3D0YB

Crystal structure of s100b in the calcium and zinc loaded state at ph 6.5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d0yB00
2WC8A 5HKZA 1CNPA 2IS9A 1SK6D 3CTNA 2FCDA 2L0PA 2QACA 5DKRA 3MSEB 3VGOA 5I8NA 1TTXA 3CLNA 3NSOA 3OB1B 3PALA 1CM1A 2EHBA 1F55A 1CLBA 3HX4A 3IQQA 1B8RA 4ORCB 2BKIB 1QV1A 2KFHA 2ZRSA 1EG4A 2KFFA 2WOSA 2BKHB 1S6CA 4MBEA 1CFFA 4NQGA 1H4BA 2FJUB 3TDUA 5AERA 4FTGA 4C0JA 2LNKA 3SJSA 4WQ2A 2KFGA 5JOLA 1G33A 3TDZA 3CWGA 1XFVO 1Y1UA 1K9PA 1SRAA 2EC6B 3C1VA 3LK0A 2K61A 3KPXA 4OV2A 1QVIY 2PALA 3RLZA 1A03A 1YTZC 3KEVA 2MBXA 1BLQA 2WCBA 1KK7Y 1PK0D 1KWOB 1JWDA 1MXLC 1J1EA 1C07A 2BBNA 1DGUA 3PN7C 2KGRA 2K2FA 1NYAA 2M1UA 1DTLA 3IF7A 3OX6A 3GK1A 4OCIA 1HT9A 4ORBB 2E30A 3HCMA 1QLKA 1Y0VH 1SYMA 1C7WA 2LMTA 1TNQA 4ORAB 2KAYA 4QJ5B 1CDPA 5G08A 2KQ6A 2KI6D 1YVHA 2I7AA 4M2PA 1R2UA 1OMDA 1LINA 1OOJA 2COLB 3CGAA 3K21A 3BOWA 1KFXL 3NXAA 4PCWA 1F4QA 3FIAA 1ZMZA 2FCEA 3H4SE 1GGZA 3NSIA 1CKKA 3BQ3A 3BUXB 1QV0A 2E6WA 3I5GB 3WXAA 1FBVA 2O60A 4BY4A 1B1GA 4DCKA 1SW8A 2MLEC 1KSOA 1TRFA 1W7IB 1L2OB 3NSLA 2M1KB 1IJ5A 1S5GY 2F3YA 1DF0B 3D0YB 1YRUB 1C7VA 1QVIZ 2BECA 3F45A 3LCPC 2A4JA 3LLEA 2BE4A 1KK7Z 2KBMA 1PVBA 1YX7A 1GQMA 4YRUA 1RROA 1EG3A 2HF5A 5CSNA 4AQJA 1SCVA 1FI6A 1ZFSA 2F2PA 1Y1XA 2M49B 2LP3A 1CDMA 2OTGB 1DT7B 1RWYA 5CPVA 4GUKA 3ZNIA 1DJWA 1SKTA 2K0JA 5HKWA 1CLMA 3A8RA 1RJVA 1TNPA 2CT9A 3PM8A 1BF5A 1N0YA 2B1UA 1RFJA 3VRPA 1YURA 3CZTX 1CMGA 2CNPA 4YGEB 1S36A 1V1GA 2G9BA 5KSZA 1FF1A 1A4PA 1AP4A 1CLLA 1NWDA 4M2OA 4GPLB 3GK4X 1QJTA 4NDCA 1M45A 1KFUL 1CDLA 2KOTA 4P2YB 1H8BA 1SY9A 5BPJA 5IBWA 2NCOA 1X02A 1YUUA 1BU3A 2LV7A 2EGDA 1NCYA 2LMVA 4ZCVA 2MLFC 1UWOA 4YGCB 2JWWA 1XYDA 4PDZA 2ZFDA 2WCEA 3EKJA 3NSKA 1MUXA 3CR5X 2EC6C 1JF2A 1AK8A 1S5GZ 3A4UB 5CSIA 1CB1A 3JVTB 3JTDB 1LA0A 5CSFA 3AAKA 1KWOC 1JF0A 2DOQA 1XK4C 4A4BA 1TN4A 2JU0A 2Y5IA 1L7ZA 1OQPA 2LVIA 1XO5A 1IQ5A 4I5LB 3FWBA 4AQIA 1B8LA 2KI4B 4YI9A 3TDIA 1SMGA 2OPOA 2CCMA 5F6TA 3OB2B 2KYFA 2TN4A 5K89A 2MA2A 1B4CA 2H2KA 3DVKA 1LXFC 4CFRA 1M46A 3I5HB 2Q4UA 1G8IA 4XYNA 2LHLA 2LLSA 4JPZB 4QJ4B 2ZKMX 4E68A 4N1FA 2K7DA 1CM4A 1LA3A 5CSJA 4CFQA 1FI5A 2AUCA 4BY5A 2HPSA 3VRQA 3OX5A 1MWNA 3I5GC 1YRTB 1ZOTB 3WNXB 2D8NA 2BCAA 3KO0A 4P5OE 4AOMA 1A75B 1B9AA 1DF0A 3D0YA 1BOCA 1IJ6A 1E8AA 4YGAA 2M29A 4C0KA 2BBMA 1OZOA 2LC5A 3O2PA 1NCXA 2JXLA 1TOPA 3EKHA 1L2OC 4GGNA 4XJKA 1K96A 4CIDA 1K8UA 1BODA 1JC2A 2JC2A 3E3RA 2M3WA 4ICBA 2CTNA 4YBHB 3AKAA 2LAPA 4D1EA 3DVEA 3M0WA 3O78A 1QATA 3SG4A 1QIWA 1KFXS 3DF0B 1S26D 2KSPA 2OTGC 4MEWA 3RM1A 3VROA 1B47A 4I5KA 1CFPA 2LHIA 2WNDA 1PSBA 1U5IA 2JTTA 1WDCB 4YI8A 1XA5A 2R2IA 1QLSA 1UHNA 5I2LA 5ER4X 3SG5A 1IWQA 2KAXA 5I2QA 1V1FA 2K7OA 3CR2A 5B8IB 1OMRA 1UUSA 2HETA 2ZRTA 1LVCD 5HKYA 1EJ3A 3O6BA 4PHMA 1BR1B 4JWQA 2K7CA 2LMUA 4C0LA 4L9MA 4DS7A 3I5IB 2NCPA 3LL8B 1S6IA 1A2XA 1IGVA 5HYDA 5I2OA 2F8PA 4HREE 2JNXA 1CFDA 1NIWA 2F2OA 3AAJA 5D69A 5KU1A 1F71A 4OKHA 4MSPA 1WRZA 2M7NA 3PATA 1OMVA 1BT6A 1DJYA 1UHJA 3JVTC 1WLMA 5AANA 3JTDC 1IH0A 3DD4A 2PRUA 3SIAA 1UHKA 1RTP1 2RGIA 3BUNB 2L98A 1BR4B 1LKJA 2GGMA 1MQ1A 1D1OA 2QPTA 3BUOB 3EK8A 1XFUO 2JQ6A 2MRDA 5AXIA 3VRRA 1J7RA 1XFZO 1NX2A 1NX0A 3BUMB 1WLZA 1KFUS 2KI4C 1R6PA 1JUOA 2F3ZA 1TCFA 4USLA 3WHUB 2SCPA 1TIZA 1CDNA 4GAOA 2K7BA 1S6JA 4JQ0D 3ZWHA 2BL0B 2KDHA 1QX5B 5KTYA 2LANA 3I5HC 2JT0A 3AKBA 3SIBA 3D10A 1UURA 3EVRA 1SCMB 4PE4A 4MLWA 3O4YA 1NSHA 1A75A 5DKNA 3TZ1A 4DIRA 1UHHA 1NPQA 5TNCA 4GGFC 4M2QA 4ETOA 1BG1A 2LCPA 4YGDB 1YR5A 4CLNA 1J7PA 2LVKA 2WORA 3QRXA 1AHRA 4NDDA 4MZKA 1MHOA 1S1EA 1CTRA 1HQVA 1PSRA 3BUWB 4U8DA 2O5GA 1JFJA 4HRHA 1XK4A 1YVLA 1YUSA 3FS7A 1SPYA 2Y4QA 1K94A 2H61A 4PHKA 5HLOA 4PE7A 4OVNF 1F54A 2AAOA 2WCFA 1Q80A 1KQMB 2ZN8A 2HQ8A 2SASA 1ODBA 1PRWA 1OSAA 2F33A 3DF0A 2JULA 1WRLA 2H61C 2KNEA 2M9GA 1OE9B 2LVJA 5HLVA 2GV5A 2M8UA 1SR6B 4MZLA 3SG2A 1JFKA 4MRYA 3SG7A 1GJYA 1NCZA 1IRJA 2L4IA 2CXJA 1WDCC 2JNFA 1YX8A 2NZ0A 2JZIA 3SG3A 2HQWA 4QJ3B 