A;  3LK0 A;  3EK8 A;  2LLT A;  1XFW O;  2MA2 A;  2K2F A;  2KHN A;  5FYX A;  1SY9 A;  1OSA A;  2V53 A;  1B4C A;  4OKH A;  1VRK A;  2ZRT A;  5CSJ A;  2WCE A;  2BL0 B;  5JOL A;  4MZJ A;  3BYA A;  2HET A;  2LLS A;  1B8L A;  1UHH A;  1XO5 A;  4MLW A;  2AAO A;  1S6J A;  2WCF A;  3WXA A;  3OX6 A;  4FTG A;  1QIV A;  4HRG A;  5B8I B;  1BF5 A;  4ZCU A;  1WY9 A;  1DF0 B;  1EG4 A;  4GGF C;  1EL4 A;  1IWQ A;  4MRY A;  4I5K A;  1A4P A;  2WOS A;  2CXJ A;  3JTD C;  3SG7 A;  3BUX B;  4N1F A;  2H61 C;  2ZRS A;  1M45 A;  4MBE A;  3NSL A;  5HLV A;  1SCM B;  5DKQ A;  2LVI A;  4GUK A;  3KO0 A;  5CSF A;  2D8N A;  3C1V A;  1NCY A;  1S6I A;  1SR6 B;  3O4Y A;  1CKK A;  1TNQ A;  1CDM A; 
#chains in the Genus database with same CATH topology
 3LLE A;  2CBL A;  1B1G A;  1JUO A;  1AUI B;  2EC6 B;  3CTN A;  3QME A;  1JFK A;  1B7T Y;  2BL0 C;  2HQW A;  3BFB A;  2NCP A;  2LMT A;  4MSP A;  2JQ6 A;  2O5G A;  1K90 D;  3R1O A;  2NZ0 A;  2JOJ A;  1JBA A;  1WRK A;  1K96 A;  2MRD A;  4QJ5 B;  4P5O E;  4PE0 A;  1V1F A;  3E3R A;  4PCW A;  5AFP A;  3M0W A;  1J7O A;  1L7Z A;  1DTL A;  1YVL A;  5F6T A;  1LA3 A;  1J55 A;  2WND A;  1TNP A;  1C07 A;  2KAX A;  4DCK A;  3TDZ A;  3PN7 B;  1SMG A;  3BFA A;  3CS1 A;  1K93 D;  1MQ1 A;  1K2H A;  3EVR A;  1XYD A;  1TUZ A;  1GGZ A;  1SCM C;  2BNX A;  1Y0V H;  1NIW A;  1DJH A;  2OTG B;  3RM1 A;  3CYZ A;  1XFV O;  1REC A;  3AAJ A;  3PLF B;  1RRO A;  2F2O A;  1YUR A;  2ZFD A;  1AJ5 A;  2PYQ A;  4I5J A;  1SR6 C;  4YI8 A;  1BLQ A;  2L98 A;  1CTR A;  4JQ0 D;  4XJK B;  2K7C A;  4GAO A;  1IJ6 A;  1PSR A;  1QXP A;  1KK8 B;  2EC6 C;  2WC6 A;  1OE9 B;  1A29 A;  2ISD A;  1SCV A;  3HCM A;  2ZNE A;  2KPH A;  3GK4 X;  2VRG A;  1AK8 A;  1MR8 A;  3VRP A;  4AOM A;  4YGC B;  3SG4 A;  1K9P A;  2K7B A;  3H4S E;  3V2L A;  2I94 A;  3BXK A;  1RTP 1;  1ODB A;  4WRI A;  2QDI A;  3BOW B;  3I5G B;  3SS3 A;  2JWW A;  4YGD B;  4C0J A;  2P6B B;  2DOQ A;  4F7F A;  1S3P A;  1B7T Z;  1PVA A;  3BUM B;  3B7A A;  4OCI A;  3TUY B;  2I2R E;  2OTG C;  5HYD A;  1BR4 B;  4PHN A;  1YR5 A;  2KSP A;  4YI9 A;  1HQV A;  2JRF A;  5BPJ A;  1GQM A;  1OOI X;  3ZNI A;  1DJG A;  2JXL A;  1C3Y A;  2M1K B;  1JWD A;  1M39 A;  3S0G A;  3FS7 A;  4Q04 A;  2BE6 A;  2LHI A;  1CDP A;  1K94 A;  1RFJ A;  1KK8 C;  2L5X B;  3O78 A;  4DUQ A;  1Q80 A;  5KSZ A;  2LNK A;  2ZN8 A;  1UHJ A;  1SW8 A;  2NLN A;  2KGR A;  2M7L A;  1J7P A;  2QAC A;  3A8R A;  3CZ1 A;  2F3Y A;  2JZI A;  2A4J A;  1Z4H A;  1SL7 A;  1QVI Y;  1Y6W A;  4PHM A;  1QAT A;  3AKB A;  1N2D A;  2O60 A;  3OP0 A;  4CFR A;  1BR1 B;  2FJU B;  2JPO A;  2R2I A;  3I5G C;  1OOH A;  1QV1 A;  3DYE A;  3ICB A;  5I8N A;  1OZO A;  1YX8 A;  3D0Y B;  2K7D A;  5CPV A;  1FF1 A;  1M46 A;  1YUS A;  1MF8 B;  1QTX A;  2L51 A;  2K60 A;  1TN4 A;  3K21 A;  3NGV A;  3TUY C;  1TOP A;  3UO9 A;  2LHL A;  1SBJ A;  1IIO A;  3DVJ A;  1NP8 A;  1ALV A;  3CGA A;  1ZOT B;  3BUW B;  4P2Y B;  1PRW A;  3CLN A;  1CMF A;  1M31 A;  2PSR A;  1OMD A;  1BMO A;  4YBH B;  2KGB C;  3SS5 A;  3O4X A;  2CT9 A;  4CLN A;  1MHO A;  2K0J A;  1G8I A;  3A4U B;  3DZT A;  4MZL A;  1RJV A;  3I5I B;  1R6P A;  1SL9 A;  3LK1 A;  1UUS A;  1CM4 A;  3R72 A;  1V1G A;  4WQ3 A;  1NPQ A;  3D76 A;  3DVE A;  4OVN F;  1IQ5 A;  2CCM A;  1XFR A;  4FQO A;  4PDZ A;  1KCY A;  1DJZ A;  1A03 A;  1UHN A;  3CR5 X;  2JU0 A;  2F33 A;  1U5I A;  1FI6 A;  2LLU A;  1HT9 A;  3PM8 A;  4NDD A;  2KQ6 A;  3R1V A;  1NCZ A;  5PAL A;  1S26 D;  3DF0 A;  1QVI Z;  2BCA A;  3VRN A;  4E68 A;  3SS4 A;  3QRX A;  2K8M B;  2AMI A;  2KFF A;  2KYF A;  1XK4 C;  4ORB B;  3SIB A;  1BG1 A;  1QV0 A;  1WLM A;  1TIZ A;  1DQE A;  3S0F A;  1G33 A;  4I5N B;  1DC1 A;  1IRJ A;  2F8P A;  4WQ2 A;  1UHI A;  1BT6 A;  2HF5 A;  2LUC A;  2WCM A;  3BJH A;  3RZS A;  2LMV A;  3IQQ A;  1GJY A;  3I5I C;  1Y1A A;  1DGU A;  4TNC A;  3NSO A;  1F71 A;  1DEK A;  1SL8 A;  2B1U A;  1DJX A;  5IBW A;  1A75 A;  3CZT X;  1E8A A;  2ZKM X;  1NSH A;  2KQY A;  1F4O A;  1LA0 A;  4UPG A;  1DJW A;  1TCF A;  1LIN A;  2KAY A;  3SJS A;  1LVC D;  2L0P A;  1S6C A;  2FOT A;  2KOT A;  1QS7 A;  4PE4 A;  4QJ4 B;  2HPS A;  5HL1 A;  3S0E A;  1FBV A;  2JT3 A;  2L2E A;  1FW4 A;  3RLZ A;  3K1E A;  3F45 A;  1TNX A;  5AER A;  2M0R A;  2L50 A;  1SPY A;  4NDB A;  1ZUZ A;  4ORC B;  1C7W A;  4GBA A;  3LL8 B;  2K7O A;  3L47 A;  2BE4 A;  2WCJ A;  3CR2 A;  1EJ3 A;  3TDI A;  2F3Z A;  2KLD A;  4I5L B;  1WDC B;  2KBI A;  1EH2 A;  1WRL A;  1WRZ A;  1BU3 A;  1F8H A;  1KQV A;  1XFY O;  5I2Q A;  1XFZ O;  1YUT A;  2LP3 A;  1DGV A;  4XYN A;  