2KBMA

Ca-s100a1 interacting with trtk12
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords F-actin-capping protein subunit alpha-2
publication title Solution structure of Ca-S100A1-TRTK12
rcsb
source organism Rattus norvegicus
total genus 21
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kbmA00
3CLNA 1IRJA 1BT6A 2L0PA 4GPLB 2KQYA 4JWQA 1KSOA 3KF9A 2QPTA 3IQOA 1JF0A 3LK1A 2KFFA 3C1VA 1M46A 3O6BA 4QJ5B 3OB2B 4I5NB 1EXRA 2AUCA 1TNQA 2O5GA 5AANA 1WLMA 4Q04A 3PSRA 1AVSA 3KO0A 1QLSA 1CDMA 1UHJA 3D0YB 3E3RA 1C7VA 2L5XB 1KFUL 1ZMZA 4MZLA 3NSKA 2LVKA 4PHNA 3CR2A 2F3YA 1JUOA 1Y1XA 3BUNB 4HRGA 1NX3A 2JQ6A 4N5XA 3BYAA 1WRZA 2MAZA 2K7OA 2JC2A 5FYXA 2LAPA 2I2RE 2LANA 1LKJA 2PSRA 4JQ0D 1PULA 3SIBA 5JJGA 4YGBB 3SG6A 5D7FA 4XJKA 1FPWA 2BBMA 1ALVA 2GV5A 5KU1A 1AJ5A 4BY5A 2Q4UA 3PALA 4ICBA 4QJ3B 5AFPA 1FI6A 2M29A 4ZCVA 1VRKA 1CDPA 1RWYA 2BKHB 2SCPA 2PALA 4GGNA 4C0KA 3I5HB 4YGAA 1WRKA 1B8LA 1NCZA 2M3WA 2K7BA 1OOJA 3FIAA 3TS5C 1CKKA 1SW8A 2LLSA 1L2OC 2KGBC 1M63B 1G33A 1RTP1 4MZJA 2M0RA 1XK4A 2WCFA 1NX2A 3VRRA 2KBMA 1GGWA 1SK6D 2KYCA 1MQ1A 1XFYO 2ZNEA 1KCYA 1XFVO 4GGFC 1V1FA 1YX8A 3DF0B 5HKYA 2CXJA 1QXPA 3CTNA 1B8RA 2LE9B 3O4YA 1X02A 1SL9A 1XO5A 1A4PA 1AP4A 3GOFA 2COLB 2V53A 2KQ6A 4TNCA 1NCYA 4XYNA 1B8CA 2ZRSA 5CSIA 3RLZA 1CTRA 1NX1A 2FOTA 1QTXA 3OP0A 1IG5A 1RFJA 2F33A 1XFZO 1SMGA 1ZACA 2I18A 1SYMA 1SNLA 1QX2A 5AXIA 3CGAA 5AERA 3D10A 2HF5A 1A75B 1OZOA 2LNKA 1DMOA 1PK0D 5HKWA 2OTGC 4WRIA 2PVBA 3DVJA 3ICBA 4HSZA 1AUIB 3O78A 1CM4A 2KFHA 2KI6C 1BLQA 4N1FA 2NCPA 2EC6C 4NQGA 1GGZA 4JPZB 4YI8A 3TS5B 1GQMA 5I2OA 2BL0B 1IH0A 1F55A 1SKTA 2WCBA 1S36A 1UHKA 5G08A 4N1GA 4C0JA 4MSPA 5CSNA 3SG3A 5HLOA 4CIDA 5IBWA 2K0JA 1L7ZA 4PE0A 2MRDA 2O60A 1IQ5A 2PASA 1K96A 1KK8C 1TNXA 3VRPA 4C0LA 2BCBA 1ZUZA 4UPGA 1F70A 2I94A 1E8AA 1CFCA 1DTLA 4CLNA 1W7JB 2JTTA 1DVIA 2LV7A 1ODBA 3SG5A 2M9GA 1CLBA 4GUKA 1J7RA 1AK8A 1LA3A 2JXCA 3M0WA 4YGDB 4AQIA 1QIWA 1SR6C 1J1DA 2SASA 4FTGA 4YGEB 1AHRA 4U8DA 2JNFA 5KTYA 4OV2A 2MBXA 1KFUS 1N0YA 2LUCA 1PVBA 2WOSA 3FWCA 2I7AA 1DGUA 2LVVA 2OTGB 1IQ3A 1H4BA 4QJ4B 1MF8B 2PMYA 2VRGA 1UHHA 1SY9A 1MR8A 5D69A 2EC6B 1IGVA 3I5FC 5PALA 1S26D 5CPVA 1W7IB 4F0ZB 1ZFSA 2K8MB 4NDBA 3VRQA 4YRUA 2K2FA 4DIRA 1CM1A 4OVNF 1IWQA 1EG3A 3ZWHA 1SCVA 4DCKA 2LP3A 1IJ5A 2D8NA 2ZFDA 3DVKA 1CLMA 2JZIA 4MN0A 2MA2A 3EK8A 3F45A 1PSRA 2RGIA 1KK8B 3ZNIA 1DF0A 4YBHB 4GAOA 2NCOA 1TTXA 3TDUA 1S6JA 1B9AA 1KWOB 2E30A 3H4SE 1BMOA 1UUSA 2IS9A 1RK9A 2M8UA 3AAJA 3BOWB 4PHJA 2LM5A 4M2PA 1UP5A 1U5IA 2ZKMX 1DJYA 1PSBA 1BR1B 2CCMA 4HREE 1CNPA 5HKZA 2L4HA 1SL7A 1G4YR 2KDHA 1GJYA 1K93D 1QX7A 1N65A 2F2OA 2LMTA 1M31A 3EVVA 3KPXA 3LL8B 1B4CA 2BECA 1BODA 2KHNA 1NCXA 1K9KA 2H61A 3OX6A 3GK1A 1OQPA 1QVIZ 1DJXA 2EHBA 2KI6D 1SL8A 3I5IC 1LA0A 3PLFB 1YX7A 3BXKA 3I5FB 1K94A 2LLTA 1KQMC 4HRHA 2B1UA 1RJVA 3EKHA 1UHNA 3HX4A 2BBNA 3LK0A 5HYDA 1Y1UA 4MRXA 1AJ4A 1NUBA 4ORAB 2PRUA 1JWDA 1CDNA 3AKAA 1SBJA 2KOTA 2MLFC 1QASA 2M49B 3AAKA 4ORBB 1FF1A 1CDLA 3WNXB 3D0YA 1Y0VH 2L50A 4PHMA 1QJTA 2HETA 3SG2A 2K7DA 1XK4C 4CPVA 2MLEC 1DJZA 4OCIA 3BUXB 1DJHA 2KNEA 1NPQA 4P5OE 2AAOA 1J55A 3VROA 1HT9A 1S5GZ 1J1EA 1KK7Z 3JTDC 1EG4A 3KHEA 1WY9A 4USLA 1L2OB 4M2QA 2ZN9A 2Y5IA 1QLKA 1NP8A 1WDCC 5K89A 1B7TZ 1BR4B 1BU3A 3EVRA 5KSZA 4IL1A 3LCPC 4I5KA 1HQVA 3SJSA 5ER5A 2NZ0A 1YTZC 2ZRTA 1TOPA 1RECA 1LVCD 3EK7A 5I2LA 1NSHA 3JVTC 1BOCA 5B8IB 2HPSA 2KAVA 3I5IB 4AOMA 1BG1A 1YUTA 2WCEA 4L9MA 4MZKA 1QATA 1QV0A 1CMFA 1F71A 1KQMB 4YGCB 1K90D 3WXAA 1DT7B 2LVJA 4NDCA 1TIZA 2M1UA 3CS1A 2BKIB 1B47A 2DOQA 2LUXA 4E68A 1XFWO 3EVUA 2OS8C 4XJKB 1OMDA 1RROA 2JT8A 4PE4A 4OKHA 2F2PA 4WQ2A 1BF5A 1CMGA 4PE7A 2M1KB 4GNKB 1SPYA 4FQOA 2MHHA 4ORCB 2LMUA 1JSAA 1S1EA 1KFXL 2LC5A 1OZSA 3DF0A 4MRYA 1NWDA 2CBLA 1M45A 1YRTB 1UWOA 1OMVA 2LHIA 3IQQA 1PALA 3SG7A 2LHLA 3TUYC 2KYFA 2JXLA 3EK4A 1CFDA 1XA5A 3PM8A 2FCDA 5BPJA 1A03A 4PALA 1MUXA 1ALWA 1XYDA 4D1EA 1PVAA 1CB1A 2K7CA 2BCXA 5TNCA 1K9PA 2JOJA 3EKJA 1MWNA 1LXFC 1EL4A 1TCOB 1UHIA 1M39A 2TN4A 3MSEB 1DJGA 1YUSA 4MVFA 3NXAA 4PDZA 2Q91A 3O2PA 1K8UA 3VRNA 1WDCB 1IKUA 1A75A 1YVLA 1R2UA 2KSPA 1BJFA 4GBAA 2G2BA 2FJUB 1A2XA 2BE6A 2JNXA 3PN7C 1G8IA 2BCAA 1C07A 3SIAA 3JVTB 4PHKA 2ZN8A 2M7LA 1J7QA 1C7WA 1JF2A 2JU0A 1Q80A 2JPTA 3LLEA 2LMVA 1K2HA 2WNDA 1B1GA 4BY4A 1MHOA 3NSLA 1Y6WA 3CR5X 2OS8B 1Y1AA 1SR6B 2JT0A 2K61A 1F54A 1QS7A 2R2IA 2Y1MA 5JOLA 1TNPA 2F8PA 1F8HA 1MXEA 4GGFA 5F6TA 3OHMB 1FI5A 3QRXA 3OB1B 1UURA 4A4BA 3BUOB 1DGVA 4DS7A 2L98A 3VGOA 1A29A 1SCMC 3TDZA 1EH2A 2CT9A 4CFRA 5I2QA 2LLUA 3TUYB 3TZ1A 1V1GA 2M97A 2M7NA 2JTZA 1YURA 3OX5A 4MEWA 1MXLC 5CSJA 1KQVA 4PCWA 1PRWA 1R6PA 1EJ3A 2JRFA 3CZTX 1S6IA 1YR5A 1D1OA 3I5GC 1NIWA 2BL0C 2NXQA 3WHTB 3BQ3A 1CFFA 2EGDA 4A4CA 3PFVA 3WHUB 1OSAA 1NX0A 1WRLA 2KI4C 3BUMB 1N2DA 2JWWA 3PN7B 4WQ3A 3DD4A 1FBVA 2KAXA 5DKNA 2CNPA 1JFJA 2QACA 3CWGA 3A4UB 2GGZA 2NLNA 2G9BA 1YVHA 3SG4A 2Y4QA 3NSIA 1KSMA 2JT3A 5DKQA 4PE1A 4YI9A 5ER4X 1QV1A 1TCFA 1QVIY 2H61C 2HQ8A 3K21A 2GGMA 2L4IA 2L2EA 2Y1NA 3IF7A 1TN4A 1WLZA 2KAYA 3GK4X 1NYAA 1F4OA 3FWBA 1IJ6A 4GFTA 4I5LB 3KEVA 5DKRA 5AEQA 2MJWB 1JBAA 4P2YB 1SCMB 2WC8A 5J3XA 3TDIA 3BOWA 3HCMA 1J7OA 2F3ZA 1CFPA 2BE4A 3DVMA 1KFXS 4M2OA 4ETOA 1TNWA 4AQJA 2LVIA 2OPOA 1XVJA 4OR9B 1S3PA 1DF0B 1YUUA 1QIVA 3NSOA 1TRFA 3I5GB 3CR4X 1LINA 1J7PA 1K95A 4ZCUA 2LCPA 2L51A 2P6BB 1SRAA 1U5IB 3AKBA 2FCEA 1OE9B 5I8NA 1FW4A 1S5GY 2KI4B 1JFKA 1KK7Y 3BUWB 1DJIA 2K2AA 3DVEA 2KFGA 2ISDA 1F4QA 2AMIA 2E6WA 3FS7A 5CSFA 1H8BA 1CLLA 1K9UA 3GK2A 1B7TY 4DRWA 2HQWA 1YRUB 2KBIA 2LP2A 1DJWA 4R1EA 3A8RA 2JULA 1JC2A 2A4JA 1KWOC 4MLWA 1XFUO 4MBEA 3RM1A 1S6CA 1ZOTB 5GQQC 4DUQA 2CTNA 2KGRA 4CFQA 3PATA 1OMRA 4NDDA 5HLVA 1QX5B 2H2KA 2ZNDA 3JTDB 4I5JA 3I5HC 2WORA 1XFXO