1ALVA 1DVIA 4MZJA 3BXKA 1XVJA 2JTZA 3TS5B 1XFWO 1NX3A 1KCYA 1TNXA 3PSRA 1AVSA 4Q04A 1AJ5A 2L50A 2I94A 3VRNA 2I2RE 2JOJA 1TNWA 2V53A 4UPGA 4N5XA 4PALA 1WY9A 4YGBB 3IQOA 3I5IC 1QXPA 2JPTA 2OS8B 1DJXA 2VRGA 4PE1A 5GQQC 1K95A 4N1GA 1IQ3A 4FQOA 2LM5A 1GGWA 1SNLA 1CFCA 2M0RA 3CR4X 4IL1A 2KHNA 1NP8A 2LLTA 1UHIA 4TNCA 4GBAA 3SG6A 1EL4A 3FWCA 3DVMA 3I5FB 1KK8C 1J7QA 1OZSA 3BYAA 1TCOB 2P6BB 4PE0A 1QTXA 4CPVA 1Y6WA 2LVVA 4GFTA 1DJGA 2MJWB 2Y1MA 1JSAA 4PHJA 2G2BA 5PALA 1DJIA 3GK2A 2BL0C 2K2AA 1QX7A 1AJ4A 1SCMC 2KYCA 2Q91A 1FPWA 1F4OA 1PULA 1XFXO 3PFVA 3GOFA 1VRKA 2KBIA 1SL7A 2LUXA 2ZNDA 4DRWA 1ZACA 1W7JB 1K93D 2FOTA 4WQ3A 2KGBC 1Y1AA 2L5XB 2PASA 1B7TY 3DVJA 1QASA 3TUYC 2L4HA 2NXQA 4I5NB 4DUQA 2GGZA 1IG5A 1K90D 2KI6C 1UP5A 1KQMC 4R1EA 1K2HA 1FW4A 1BJFA 1DJHA 2BCXA 5FYXA 2L51A 1SL8A 1KK8B 3ICBA 5D7FA 1N2DA 1SR6C 1WRKA 1K9UA 1MF8B 1J7OA 1IKUA 2M97A 1SL9A 2L2EA 3EK7A 1ZUZA 3PN7B 1PVAA 5AFPA 1NX1A 1M39A 4GGFA 1RECA 1QX2A 2JRFA 4XJKB 5AEQA 4MRXA 1QIVA 3EVUA 1S3PA 1AUIB 1XFYO 3KF9A 3TS5C 2NLNA 1A29A 2LP2A 1F8HA 2ZNEA 3OP0A 2LLUA 4HSZA 1EH2A 4WRIA 1M31A 4MVFA 3CS1A 3LK1A 2ISDA 3TUYB 1NUBA 1RK9A 4PHNA 1U5IB 2LE9B 4MN0A 2OS8C 1DMOA 2JXCA 1B7TZ 4NDBA 2JT3A 1BMOA 2K8MB 1JBAA 4ZCUA 1EXRA 1MR8A 2ZN9A 2KQYA 3BOWB 2MAZA 4I5JA 3KHEA 2MHHA 5DKQA 5ER5A 3EVVA 1QS7A 2LUCA 4F0ZB 1CMFA 2BE6A 2PSRA 1DJZA 1DGVA 4A4CA 3OHMB 1PALA 1KQVA 3EK4A 1YUTA 5J3XA 1SBJA 2JT8A 3WHTB 4GNKB 2KAVA 3I5FC 1G4YR 1N65A 1ALWA 2I18A 4OR9B 1KSMA 1M63B 2PMYA 4HRGA 2AMIA 1K9KA 1B8CA 2Y1NA 2PVBA 1J55A 2M7LA 2BCBA 2CBLA 1J1DA 1MXEA 5JJGA 1F70A 3PLFB
chains in the Genus database with same CATH superfamily
2WC8A 5HKZA 1CNPA 2IS9A 1SK6D 3CTNA 2FCDA 2L0PA 2QACA 5DKRA 3MSEB 3VGOA 5I8NA 1TTXA 2WCLA 3CLNA 3NSOA 3OB1B 3PALA 1CM1A 2EHBA 1C3YA 1F55A 1CLBA 3CYZA 3HX4A 3IQQA 2PYQA 1B8RA 4ORCB 2BKIB 1QV1A 2KFHA 2ZRSA 2PQLA 1EG4A 2KFFA 2WOSA 2BKHB 1S6CA 4MBEA 1CFFA 4NQGA 1H4BA 2FJUB 3SS4A 3TDUA 5AERA 4FTGA 4C0JA 2LNKA 3SJSA 2QEBA 4WQ2A 2KFGA 5JOLA 1G33A 3TDZA 3CWGA 1XFVO 1Y1UA 1K9PA 1SRAA 2EC6B 3C1VA 3LK0A 2K61A 3KPXA 4OV2A 1QVIY 2PALA 3RLZA 1A03A 1YTZC 3KEVA 2MBXA 3D74A 3NHTA 1BLQA 2BAPA 2WCBA 1KK7Y 1PK0D 1KWOB 1JWDA 3BFHA 1MXLC 1J1EA 1C07A 2BBNA 1DGUA 3PN7C 2KGRA 2K2FA 1NYAA 2M1UA 1DTLA 3S0GA 3IF7A 3OX6A 3GK1A 4OCIA 1HT9A 1ORGA 4ORBB 2E30A 3HCMA 1QLKA 1Y0VH 1SYMA 1OOHA 1C7WA 3V2LA 2LMTA 1TNQA 4JD9A 2KAYA 4ORAB 4QJ5B 1CDPA 5G08A 3R1PA 3VB1A 2KQ6A 2KI6D 3FE6A 1YVHA 2I7AA 4M2PA 1R2UA 1OMDA 1LINA 1OOJA 2COLB 3CGAA 3K21A 3BOWA 1KFXL 3NXAA 4PCWA 1F4QA 3FIAA 1ZMZA 2FCEA 3H4SE 1GGZA 3NSIA 1CKKA 3BQ3A 3BUXB 1QV0A 2E6WA 3I5GB 3WXAA 1FBVA 2O60A 4BY4A 4OZDA 1B1GA 3L4AA 4DCKA 1SW8A 2MLEC 1KSOA 1TRFA 1W7IB 1L2OB 3NSLA 2M1KB 1IJ5A 1S5GY 2F3YA 1DF0B 3B87A 3D0YB 1YRUB 1C7VA 1QVIZ 2BECA 3F45A 3LCPC 2A4JA 3LLEA 2BE4A 1KK7Z 2KBMA 1PVBA 1YX7A 1GQMA 3FE9A 4YRUA 1RROA 1EG3A 2HF5A 5CSNA 4AQJA 1SCVA 1FI6A 1ZFSA 2F2PA 1Y1XA 2M49B 2LP3A 1CDMA 2OTGB 1DT7B 1RWYA 5CPVA 4GUKA 4PT1A 3ZNIA 1DJWA 1SKTA 1DEKA 2K0JA 1CLMA 5HKWA 3A8RA 1RJVA 1TNPA 2CT9A 3PM8A 1BF5A 1N0YA 2B1UA 1RFJA 3VRPA 1YURA 3CZTX 4FQTA 2CNPA 4YGEB 1CMGA 1S36A 1V1GA 2G9BA 5KSZA 1FF1A 1A4PA 1AP4A 1CLLA 1NWDA 4M2OA 4GPLB 3GK4X 1QJTA 4NDCA 2K60A 1M45A 1KFUL 1CDLA 2KOTA 4P2YB 1T14A 1H8BA 1SY9A 3IVTA 5BPJA 2NCOA 5IBWA 1X02A 1YUUA 1BU3A 2LV7A 2EGDA 3PM2A 1NCYA 2LMVA 4ZCVA 2MLFC 1UWOA 4YGCB 2JWWA 1W9ZA 1XYDA 4PDZA 2ZFDA 2WCEA 3EKJA 3NSKA 1MUXA 3CR5X 2EC6C 1JF2A 1AK8A 1S5GZ 3A4UB 5CSIA 1OOGA 3JVTB 1CB1A 3JTDB 1LA0A 5CSFA 1DC1A 3AAKA 1KWOC 1JF0A 2DOQA 1XK4C 4A4BA 1TN4A 2JU0A 2Y5IA 1L7ZA 1OQPA 2LVIA 3S0EA 1XO5A 1IQ5A 2QEOA 4I5LB 3FWBA 4AQIA 1B8LA 2KI4B 4YI9A 3TDIA 1SMGA 2OPOA 2CCMA 5F6TA 3OB2B 2KYFA 2TN4A 5K89A 2MA2A 3K1EA 1B4CA 2WC6A 2H2KA 3DVKA 1LXFC 2BNXA 4CFRA 1M46A 3I5HB 2Q4UA 1G8IA 4XYNA 2LHLA 2LLSA 4JPZB 4QJ4B 2ZKMX 4E68A 1Z2CB 1Z4HA 2FJYA 1OOFA 4N1FA 2K7DA 1CM4A 1LA3A 5CSJA 4CFQA 1FI5A 1XFRA 2AUCA 