1XFX O;  5I2L A;  1H8B A;  3B88 A;  3PAL A;  4PE7 A;  2MJW B;  2KBM A;  5CSN A;  3WHU B;  2RGI A;  1CDN A;  1FI5 A;  4OV2 A;  1OQP A;  1JSA A;  1JF2 A;  2M9G A;  1YRU B;  2QEO A;  1QIW A;  1TTX A;  3SG6 A;  1YUU A;  3D73 A;  4MRX A;  5DIC A;  3OB1 B;  2H8V A;  1IGV A;  2BEC A;  1N0Y A;  2Y4Q A;  1CMG A;  4DRW A;  3OX5 A;  1BOC A;  1KQM B;  1DJY A;  1W7I B;  2KI4 B;  1K8U A;  1B8R A;  3EG5 B;  3PJI A;  4JKT A;  1CNP A;  2K2A A;  4CID A;  5D69 A;  1MXE A;  2GV5 A;  2E6W A;  2PAS A;  3DVK A;  2COL B;  2KFG A;  1F70 A;  3DD4 A;  5D7F A;  1NX3 A;  1BOD A;  1FPW A;  2Q4U A;  1TCO B;  1Z2C B;  1NX1 A;  1KK7 Y;  2BBM A;  4IL1 A;  2SAS A;  1JF0 A;  1B8C A;  2Y1N A;  1OOJ A;  3VGO A;  5FI7 A;  1DT7 B;  1WDC C;  4GGF A;  3EKH A;  1YX7 A;  2NXQ A;  1UHK A;  3SG3 A;  4ETO A;  2I18 A;  2H61 A;  3EKJ A;  5HKY A;  1L2O B;  2H2K A;  5GQQ C;  1CFF A;  4MEW A;  1SRA A;  1UWO A;  1S1E A;  3DY9 A;  1W9Z A;  2NCO A;  3IQO A;  3N7H A;  3OB2 B;  5AXI A;  3VRQ A;  1QJT A;  4M2O A;  1ZMZ A;  3I5H B;  2F2P A;  4HRE E;  1KWO C;  1B47 A;  1R2U A;  1PVB A;  1AVS A;  2JC2 A;  1KQM C;  2Y5I A;  3BUO B;  2KI4 C;  2ZND A;  2CNP A;  4INW A;  2KNE A;  1CFC A;  1QLK A;  3PSR A;  3CZ0 A;  4HRH A;  3BQ3 A;  4M2P A;  4YRU A;  1LXF C;  1UP5 A;  1QX7 A;  4A4C A;  5K89 A;  2EHB A;  3JVT B;  2LAN A;  3KHE A;  2M8U A;  5FI6 A;  1CFP A;  3ZWH A;  2BAP A;  1KFX L;  2G9B A;  2I7A A;  3SIA A;  4DS7 A;  1IH0 A;  1DF0 A;  5TNC A;  2LVJ A;  3DXL A;  2MHH A;  2FCE A;  1PAL A;  2IS9 A;  1CB1 A;  5J3X A;  1TRF A;  1AJ4 A;  3VRO A;  3NSI A;  4CPV A;  1TUJ A;  3IVT A;  5G08 A;  5KTY A;  1ZFS A;  1RK9 A;  5ER4 X;  1CLB A;  1L2O C;  1KSO A;  4QJ3 B;  2KI6 D;  2L5Y A;  1KK7 Z;  3D78 A;  3EVU A;  2M1U A;  1K95 A;  1QLS A;  3I5H C;  4YGE B;  5AAN A;  2KLE A;  4R1E A;  2L2C A;  1G4Y R;  4JWQ A;  4ZCV A;  1ORG A;  1UUR A;  1Y1U A;  2ZN9 A;  3GOF A;  1PK0 D;  1KFU L;  2BKH B;  2QPT A;  1W7J B;  2JT0 A;  4PE1 A;  1AP4 A;  5DKR A;  1IQ3 A;  1C7V A;  1MUX A;  4N1G A;  3L4A A;  1P28 A;  1CDL A;  1SSE B;  5D3O A;  2PRU A;  4BY4 A;  4D1E A;  2PVB A;  3JVT C;  1OMV A;  3NSK A;  1C3Z A;  2WCL A;  4JPZ B;  4L9M A;  5AEQ A;  1CLM A;  4MN0 A;  2LAP A;  1IKU A;  3CDN A;  1EG3 A;  4JD9 A;  2BKI B;  2OS8 C;  