chains in the Genus database with same CATH superfamily
3CLNA 1IRJA 1BT6A 2L0PA 2WC5A 4GPLB 2KQYA 4JWQA 1KSOA 3KF9A 3FE9A 2QPTA 3IQOA 1JF0A 3LK1A 2KFFA 3TS5C 3C1VA 3PJIA 1M46A 3O6BA 1Z4HA 1Z2CB 3OB2B 4QJ5B 4I5NB 1EXRA 2AUCA 1TNQA 2O5GA 5AANA 3B87A 1WLMA 4Q04A 3PSRA 1AVSA 3KO0A 1QLSA 1CDMA 1UHJA 3D0YB 3E3RA 3D77A 1C7VA 2L5XB 1KFUL 1ZMZA 4MZLA 3NSKA 2LVKA 4PHNA 3CR2A 2F3YA 1C3ZA 1JUOA 1Y1XA 3BUNB 2L2CA 4HRGA 1NX3A 2JQ6A 4N5XA 2JPOA 3BYAA 1WRZA 2KLDA 2MAZA 2KPHA 3CZ0A 2K7OA 2JC2A 5FYXA 2K60A 2LAPA 2I2RE 2LANA 1LKJA 2PSRA 4JQ0D 1PULA 3SIBA 5JJGA 4YGBB 3SG6A 5D7FA 3L47A 4XJKA 1FPWA 2BBMA 1ALVA 2GV5A 5KU1A 1AJ5A 4BY5A 2BAPA 2Q4UA 3PALA 4ICBA 2WC6A 4QJ3B 5AFPA 1FI6A 2M29A 4ZCVA 1VRKA 1CDPA 1RWYA 2BKHB 2SCPA 2PALA 4GGNA 4C0KA 3K1EA 1SSEB 3I5HB 4YGAA 1WRKA 1B8LA 1NCZA 2M3WA 2K7BA 1OOJA 3FIAA 3L4AA 1CKKA 3S0AA 1SW8A 2LLSA 1L2OC 2KGBC 1M63B 3L4LA 1G33A 1RTP1 4MZJA 2M0RA 1XK4A 2WCFA 1NX2A 3VRRA 1LS8A 2KBMA 2QEBA 1SK6D 2KYCA 1MQ1A 1XFYO 2ZNEA 1GGWA 1KCYA 1XFVO 4GGFC 1V1FA 3PM2A 1YX8A 3DF0B 5HKYA 2CXJA 1QXPA 3CTNA 1B8RA 2LE9B 3O4YA 1X02A 1SL9A 1XO5A 1A4PA 1AP4A 3GOFA 2COLB 2V53A 2KQ6A 1TUJA 1NCYA 4TNCA 4XYNA 1B8CA 2ZRSA 5CSIA 3RLZA 1CTRA 1NX1A 2FOTA 1QTXA 3OP0A 1IG5A 1RFJA 2F33A 3DY9A 1XFZO 1SMGA 1ZACA 3CABA 2I18A 1SYMA 1SNLA 1QX2A 5AXIA 3CGAA 5AERA 3D10A 2HF5A 1A75B 1OZOA 2LNKA 1DMOA 1PK0D 5HKWA 1OOGA 2OTGC 4WRIA 2PVBA 3DVJA 3ICBA 4HSZA 1AUIB 3O78A 1CM4A 1OOIX 2KFHA 2KI6C 1BLQA 4N1FA 2NCPA 2EC6C 4NQGA 1GGZA 4JPZB 3D74A 4YI8A 3TS5B 1GQMA 5I2OA 2BL0B 1IH0A 1F55A 1SKTA 2WCBA 1S36A 1UHKA 1XFRA 5G08A 4N1GA 4C0JA 4MSPA 5CSNA 3SG3A 5HLOA 4CIDA 5IBWA 2K0JA 1L7ZA 3D73A 3S0FA 3EG5B 4PE0A 2MRDA 2O60A 1IQ5A 3BFBA 2PASA 1K96A 1KK8C 1TNXA 3NHTA 3VRPA 2BCBA 1ZUZA 4C0LA 4UPGA 2I94A 1E8AA 1CFCA 1DTLA 2BNXA 4CLNA 1W7JB 2JTTA 1DVIA 2LV7A 5D3OA 1ODBA 3SG5A 2M9GA 1CLBA 4GUKA 1J7RA 1AK8A 1LA3A 3UO9A 2JXCA 3M0WA 4YGDB 4AQIA 1QIWA 1SR6C 1J1DA 2FJYA 2SASA 4FTGA 4YGEB 1AHRA 4U8DA 2JNFA 5KTYA 4OV2A 2MBXA 1T14A 1KFUS 1N0YA 2LUCA 1PVBA 2WOSA 3FWCA 2I7AA 1DGUA 2PQLA 3S0DA 3V2LA 2LVVA 3R72A 2OTGB 1IQ3A 1H4BA 4QJ4B 1MF8B 2PMYA 2VRGA 1UHHA 1SY9A 1MR8A 5D69A 2EC6B 1IGVA 2YGUA 3I5FC 5PALA 3D76A 1S26D 5CPVA 3OBVA 1W7IB 4F0ZB 5DICA 1ZFSA 2K8MB 4NDBA 3VRQA 4YRUA 2K2FA 4DIRA 1CM1A 4OVNF 1IWQA 1EG3A 3ZWHA 1SCVA 4DCKA 2LP3A 1IJ5A 2D8NA 2ZFDA 2QEOA 3DVKA 1CLMA 2JZIA 4MN0A 2MA2A 3EK8A 3F45A 3S0EA 1PSRA 2RGIA 1KK8B 3ZNIA 1DF0A 4YBHB 4GAOA 2NCOA 1TTXA 3TDUA 1S6JA 1B9AA 1KWOB 2E30A 3H4SE 1BMOA 1UUSA 2IS9A 3NHIA 1RK9A 2M8UA 3AAJA 3BOWB 4PHJA 2LM5A 4M2PA 1UP5A 1U5IA 4PT1A 2ZKMX 1DJYA 1PSBA 1BR1B 4OZDA 2CCMA 4HREE 1CNPA 5HKZA 2L4HA 1SL7A 1G4YR 2KDHA 1GJYA 1K93D 1QX7A 2PYQA 1N65A 3CDNA 2F2OA 2LMTA 1M31A 3EVVA 3KPXA 3LL8B 1B4CA 2BECA 1BODA 2KHNA 1NCXA 1K9KA 2H61A 3D75A 3GK1A 3OX6A 1DC1A 1OQPA 1QVIZ 1DJXA 2EHBA 2KI6D 1SL8A 3I5IC 1LA0A 2WCHA 3PLFB 1YX7A 3BXKA 3I5FB 1K94A 2LLTA 1KQMC 4HRHA 2B1UA 3B7AA 1RJVA 1P28A 4INXA 4JD9A 1F70A 3EKHA 2QEVA 1UHNA 4INWA 3HX4A 2BBNA 3LK0A 5HYDA 1Y1UA 2P70A 4MRXA 1AJ4A 1NUBA 3Q8IA 1OOFA 4ORAB 2PRUA 1JWDA 1CDNA 1DELA 3AKAA 1SBJA 2KOTA 2MLFC 1QASA 3QMEA 2M49B 3AAKA 4ORBB 1FF1A 1CDLA 3WNXB 3D0YA 1Y0VH 2L50A 4JKTA 1QJTA 2HETA 4PHMA 3SG2A 2K7DA 1XK4C 4CPVA 2MLEC 1DJZA 4OCIA 3BUXB 3DXLA 1DJHA 2KNEA 1NPQA 4P5OE 2AAOA 1J55A 3VROA 1HT9A 1S5GZ 1J1EA 1KK7Z 3JTDC 1EG4A 3FE8A 3KHEA 4KYNA 1WY9A 3BFHA 4USLA 1L2OB 4M2QA 2ZN9A 2Y5IA 1QLKA 1NP8A 1WDCC 5K89A 1B7TZ 1BR4B 1BU3A 3EVRA 5KSZA 4IL1A 3LCPC 4I5KA 1HQVA 3SJSA 5ER5A 2NZ0A 1YTZC 1OOHA 2ZRTA 1TOPA 1RECA 1LVCD 3EK7A 5I2LA 1NSHA 3JVTC 1JBAA 1BOCA 5B8IB 2HPSA 2KAVA 3I5IB 4AOMA 1BG1A 1YUTA 2WCEA 4L9MA 4MZKA 1QATA 1QV0A 1CMFA 1F71A 1DEKA 1KQMB 4YGCB 1K90D 3WXAA 1DQEA 1DT7B 2LVJA 4NDCA 1TIZA 2M1UA 3B86A 3CS1A 2BKIB 1B47A 2DOQA 2LUXA 2WCKA 4E68A 1XFWO 3EVUA 2OS8C 3UNWA 4XJKB 1OMDA 1RROA 2JT8A 4PE4A 2ERBA 4OKHA 2F2PA 3N7HA 4WQ2A 1BF5A 1CMGA 4PE7A 2M1KB 4GNKB 1SPYA 4FQOA 2MHHA 4ORCB 2LMUA 1JSAA 1S1EA 1KFXL 2LC5A 1OZSA 3DF0A 4MRYA 1NWDA 2CBLA 1M45A 1YRTB 1UWOA 1OMVA 3VB1A 2LHIA 3IQQA 1PALA 3SG7A 2LHLA 4IJ7A 2KYFA 3TUYC 2JXLA 3EK4A 1CFDA 1XA5A 3PM8A 2FCDA 3SS4A 5BPJA 4PALA 1A03A 2QDIA 1MUXA 1ALWA 1XYDA 5FI2A 1PVAA 4D1EA 1CB1A 2K7CA 2BCXA 5TNCA 1K9PA 2JOJA 3EKJA 1MWNA 1LXFC 1UHIA 1EL4A 1TCOB 1M39A 2TN4A 3MSEB 3RZSA 1DJGA 1YUSA 4MVFA 3NXAA 4PDZA 3SS5A 2Q91A 3O2PA 1K8UA 3VRNA 1WDCB 1IKUA 1A75A 1YVLA 1IIOA 1R2UA 2KSPA 1BJFA 4GBAA 2QEHA 2G2BA 2FJUB 1A2XA 1QWVA 2BE6A 2JNXA 3PN7C 1G8IA 2BCAA 1C07A 3SIAA 3JVTB 4PHKA 2ZN8A 2M7LA 1J7QA 1C7WA 1JF2A 2JU0A 1Q80A 2JPTA 3LLEA 2LMVA 1K2HA 3NGVA 3R1OA 2WNDA 1B1GA 4BY4A 1MHOA 3NSLA 1Y6WA 3CR5X 3S0BA 2OS8B 1Y1AA 2WCLA 1SR6B 2JT0A 2K61A 1F54A 2P71A 1QS7A 2R2IA 2Y1MA 5JOLA 1TNPA 2F8PA 1F8HA 1MXEA 4GGFA 5F6TA 3OHMB 1FI5A 3QRXA 3OB1B 1UURA 4A4BA 3BUOB 1DGVA 4DS7A 2L98A 3VGOA 1A29A 1SCMC 3TDZA 3B88A 1TUZA 2H8VA 2WCJA 1EH2A 2CT9A 4CFRA 5I2QA 2LLUA 3TUYB 3TZ1A 1V1GA 2M97A 2M7NA 2JTZA 1YURA 3OX5A 4MEWA 1MXLC 5CSJA 3CZ2A 1KQVA 3DYEA 4PCWA 1PRWA 1R6PA 1EJ3A 2JRFA 3CZTX 1S6IA 3R1VA 1YR5A 1D1OA 3FE6A 3I5GC 1NIWA 