3CABA 2WCKA 2HPSA 3VRQA 4BY5A 3OX5A 1MWNA 3I5GC 1YRTB 1ZOTB 3WNXB 2D8NA 2BCAA 3KO0A 4P5OE 4AOMA 1A75B 1B9AA 1DF0A 3D0YA 1BOCA 1IJ6A 1E8AA 4YGAA 2M29A 4C0KA 2BBMA 2KLDA 1OZOA 2LC5A 3CZ2A 4F7FA 1FPWA 3R72A 3O2PA 1NCXA 2JXLA 1TOPA 3EKHA 1L2OC 4GGNA 4XJKA 1K96A 4CIDA 1K8UA 1TUJA 1BODA 1JC2A 2JC2A 3E3RA 2M3WA 4ICBA 2CTNA 4YBHB 3AKAA 2LAPA 4D1EA 3DVEA 3M0WA 3O78A 1QATA 3SG4A 1QIWA 1KFXS 3DF0B 1S26D 2KSPA 2OTGC 4MEWA 3RM1A 3VROA 1B47A 4I5KA 1CFPA 2LHIA 2WNDA 1PSBA 1U5IA 2JTTA 1WDCB 5FI2A 4YI8A 1XA5A 2R2IA 1QLSA 1UHNA 3Q8IA 5I2LA 5ER4X 3SG5A 1IWQA 4INXA 2KAXA 3NHIA 5I2QA 1V1FA 2K7OA 2YGUA 3CR2A 5B8IB 1OMRA 1UUSA 2HETA 2ZRTA 1LVCD 5HKYA 2GTEA 1EJ3A 3O6BA 4PHMA 1IIOA 1BR1B 4JWQA 3S0FA 2WCHA 3SS3A 2K7CA 2LMUA 3N7HA 4C0LA 4L9MA 4DS7A 3I5IB 2NCPA 3LL8B 1S6IA 1A2XA 1IGVA 5HYDA 5I2OA 2F8PA 4HREE 2JNXA 3L47A 1CFDA 1NIWA 2F2OA 3AAJA 5D69A 5KU1A 1F71A 2WC5A 4OKHA 4MSPA 1WRZA 2M7NA 3PATA 1OMVA 1BT6A 1DJYA 1UHJA 3JVTC 1WLMA 5AANA 3JTDC 1IH0A 3DD4A 4IJ7A 2PRUA 3B7AA 3PJIA 3SIAA 1UHKA 1RTP1 3FE8A 2RGIA 3BUNB 2L98A 1BR4B 1LKJA 2GGMA 1MQ1A 1D1OA 2QPTA 3BUOB 3EK8A 1XFUO 2JQ6A 2MRDA 5AXIA 3VRRA 1J7RA 1XFZO 1NX2A 2QEVA 1NX0A 2JPOA 3BUMB 1WLZA 1KFUS 2KI4C 1R6PA 1JUOA 2F3ZA 1TCFA 4USLA 3WHUB 2SCPA 1TIZA 2P70A 1CDNA 4GAOA 2K7BA 1S6JA 4JQ0D 3ZWHA 2BL0B 2KDHA 1QX5B 5KTYA 2LANA 3I5HC 2JT0A 3AKBA 3SIBA 3UNWA 3D10A 1UURA 3EVRA 1SCMB 4PE4A 4MLWA 3O4YA 1NSHA 3B88A 3BFAA 1A75A 5DKNA 3TZ1A 4DIRA 2L5YA 1UHHA 1NPQA 5TNCA 4GGFC 4M2QA 4ETOA 1BG1A 2LCPA 4YGDB 1YR5A 4CLNA 1J7PA 2LVKA 2WORA 3QRXA 1AHRA 4NDDA 1DQEA 4MZKA 1MHOA 1S1EA 1CTRA 1HQVA 1PSRA 2KLEA 3BJHA 2O5GA 3BUWB 4HRHA 1XK4A 4U8DA 1JFJA 1YVLA 1YUSA 3FS7A 1SPYA 2Y4QA 1K94A 2H61A 4PHKA 5HLOA 4PE7A 4OVNF 5D3OA 3BFBA 1F54A 2AAOA 2WCFA 3NGVA 1Q80A 1KQMB 2ZN8A 2HQ8A 2SASA 1ODBA 1PRWA 1OSAA 2F33A 3DF0A 2JULA 1WRLA 2H61C 2KNEA 2M9GA 1OE9B 2LVJA 5HLVA 1SSEB 2GV5A 2M8UA 3D76A 1SR6B 4MZLA 3SG2A 1JFKA 4MRYA 3SG7A 1GJYA 1NCZA 1IRJA 2L4IA 3D73A 3OBVA 2CXJA 1WDCC 2JNFA 1YX8A 2NZ0A 2JZIA 3SG3A 2HQWA 4QJ3B 1ALVA 3B6XA 1DVIA 3S0BA 3SS5A 4MZJA 3BXKA 1XVJA 2JTZA 3TS5B 1XFWO 1NX3A 1KCYA 1TNXA 3PSRA 1AVSA 4Q04A 1AJ5A 2L50A 2I94A 3D77A 3VRNA 2I2RE 2JOJA 1TNWA 2V53A 5DICA 4UPGA 4N5XA 4PALA 1WY9A 2QDIA 4YGBB 3O4XA 3IQOA 3I5IC 1QXPA 2JPTA 2OS8B 1DJXA 5FI6A 2VRGA 4PE1A 5GQQC 1K95A 4N1GA 1IQ3A 4FQOA 5I94A 2LM5A 1GGWA 1SNLA 1LS8A 1CFCA 2M0RA 3CR4X 4IL1A 3DZTA 2KHNA 1NP8A 2LLTA 1UHIA 1TWOA 4TNCA 2H8VA 4GBAA 3SG6A 1EL4A 3D78A 3FWCA 3DVMA 3I5FB 2QEHA 3L4LA 1KK8C 3DY9A 1J7QA 1OZSA 3BYAA 1TCOB 2P6BB 4PE0A 1QTXA 4CPVA 1Y6WA 1TUZA 2LVVA 4GFTA 1DJGA 2MJWB 2Y1MA 1JSAA 4PHJA 2G2BA 5PALA 1DJIA 3GK2A 2BL0C 3CZ0A 2P71A 2K2AA 1QX7A 3CDNA 1AJ4A 1OW4A 1SCMC 2KYCA 2Q91A 1F4OA 1PULA 1XFXO 3PFVA 3GOFA 1VRKA 2KBIA 1SL7A 2LUXA 2ZNDA 4DRWA 1ZACA 1W7JB 1K93D 2FOTA 4WQ3A 4INWA 2KGBC 1Y1AA 2L5XB 2PASA 1B7TY 3DVJA 1QASA 3TUYC 2L4HA 2NXQA 4I5NB 4DUQA 3B86A 2GGZA 1IG5A 3D75A 1K90D 2KI6C 1UP5A 1KQMC 2KPHA 1QWVA 4R1EA 1FW4A 1BJFA 1DJHA 1K2HA 2BCXA 5FYXA 2L51A 1SL8A 1KK8B 3ICBA 2WCMA 5D7FA 1N2DA 1P28A 1SR6C 1WRKA 1K9UA 1MF8B 3EG5B 1IKUA 1J7OA 2M97A 1SL9A 2L2EA 3EK7A 1ZUZA 3PN7B 1PVAA 5HL1A 5AFPA 2ERBA 1NX1A 1M39A 4GGFA 1RECA 1QX2A 1GM0A 3DXLA 2JRFA 4XJKB 5AEQA 4MRXA 1QIVA 3EVUA 1S3PA 1C3ZA 1AUIB 1XFYO 3CZ1A 3KF9A 3TS5C 3QMEA 2NLNA 1A29A 2LP2A 1F8HA 2ZNEA 3OP0A 2LLUA 4HSZA 1EH2A 3R1OA 4WRIA 1M31A 4MVFA 3CS1A 3LK1A 5JJGA 2ISDA 3TUYB 1NUBA 3S0AA 1RK9A 4PHNA 1U5IB 2LE9B 4MN0A 2OS8C 1DMOA 2JXCA 1B7TZ 4NDBA 2JT3A 1BMOA 2K8MB 1JBAA 4ZCUA 1EXRA 5FI7A 1MR8A 2ZN9A 2KQYA 3BOWB 2MAZA 4I5JA 3KHEA 2MHHA 5DKQA 5ER5A 3EVVA 1QS7A 2LUCA 4F0ZB 1CMFA 2BE6A 2PSRA 1DJZA 1OOIX 1DGVA 4A4CA 2L2CA 3R1VA 3OHMB 1PALA 3RZSA 1KQVA 2WCJA 3OGNA 4KYNA 3EK4A 1YUTA 5J3XA 1SBJA 2JT8A 3WHTB 4GNKB 2KAVA 3I5FC 1DELA 1G4YR 3UO9A 1N65A 1ALWA 2I18A 4OR9B 1KSMA 1M63B 2PMYA 4HRGA 5EL2A 2AMIA 1K9KA 3DYEA 1B8CA 2Y1NA 2PVBA 1J55A 2M7LA 2BCBA 2CBLA 4JKTA 1J1DA 1MXEA 3S0DA 1F70A 3PLFB