1GGW A;  2LUX A;  1SK6 D;  1CLL A;  4USL A;  1DEL A;  1U5I B;  2Q91 A;  3O6B A;  1YTZ C;  3I5F B;  3MSE B;  5I94 A;  3KF9 A;  2BCX A;  4AQI A;  1NUB A;  4YGA A;  5CSI A;  3S0A A;  1OMR A;  2HQ8 A;  1SYM A;  3DF0 B;  3L4L A;  1SNL A;  1OW4 A;  4YGB B;  1SKT A;  1RWY A;  1F55 A;  1QX2 A;  3FIA A;  3FWB A;  1S36 A;  1OOG A;  3O2P A;  1NX2 A;  3PFV A;  1DJI A;  1CM1 A;  1K9U A;  4ICB A;  5HKZ A;  1PSB A;  2E30 A;  4XJK A;  4OZD A;  3EK7 A;  2YGU A;  4A4B A;  3TDU A;  3AKA A;  2OPO A;  4PHJ A;  3S0B A;  2JT8 A;  3CAB A;  2KYC A;  1J1D A;  2M49 B;  1TWO A;  2LV7 A;  1S5G Y;  1PUL A;  2L4I A;  2LVV A;  2P71 A;  2MBX A;  2JUL A;  4BY5 A;  2MLF C;  2JTT A;  2PAL A;  4MZK A;  1A75 B;  1M63 B;  3CR4 X;  1X02 A;  2AUC A;  3TS5 B;  1XFU O;  3BOW A;  3SG2 A;  3D10 A;  4N5X A;  2BBN A;  2M29 A;  3I5F C;  1H4B A;  2EGD A;  3NXA A;  4C0L A;  1NWD A;  1AHR A;  5DKN A;  2QEH A;  1KWO B;  2WCH A;  4OR9 B;  2SCP A;  1J7R A;  1YRT B;  1QAS A;  2LP2 A;  1N65 A;  2WCK A;  5HLO A;  2K61 A;  3OHM B;  1K9K A;  4AQJ A;  3KEV A;  1KFX S;  4GFT A;  1J7Q A;  3WNX B;  1OZS A;  5JJG A;  3DVM A;  4INX A;  2P70 A;  2GGM A;  1Y1X A;  3WHT B;  4GPL B;  2KI6 C;  1QX5 B;  4NQG A;  2MLE C;  2BCB A;  4M2Q A;  5ER5 A;  1ZAC A;  3PAT A;  3SG5 A;  4F0Z B;  2M7N A;  2CTN A;  3BUN B;  3PM2 A;  1ALW A;  1XA5 A;  2WCB A;  1F54 A;  2JTZ A;  3PN7 C;  2JXC A;  4MVF A;  1JFJ A;  5KU1 A;  1OOF A;  3D77 A;  1J1E A;  3HX4 A;  3D75 A;  1KSM A;  1GM0 A;  3TS5 C;  2LMU A;  1MWN A;  2QEV A;  3AAK A;  1NCX A;  1WLZ A;  2FCD A;  3B6X A;  1EXR A;  1B9A A;  1NX0 A;  2LC5 A;  3FE6 A;  1YVH A;  3D0Y A;  4CFQ A;  3TZ1 A;  1NYA A;  2WC8 A;  1KFU S;  1F4Q A;  1CFD A;  2M97 A;  2Y1M A;  3FE9 A;  1BJF A;  3B86 A;  3B87 A;  3OGN A;  4PHK A;  3S0D A;  1S5G Z;  3CWG A;  3NHI A;  1LKJ A;  4PAL A;  1IG5 A;  2FJY A;  2KFH A;  2L4H A;  2PMY A;  3FE8 A;  5I2O A;  2PQL A;  2MAZ A;  1D1O A;  1JC2 A;  2WOR A;  1DMO A;  3BFH A;  4C0K A;  2LE9 B;  3IF7 A;  4DIR A;  4ORA B;  4GGN A;  1DVI A;  3OBV A;  4GNK B;  1XK4 A;  2LCP A;  1TNW A;  2KDH A;  3EVV A;  1XVJ A;  3FWC A;  3GK2 A;  3GK1 A;  3EK4 A;  4NDC A;  2M3W A;  3VRR A;  1MXL C;  3JTD B;  5EL2 A;  4KYN A;  2TN4 A;  1IJ5 A;  3KPX A;  2LM5 A;  2LVK A;  4U8D A;  