2BL0C 2NXQA 3SS3A 3WHTB 3BQ3A 1CFFA 2EGDA 4A4CA 4FQTA 3PFVA 3WHUB 1W9ZA 1OSAA 1NX0A 1WRLA 2KI4C 3BUMB 1N2DA 2JWWA 3PN7B 4WQ3A 3IVTA 3DD4A 1FBVA 2KAXA 5DKNA 2CNPA 1JFJA 2QACA 3CWGA 3R1PA 3A4UB 2GGZA 2NLNA 2G9BA 1YVHA 3SG4A 2Y4QA 3CZ1A 3NSIA 1KSMA 2KLEA 2JT3A 5DKQA 4PE1A 4YI9A 5ER4X 1QV1A 1TCFA 1QVIY 2H61C 2HQ8A 3K21A 1ORGA 2GGMA 2L4IA 2L2EA 2Y1NA 5HL1A 3IF7A 1TN4A 1WLZA 2KAYA 5I94A 3GK4X 1NYAA 1F4OA 3FWBA 1IJ6A 4GFTA 4I5LB 3KEVA 5DKRA 3B6XA 2MJWB 3BJHA 5AEQA 4P2YB 1SCMB 2WC8A 5J3XA 3TDIA 3BOWA 3HCMA 1GM0A 1J7OA 2F3ZA 1CFPA 3S0GA 2BE4A 3DVMA 1KFXS 4M2OA 4ETOA 2GTEA 1TNWA 4AQJA 2LVIA 2OPOA 1XVJA 4OR9B 5EL2A 1S3PA 1DF0B 1YUUA 1QIVA 3NSOA 1TRFA 3I5GB 3CR4X 1LINA 1TWOA 2L5YA 5FI7A 1K95A 4ZCUA 2LCPA 1J7PA 2L51A 2P6BB 1SRAA 1U5IB 3AKBA 2FCEA 1OE9B 5I8NA 1FW4A 1S5GY 2KI4B 1JFKA 5FI6A 1KK7Y 3BUWB 1DJIA 2K2AA 3DVEA 2KFGA 2ISDA 1F4QA 2AMIA 2E6WA 3FS7A 3D78A 5CSFA 1H8BA 1CLLA 1K9UA 3GK2A 1B7TY 3OGNA 4DRWA 2HQWA 1YRUB 2KBIA 2LP2A 1DJWA 4R1EA 3A8RA 2JULA 3DZTA 2A4JA 1KWOC 3O4XA 4F7FA 1JC2A 3CYZA 3BFAA 2WCMA 4MLWA 1XFUO 4MBEA 3RM1A 1S6CA 1ZOTB 5GQQC 4DUQA 2CTNA 2KGRA 4CFQA 3PATA 1OMRA 4NDDA 5HLVA 1OW4A 1QX5B 2H2KA 2ZNDA 3JTDB 4I5JA 1C3YA 3I5HC 2WORA 1XFXO
chains in the Genus database with same CATH topology
3CLNA 1IRJA 1BT6A 2L0PA 4GPLB 2KQYA 4JWQA 1KSOA 3KF9A 2QPTA 3IQOA 1JF0A 3LK1A 2KFFA 3C1VA 1M46A 3O6BA 4QJ5B 3OB2B 4I5NB 1EXRA 2AUCA 1TNQA 2O5GA 5AANA 1WLMA 4Q04A 3PSRA 1AVSA 3KO0A 1QLSA 1CDMA 1UHJA 3D0YB 3E3RA 1C7VA 2L5XB 1KFUL 1ZMZA 4MZLA 3NSKA 2LVKA 4PHNA 3CR2A 2F3YA 1JUOA 1Y1XA 3BUNB 4HRGA 1NX3A 2JQ6A 4N5XA 3BYAA 1WRZA 2MAZA 2K7OA 2JC2A 5FYXA 2LAPA 2I2RE 2LANA 1LKJA 2PSRA 4JQ0D 1PULA 3SIBA 5JJGA 4YGBB 3SG6A 5D7FA 4XJKA 1FPWA 2BBMA 1ALVA 2GV5A 5KU1A 1AJ5A 4BY5A 2Q4UA 3PALA 4ICBA 4QJ3B 5AFPA 1FI6A 2M29A 4ZCVA 1VRKA 1CDPA 1RWYA 2BKHB 2SCPA 2PALA 4GGNA 4C0KA 3I5HB 4YGAA 1WRKA 1B8LA 1NCZA 2M3WA 2K7BA 1OOJA 3FIAA 3TS5C 1CKKA 1SW8A 2LLSA 1L2OC 2KGBC 1M63B 1G33A 1RTP1 4MZJA 2M0RA 1XK4A 2WCFA 1NX2A 3VRRA 2KBMA 1GGWA 1SK6D 2KYCA 1MQ1A 1XFYO 2ZNEA 1KCYA 1XFVO 4GGFC 1V1FA 1YX8A 3DF0B 5HKYA 2CXJA 1QXPA 3CTNA 1B8RA 2LE9B 3O4YA 1X02A 1SL9A 1XO5A 1A4PA 1AP4A 3GOFA 2COLB 2V53A 2KQ6A 4TNCA 1NCYA 4XYNA 1B8CA 2ZRSA 5CSIA 3RLZA 1CTRA 1NX1A 2FOTA 1QTXA 3OP0A 1IG5A 1RFJA 2F33A 1XFZO 1SMGA 1ZACA 2I18A 1SYMA 1SNLA 1QX2A 5AXIA 3CGAA 5AERA 3D10A 2HF5A 1A75B 1OZOA 2LNKA 1DMOA 1PK0D 5HKWA 2OTGC 4WRIA 2PVBA 3DVJA 3ICBA 4HSZA 1AUIB 3O78A 1CM4A 2KFHA 2KI6C 1BLQA 4N1FA 2NCPA 2EC6C 4NQGA 1GGZA 4JPZB 4YI8A 3TS5B 1GQMA 5I2OA 2BL0B 1IH0A 1F55A 1SKTA 2WCBA 1S36A 1UHKA 5G08A 4N1GA 4C0JA 4MSPA 5CSNA 3SG3A 5HLOA 4CIDA 5IBWA 2K0JA 1L7ZA 4PE0A 2MRDA 2O60A 1IQ5A 2PASA 1K96A 1KK8C 1TNXA 3VRPA 4C0LA 2BCBA 1ZUZA 4UPGA 1F70A 2I94A 1E8AA 1CFCA 1DTLA 4CLNA 1W7JB 2JTTA 1DVIA 2LV7A 1ODBA 3SG5A 2M9GA 1CLBA 4GUKA 1J7RA 1AK8A 1LA3A 2JXCA 3M0WA 4YGDB 4AQIA 1QIWA 1SR6C 1J1DA 2SASA 4FTGA 4YGEB 1AHRA 4U8DA 2JNFA 5KTYA 4OV2A 2MBXA 1KFUS 1N0YA 2LUCA 1PVBA 2WOSA 3FWCA 2I7AA 1DGUA 2LVVA 2OTGB 1IQ3A 1H4BA 4QJ4B 1MF8B 2PMYA 2VRGA 1UHHA 1SY9A 1MR8A 5D69A 2EC6B 1IGVA 3I5FC 5PALA 1S26D 5CPVA 1W7IB 4F0ZB 1ZFSA 2K8MB 4NDBA 3VRQA 4YRUA 2K2FA 4DIRA 1CM1A 4OVNF 1IWQA 1EG3A 3ZWHA 1SCVA 4DCKA 2LP3A 1IJ5A 2D8NA 2ZFDA 3DVKA 1CLMA 2JZIA 4MN0A 2MA2A 3EK8A 3F45A 1PSRA 2RGIA 1KK8B 3ZNIA 1DF0A 4YBHB 4GAOA 2NCOA 1TTXA 3TDUA 1S6JA 1B9AA 1KWOB 2E30A 3H4SE 1BMOA 1UUSA 2IS9A 1RK9A 2M8UA 3AAJA 3BOWB 4PHJA 2LM5A 4M2PA 1UP5A 1U5IA 2ZKMX 1DJYA 1PSBA 1BR1B 2CCMA 4HREE 1CNPA 5HKZA 2L4HA 1SL7A 1G4YR 2KDHA 1GJYA 1K93D 1QX7A 1N65A 2F2OA 2LMTA 1M31A 3EVVA 3KPXA 3LL8B 1B4CA 2BECA 1BODA 2KHNA 1NCXA 1K9KA 2H61A 3OX6A 3GK1A 1OQPA 1QVIZ 1DJXA 2EHBA 2KI6D 1SL8A 3I5IC 1LA0A 3PLFB 1YX7A 3BXKA 3I5FB 1K94A 2LLTA 1KQMC 4HRHA 2B1UA 1RJVA 3EKHA 1UHNA 3HX4A 2BBNA 3LK0A 5HYDA 1Y1UA 4MRXA 1AJ4A 1NUBA 4ORAB 2PRUA 1JWDA 1CDNA 3AKAA 1SBJA 2KOTA 2MLFC 1QASA 2M49B 3AAKA 4ORBB 1FF1A 1CDLA 3WNXB 3D0YA 1Y0VH 2L50A 4PHMA 1QJTA 2HETA 3SG2A 2K7DA 1XK4C 4CPVA 2MLEC 1DJZA 4OCIA 3BUXB 1DJHA 2KNEA 1NPQA 4P5OE 2AAOA 1J55A 3VROA 1HT9A 1S5GZ 1J1EA 1KK7Z 3JTDC 1EG4A 3KHEA 1WY9A 4USLA 1L2OB 4M2QA 2ZN9A 2Y5IA 1QLKA 1NP8A 1WDCC 5K89A 1B7TZ 1BR4B 1BU3A 3EVRA 5KSZA 4IL1A 3LCPC 4I5KA 1HQVA 3SJSA 5ER5A 2NZ0A 1YTZC 2ZRTA 1TOPA 1RECA 1LVCD 3EK7A 5I2LA 1NSHA 3JVTC 1BOCA 5B8IB 2HPSA 2KAVA 3I5IB 4AOMA 1BG1A 1YUTA 2WCEA 4L9MA 4MZKA 1QATA 1QV0A 1CMFA 1F71A 1KQMB 4YGCB 1K90D 3WXAA 1DT7B 2LVJA 4NDCA 1TIZA 2M1UA 3CS1A 2BKIB 1B47A 2DOQA 2LUXA 4E68A 1XFWO 3EVUA 2OS8C 4XJKB 1OMDA 1RROA 2JT8A 4PE4A 4OKHA 2F2PA 4WQ2A 1BF5A 1CMGA 4PE7A 2M1KB 4GNKB 1SPYA 4FQOA 2MHHA 4ORCB 2LMUA 1JSAA 1S1EA 1KFXL 2LC5A 1OZSA 3DF0A 4MRYA 1NWDA 2CBLA 1M45A 1YRTB 1UWOA 1OMVA 2LHIA 3IQQA 1PALA 3SG7A 2LHLA 3TUYC 2KYFA 2JXLA 3EK4A 1CFDA 1XA5A 3PM8A 2FCDA 5BPJA 1A03A 4PALA 1MUXA 1ALWA 1XYDA 4D1EA 1PVAA 1CB1A 2K7CA 2BCXA 5TNCA 1K9PA 2JOJA 3EKJA 1MWNA 1LXFC 1EL4A 1TCOB 1UHIA 1M39A 2TN4A 3MSEB 1DJGA 1YUSA 4MVFA 3NXAA 4PDZA 2Q91A 3O2PA 1K8UA 3VRNA 1WDCB 1IKUA 1A75A 1YVLA 1R2UA 2KSPA 1BJFA 4GBAA 2G2BA 2FJUB 1A2XA 2BE6A 2JNXA 3PN7C 1G8IA 2BCAA 1C07A 3SIAA 3JVTB 4PHKA 2ZN8A 2M7LA 1J7QA 1C7WA 1JF2A 2JU0A 1Q80A 2JPTA 3LLEA 2LMVA 1K2HA 2WNDA 1B1GA 4BY4A 1MHOA 3NSLA 1Y6WA 3CR5X 2OS8B 1Y1AA 1SR6B 2JT0A 2K61A 1F54A 1QS7A 2R2IA 2Y1MA 5JOLA 1TNPA 2F8PA 1F8HA 1MXEA 4GGFA 5F6TA 3OHMB 1FI5A 3QRXA 3OB1B 1UURA 4A4BA 3BUOB 