chains in the Genus database with same CATH topology
2WC8A 5HKZA 1CNPA 2IS9A 1SK6D 3CTNA 2FCDA 2L0PA 2QACA 5DKRA 3MSEB 3VGOA 5I8NA 1TTXA 3CLNA 3NSOA 3OB1B 3PALA 1CM1A 2EHBA 1F55A 1CLBA 3HX4A 3IQQA 1B8RA 4ORCB 2BKIB 1QV1A 2KFHA 2ZRSA 1EG4A 2KFFA 2WOSA 2BKHB 1S6CA 4MBEA 1CFFA 4NQGA 1H4BA 2FJUB 3TDUA 5AERA 4FTGA 4C0JA 2LNKA 3SJSA 4WQ2A 2KFGA 5JOLA 1G33A 3TDZA 3CWGA 1XFVO 1Y1UA 1K9PA 1SRAA 2EC6B 3C1VA 3LK0A 2K61A 3KPXA 4OV2A 1QVIY 2PALA 3RLZA 1A03A 1YTZC 3KEVA 2MBXA 1BLQA 2WCBA 1KK7Y 1PK0D 1KWOB 1JWDA 1MXLC 1J1EA 1C07A 2BBNA 1DGUA 3PN7C 2KGRA 2K2FA 1NYAA 2M1UA 1DTLA 3IF7A 3OX6A 3GK1A 4OCIA 1HT9A 4ORBB 2E30A 3HCMA 1QLKA 1Y0VH 1SYMA 1C7WA 2LMTA 1TNQA 4ORAB 2KAYA 4QJ5B 1CDPA 5G08A 2KQ6A 2KI6D 1YVHA 2I7AA 4M2PA 1R2UA 1OMDA 1LINA 1OOJA 2COLB 3CGAA 3K21A 3BOWA 1KFXL 3NXAA 4PCWA 1F4QA 3FIAA 1ZMZA 2FCEA 3H4SE 1GGZA 3NSIA 1CKKA 3BQ3A 3BUXB 1QV0A 2E6WA 3I5GB 3WXAA 1FBVA 2O60A 4BY4A 1B1GA 4DCKA 1SW8A 2MLEC 1KSOA 1TRFA 1W7IB 1L2OB 3NSLA 2M1KB 1IJ5A 1S5GY 2F3YA 1DF0B 3D0YB 1YRUB 1C7VA 1QVIZ 2BECA 3F45A 3LCPC 2A4JA 3LLEA 2BE4A 1KK7Z 2KBMA 1PVBA 1YX7A 1GQMA 4YRUA 1RROA 1EG3A 2HF5A 5CSNA 4AQJA 1SCVA 1FI6A 1ZFSA 2F2PA 1Y1XA 2M49B 2LP3A 1CDMA 2OTGB 1DT7B 1RWYA 5CPVA 4GUKA 3ZNIA 1DJWA 1SKTA 2K0JA 5HKWA 1CLMA 3A8RA 1RJVA 1TNPA 2CT9A 3PM8A 1BF5A 1N0YA 2B1UA 1RFJA 3VRPA 1YURA 3CZTX 1CMGA 2CNPA 4YGEB 1S36A 1V1GA 2G9BA 5KSZA 1FF1A 1A4PA 1AP4A 1CLLA 1NWDA 4M2OA 4GPLB 3GK4X 1QJTA 4NDCA 1M45A 1KFUL 1CDLA 2KOTA 4P2YB 1H8BA 1SY9A 5BPJA 5IBWA 2NCOA 1X02A 1YUUA 1BU3A 2LV7A 2EGDA 1NCYA 2LMVA 4ZCVA 2MLFC 1UWOA 4YGCB 2JWWA 1XYDA 4PDZA 2ZFDA 2WCEA 3EKJA 3NSKA 1MUXA 3CR5X 2EC6C 1JF2A 1AK8A 1S5GZ 3A4UB 5CSIA 1CB1A 3JVTB 3JTDB 1LA0A 5CSFA 3AAKA 1KWOC 1JF0A 2DOQA 1XK4C 4A4BA 1TN4A 2JU0A 2Y5IA 1L7ZA 1OQPA 2LVIA 1XO5A 1IQ5A 4I5LB 3FWBA 4AQIA 1B8LA 2KI4B 4YI9A 3TDIA 1SMGA 2OPOA 2CCMA 5F6TA 3OB2B 2KYFA 2TN4A 5K89A 2MA2A 1B4CA 2H2KA 3DVKA 1LXFC 4CFRA 1M46A 3I5HB 2Q4UA 1G8IA 4XYNA 2LHLA 2LLSA 4JPZB 4QJ4B 2ZKMX 4E68A 4N1FA 2K7DA 1CM4A 1LA3A 5CSJA 4CFQA 1FI5A 2AUCA 4BY5A 2HPSA 3VRQA 3OX5A 1MWNA 3I5GC 1YRTB 1ZOTB 3WNXB 2D8NA 2BCAA 3KO0A 4P5OE 4AOMA 1A75B 1B9AA 1DF0A 3D0YA 1BOCA 1IJ6A 1E8AA 4YGAA 2M29A 4C0KA 2BBMA 1OZOA 2LC5A 3O2PA 1NCXA 2JXLA 1TOPA 3EKHA 1L2OC 4GGNA 4XJKA 1K96A 4CIDA 1K8UA 1BODA 1JC2A 2JC2A 3E3RA 2M3WA 4ICBA 2CTNA 4YBHB 3AKAA 2LAPA 4D1EA 3DVEA 3M0WA 3O78A 1QATA 3SG4A 1QIWA 1KFXS 3DF0B 1S26D 2KSPA 2OTGC 4MEWA 3RM1A 3VROA 1B47A 4I5KA 1CFPA 2LHIA 2WNDA 1PSBA 1U5IA 2JTTA 1WDCB 4YI8A 1XA5A 2R2IA 1QLSA 1UHNA 5I2LA 5ER4X 3SG5A 1IWQA 2KAXA 5I2QA 1V1FA 2K7OA 3CR2A 5B8IB 1OMRA 1UUSA 2HETA 2ZRTA 1LVCD 5HKYA 1EJ3A 3O6BA 4PHMA 1BR1B 4JWQA 2K7CA 2LMUA 4C0LA 4L9MA 4DS7A 3I5IB 2NCPA 3LL8B 1S6IA 1A2XA 1IGVA 5HYDA 5I2OA 2F8PA 4HREE 2JNXA 1CFDA 1NIWA 2F2OA 3AAJA 5D69A 5KU1A 1F71A 4OKHA 4MSPA 1WRZA 2M7NA 3PATA 1OMVA 1BT6A 1DJYA 1UHJA 3JVTC 1WLMA 5AANA 3JTDC 1IH0A 3DD4A 2PRUA 3SIAA 1UHKA 1RTP1 2RGIA 3BUNB 2L98A 1BR4B 1LKJA 2GGMA 1MQ1A 1D1OA 2QPTA 3BUOB 3EK8A 1XFUO 2JQ6A 2MRDA 5AXIA 3VRRA 1J7RA 1XFZO 1NX2A 1NX0A 3BUMB 1WLZA 1KFUS 2KI4C 1R6PA 1JUOA 2F3ZA 1TCFA 4USLA 3WHUB 2SCPA 1TIZA 1CDNA 4GAOA 2K7BA 1S6JA 4JQ0D 3ZWHA 2BL0B 2KDHA 1QX5B 5KTYA 2LANA 3I5HC 2JT0A 3AKBA 3SIBA 3D10A 1UURA 3EVRA 1SCMB 4PE4A 4MLWA 3O4YA 1NSHA 1A75A 5DKNA 3TZ1A 4DIRA 1UHHA 1NPQA 5TNCA 4GGFC 4M2QA 4ETOA 1BG1A 2LCPA 4YGDB 1YR5A 4CLNA 1J7PA 2LVKA 2WORA 3QRXA 1AHRA 4NDDA 4MZKA 1MHOA 1S1EA 1CTRA 1HQVA 1PSRA 3BUWB 4U8DA 2O5GA 1JFJA 4HRHA 1XK4A 1YVLA 1YUSA 3FS7A 1SPYA 2Y4QA 1K94A 2H61A 4PHKA 5HLOA 4PE7A 4OVNF 1F54A 2AAOA 2WCFA 1Q80A 1KQMB 2ZN8A 2HQ8A 2SASA 1ODBA 1PRWA 1OSAA 2F33A 3DF0A 2JULA 1WRLA 2H61C 2KNEA 2M9GA 1OE9B 2LVJA 5HLVA 2GV5A 2M8UA 1SR6B 4MZLA 3SG2A 1JFKA 4MRYA 3SG7A 1GJYA 1NCZA 1IRJA 2L4IA 2CXJA 1WDCC 2JNFA 1YX8A 2NZ0A 2JZIA 3SG3A 2HQWA 4QJ3B 1ALVA 1DVIA 4MZJA 3BXKA 1XVJA 2JTZA 3TS5B 1XFWO 1NX3A 