2GGZ A;  2KAV A;  4HSZ A;  3CZ2 A;  2OS8 B;  2WC5 A;  2JNF A;  2G2B A;  2JPT A;  1A2X A;  3LCP C;  5HKW A;  2JNX A;  3LK0 A;  3EK8 A;  2LLT A;  1XFW O;  2MA2 A;  2K2F A;  2KHN A;  5FYX A;  1SY9 A;  1OSA A;  2V53 A;  1B4C A;  3R1P A;  1QWV A;  4OKH A;  1VRK A;  2ZRT A;  2ERB A;  5CSJ A;  2WCE A;  1T14 A;  1LS8 A;  2BL0 B;  5JOL A;  4MZJ A;  2GTE A;  3BYA A;  2HET A;  2LLS A;  1B8L A;  1UHH A;  1XO5 A;  4MLW A;  2AAO A;  1S6J A;  2WCF A;  4PT1 A;  3OX6 A;  4FTG A;  1QIV A;  4HRG A;  3WXA A;  5B8I B;  1BF5 A;  4ZCU A;  1WY9 A;  1DF0 B;  1EG4 A;  4GGF C;  1EL4 A;  1IWQ A;  4MRY A;  4I5K A;  1A4P A;  2WOS A;  2CXJ A;  3JTD C;  3SG7 A;  3BUX B;  4N1F A;  2H61 C;  3Q8I A;  2ZRS A;  1M45 A;  4MBE A;  3NSL A;  5HLV A;  2QEB A;  1SCM B;  5DKQ A;  5FI2 A;  2LVI A;  3D74 A;  4GUK A;  3KO0 A;  3NHT A;  5CSF A;  2D8N A;  3C1V A;  1NCY A;  4IJ7 A;  1S6I A;  3UNW A;  1SR6 B;  3O4Y A;  1CKK A;  3VB1 A;  4FQT A;  1TNQ A;  1CDM A; 
#chains in the Genus database with same CATH homology
 3LLE A;  2CBL A;  1B1G A;  1JUO A;  1AUI B;  2EC6 B;  3CTN A;  1JFK A;  1B7T Y;  2BL0 C;  2HQW A;  4MSP A;  2NCP A;  2LMT A;  2JQ6 A;  2O5G A;  1K90 D;  2NZ0 A;  2JOJ A;  1JBA A;  1WRK A;  1K96 A;  2MRD A;  4QJ5 B;  4P5O E;  4PE0 A;  1V1F A;  3E3R A;  4PCW A;  5AFP A;  3M0W A;  1J7O A;  1L7Z A;  1DTL A;  1YVL A;  5F6T A;  1LA3 A;  1J55 A;  2WND A;  1TNP A;  1C07 A;  2KAX A;  4DCK A;  3TDZ A;  3PN7 B;  1SMG A;  3CS1 A;  1K93 D;  1MQ1 A;  1K2H A;  3EVR A;  1XYD A;  1GGZ A;  1SCM C;  1Y0V H;  1NIW A;  1DJH A;  2OTG B;  3RM1 A;  1XFV O;  1REC A;  3AAJ A;  3PLF B;  1RRO A;  2F2O A;  1YUR A;  2ZFD A;  1AJ5 A;  4I5J A;  1SR6 C;  4YI8 A;  1BLQ A;  2L98 A;  1CTR A;  4JQ0 D;  4XJK B;  2K7C A;  4GAO A;  1IJ6 A;  1PSR A;  1QXP A;  1KK8 B;  2EC6 C;  1OE9 B;  1A29 A;  2ISD A;  1SCV A;  3HCM A;  2ZNE A;  3GK4 X;  2VRG A;  1AK8 A;  1MR8 A;  3VRP A;  4AOM A;  4YGC B;  3SG4 A;  1K9P A;  2K7B A;  3H4S E;  2I94 A;  3BXK A;  1RTP 1;  1ODB A;  4WRI A;  3I5G B;  3BOW B;  2JWW A;  4YGD B;  4C0J A;  2P6B B;  2DOQ A;  1S3P A;  1B7T Z;  1PVA A;  3BUM B;  4OCI A;  3TUY B;  2I2R E;  2OTG C;  5HYD A;  1BR4 B;  4PHN A;  1YR5 A;  2KSP A;  4YI9 A;  1HQV A;  2JRF A;  5BPJ A;  1GQM A;  3ZNI A;  1DJG A;  