1DGVA 4DS7A 2L98A 3VGOA 1A29A 1SCMC 3TDZA 1EH2A 2CT9A 4CFRA 5I2QA 2LLUA 3TUYB 3TZ1A 1V1GA 2M97A 2M7NA 2JTZA 1YURA 3OX5A 4MEWA 1MXLC 5CSJA 1KQVA 4PCWA 1PRWA 1R6PA 1EJ3A 2JRFA 3CZTX 1S6IA 1YR5A 1D1OA 3I5GC 1NIWA 2BL0C 2NXQA 3WHTB 3BQ3A 1CFFA 2EGDA 4A4CA 3PFVA 3WHUB 1OSAA 1NX0A 1WRLA 2KI4C 3BUMB 1N2DA 2JWWA 3PN7B 4WQ3A 3DD4A 1FBVA 2KAXA 5DKNA 2CNPA 1JFJA 2QACA 3CWGA 3A4UB 2GGZA 2NLNA 2G9BA 1YVHA 3SG4A 2Y4QA 3NSIA 1KSMA 2JT3A 5DKQA 4PE1A 4YI9A 5ER4X 1QV1A 1TCFA 1QVIY 2H61C 2HQ8A 3K21A 2GGMA 2L4IA 2L2EA 2Y1NA 3IF7A 1TN4A 1WLZA 2KAYA 3GK4X 1NYAA 1F4OA 3FWBA 1IJ6A 4GFTA 4I5LB 3KEVA 5DKRA 5AEQA 2MJWB 1JBAA 4P2YB 1SCMB 2WC8A 5J3XA 3TDIA 3BOWA 3HCMA 1J7OA 2F3ZA 1CFPA 2BE4A 3DVMA 1KFXS 4M2OA 4ETOA 1TNWA 4AQJA 2LVIA 2OPOA 1XVJA 4OR9B 1S3PA 1DF0B 1YUUA 1QIVA 3NSOA 1TRFA 3I5GB 3CR4X 1LINA 1J7PA 1K95A 4ZCUA 2LCPA 2L51A 2P6BB 1SRAA 1U5IB 3AKBA 2FCEA 1OE9B 5I8NA 1FW4A 1S5GY 2KI4B 1JFKA 1KK7Y 3BUWB 1DJIA 2K2AA 3DVEA 2KFGA 2ISDA 1F4QA 2AMIA 2E6WA 3FS7A 5CSFA 1H8BA 1CLLA 1K9UA 3GK2A 1B7TY 4DRWA 2HQWA 1YRUB 2KBIA 2LP2A 1DJWA 4R1EA 3A8RA 2JULA 1JC2A 2A4JA 1KWOC 4MLWA 1XFUO 4MBEA 3RM1A 1S6CA 1ZOTB 5GQQC 4DUQA 2CTNA 2KGRA 4CFQA 3PATA 1OMRA 4NDDA 5HLVA 1QX5B 2H2KA 2ZNDA 3JTDB 4I5JA 3I5HC 2WORA 1XFXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  1IRJ A;  1BT6 A;  2L0P A;  4GPL B;  2KQY A;  4JWQ A;  1KSO A;  3KF9 A;  2QPT A;  3IQO A;  1JF0 A;  3LK1 A;  2KFF A;  3C1V A;  1M46 A;  3O6B A;  4QJ5 B;  3OB2 B;  4I5N B;  1EXR A;  2AUC A;  1TNQ A;  2O5G A;  5AAN A;  1WLM A;  4Q04 A;  3PSR A;  1AVS A;  3KO0 A;  1QLS A;  1CDM A;  1UHJ A;  3D0Y B;  3E3R A;  1C7V A;  2L5X B;  1KFU L;  1ZMZ A;  4MZL A;  3NSK A;  2LVK A;  4PHN A;  3CR2 A;  2F3Y A;  1JUO A;  1Y1X A;  3BUN B;  4HRG A;  1NX3 A;  2JQ6 A;  4N5X A;  3BYA A;  1WRZ A;  2MAZ A;  2K7O A;  2JC2 A;  5FYX A;  2LAP A;  2I2R E;  2LAN A;  1LKJ A;  2PSR A;  4JQ0 D;  1PUL A;  3SIB A;  5JJG A;  4YGB B;  3SG6 A;  5D7F A;  4XJK A;  1FPW A;  2BBM A;  1ALV A;  2GV5 A;  5KU1 A;  1AJ5 A;  4BY5 A;  2Q4U A;  3PAL A;  4ICB A;  4QJ3 B;  5AFP A;  1FI6 A;  2M29 A;  4ZCV A;  1VRK A;  1CDP A;  1RWY A;  2BKH B;  2SCP A;  2PAL A;  4GGN A;  4C0K A;  3I5H B;  4YGA A;  1WRK A;  1B8L A;  1NCZ A;  2M3W A;  2K7B A;  1OOJ A;  3FIA A;  3TS5 C;  1CKK A;  1SW8 A;  2LLS A;  1L2O C;  2KGB C;  1M63 B;  1G33 A;  1RTP 1;  4MZJ A;  2M0R A;  1XK4 A;  2WCF A;  1NX2 A;  3VRR A;  2KBM A;  1GGW A;  1SK6 D;  2KYC A;  1MQ1 A;  1XFY O;  2ZNE A;  1KCY A;  1XFV O;  4GGF C;  1V1F A;  1YX8 A;  3DF0 B;  5HKY A;  2CXJ A;  1QXP A;  3CTN A;  1B8R A;  2LE9 B;  3O4Y A;  1X02 A;  1SL9 A;  1XO5 A;  1A4P A;  1AP4 A;  3GOF A;  2COL B;  2V53 A;  2KQ6 A;  4TNC A;  1NCY A;  4XYN A;  1B8C A;  2ZRS A;  5CSI A;  3RLZ A;  1CTR A;  1NX1 A;  2FOT A;  1QTX A;  3OP0 A;  1IG5 A;  1RFJ A;  2F33 A;  1XFZ O;  1SMG A;  1ZAC A;  2I18 A;  1SYM A;  1SNL A;  1QX2 A;  5AXI A;  3CGA A;  5AER A;  3D10 A;  2HF5 A;  1A75 B;  1OZO A;  2LNK A;  1DMO A;  1PK0 D;  5HKW A;  2OTG C;  4WRI A;  2PVB A;  3DVJ A;  3ICB A;  4HSZ A;  1AUI B;  3O78 A;  1CM4 A;  2KFH A;  2KI6 C;  1BLQ A;  4N1F A;  2NCP A;  2EC6 C;  4NQG A;  1GGZ A;  4JPZ B;  4YI8 A;  3TS5 B;  1GQM A;  5I2O A;  2BL0 B;  1IH0 A;  1F55 A;  1SKT A;  2WCB A;  1S36 A;  1UHK A;  5G08 A;  4N1G A;  4C0J A;  4MSP A;  5CSN A;  3SG3 A;  5HLO A;  4CID A;  5IBW A;  2K0J A;  1L7Z A;  4PE0 A;  2MRD A;  2O60 A;  1IQ5 A;  2PAS A;  1K96 A;  1KK8 C;  1TNX A;  3VRP A;  4C0L A;  2BCB A;  1ZUZ A;  4UPG A;  1F70 A;  2I94 A;  1E8A A;  1CFC A;  1DTL A;  4CLN A;  1W7J B;  2JTT A;  1DVI A;  2LV7 A;  1ODB A;  3SG5 A;  2M9G A;  1CLB A;  4GUK A;  1J7R A;  1AK8 A;  1LA3 A;  2JXC A;  3M0W A;  4YGD B;  4AQI A;  1QIW A;  1SR6 C;  1J1D A;  2SAS A;  4FTG A;  4YGE B;  1AHR A;  4U8D A;  2JNF A;  5KTY A;  4OV2 A;  2MBX A;  1KFU S;  1N0Y A;  2LUC A;  1PVB A;  2WOS A;  3FWC A;  2I7A A;  1DGU A;  2LVV A;  2OTG B;  1IQ3 A;  1H4B A;  4QJ4 B;  1MF8 B;  2PMY A;  2VRG A;  1UHH A;  1SY9 A;  1MR8 A;  5D69 A;  2EC6 B;  1IGV A;  3I5F C;  5PAL A;  1S26 D;  5CPV A;  1W7I B;  4F0Z B;  1ZFS A;  2K8M B;  4NDB A;  3VRQ A;  4YRU A;  2K2F A;  4DIR A;  1CM1 A;  4OVN F;  1IWQ A;  1EG3 A;  3ZWH A;  1SCV A;  4DCK A;  2LP3 A;  1IJ5 A;  2D8N A;  2ZFD A;  3DVK A;  1CLM A;  2JZI A;  4MN0 A;  2MA2 A;  3EK8 A;  3F45 A;  1PSR A;  2RGI A;  1KK8 B;  3ZNI A;  1DF0 A;  4YBH B;  4GAO A;  2NCO A;  1TTX A;  3TDU A;  1S6J A;  1B9A A;  1KWO B;  2E30 A;  3H4S E;  1BMO A;  1UUS A;  2IS9 A;  1RK9 A;  2M8U A;  3AAJ A;  3BOW B;  4PHJ A;  2LM5 A;  4M2P A;  1UP5 A;  1U5I A;  2ZKM X;  1DJY A;  1PSB A;  1BR1 B;  2CCM A;  4HRE E;  1CNP A;  5HKZ A;  2L4H A;  1SL7 A;  1G4Y R;  2KDH A;  1GJY A;  1K93 D;  1QX7 A;  1N65 A;  2F2O A;  2LMT A;  1M31 A;  3EVV A;  3KPX A;  3LL8 B;  1B4C A;  2BEC A;  1BOD A;  2KHN A;  1NCX A;  1K9K A;  2H61 A;  3OX6 A;  3GK1 A;  1OQP A;  1QVI Z;  1DJX A;  2EHB A;  2KI6 D;  1SL8 A;  3I5I C;  1LA0 A;  3PLF B;  1YX7 A;  3BXK A;  3I5F B;  1K94 A;  2LLT A;  1KQM C;  4HRH A;  2B1U A;  1RJV A;  3EKH A;  1UHN A;  3HX4 A;  2BBN A;  3LK0 A;  5HYD A;  1Y1U A;  4MRX A;  1AJ4 A;  1NUB A;  4ORA B;  2PRU A;  1JWD A;  1CDN A;  3AKA A;  1SBJ A;  2KOT A;  2MLF C;  1QAS A;  2M49 B;  3AAK A;  4ORB B;  1FF1 A;  1CDL A;  3WNX B;  3D0Y A;  1Y0V H;  2L50 A;  4PHM A;  1QJT A;  2HET A;  3SG2 A;  2K7D A;  1XK4 C;  4CPV