1KCYA 1TNXA 3PSRA 1AVSA 4Q04A 1AJ5A 2L50A 2I94A 3VRNA 2I2RE 2JOJA 1TNWA 2V53A 4UPGA 4N5XA 4PALA 1WY9A 4YGBB 3IQOA 3I5IC 1QXPA 2JPTA 2OS8B 1DJXA 2VRGA 4PE1A 5GQQC 1K95A 4N1GA 1IQ3A 4FQOA 2LM5A 1GGWA 1SNLA 1CFCA 2M0RA 3CR4X 4IL1A 2KHNA 1NP8A 2LLTA 1UHIA 4TNCA 4GBAA 3SG6A 1EL4A 3FWCA 3DVMA 3I5FB 1KK8C 1J7QA 1OZSA 3BYAA 1TCOB 2P6BB 4PE0A 1QTXA 4CPVA 1Y6WA 2LVVA 4GFTA 1DJGA 2MJWB 2Y1MA 1JSAA 4PHJA 2G2BA 5PALA 1DJIA 3GK2A 2BL0C 2K2AA 1QX7A 1AJ4A 1SCMC 2KYCA 2Q91A 1FPWA 1F4OA 1PULA 1XFXO 3PFVA 3GOFA 1VRKA 2KBIA 1SL7A 2LUXA 2ZNDA 4DRWA 1ZACA 1W7JB 1K93D 2FOTA 4WQ3A 2KGBC 1Y1AA 2L5XB 2PASA 1B7TY 3DVJA 1QASA 3TUYC 2L4HA 2NXQA 4I5NB 4DUQA 2GGZA 1IG5A 1K90D 2KI6C 1UP5A 1KQMC 4R1EA 1K2HA 1FW4A 1BJFA 1DJHA 2BCXA 5FYXA 2L51A 1SL8A 1KK8B 3ICBA 5D7FA 1N2DA 1SR6C 1WRKA 1K9UA 1MF8B 1J7OA 1IKUA 2M97A 1SL9A 2L2EA 3EK7A 1ZUZA 3PN7B 1PVAA 5AFPA 1NX1A 1M39A 4GGFA 1RECA 1QX2A 2JRFA 4XJKB 5AEQA 4MRXA 1QIVA 3EVUA 1S3PA 1AUIB 1XFYO 3KF9A 3TS5C 2NLNA 1A29A 2LP2A 1F8HA 2ZNEA 3OP0A 2LLUA 4HSZA 1EH2A 4WRIA 1M31A 4MVFA 3CS1A 3LK1A 2ISDA 3TUYB 1NUBA 1RK9A 4PHNA 1U5IB 2LE9B 4MN0A 2OS8C 1DMOA 2JXCA 1B7TZ 4NDBA 2JT3A 1BMOA 2K8MB 1JBAA 4ZCUA 1EXRA 1MR8A 2ZN9A 2KQYA 3BOWB 2MAZA 4I5JA 3KHEA 2MHHA 5DKQA 5ER5A 3EVVA 1QS7A 2LUCA 4F0ZB 1CMFA 2BE6A 2PSRA 1DJZA 1DGVA 4A4CA 3OHMB 1PALA 1KQVA 3EK4A 1YUTA 5J3XA 1SBJA 2JT8A 3WHTB 4GNKB 2KAVA 3I5FC 1G4YR 1N65A 1ALWA 2I18A 4OR9B 1KSMA 1M63B 2PMYA 4HRGA 2AMIA 1K9KA 1B8CA 2Y1NA 2PVBA 1J55A 2M7LA 2BCBA 2CBLA 1J1DA 1MXEA 5JJGA 1F70A 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC8 A;  5HKZ A;  1CNP A;  2IS9 A;  1SK6 D;  3CTN A;  2FCD A;  2L0P A;  2QAC A;  5DKR A;  3MSE B;  3VGO A;  5I8N A;  1TTX A;  3CLN A;  3NSO A;  3OB1 B;  3PAL A;  1CM1 A;  2EHB A;  1F55 A;  1CLB A;  3HX4 A;  3IQQ A;  1B8R A;  4ORC B;  2BKI B;  1QV1 A;  2KFH A;  2ZRS A;  1EG4 A;  2KFF A;  2WOS A;  2BKH B;  1S6C A;  4MBE A;  1CFF A;  4NQG A;  1H4B A;  2FJU B;  3TDU A;  5AER A;  4FTG A;  4C0J A;  2LNK A;  3SJS A;  4WQ2 A;  2KFG A;  5JOL A;  1G33 A;  3TDZ A;  3CWG A;  1XFV O;  1Y1U A;  1K9P A;  1SRA A;  2EC6 B;  3C1V A;  3LK0 A;  2K61 A;  3KPX A;  4OV2 A;  1QVI Y;  2PAL A;  3RLZ A;  1A03 A;  1YTZ C;  3KEV A;  2MBX A;  1BLQ A;  2WCB A;  1KK7 Y;  1PK0 D;  1KWO B;  1JWD A;  1MXL C;  1J1E A;  1C07 A;  2BBN A;  1DGU A;  3PN7 C;  2KGR A;  2K2F A;  1NYA A;  2M1U A;  1DTL A;  3IF7 A;  3OX6 A;  3GK1 A;  4OCI A;  1HT9 A;  4ORB B;  2E30 A;  3HCM A;  1QLK A;  1Y0V H;  1SYM A;  1C7W A;  2LMT A;  1TNQ A;  4ORA B;  2KAY A;  4QJ5 B;  1CDP A;  5G08 A;  2KQ6 A;  2KI6 D;  1YVH A;  2I7A A;  4M2P A;  1R2U A;  1OMD A;  1LIN A;  1OOJ A;  2COL B;  3CGA A;  3K21 A;  3BOW A;  1KFX L;  3NXA A;  4PCW A;  1F4Q A;  3FIA A;  1ZMZ A;  2FCE A;  3H4S E;  1GGZ A;  3NSI A;  1CKK A;  3BQ3 A;  3BUX B;  1QV0 A;  2E6W A;  3I5G B;  3WXA A;  1FBV A;  2O60 A;  4BY4 A;  1B1G A;  4DCK A;  1SW8 A;  2MLE C;  1KSO A;  1TRF A;  1W7I B;  1L2O B;  3NSL A;  2M1K B;  1IJ5 A;  1S5G Y;  2F3Y A;  1DF0 B;  3D0Y B;  1YRU B;  1C7V A;  1QVI Z;  2BEC A;  3F45 A;  3LCP C;  2A4J A;  3LLE A;  2BE4 A;  1KK7 Z;  2KBM A;  1PVB A;  1YX7 A;  1GQM A;  4YRU A;  1RRO A;  1EG3 A;  2HF5 A;  5CSN A;  4AQJ A;  1SCV A;  1FI6 A;  1ZFS A;  2F2P A;  1Y1X A;  2M49 B;  2LP3 A;  1CDM A;  2OTG B;  1DT7 B;  1RWY A;  5CPV A;  4GUK A;  3ZNI A;  1DJW A;  1SKT A;  2K0J A;  5HKW A;  1CLM A;  3A8R A;  1RJV A;  1TNP A;  2CT9 A;  3PM8 A;  1BF5 A;  1N0Y A;  2B1U A;  1RFJ A;  3VRP A;  1YUR A;  3CZT X;  1CMG A;  2CNP A;  4YGE B;  1S36 A;  1V1G A;  2G9B A;  5KSZ A;  1FF1 A;  1A4P A;  1AP4 A;  1CLL A;  1NWD A;  4M2O A;  4GPL B;  3GK4 X;  1QJT A;  4NDC A;  1M45 A;  1KFU L;  1CDL A;  2KOT A;  4P2Y B;  1H8B A;  1SY9 A;  5BPJ A;  5IBW A;  2NCO A;  1X02 A;  1YUU A;  1BU3 A;  2LV7 A;  2EGD A;  1NCY A;  2LMV A;  4ZCV A;  2MLF C;  1UWO A;  4YGC B;  2JWW A;  1XYD A;  4PDZ A;  2ZFD A;  2WCE