2JXL A;  2M1K B;  1JWD A;  1M39 A;  3FS7 A;  4Q04 A;  2BE6 A;  2LHI A;  1CDP A;  1K94 A;  1RFJ A;  1KK8 C;  2L5X B;  3O78 A;  4DUQ A;  1Q80 A;  5KSZ A;  2LNK A;  2ZN8 A;  1UHJ A;  1SW8 A;  2NLN A;  2KGR A;  2M7L A;  1J7P A;  2QAC A;  3A8R A;  2F3Y A;  2JZI A;  2A4J A;  1SL7 A;  1QVI Y;  1Y6W A;  4PHM A;  1QAT A;  3AKB A;  1N2D A;  2O60 A;  3OP0 A;  4CFR A;  1BR1 B;  2FJU B;  2R2I A;  3I5G C;  1QV1 A;  3ICB A;  5I8N A;  1OZO A;  1YX8 A;  3D0Y B;  2K7D A;  5CPV A;  1FF1 A;  1M46 A;  1YUS A;  1MF8 B;  1QTX A;  2L51 A;  3K21 A;  1TN4 A;  3TUY C;  1TOP A;  2LHL A;  1SBJ A;  3DVJ A;  1NP8 A;  1ALV A;  3CGA A;  1ZOT B;  3BUW B;  4P2Y B;  1PRW A;  3CLN A;  1CMF A;  1M31 A;  2PSR A;  1OMD A;  1BMO A;  4YBH B;  2KGB C;  2CT9 A;  4CLN A;  1MHO A;  2K0J A;  1G8I A;  3A4U B;  4MZL A;  1RJV A;  3I5I B;  1R6P A;  1SL9 A;  3LK1 A;  1UUS A;  1CM4 A;  1V1G A;  4WQ3 A;  1NPQ A;  3DVE A;  4OVN F;  1IQ5 A;  2CCM A;  4FQO A;  4PDZ A;  1KCY A;  1DJZ A;  1A03 A;  1UHN A;  3CR5 X;  2JU0 A;  2F33 A;  1U5I A;  1FI6 A;  2LLU A;  1HT9 A;  3PM8 A;  4NDD A;  2KQ6 A;  1NCZ A;  5PAL A;  1S26 D;  3DF0 A;  1QVI Z;  2BCA A;  3VRN A;  4E68 A;  3QRX A;  2K8M B;  2AMI A;  2KFF A;  2KYF A;  1XK4 C;  4ORB B;  3SIB A;  1BG1 A;  1QV0 A;  1WLM A;  1TIZ A;  1G33 A;  4I5N B;  1IRJ A;  2F8P A;  4WQ2 A;  1UHI A;  1BT6 A;  2HF5 A;  2LUC A;  2LMV A;  3IQQ A;  1GJY A;  3I5I C;  1Y1A A;  1DGU A;  4TNC A;  3NSO A;  1F71 A;  1SL8 A;  2B1U A;  1DJX A;  5IBW A;  1A75 A;  3CZT X;  1E8A A;  2ZKM X;  1NSH A;  2KQY A;  1F4O A;  1LA0 A;  4UPG A;  1DJW A;  1TCF A;  1LIN A;  2KAY A;  3SJS A;  1LVC D;  2L0P A;  1S6C A;  2FOT A;  2KOT A;  1QS7 A;  4PE4 A;  4QJ4 B;  2HPS A;  1FBV A;  2JT3 A;  2L2E A;  1FW4 A;  3RLZ A;  3F45 A;  1TNX A;  5AER A;  2M0R A;  2L50 A;  1SPY A;  4NDB A;  1ZUZ A;  4ORC B;  1C7W A;  4GBA A;  3LL8 B;  2K7O A;  2BE4 A;  3CR2 A;  1EJ3 A;  3TDI A;  2F3Z A;  4I5L B;  1WDC B;  2KBI A;  1EH2 A;  1WRL A;  1WRZ A;  1BU3 A;  1F8H A;  1KQV A;  1XFY O;  5I2Q A;  1XFZ O;  1YUT A;  2LP3 A;  1DGV A;  4XYN A;  1XFX O;  5I2L A;  1H8B A;  4PE7 A;  3PAL A;  3WHU B;  2MJW B;  2KBM A;  5CSN A;  1CDN A;  2RGI A;  1FI5 A;  4OV2 A;  1OQP A;  1JSA A;  1JF2 A;  2M9G A;  1YRU B;  1QIW A;  1TTX