A;  2MLE C;  1DJZ A;  4OCI A;  3BUX B;  1DJH A;  2KNE A;  1NPQ A;  4P5O E;  2AAO A;  1J55 A;  3VRO A;  1HT9 A;  1S5G Z;  1J1E A;  1KK7 Z;  3JTD C;  1EG4 A;  3KHE A;  1WY9 A;  4USL A;  1L2O B;  4M2Q A;  2ZN9 A;  2Y5I A;  1QLK A;  1NP8 A;  1WDC C;  5K89 A;  1B7T Z;  1BR4 B;  1BU3 A;  3EVR A;  5KSZ A;  4IL1 A;  3LCP C;  4I5K A;  1HQV A;  3SJS A;  5ER5 A;  2NZ0 A;  1YTZ C;  2ZRT A;  1TOP A;  1REC A;  1LVC D;  3EK7 A;  5I2L A;  1NSH A;  3JVT C;  1BOC A;  5B8I B;  2HPS A;  2KAV A;  3I5I B;  4AOM A;  1BG1 A;  1YUT A;  2WCE A;  4L9M A;  4MZK A;  1QAT A;  1QV0 A;  1CMF A;  1F71 A;  1KQM B;  4YGC B;  1K90 D;  3WXA A;  1DT7 B;  2LVJ A;  4NDC A;  1TIZ A;  2M1U A;  3CS1 A;  2BKI B;  1B47 A;  2DOQ A;  2LUX A;  4E68 A;  1XFW O;  3EVU A;  2OS8 C;  4XJK B;  1OMD A;  1RRO A;  2JT8 A;  4PE4 A;  4OKH A;  2F2P A;  4WQ2 A;  1BF5 A;  1CMG A;  4PE7 A;  2M1K B;  4GNK B;  1SPY A;  4FQO A;  2MHH A;  4ORC B;  2LMU A;  1JSA A;  1S1E A;  1KFX L;  2LC5 A;  1OZS A;  3DF0 A;  4MRY A;  1NWD A;  2CBL A;  1M45 A;  1YRT B;  1UWO A;  1OMV A;  2LHI A;  3IQQ A;  1PAL A;  3SG7 A;  2LHL A;  3TUY C;  2KYF A;  2JXL A;  3EK4 A;  1CFD A;  1XA5 A;  3PM8 A;  2FCD A;  5BPJ A;  1A03 A;  4PAL A;  1MUX A;  1ALW A;  1XYD A;  4D1E A;  1PVA A;  1CB1 A;  2K7C A;  2BCX A;  5TNC A;  1K9P A;  2JOJ A;  3EKJ A;  1MWN A;  1LXF C;  1EL4 A;  1TCO B;  1UHI A;  1M39 A;  2TN4 A;  3MSE B;  1DJG A;  1YUS A;  4MVF A;  3NXA A;  4PDZ A;  2Q91 A;  3O2P A;  1K8U A;  3VRN A;  1WDC B;  1IKU A;  1A75 A;  1YVL A;  1R2U A;  2KSP A;  1BJF A;  4GBA A;  2G2B A;  2FJU B;  1A2X A;  2BE6 A;  2JNX A;  3PN7 C;  1G8I A;  2BCA A;  1C07 A;  3SIA A;  3JVT B;  4PHK A;  2ZN8 A;  2M7L A;  1J7Q A;  1C7W A;  1JF2 A;  2JU0 A;  1Q80 A;  2JPT A;  3LLE A;  2LMV A;  1K2H A;  2WND A;  1B1G A;  4BY4 A;  1MHO A;  3NSL A;  1Y6W A;  3CR5 X;  2OS8 B;  1Y1A A;  1SR6 B;  2JT0 A;  2K61 A;  1F54 A;  1QS7 A;  2R2I A;  2Y1M A;  5JOL A;  1TNP A;  2F8P A;  1F8H A;  1MXE A;  4GGF A;  5F6T A;  3OHM B;  1FI5 A;  3QRX A;  3OB1 B;  1UUR A;  4A4B A;  3BUO B;  1DGV A;  4DS7 A;  2L98 A;  3VGO A;  1A29 A;  1SCM C;  3TDZ A;  1EH2 A;  2CT9 A;  4CFR A;  5I2Q A;  2LLU A;  3TUY B;  3TZ1 A;  1V1G A;  2M97 A;  2M7N A;  2JTZ A;  1YUR A;  3OX5 A;  4MEW A;  1MXL C;  5CSJ A;  1KQV A;  4PCW A;  1PRW A;  1R6P A;  1EJ3 A;  2JRF A;  3CZT X;  1S6I A;  1YR5 A;  1D1O A;  3I5G C;  1NIW A;  2BL0 C;  2NXQ A;  3WHT B;  3BQ3 A;  1CFF A;  2EGD A;  4A4C A;  3PFV A;  3WHU B;  1OSA A;  1NX0 A;  1WRL A;  2KI4 C;  3BUM B;  1N2D A;  2JWW A;  3PN7 B;  4WQ3 A;  3DD4 A;  1FBV A;  2KAX A;  5DKN A;  2CNP A;  1JFJ A;  2QAC A;  3CWG A;  3A4U B;  2GGZ A;  2NLN A;  2G9B A;  1YVH A;  3SG4 A;  2Y4Q A;  3NSI A;  1KSM A;  2JT3 A;  5DKQ A;  4PE1 A;  4YI9 A;  5ER4 X;  1QV1 A;  1TCF A;  1QVI Y;  2H61 C;  2HQ8 A;  3K21 A;  2GGM A;  2L4I A;  2L2E A;  2Y1N A;  3IF7 A;  1TN4 A;  1WLZ A;  2KAY A;  3GK4 X;  1NYA A;  1F4O A;  3FWB A;  1IJ6 A;  4GFT A;  4I5L B;  3KEV A;  5DKR A;  5AEQ A;  2MJW B;  1JBA A;  4P2Y B;  1SCM B;  2WC8 A;  5J3X A;  3TDI A;  3BOW A;  3HCM A;  1J7O A;  2F3Z A;  1CFP A;  2BE4 A;  3DVM A;  1KFX S;  4M2O A;  4ETO A;  1TNW A;  4AQJ A;  2LVI A;  2OPO A;  1XVJ A;  4OR9 B;  1S3P A;  1DF0 B;  1YUU A;  1QIV A;  3NSO A;  1TRF A;  3I5G B;  3CR4 X;  1LIN A;  1J7P A;  1K95 A;  4ZCU A;  2LCP A;  2L51 A;  2P6B B;  1SRA A;  1U5I B;  3AKB A;  2FCE A;  1OE9 B;  5I8N A;  1FW4 A;  1S5G Y;  2KI4 B;  1JFK A;  1KK7 Y;  3BUW B;  1DJI A;  2K2A A;  3DVE A;  2KFG A;  2ISD A;  1F4Q A;  2AMI A;  2E6W A;  3FS7 A;  5CSF A;  1H8B A;  1CLL A;  1K9U A;  3GK2 A;  1B7T Y;  4DRW A;  2HQW A;  1YRU B;  2KBI A;  2LP2 A;  1DJW A;  4R1E A;  3A8R A;  2JUL A;  1JC2 A;  2A4J A;  1KWO C;  4MLW A;  1XFU O;  4MBE A;  3RM1 A;  1S6C A;  1ZOT B;  5GQQ C;  4DUQ A;  2CTN A;  2KGR A;  4CFQ A;  3PAT A;  1OMR A;  4NDD A;  5HLV A;  1QX5 B;  2H2K A;  2ZND A;  3JTD B;  4I5J A;  3I5H C;  2WOR A;  1XFX O; 
#chains in the Genus database with same CATH topology
 3CLN A;  1IRJ A;  1BT6 A;  2L0P A;  2WC5 A;  4GPL B;  2KQY A;  4JWQ A;  1KSO A;  3KF9 A;  3FE9 A;  2QPT A;  3IQO A;  1JF0 A;  3LK1 A;  2KFF A;  3TS5 C;  3C1V A;  3PJI A;  1M46 A;  3O6B A;  1Z4H A;  1Z2C B;  3OB2 B;  4QJ5 B;  4I5N B;  1EXR A;  2AUC A;  1TNQ A;  2O5G A;  5AAN A;  3B87 A;  1WLM A;  4Q04 A;  3PSR A;  1AVS A;  3KO0 A;  1QLS A;  1CDM A;  1UHJ A;  3D0Y B;  3E3R A;  3D77 A;  1C7V A;  2L5X B;  1KFU L;  1ZMZ A;  4MZL A;  3NSK A;  2LVK A;  4PHN A;  3CR2 A;  2F3Y A;  1C3Z A;  1JUO A;  1Y1X A;  3BUN B;  2L2C A;  4HRG A;  1NX3 A;  2JQ6 A;  4N5X A;  2JPO A;  3BYA A;  1WRZ A;  2KLD A;  2MAZ A;  2KPH A;  3CZ0 A;  2K7O A;  2JC2 A;  5FYX A;  2K60 A;  2LAP A;  2I2R E;  2LAN A;  1LKJ A;  2PSR A;  4JQ0 D;  1PUL A;  3SIB A;  5JJG A;  4YGB B;  3SG6 A;  5D7F A;  3L47 A;  4XJK A;  1FPW A;  2BBM A;  1ALV A;  2GV5 A;  5KU1 A;  1AJ5 A;  4BY5 A;  2BAP A;  2Q4U A;  3PAL A;  4ICB A;  2WC6 A;  4QJ3 B;  5AFP A;  1FI6 A;  2M29 A;  4ZCV A;  1VRK A;  1CDP A;  1RWY A;  2BKH B;  2SCP A;  2PAL A;  4GGN A;  4C0K A;  3K1E A;  1SSE B;  3I5H B;  4YGA A;  1WRK A;  1B8L A;  1NCZ A;  2M3W A;  2K7B A;  1OOJ A;  3FIA A;  3L4A A;  1CKK A;  3S0A A;  1SW8 A;  2LLS A;  1L2O C;  2KGB C;  1M63 B;  3L4L A;  1G33 A;  1RTP 1;  4MZJ A;  2M0R A;  1XK4 A;  2WCF A;  1NX2 A;  3VRR A;  1LS8 A;  2KBM A;  2QEB A;  