A;  3EKJ A;  3NSK A;  1MUX A;  3CR5 X;  2EC6 C;  1JF2 A;  1AK8 A;  1S5G Z;  3A4U B;  5CSI A;  1CB1 A;  3JVT B;  3JTD B;  1LA0 A;  5CSF A;  3AAK A;  1KWO C;  1JF0 A;  2DOQ A;  1XK4 C;  4A4B A;  1TN4 A;  2JU0 A;  2Y5I A;  1L7Z A;  1OQP A;  2LVI A;  1XO5 A;  1IQ5 A;  4I5L B;  3FWB A;  4AQI A;  1B8L A;  2KI4 B;  4YI9 A;  3TDI A;  1SMG A;  2OPO A;  2CCM A;  5F6T A;  3OB2 B;  2KYF A;  2TN4 A;  5K89 A;  2MA2 A;  1B4C A;  2H2K A;  3DVK A;  1LXF C;  4CFR A;  1M46 A;  3I5H B;  2Q4U A;  1G8I A;  4XYN A;  2LHL A;  2LLS A;  4JPZ B;  4QJ4 B;  2ZKM X;  4E68 A;  4N1F A;  2K7D A;  1CM4 A;  1LA3 A;  5CSJ A;  4CFQ A;  1FI5 A;  2AUC A;  4BY5 A;  2HPS A;  3VRQ A;  3OX5 A;  1MWN A;  3I5G C;  1YRT B;  1ZOT B;  3WNX B;  2D8N A;  2BCA A;  3KO0 A;  4P5O E;  4AOM A;  1A75 B;  1B9A A;  1DF0 A;  3D0Y A;  1BOC A;  1IJ6 A;  1E8A A;  4YGA A;  2M29 A;  4C0K A;  2BBM A;  1OZO A;  2LC5 A;  3O2P A;  1NCX A;  2JXL A;  1TOP A;  3EKH A;  1L2O C;  4GGN A;  4XJK A;  1K96 A;  4CID A;  1K8U A;  1BOD A;  1JC2 A;  2JC2 A;  3E3R A;  2M3W A;  4ICB A;  2CTN A;  4YBH B;  3AKA A;  2LAP A;  4D1E A;  3DVE A;  3M0W A;  3O78 A;  1QAT A;  3SG4 A;  1QIW A;  1KFX S;  3DF0 B;  1S26 D;  2KSP A;  2OTG C;  4MEW A;  3RM1 A;  3VRO A;  1B47 A;  4I5K A;  1CFP A;  2LHI A;  2WND A;  1PSB A;  1U5I A;  2JTT A;  1WDC B;  4YI8 A;  1XA5 A;  2R2I A;  1QLS A;  1UHN A;  5I2L A;  5ER4 X;  3SG5 A;  1IWQ A;  2KAX A;  5I2Q A;  1V1F A;  2K7O A;  3CR2 A;  5B8I B;  1OMR A;  1UUS A;  2HET A;  2ZRT A;  1LVC D;  5HKY A;  1EJ3 A;  3O6B A;  4PHM A;  1BR1 B;  4JWQ A;  2K7C A;  2LMU A;  4C0L A;  4L9M A;  4DS7 A;  3I5I B;  2NCP A;  3LL8 B;  1S6I A;  1A2X A;  1IGV A;  5HYD A;  5I2O A;  2F8P A;  4HRE E;  2JNX A;  1CFD A;  1NIW A;  2F2O A;  3AAJ A;  5D69 A;  5KU1 A;  1F71 A;  4OKH A;  4MSP A;  1WRZ A;  2M7N A;  3PAT A;  1OMV A;  1BT6 A;  1DJY A;  1UHJ A;  3JVT C;  1WLM A;  5AAN A;  3JTD C;  1IH0 A;  3DD4 A;  2PRU A;  3SIA A;  1UHK A;  1RTP 1;  2RGI A;  3BUN B;  2L98 A;  1BR4 B;  1LKJ A;  2GGM A;  1MQ1 A;  1D1O A;  2QPT A;  3BUO B;  3EK8 A;  1XFU O;  2JQ6 A;  2MRD A;  5AXI A;  3VRR A;  1J7R A;  1XFZ O;  1NX2 A;  1NX0 A;  3BUM B;  1WLZ A;  1KFU S;  2KI4 C;  1R6P A;  1JUO A;  2F3Z A;  1TCF A;  4USL A;  3WHU B;  2SCP A;  1TIZ A;  1CDN A;  4GAO A;  2K7B A;  1S6J A;  4JQ0 D;  3ZWH A;  2BL0 B;  2KDH A;  1QX5 B;  5KTY A;  2LAN A;  3I5H C;  2JT0 A;  3AKB A;  3SIB A;  3D10 A;  1UUR A;  3EVR A;  1SCM B;  4PE4 A;  4MLW A;  3O4Y A;  1NSH A;  1A75 A;  5DKN A;  3TZ1 A;  4DIR A;  1UHH A;  1NPQ A;  5TNC A;  4GGF C;  4M2Q A;  4ETO A;  1BG1 A;  2LCP A;  4YGD B;  1YR5 A;  4CLN A;  1J7P A;  2LVK A;  2WOR A;  3QRX A;  1AHR A;  4NDD A;  4MZK A;  1MHO A;  1S1E A;  1CTR A;  1HQV A;  1PSR A;  3BUW B;  4U8D A;  2O5G A;  1JFJ A;  4HRH A;  1XK4 A;  1YVL A;  1YUS A;  3FS7 A;  1SPY A;  2Y4Q A;  1K94 A;  2H61 A;  4PHK A;  5HLO A;  4PE7 A;  4OVN F;  1F54 A;  2AAO A;  2WCF A;  1Q80 A;  1KQM B;  2ZN8 A;  2HQ8 A;  2SAS A;  1ODB A;  1PRW A;  1OSA A;  2F33 A;  3DF0 A;  2JUL A;  1WRL A;  2H61 C;  2KNE A;  2M9G A;  1OE9 B;  2LVJ A;  5HLV A;  2GV5 A;  2M8U A;  1SR6 B;  4MZL A;  3SG2 A;  1JFK A;  4MRY A;  3SG7 A;  1GJY A;  1NCZ A;  1IRJ A;  2L4I A;  2CXJ A;  1WDC C;  2JNF A;  1YX8 A;  2NZ0 A;  2JZI A;  3SG3 A;  2HQW A;  4QJ3 B;  1ALV A;  1DVI A;  4MZJ A;  3BXK A;  1XVJ A;  2JTZ A;  3TS5 B;  1XFW O;  1NX3 A;  1KCY A;  1TNX A;  3PSR A;  1AVS A;  4Q04 A;  1AJ5 A;  2L50 A;  2I94 A;  3VRN A;  2I2R E;  2JOJ A;  1TNW A;  2V53 A;  4UPG A;  4N5X A;  4PAL A;  1WY9 A;  4YGB B;  3IQO A;  3I5I C;  1QXP A;  2JPT A;  2OS8 B;  1DJX A;  2VRG A;  4PE1 A;  5GQQ C;  1K95 A;  4N1G A;  1IQ3 A;  4FQO A;  2LM5 A;  1GGW A;  1SNL A;  1CFC A;  2M0R A;  3CR4 X;  4IL1 A;  2KHN A;  1NP8 A;  2LLT A;  1UHI A;  4TNC A;  4GBA A;  3SG6 A;  1EL4 A;  3FWC A;  3DVM A;  3I5F B;  1KK8 C;  1J7Q A;  1OZS A;  3BYA A;  1TCO B;  