A;  3SG6 A;  1YUU A;  4MRX A;  3OB1 B;  1IGV A;  2BEC A;  1N0Y A;  2Y4Q A;  1CMG A;  4DRW A;  3OX5 A;  1BOC A;  1KQM B;  1DJY A;  1W7I B;  2KI4 B;  1K8U A;  1B8R A;  1CNP A;  2K2A A;  4CID A;  5D69 A;  1MXE A;  2GV5 A;  2E6W A;  2PAS A;  3DVK A;  2COL B;  2KFG A;  1F70 A;  3DD4 A;  5D7F A;  1NX3 A;  1BOD A;  1FPW A;  2Q4U A;  1TCO B;  1NX1 A;  1KK7 Y;  2BBM A;  4IL1 A;  2SAS A;  1JF0 A;  1B8C A;  2Y1N A;  1OOJ A;  3VGO A;  1DT7 B;  1WDC C;  4GGF A;  3EKH A;  1YX7 A;  2NXQ A;  1UHK A;  3SG3 A;  4ETO A;  2I18 A;  2H61 A;  3EKJ A;  5HKY A;  1L2O B;  2H2K A;  5GQQ C;  1CFF A;  4MEW A;  1SRA A;  1UWO A;  1S1E A;  3OB2 B;  5AXI A;  2NCO A;  3IQO A;  3VRQ A;  1QJT A;  4M2O A;  1ZMZ A;  3I5H B;  2F2P A;  4HRE E;  1KWO C;  1B47 A;  1R2U A;  1PVB A;  1AVS A;  2JC2 A;  1KQM C;  2Y5I A;  3BUO B;  2KI4 C;  2ZND A;  2CNP A;  2KNE A;  1CFC A;  1QLK A;  3PSR A;  4HRH A;  3BQ3 A;  4M2P A;  4YRU A;  1LXF C;  1UP5 A;  1QX7 A;  4A4C A;  5K89 A;  2EHB A;  3JVT B;  2LAN A;  3KHE A;  2M8U A;  1CFP A;  3ZWH A;  1KFX L;  2G9B A;  2I7A A;  3SIA A;  4DS7 A;  1IH0 A;  1DF0 A;  5TNC A;  2LVJ A;  2MHH A;  2FCE A;  1PAL A;  2IS9 A;  1CB1 A;  5J3X A;  1TRF A;  1AJ4 A;  3VRO A;  3NSI A;  4CPV A;  5KTY A;  1CLB A;  5G08 A;  1ZFS A;  1RK9 A;  5ER4 X;  1L2O C;  1KSO A;  4QJ3 B;  2KI6 D;  1KK7 Z;  3EVU A;  2M1U A;  1K95 A;  1QLS A;  3I5H C;  5AAN A;  4R1E A;  1G4Y R;  4JWQ A;  4ZCV A;  1UUR A;  1Y1U A;  2ZN9 A;  3GOF A;  1PK0 D;  1KFU L;  2BKH B;  2QPT A;  1W7J B;  2JT0 A;  4PE1 A;  1AP4 A;  5DKR A;  1IQ3 A;  1C7V A;  1MUX A;  4N1G A;  1CDL A;  2PRU A;  4BY4 A;  4D1E A;  2PVB A;  3JVT C;  1OMV A;  3NSK A;  4JPZ B;  4L9M A;  5AEQ A;  1CLM A;  4MN0 A;  2LAP A;  1IKU A;  1EG3 A;  2BKI B;  2OS8 C;  1GGW A;  2LUX A;  1SK6 D;  1CLL A;  4USL A;  2Q91 A;  1U5I B;  3O6B A;  1YTZ C;  3I5F B;  3MSE B;  3KF9 A;  2BCX A;  4AQI A;  1NUB A;  4YGA A;  5CSI A;  1OMR A;  2HQ8 A;  1SYM A;  3DF0 B;  1SNL A;  4YGB B;  1SKT A;  1RWY A;  1F55 A;  1QX2 A;  3FIA A;  3FWB A;  1S36 A;  3O2P A;  1NX2 A;  3PFV A;  1DJI A;  1CM1 A;  1K9U A;  4ICB A;  5HKZ A;  1PSB A;  2E30 A;  4XJK A;  3EK7 A;  4A4B A;  3TDU A;  3AKA A;  2OPO A;  4PHJ A;  2JT8 A;  2KYC A;  1J1D A;  2M49 B;  2LV7 A;  1S5G Y;  1PUL