1SK6 D;  2KYC A;  1MQ1 A;  1XFY O;  2ZNE A;  1GGW A;  1KCY A;  1XFV O;  4GGF C;  1V1F A;  3PM2 A;  1YX8 A;  3DF0 B;  5HKY A;  2CXJ A;  1QXP A;  3CTN A;  1B8R A;  2LE9 B;  3O4Y A;  1X02 A;  1SL9 A;  1XO5 A;  1A4P A;  1AP4 A;  3GOF A;  2COL B;  2V53 A;  2KQ6 A;  1TUJ A;  1NCY A;  4TNC A;  4XYN A;  1B8C A;  2ZRS A;  5CSI A;  3RLZ A;  1CTR A;  1NX1 A;  2FOT A;  1QTX A;  3OP0 A;  1IG5 A;  1RFJ A;  2F33 A;  3DY9 A;  1XFZ O;  1SMG A;  1ZAC A;  3CAB A;  2I18 A;  1SYM A;  1SNL A;  1QX2 A;  5AXI A;  3CGA A;  5AER A;  3D10 A;  2HF5 A;  1A75 B;  1OZO A;  2LNK A;  1DMO A;  1PK0 D;  5HKW A;  1OOG A;  2OTG C;  4WRI A;  2PVB A;  3DVJ A;  3ICB A;  4HSZ A;  1AUI B;  3O78 A;  1CM4 A;  1OOI X;  2KFH A;  2KI6 C;  1BLQ A;  4N1F A;  2NCP A;  2EC6 C;  4NQG A;  1GGZ A;  4JPZ B;  3D74 A;  4YI8 A;  3TS5 B;  1GQM A;  5I2O A;  2BL0 B;  1IH0 A;  1F55 A;  1SKT A;  2WCB A;  1S36 A;  1UHK A;  1XFR A;  5G08 A;  4N1G A;  4C0J A;  4MSP A;  5CSN A;  3SG3 A;  5HLO A;  4CID A;  5IBW A;  2K0J A;  1L7Z A;  3D73 A;  3S0F A;  3EG5 B;  4PE0 A;  2MRD A;  2O60 A;  1IQ5 A;  3BFB A;  2PAS A;  1K96 A;  1KK8 C;  1TNX A;  3NHT A;  3VRP A;  2BCB A;  1ZUZ A;  4C0L A;  4UPG A;  2I94 A;  1E8A A;  1CFC A;  1DTL A;  2BNX A;  4CLN A;  1W7J B;  2JTT A;  1DVI A;  2LV7 A;  5D3O A;  1ODB A;  3SG5 A;  2M9G A;  1CLB A;  4GUK A;  1J7R A;  1AK8 A;  1LA3 A;  3UO9 A;  2JXC A;  3M0W A;  4YGD B;  4AQI A;  1QIW A;  1SR6 C;  1J1D A;  2FJY A;  2SAS A;  4FTG A;  4YGE B;  1AHR A;  4U8D A;  2JNF A;  5KTY A;  4OV2 A;  2MBX A;  1T14 A;  1KFU S;  1N0Y A;  2LUC A;  1PVB A;  2WOS A;  3FWC A;  2I7A A;  1DGU A;  2PQL A;  3S0D A;  3V2L A;  2LVV A;  3R72 A;  2OTG B;  1IQ3 A;  1H4B A;  4QJ4 B;  1MF8 B;  2PMY A;  2VRG A;  1UHH A;  1SY9 A;  1MR8 A;  5D69 A;  2EC6 B;  1IGV A;  2YGU A;  3I5F C;  5PAL A;  3D76 A;  1S26 D;  5CPV A;  3OBV A;  1W7I B;  4F0Z B;  5DIC A;  1ZFS A;  2K8M B;  4NDB A;  3VRQ A;  4YRU A;  2K2F A;  4DIR A;  1CM1 A;  4OVN F;  1IWQ A;  1EG3 A;  3ZWH A;  1SCV A;  4DCK A;  2LP3 A;  1IJ5 A;  2D8N A;  2ZFD A;  2QEO A;  3DVK A;  1CLM A;  2JZI A;  4MN0 A;  2MA2 A;  3EK8 A;  3F45 A;  3S0E A;  1PSR A;  2RGI A;  1KK8 B;  3ZNI A;  1DF0 A;  4YBH B;  4GAO A;  2NCO A;  1TTX A;  3TDU A;  1S6J A;  1B9A A;  1KWO B;  2E30 A;  3H4S E;  1BMO A;  1UUS A;  2IS9 A;  3NHI A;  1RK9 A;  2M8U A;  3AAJ A;  3BOW B;  4PHJ A;  2LM5 A;  4M2P A;  1UP5 A;  1U5I A;  4PT1 A;  2ZKM X;  1DJY A;  1PSB A;  1BR1 B;  4OZD A;  2CCM A;  4HRE E;  1CNP A;  5HKZ A;  2L4H A;  1SL7 A;  1G4Y R;  2KDH A;  1GJY A;  1K93 D;  1QX7 A;  2PYQ A;  1N65 A;  3CDN A;  2F2O A;  2LMT A;  1M31 A;  3EVV A;  3KPX A;  3LL8 B;  1B4C A;  2BEC A;  1BOD A;  2KHN A;  1NCX A;  1K9K A;  2H61 A;  3D75 A;  3GK1 A;  3OX6 A;  1DC1 A;  1OQP A;  1QVI Z;  1DJX A;  2EHB A;  2KI6 D;  1SL8 A;  3I5I C;  1LA0 A;  2WCH A;  3PLF B;  1YX7 A;  3BXK A;  3I5F B;  1K94 A;  2LLT A;  1KQM C;  4HRH A;  2B1U A;  3B7A A;  1RJV A;  1P28 A;  4INX A;  4JD9 A;  1F70 A;  3EKH A;  2QEV A;  1UHN A;  4INW A;  3HX4 A;  2BBN A;  3LK0 A;  5HYD A;  1Y1U A;  2P70 A;  4MRX A;  1AJ4 A;  1NUB A;  3Q8I A;  1OOF A;  4ORA B;  2PRU A;  1JWD A;  1CDN A;  1DEL A;  3AKA A;  1SBJ A;  2KOT A;  2MLF C;  1QAS A;  3QME A;  2M49 B;  3AAK A;  4ORB B;  1FF1 A;  1CDL A;  3WNX B;  3D0Y A;  1Y0V H;  2L50 A;  4JKT A;  1QJT A;  2HET A;  4PHM A;  3SG2 A;  2K7D A;  1XK4 C;  4CPV A;  2MLE C;  1DJZ A;  4OCI A;  3BUX B;  3DXL A;  1DJH A;  2KNE A;  1NPQ A;  4P5O E;  2AAO A;  1J55 A;  3VRO A;  1HT9 A;  1S5G Z;  1J1E A;  1KK7 Z;  3JTD C;  1EG4 A;  3FE8 A;  3KHE A;  4KYN A;  1WY9 A;  3BFH A;  4USL A;  1L2O B;  4M2Q A;  2ZN9 A;  2Y5I A;  1QLK A;  1NP8 A;  1WDC C;  5K89 A;  1B7T Z;  1BR4 B;  1BU3 A;  3EVR A;  5KSZ A;  4IL1 A;  3LCP C;  4I5K A;  1HQV A;  3SJS A;  5ER5 A;  2NZ0 A;  1YTZ C;  1OOH A;  2ZRT A;  1TOP A;  1REC A;  1LVC D;  3EK7 A;  5I2L A;  1NSH A;  3JVT C;  1JBA A;  1BOC A;  5B8I B;  2HPS A;  2KAV A;  3I5I B;  4AOM A;  1BG1 A;  1YUT A;  2WCE A;  4L9M A;  4MZK A;  1QAT A;  1QV0 A;  1CMF A;  1F71 A;  1DEK A;  1KQM B;  4YGC B;  1K90 D;  3WXA A;  1DQE A;  1DT7 B;  2LVJ A;  4NDC A;  1TIZ A;  2M1U A;  3B86 A;  3CS1 A;  2BKI B;  1B47 A;  2DOQ A;  2LUX A;  2WCK A;  4E68 A;  1XFW O;  3EVU A;  2OS8 C;  3UNW A;  4XJK B;  1OMD A;  1RRO A;  2JT8 A;  4PE4 A;  2ERB A;  4OKH A;  2F2P A;  3N7H A;  4WQ2 A;  1BF5 A;  1CMG A;  4PE7 A;  2M1K B;  4GNK B;  1SPY A;  4FQO A;  2MHH A;  4ORC B;  2LMU A;  1JSA A;  1S1E A;  1KFX L;  2LC5 A;  1OZS A;  3DF0 A;  4MRY A;  1NWD A;  2CBL A;  1M45 A;  1YRT B;  1UWO A;  1OMV A;  3VB1 A;  2LHI A;  3IQQ A;  1PAL A;  3SG7 A;  2LHL A;  4IJ7 A;  2KYF A;  3TUY C;  2JXL A;  3EK4 A;  1CFD A;  1XA5 A;  3PM8 A;  2FCD A;  3SS4 A;  5BPJ A;  4PAL A;  1A03 A;  2QDI A;  1MUX A;  1ALW A;  1XYD A;  5FI2 A;  1PVA A;  4D1E A;  1CB1 A;  2K7C A;  2BCX A;  5TNC A;  1K9P A;  2JOJ A;  3EKJ A;  1MWN A;  1LXF C;  1UHI A;  1EL4 A;  1TCO B;  1M39 A;  2TN4 A;  3MSE B;  3RZS A;  1DJG A;  1YUS A;  4MVF A;  3NXA A;  4PDZ A;  3SS5 A;  2Q91 A;  3O2P A;  1K8U A;  3VRN A;  1WDC B;  1IKU A;  1A75 A;  1YVL A;  1IIO A;  1R2U A;  2KSP A;  1BJF A;  4GBA A;  2QEH A;  2G2B A;  2FJU B;  1A2X A;  1QWV A;  2BE6 A;  2JNX A;  3PN7 C;  1G8I A;  2BCA A;  1C07 A;  3SIA A;  3JVT B;  4PHK A;  2ZN8 A;  2M7L A;  1J7Q A;  1C7W A;  1JF2 A;  2JU0 A;  1Q80 A;  