2P6B B;  4PE0 A;  1QTX A;  4CPV A;  1Y6W A;  2LVV A;  4GFT A;  1DJG A;  2MJW B;  2Y1M A;  1JSA A;  4PHJ A;  2G2B A;  5PAL A;  1DJI A;  3GK2 A;  2BL0 C;  2K2A A;  1QX7 A;  1AJ4 A;  1SCM C;  2KYC A;  2Q91 A;  1FPW A;  1F4O A;  1PUL A;  1XFX O;  3PFV A;  3GOF A;  1VRK A;  2KBI A;  1SL7 A;  2LUX A;  2ZND A;  4DRW A;  1ZAC A;  1W7J B;  1K93 D;  2FOT A;  4WQ3 A;  2KGB C;  1Y1A A;  2L5X B;  2PAS A;  1B7T Y;  3DVJ A;  1QAS A;  3TUY C;  2L4H A;  2NXQ A;  4I5N B;  4DUQ A;  2GGZ A;  1IG5 A;  1K90 D;  2KI6 C;  1UP5 A;  1KQM C;  4R1E A;  1K2H A;  1FW4 A;  1BJF A;  1DJH A;  2BCX A;  5FYX A;  2L51 A;  1SL8 A;  1KK8 B;  3ICB A;  5D7F A;  1N2D A;  1SR6 C;  1WRK A;  1K9U A;  1MF8 B;  1J7O A;  1IKU A;  2M97 A;  1SL9 A;  2L2E A;  3EK7 A;  1ZUZ A;  3PN7 B;  1PVA A;  5AFP A;  1NX1 A;  1M39 A;  4GGF A;  1REC A;  1QX2 A;  2JRF A;  4XJK B;  5AEQ A;  4MRX A;  1QIV A;  3EVU A;  1S3P A;  1AUI B;  1XFY O;  3KF9 A;  3TS5 C;  2NLN A;  1A29 A;  2LP2 A;  1F8H A;  2ZNE A;  3OP0 A;  2LLU A;  4HSZ A;  1EH2 A;  4WRI A;  1M31 A;  4MVF A;  3CS1 A;  3LK1 A;  2ISD A;  3TUY B;  1NUB A;  1RK9 A;  4PHN A;  1U5I B;  2LE9 B;  4MN0 A;  2OS8 C;  1DMO A;  2JXC A;  1B7T Z;  4NDB A;  2JT3 A;  1BMO A;  2K8M B;  1JBA A;  4ZCU A;  1EXR A;  1MR8 A;  2ZN9 A;  2KQY A;  3BOW B;  2MAZ A;  4I5J A;  3KHE A;  2MHH A;  5DKQ A;  5ER5 A;  3EVV A;  1QS7 A;  2LUC A;  4F0Z B;  1CMF A;  2BE6 A;  2PSR A;  1DJZ A;  1DGV A;  4A4C A;  3OHM B;  1PAL A;  1KQV A;  3EK4 A;  1YUT A;  5J3X A;  1SBJ A;  2JT8 A;  3WHT B;  4GNK B;  2KAV A;  3I5F C;  1G4Y R;  1N65 A;  1ALW A;  2I18 A;  4OR9 B;  1KSM A;  1M63 B;  2PMY A;  4HRG A;  2AMI A;  1K9K A;  1B8C A;  2Y1N A;  2PVB A;  1J55 A;  2M7L A;  2BCB A;  2CBL A;  1J1D A;  1MXE A;  5JJG A;  1F70 A;  3PLF B; 
#chains in the Genus database with same CATH topology
 2WC8 A;  5HKZ A;  1CNP A;  2IS9 A;  1SK6 D;  3CTN A;  2FCD A;  2L0P A;  2QAC A;  5DKR A;  3MSE B;  3VGO A;  5I8N A;  1TTX A;  2WCL A;  3CLN A;  3NSO A;  3OB1 B;  3PAL A;  1CM1 A;  2EHB A;  1C3Y A;  1F55 A;  1CLB A;  3CYZ A;  3HX4 A;  3IQQ A;  2PYQ A;  1B8R A;  4ORC B;  2BKI B;  1QV1 A;  2KFH A;  2ZRS A;  2PQL A;  1EG4 A;  2KFF A;  2WOS A;  2BKH B;  1S6C A;  4MBE A;  1CFF A;  4NQG A;  1H4B A;  2FJU B;  3SS4 A;  3TDU A;  5AER A;  4FTG A;  4C0J A;  2LNK A;  3SJS A;  2QEB A;  4WQ2 A;  2KFG A;  5JOL A;  1G33 A;  3TDZ A;  3CWG A;  1XFV O;  1Y1U A;  1K9P A;  1SRA A;  2EC6 B;  3C1V A;  3LK0 A;  2K61 A;  3KPX A;  4OV2 A;  1QVI Y;  2PAL A;  3RLZ A;  1A03 A;  1YTZ C;  3KEV A;  2MBX A;  3D74 A;  3NHT A;  1BLQ A;  2BAP A;  2WCB A;  1KK7 Y;  1PK0 D;  1KWO B;  1JWD A;  3BFH A;  1MXL C;  1J1E A;  1C07 A;  2BBN A;  1DGU A;  3PN7 C;  2KGR A;  2K2F A;  1NYA A;  2M1U A;  1DTL A;  3S0G A;  3IF7 A;  3OX6 A;  3GK1 A;  4OCI A;  1HT9 A;  1ORG A;  4ORB B;  2E30 A;  3HCM A;  1QLK A;  1Y0V H;  1SYM A;  1OOH A;  1C7W A;  3V2L A;  2LMT A;  1TNQ A;  4JD9 A;  2KAY A;  4ORA B;  4QJ5 B;  1CDP A;  5G08 A;  3R1P A;  3VB1 A;  2KQ6 A;  2KI6 D;  3FE6 A;  1YVH A;  2I7A A;  4M2P A;  1R2U A;  1OMD A;  1LIN A;  1OOJ A;  2COL B;  3CGA A;  3K21 A;  3BOW A;  1KFX L;  3NXA A;  4PCW A;  1F4Q A;  3FIA A;  1ZMZ A;  2FCE A;  3H4S E;  1GGZ A;  3NSI A;  1CKK A;  3BQ3 A;  3BUX B;  1QV0 A;  2E6W A;  3I5G B;  3WXA A;  1FBV A;  2O60 A;  4BY4 A;  4OZD A;  1B1G A;  3L4A A;  4DCK A;  1SW8 A;  2MLE C;  1KSO A;  1TRF A;  1W7I B;  1L2O B;  3NSL A;  2M1K B;  1IJ5 A;  1S5G Y;  2F3Y A;  1DF0 B;  3B87 A;  3D0Y B;  1YRU B;  1C7V A;  1QVI Z;  2BEC A;  3F45 A;  3LCP C;  2A4J A;  3LLE A;  2BE4 A;  1KK7 Z;  2KBM A;  1PVB A;  1YX7 A;  1GQM A;  3FE9 A;  4YRU A;  1RRO A;  1EG3 A;  2HF5 A;  5CSN A;  4AQJ A;  1SCV A;  1FI6 A;  1ZFS A;  2F2P A;  1Y1X A;  2M49 B;  2LP3 A;  1CDM A;  2OTG B;  1DT7 B;  1RWY A;  5CPV A;  4GUK A;  4PT1 A;  3ZNI A;  1DJW A;  1SKT A;  1DEK A;  2K0J A;  1CLM A;  5HKW A;  3A8R A;  1RJV