A;  2L4I A;  2LVV A;  2MBX A;  2JUL A;  4BY5 A;  2MLF C;  2JTT A;  2PAL A;  4MZK A;  1A75 B;  1M63 B;  3CR4 X;  1X02 A;  2AUC A;  3TS5 B;  1XFU O;  3BOW A;  3SG2 A;  3D10 A;  4N5X A;  2BBN A;  2M29 A;  3I5F C;  1H4B A;  2EGD A;  3NXA A;  4C0L A;  1NWD A;  1AHR A;  5DKN A;  1KWO B;  4OR9 B;  2SCP A;  1J7R A;  1YRT B;  1QAS A;  2LP2 A;  1N65 A;  5HLO A;  2K61 A;  3OHM B;  1K9K A;  4AQJ A;  3KEV A;  1KFX S;  4GFT A;  1J7Q A;  3WNX B;  1OZS A;  5JJG A;  3DVM A;  2GGM A;  1Y1X A;  3WHT B;  4GPL B;  2KI6 C;  1QX5 B;  4NQG A;  2MLE C;  2BCB A;  4M2Q A;  5ER5 A;  1ZAC A;  3PAT A;  3SG5 A;  4F0Z B;  2M7N A;  2CTN A;  3BUN B;  1ALW A;  1XA5 A;  2WCB A;  1F54 A;  2JTZ A;  3PN7 C;  2JXC A;  4MVF A;  1JFJ A;  5KU1 A;  1J1E A;  3HX4 A;  1KSM A;  3TS5 C;  2LMU A;  1MWN A;  3AAK A;  1NCX A;  1WLZ A;  2FCD A;  1EXR A;  1B9A A;  1NX0 A;  2LC5 A;  1YVH A;  3D0Y A;  4CFQ A;  3TZ1 A;  1NYA A;  2WC8 A;  1KFU S;  1F4Q A;  1CFD A;  2M97 A;  2Y1M A;  4PHK A;  1BJF A;  4YGE B;  1S5G Z;  3CWG A;  1LKJ A;  4PAL A;  1IG5 A;  2KFH A;  2L4H A;  2PMY A;  5I2O A;  1JC2 A;  2MAZ A;  1D1O A;  2WOR A;  1DMO A;  4C0K A;  2LE9 B;  3IF7 A;  4DIR A;  4ORA B;  4GGN A;  1DVI A;  4GNK B;  1XK4 A;  2LCP A;  1TNW A;  2KDH A;  3EVV A;  1XVJ A;  3FWC A;  3GK2 A;  3GK1 A;  3EK4 A;  4NDC A;  2M3W A;  3VRR A;  1MXL C;  3JTD B;  2TN4 A;  1IJ5 A;  3KPX A;  2LM5 A;  2LVK A;  4U8D A;  2GGZ A;  2KAV A;  4HSZ A;  2OS8 B;  2JNF A;  2G2B A;  2JPT A;  1A2X A;  3LCP C;  5HKW A;  2JNX A;  3LK0 A;  3EK8 A;  2LLT A;  1XFW O;  2MA2 A;  2K2F A;  2KHN A;  5FYX A;  1SY9 A;  1OSA A;  2V53 A;  1B4C A;  4OKH A;  1VRK A;  2ZRT A;  5CSJ A;  2WCE A;  2BL0 B;  5JOL A;  4MZJ A;  3BYA A;  2HET A;  2LLS A;  1B8L A;  1UHH A;  1XO5 A;  4MLW A;  2AAO A;  1S6J A;  2WCF A;  3WXA A;  3OX6 A;  4FTG A;  1QIV A;  4HRG A;  5B8I B;  1BF5 A;  4ZCU A;  1WY9 A;  1DF0 B;  1EG4 A;  4GGF C;  1EL4 A;  1IWQ A;  4MRY A;  4I5K A;  1A4P A;  2WOS A;  2CXJ A;  3JTD C;  3SG7 A;  3BUX B;  4N1F A;  2H61 C;  2ZRS A;  1M45 A;  4MBE A;  3NSL A;  5HLV A;  1SCM B;  5DKQ A;  2LVI A;  4GUK A;  3KO0 A;  5CSF A;  2D8N A;  3C1V A;  1NCY A;  1S6I A;  1SR6 B;  3O4Y A;  1CKK A;  1TNQ A;  1CDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...