2JPT A;  3LLE A;  2LMV A;  1K2H A;  3NGV A;  3R1O A;  2WND A;  1B1G A;  4BY4 A;  1MHO A;  3NSL A;  1Y6W A;  3CR5 X;  3S0B A;  2OS8 B;  1Y1A A;  2WCL A;  1SR6 B;  2JT0 A;  2K61 A;  1F54 A;  2P71 A;  1QS7 A;  2R2I A;  2Y1M A;  5JOL A;  1TNP A;  2F8P A;  1F8H A;  1MXE A;  4GGF A;  5F6T A;  3OHM B;  1FI5 A;  3QRX A;  3OB1 B;  1UUR A;  4A4B A;  3BUO B;  1DGV A;  4DS7 A;  2L98 A;  3VGO A;  1A29 A;  1SCM C;  3TDZ A;  3B88 A;  1TUZ A;  2H8V A;  2WCJ A;  1EH2 A;  2CT9 A;  4CFR A;  5I2Q A;  2LLU A;  3TUY B;  3TZ1 A;  1V1G A;  2M97 A;  2M7N A;  2JTZ A;  1YUR A;  3OX5 A;  4MEW A;  1MXL C;  5CSJ A;  3CZ2 A;  1KQV A;  3DYE A;  4PCW A;  1PRW A;  1R6P A;  1EJ3 A;  2JRF A;  3CZT X;  1S6I A;  3R1V A;  1YR5 A;  1D1O A;  3FE6 A;  3I5G C;  1NIW A;  2BL0 C;  2NXQ A;  3SS3 A;  3WHT B;  3BQ3 A;  1CFF A;  2EGD A;  4A4C A;  4FQT A;  3PFV A;  3WHU B;  1W9Z A;  1OSA A;  1NX0 A;  1WRL A;  2KI4 C;  3BUM B;  1N2D A;  2JWW A;  3PN7 B;  4WQ3 A;  3IVT A;  3DD4 A;  1FBV A;  2KAX A;  5DKN A;  2CNP A;  1JFJ A;  2QAC A;  3CWG A;  3R1P A;  3A4U B;  2GGZ A;  2NLN A;  2G9B A;  1YVH A;  3SG4 A;  2Y4Q A;  3CZ1 A;  3NSI A;  1KSM A;  2KLE A;  2JT3 A;  5DKQ A;  4PE1 A;  4YI9 A;  5ER4 X;  1QV1 A;  1TCF A;  1QVI Y;  2H61 C;  2HQ8 A;  3K21 A;  1ORG A;  2GGM A;  2L4I A;  2L2E A;  2Y1N A;  5HL1 A;  3IF7 A;  1TN4 A;  1WLZ A;  2KAY A;  5I94 A;  3GK4 X;  1NYA A;  1F4O A;  3FWB A;  1IJ6 A;  4GFT A;  4I5L B;  3KEV A;  5DKR A;  3B6X A;  2MJW B;  3BJH A;  5AEQ A;  4P2Y B;  1SCM B;  2WC8 A;  5J3X A;  3TDI A;  3BOW A;  3HCM A;  1GM0 A;  1J7O A;  2F3Z A;  1CFP A;  3S0G A;  2BE4 A;  3DVM A;  1KFX S;  4M2O A;  4ETO A;  2GTE A;  1TNW A;  4AQJ A;  2LVI A;  2OPO A;  1XVJ A;  4OR9 B;  5EL2 A;  1S3P A;  1DF0 B;  1YUU A;  1QIV A;  3NSO A;  1TRF A;  3I5G B;  3CR4 X;  1LIN A;  1TWO A;  2L5Y A;  5FI7 A;  1K95 A;  4ZCU A;  2LCP A;  1J7P A;  2L51 A;  2P6B B;  1SRA A;  1U5I B;  3AKB A;  2FCE A;  1OE9 B;  5I8N A;  1FW4 A;  1S5G Y;  2KI4 B;  1JFK A;  5FI6 A;  1KK7 Y;  3BUW B;  1DJI A;  2K2A A;  3DVE A;  2KFG A;  2ISD A;  1F4Q A;  2AMI A;  2E6W A;  3FS7 A;  3D78 A;  5CSF A;  1H8B A;  1CLL A;  1K9U A;  3GK2 A;  1B7T Y;  3OGN A;  4DRW A;  2HQW A;  1YRU B;  2KBI A;  2LP2 A;  1DJW A;  4R1E A;  3A8R A;  2JUL A;  3DZT A;  2A4J A;  1KWO C;  3O4X A;  4F7F A;  1JC2 A;  3CYZ A;  3BFA A;  2WCM A;  4MLW A;  1XFU O;  4MBE A;  3RM1 A;  1S6C A;  1ZOT B;  5GQQ C;  4DUQ A;  2CTN A;  2KGR A;  4CFQ A;  3PAT A;  1OMR A;  4NDD A;  5HLV A;  1OW4 A;  1QX5 B;  2H2K A;  2ZND A;  3JTD B;  4I5J A;  1C3Y A;  3I5H C;  2WOR A;  1XFX O; 
#chains in the Genus database with same CATH homology
 3CLN A;  1IRJ A;  1BT6 A;  2L0P A;  4GPL B;  2KQY A;  4JWQ A;  1KSO A;  3KF9 A;  2QPT A;  3IQO A;  1JF0 A;  3LK1 A;  2KFF A;  3C1V A;  1M46 A;  3O6B A;  4QJ5 B;  3OB2 B;  4I5N B;  1EXR A;  2AUC A;  1TNQ A;  2O5G A;  5AAN A;  1WLM A;  4Q04 A;  3PSR A;  1AVS A;  3KO0 A;  1QLS A;  1CDM A;  1UHJ A;  3D0Y B;  3E3R A;  1C7V A;  2L5X B;  1KFU L;  1ZMZ A;  4MZL A;  3NSK A;  2LVK A;  4PHN A;  3CR2 A;  2F3Y A;  1JUO A;  1Y1X A;  3BUN B;  4HRG A;  1NX3 A;  2JQ6 A;  4N5X A;  3BYA A;  1WRZ A;  2MAZ A;  2K7O A;  2JC2 A;  5FYX A;  2LAP A;  2I2R E;  2LAN A;  1LKJ A;  2PSR A;  4JQ0 D;  1PUL A;  3SIB A;  5JJG A;  4YGB B;  3SG6 A;  5D7F A;  4XJK A;  1FPW A;  2BBM A;  1ALV A;  2GV5 A;  5KU1 A;  1AJ5 A;  4BY5 A;  2Q4U A;  3PAL A;  4ICB A;  4QJ3 B;  5AFP A;  1FI6 A;  2M29 A;  4ZCV A;  1VRK A;  1CDP A;  1RWY A;  2BKH B;  2SCP A;  2PAL A;  4GGN A;  4C0K A;  3I5H B;  4YGA A;  1WRK A;  1B8L A;  1NCZ A;  2M3W A;  2K7B A;  1OOJ A;  3FIA A;  3TS5 C;  1CKK A;  1SW8 A;  2LLS A;  1L2O C;  2KGB C;  1M63 B;  1G33 A;  1RTP 1;  4MZJ A;  2M0R A;  1XK4 A;  2WCF A;  1NX2 A;  3VRR A;  2KBM A;  1GGW A;  1SK6 D;  2KYC A;  1MQ1 A;  1XFY O;  2ZNE A;  1KCY A;  1XFV O;  4GGF C;  1V1F A;  1YX8 A;  3DF0 B;  5HKY A;  2CXJ A;  1QXP A;  3CTN A;  1B8R A;  2LE9 B;  3O4Y A;  1X02 A;  1SL9 A;  1XO5 A;  1A4P A;  1AP4 A;  3GOF A;  2COL B;  2V53 A;  2KQ6 A;  4TNC A;  1NCY A;  4XYN A;  1B8C A;  2ZRS A;  5CSI A;  3RLZ A;  1CTR A;  1NX1 A;  2FOT A;  1QTX A;  3OP0 A;  1IG5 A;  1RFJ A;  2F33 A;  1XFZ O;  1SMG A;  1ZAC A;  2I18 A;  1SYM A;  1SNL A;  1QX2 A;  5AXI A;  3CGA A;  5AER A;  3D10 A;  2HF5 A;  1A75 B;  1OZO A;  2LNK A;  1DMO A;  1PK0 D;  5HKW A;  2OTG C;  4WRI A;  2PVB A;  3DVJ A;  3ICB A;  4HSZ A;  1AUI B;  3O78 A;  1CM4 A;  2KFH A;  2KI6 C;  1BLQ A;  4N1F A;  2NCP A;  2EC6 C;  4NQG A;  1GGZ A;  4JPZ B;  4YI8 A;  3TS5 B;  1GQM A;  5I2O A;  2BL0 B;  1IH0 A;  1F55 A;  1SKT A;  2WCB A;  1S36 A;  1UHK A;  5G08 A;  4N1G A;  4C0J A;  4MSP A;  5CSN A;  3SG3 A;  5HLO A;  4CID A;  5IBW A;  2K0J A;  1L7Z A;  4PE0 A;  2MRD A;  2O60 A;  1IQ5 A;  2PAS A;  1K96 A;  1KK8 C;  1TNX A;  3VRP A;  4C0L A;  2BCB A;  1ZUZ A;  4UPG A;  1F70 A;  2I94 A;  1E8A A;  1CFC A;  1DTL A;  4CLN A;  1W7J B;  2JTT A;  1DVI A;  2LV7 A;  1ODB A;  3SG5 A;  2M9G A;  1CLB A;  4GUK A;  1J7R A;  1AK8 A;  1LA3 A;  2JXC A;  3M0W A;  4YGD B;  4AQI A;  1QIW A;  1SR6 C;  1J1D A;  2SAS A;  4FTG A;  4YGE B;  1AHR A;  4U8D A;  2JNF A;  5KTY A;  4OV2 A;  2MBX A;  1KFU S;  1N0Y A;  2LUC A;  1PVB A;  2WOS A;  3FWC A;  2I7A A;  1DGU A;  2LVV A;  2OTG B;  1IQ3 A;  1H4B A;  4QJ4 B;  1MF8 B;  2PMY A;  2VRG A;  1UHH A;  1SY9 A;  1MR8 A;  5D69 A;  2EC6 B;  1IGV A;  3I5F C;  5PAL A;  1S26 D;  5CPV A;  1W7I B;  4F0Z B;  1ZFS A;  2K8M B;  4NDB A;  3VRQ A;  4YRU A;  2K2F A;  4DIR A;  1CM1 A;  4OVN F;  1IWQ A;  1EG3 A;  3ZWH A;  1SCV A;  4DCK A;  2LP3 A;  1IJ5 A;  2D8N A;  2ZFD A;  3DVK A;  1CLM A;  2JZI A;  4MN0 A;  2MA2 A;  3EK8 A;  3F45 A;  1PSR A;  2RGI A;  1KK8 B;  3ZNI A;  1DF0 A;  4YBH B;  4GAO A;  2NCO A;  1TTX A;  3TDU A;  1S6J A;  1B9A A;  1KWO B;  2E30 A;  3H4S E;  1BMO A;  1UUS A;  2IS9 A;  1RK9 A;  2M8U A;  3AAJ A;  3BOW B;  4PHJ A;  2LM5 A;  4M2P A;  1UP5 A;  1U5I A;  2ZKM X;  1DJY A;  1PSB A;  1BR1 B;  2CCM A;  4HRE E;  1CNP A;  5HKZ A;  2L4H A;  1SL7 A;  1G4Y R;  2KDH A;  1GJY A;  1K93 D;  1QX7 A;  1N65 A;  2F2O A;  2LMT A;  1M31 A;  3EVV A;  3KPX A;  3LL8 B;  1B4C A;  2BEC A;  1BOD A;  2KHN A;  1NCX A;  1K9K A;  2H61 A;  3OX6 A;  3GK1 A;  1OQP A;  1QVI Z;  1DJX A;  2EHB A;  2KI6 D;  1SL8 A;  3I5I C;  1LA0 A;  3PLF B;  1YX7 A;  3BXK A;  3I5F B;  1K94 A;  2LLT A;  1KQM C;  4HRH A;  2B1U A;  1RJV A;  3EKH A;  1UHN A;  3HX4 A;  2BBN A;  3LK0 A;  5HYD A;  1Y1U A;  4MRX A;  1AJ4 A;  1NUB A;  4ORA B;  2PRU A;  1JWD A;  1CDN A;  3AKA A;  1SBJ A;  2KOT A;  2MLF C;  1QAS A;  2M49 B;  3AAK A;  4ORB B;  1FF1 A;  1CDL A;  3WNX B;  3D0Y A;  1Y0V H;  2L50 A;  4PHM A;  1QJT A;  2HET A;  3SG2 A;  2K7D A;  1XK4 C;  4CPV A;  2MLE C;  1DJZ A;  4OCI A;  3BUX B;  1DJH A;  2KNE A;  1NPQ A;  4P5O E;  2AAO A;  1J55 A;  3VRO A;  1HT9 A;  1S5G Z;  1J1E A;  1KK7 Z;  3JTD C;  1EG4 A;  3KHE A;  1WY9 A;  4USL A;  1L2O B;  4M2Q A;  2ZN9 A;  2Y5I A;  1QLK A;  1NP8 A;  1WDC C;  5K89 A;  1B7T Z;  1BR4 B;  1BU3 A;  3EVR A;  5KSZ A;  4IL1 A;  3LCP C;  4I5K A;  1HQV A;  3SJS A;  5ER5 A;  2NZ0 A;  1YTZ C;  2ZRT A;  1TOP A;  1REC A;  1LVC D;  3EK7 A;  5I2L A;  1NSH A;  3JVT C;  1BOC A;  5B8I B;  2HPS A;  2KAV A;  3I5I B;  4AOM A;  1BG1 A;  1YUT A;  2WCE A;  4L9M A;  4MZK A;  1QAT A;  1QV0 A;  1CMF A;  1F71 A;  1KQM B;  4YGC B;  1K90 D;  3WXA A;  1DT7 B;  2LVJ A;  4NDC A;  1TIZ A;  2M1U A;  3CS1 A;  2BKI B;  1B47 A;  2DOQ A;  2LUX A;  4E68 A;  1XFW O;  3EVU A;  2OS8 C;  4XJK B;  1OMD A;  1RRO A;  2JT8 A;  4PE4 A;  4OKH A;  2F2P A;  4WQ2 A;  1BF5 A;  1CMG A;  4PE7 A;  2M1K B;  4GNK B;  1SPY A;  4FQO A;  2MHH A;  4ORC B;  2LMU A;  1JSA A;  1S1E A;  1KFX L;  2LC5 A;  1OZS A;  3DF0 A;  4MRY A;  1NWD A;  2CBL A;  1M45 A;  1YRT B;  1UWO A;  1OMV A;  2LHI A;  3IQQ A;  1PAL A;  3SG7 A;  2LHL A;  3TUY C;  2KYF A;  2JXL A;  3EK4 A;  1CFD A;  1XA5 A;  3PM8 A;  2FCD A;  5BPJ A;  1A03 A;  4PAL A;  1MUX A;  1ALW A;  1XYD A;  4D1E A;  1PVA A;  1CB1 A;  2K7C A;  2BCX A;  5TNC A;  1K9P A;  2JOJ A;  3EKJ A;  1MWN A;  1LXF C;  1EL4 A;  1TCO B;  1UHI A;  1M39 A;  2TN4 A;  3MSE B;  1DJG A;  1YUS A;  4MVF A;  3NXA A;  4PDZ A;  2Q91 A;  3O2P A;  1K8U A;  3VRN A;  1WDC B;  1IKU A;  1A75 A;  1YVL A;  1R2U A;  2KSP A;  1BJF A;  4GBA A;  2G2B A;  2FJU B;  1A2X A;  2BE6 A;  2JNX A;  3PN7 C;  1G8I A;  2BCA A;  1C07 A;  3SIA A;  3JVT B;  4PHK A;  2ZN8 A;  2M7L A;  1J7Q A;  1C7W A;  1JF2 A;  2JU0 A;  1Q80 A;  2JPT A;  3LLE A;  2LMV A;  1K2H A;  2WND A;  1B1G A;  4BY4 A;  1MHO A;  3NSL A;  1Y6W A;  3CR5 X;  2OS8 B;  1Y1A A;  1SR6 B;  2JT0 A;  2K61 A;  1F54 A;  1QS7 A;  2R2I A;  2Y1M A;  5JOL A;  1TNP A;  2F8P A;  1F8H A;  1MXE A;  4GGF A;  5F6T A;  3OHM B;  1FI5 A;  3QRX A;  3OB1 B;  1UUR A;  4A4B A;  3BUO B;  1DGV A;  4DS7 A;  2L98 A;  3VGO A;  1A29 A;  1SCM C;  3TDZ A;  1EH2 A;  2CT9 A;  4CFR A;  5I2Q A;  2LLU A;  3TUY B;  3TZ1 A;  1V1G A;  2M97 A;  2M7N A;  2JTZ A;  1YUR A;  3OX5 A;  4MEW A;  1MXL C;  5CSJ A;  1KQV A;  4PCW A;  1PRW A;  1R6P A;  1EJ3 A;  2JRF A;  3CZT X;  1S6I A;  1YR5 A;  1D1O A;  3I5G C;  1NIW A;  2BL0 C;  2NXQ A;  3WHT B;  3BQ3 A;  1CFF A;  2EGD A;  4A4C A;  3PFV A;  3WHU B;  1OSA A;  1NX0 A;  1WRL A;  2KI4 C;  3BUM B;  1N2D A;  2JWW A;  3PN7 B;  4WQ3 A;  3DD4 A;  1FBV A;  2KAX A;  5DKN A;  2CNP A;  1JFJ A;  2QAC A;  3CWG A;  3A4U B;  2GGZ A;  2NLN A;  2G9B A;  1YVH A;  3SG4 A;  2Y4Q A;  3NSI A;  1KSM A;  2JT3 A;  5DKQ A;  4PE1 A;  4YI9 A;  5ER4 X;  1QV1 A;  1TCF A;  1QVI Y;  2H61 C;  2HQ8 A;  3K21 A;  2GGM A;  2L4I A;  2L2E A;  2Y1N A;  3IF7 A;  1TN4 A;  1WLZ A;  2KAY A;  3GK4 X;  1NYA A;  1F4O A;  3FWB A;  1IJ6 A;  4GFT A;  4I5L B;  3KEV A;  5DKR A;  5AEQ A;  2MJW B;  1JBA A;  4P2Y B;  1SCM B;  2WC8 A;  5J3X A;  3TDI A;  3BOW A;  3HCM A;  1J7O A;  2F3Z A;  1CFP A;  2BE4 A;  3DVM A;  1KFX S;  4M2O A;  4ETO A;  1TNW A;  4AQJ A;  2LVI A;  2OPO A;  1XVJ A;  4OR9 B;  1S3P A;  1DF0 B;  1YUU A;  1QIV A;  3NSO A;  1TRF A;  3I5G B;  3CR4 X;  1LIN A;  1J7P A;  1K95 A;  4ZCU A;  2LCP A;  2L51 A;  2P6B B;  1SRA A;  1U5I B;  3AKB A;  2FCE A;  1OE9 B;  5I8N A;  1FW4 A;  1S5G Y;  2KI4 B;  1JFK A;  1KK7 Y;  3BUW B;  1DJI A;  2K2A A;  3DVE A;  2KFG A;  2ISD A;  1F4Q A;  2AMI A;  2E6W A;  3FS7 A;  5CSF A;  1H8B A;  1CLL A;  1K9U A;  3GK2 A;  1B7T Y;  4DRW A;  2HQW A;  1YRU B;  2KBI A;  2LP2 A;  1DJW A;  4R1E A;  3A8R A;  2JUL A;  1JC2 A;  2A4J A;  1KWO C;  4MLW A;  1XFU O;  4MBE A;  3RM1 A;  1S6C A;  1ZOT B;  5GQQ C;  4DUQ A;  2CTN A;  2KGR A;  4CFQ A;  3PAT A;  1OMR A;  4NDD A;  5HLV A;  1QX5 B;  2H2K A;  2ZND A;  3JTD B;  4I5J A;  3I5H C;  2WOR A;  1XFX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...