A;  1TNP A;  2CT9 A;  3PM8 A;  1BF5 A;  1N0Y A;  2B1U A;  1RFJ A;  3VRP A;  1YUR A;  3CZT X;  4FQT A;  2CNP A;  4YGE B;  1CMG A;  1S36 A;  1V1G A;  2G9B A;  5KSZ A;  1FF1 A;  1A4P A;  1AP4 A;  1CLL A;  1NWD A;  4M2O A;  4GPL B;  3GK4 X;  1QJT A;  4NDC A;  2K60 A;  1M45 A;  1KFU L;  1CDL A;  2KOT A;  4P2Y B;  1T14 A;  1H8B A;  1SY9 A;  3IVT A;  5BPJ A;  2NCO A;  5IBW A;  1X02 A;  1YUU A;  1BU3 A;  2LV7 A;  2EGD A;  3PM2 A;  1NCY A;  2LMV A;  4ZCV A;  2MLF C;  1UWO A;  4YGC B;  2JWW A;  1W9Z A;  1XYD A;  4PDZ A;  2ZFD A;  2WCE A;  3EKJ A;  3NSK A;  1MUX A;  3CR5 X;  2EC6 C;  1JF2 A;  1AK8 A;  1S5G Z;  3A4U B;  5CSI A;  1OOG A;  3JVT B;  1CB1 A;  3JTD B;  1LA0 A;  5CSF A;  1DC1 A;  3AAK A;  1KWO C;  1JF0 A;  2DOQ A;  1XK4 C;  4A4B A;  1TN4 A;  2JU0 A;  2Y5I A;  1L7Z A;  1OQP A;  2LVI A;  3S0E A;  1XO5 A;  1IQ5 A;  2QEO A;  4I5L B;  3FWB A;  4AQI A;  1B8L A;  2KI4 B;  4YI9 A;  3TDI A;  1SMG A;  2OPO A;  2CCM A;  5F6T A;  3OB2 B;  2KYF A;  2TN4 A;  5K89 A;  2MA2 A;  3K1E A;  1B4C A;  2WC6 A;  2H2K A;  3DVK A;  1LXF C;  2BNX A;  4CFR A;  1M46 A;  3I5H B;  2Q4U A;  1G8I A;  4XYN A;  2LHL A;  2LLS A;  4JPZ B;  4QJ4 B;  2ZKM X;  4E68 A;  1Z2C B;  1Z4H A;  2FJY A;  1OOF A;  4N1F A;  2K7D A;  1CM4 A;  1LA3 A;  5CSJ A;  4CFQ A;  1FI5 A;  1XFR A;  2AUC A;  3CAB A;  2WCK A;  2HPS A;  3VRQ A;  4BY5 A;  3OX5 A;  1MWN A;  3I5G C;  1YRT B;  1ZOT B;  3WNX B;  2D8N A;  2BCA A;  3KO0 A;  4P5O E;  4AOM A;  1A75 B;  1B9A A;  1DF0 A;  3D0Y A;  1BOC A;  1IJ6 A;  1E8A A;  4YGA A;  2M29 A;  4C0K A;  2BBM A;  2KLD A;  1OZO A;  2LC5 A;  3CZ2 A;  4F7F A;  1FPW A;  3R72 A;  3O2P A;  1NCX A;  2JXL A;  1TOP A;  3EKH A;  1L2O C;  4GGN A;  4XJK A;  1K96 A;  4CID A;  1K8U A;  1TUJ A;  1BOD A;  1JC2 A;  2JC2 A;  3E3R A;  2M3W A;  4ICB A;  2CTN A;  4YBH B;  3AKA A;  2LAP A;  4D1E A;  3DVE A;  3M0W A;  3O78 A;  1QAT A;  3SG4 A;  1QIW A;  1KFX S;  3DF0 B;  1S26 D;  2KSP A;  2OTG C;  4MEW A;  3RM1 A;  3VRO A;  1B47 A;  4I5K A;  1CFP A;  2LHI A;  2WND A;  1PSB A;  1U5I A;  2JTT A;  1WDC B;  5FI2 A;  4YI8 A;  1XA5 A;  2R2I A;  1QLS A;  1UHN A;  3Q8I A;  5I2L A;  5ER4 X;  3SG5 A;  1IWQ A;  4INX A;  2KAX A;  3NHI A;  5I2Q A;  1V1F A;  2K7O A;  2YGU A;  3CR2 A;  5B8I B;  1OMR A;  1UUS A;  2HET A;  2ZRT A;  1LVC D;  5HKY A;  2GTE A;  1EJ3 A;  3O6B A;  4PHM A;  1IIO A;  1BR1 B;  4JWQ A;  3S0F A;  2WCH A;  3SS3 A;  2K7C A;  2LMU A;  3N7H A;  4C0L A;  4L9M A;  4DS7 A;  3I5I B;  2NCP A;  3LL8 B;  1S6I A;  1A2X A;  1IGV A;  5HYD A;  5I2O A;  2F8P A;  4HRE E;  2JNX A;  3L47 A;  1CFD A;  1NIW A;  2F2O A;  3AAJ A;  5D69 A;  5KU1 A;  1F71 A;  2WC5 A;  4OKH A;  4MSP A;  1WRZ A;  2M7N A;  3PAT A;  1OMV A;  1BT6 A;  1DJY A;  1UHJ A;  3JVT C;  1WLM A;  5AAN A;  3JTD C;  1IH0 A;  3DD4 A;  4IJ7 A;  2PRU A;  3B7A A;  3PJI A;  3SIA A;  1UHK A;  1RTP 1;  3FE8 A;  2RGI A;  3BUN B;  2L98 A;  1BR4 B;  1LKJ A;  2GGM A;  1MQ1 A;  1D1O A;  2QPT A;  3BUO B;  3EK8 A;  1XFU O;  2JQ6 A;  2MRD A;  5AXI A;  3VRR A;  1J7R A;  1XFZ O;  1NX2 A;  2QEV A;  1NX0 A;  2JPO A;  3BUM B;  1WLZ A;  1KFU S;  2KI4 C;  1R6P A;  1JUO A;  2F3Z A;  1TCF A;  4USL A;  3WHU B;  2SCP A;  1TIZ A;  2P70 A;  1CDN A;  4GAO A;  2K7B A;  1S6J A;  4JQ0 D;  3ZWH A;  2BL0 B;  2KDH A;  1QX5 B;  5KTY A;  2LAN A;  3I5H C;  2JT0 A;  3AKB A;  3SIB A;  3UNW A;  3D10 A;  1UUR A;  3EVR A;  1SCM B;  4PE4 A;  4MLW A;  3O4Y A;  1NSH A;  3B88 A;  3BFA A;  1A75 A;  5DKN A;  3TZ1 A;  4DIR A;  2L5Y A;  1UHH A;  1NPQ A;  5TNC A;  4GGF C;  4M2Q A;  4ETO A;  1BG1 A;  2LCP A;  4YGD B;  1YR5 A;  4CLN A;  1J7P A;  2LVK A;  2WOR A;  3QRX A;  1AHR A;  4NDD A;  1DQE A;  4MZK A;  1MHO A;  1S1E A;  1CTR A;  1HQV A;  1PSR A;  2KLE A;  3BJH A;  2O5G A;  3BUW B;  4HRH A;  1XK4 A;  4U8D A;  1JFJ A;  1YVL A;  1YUS A;  3FS7 A;  1SPY A;  2Y4Q A;  1K94 A;  2H61 A;  4PHK A;  5HLO A;  4PE7 A;  4OVN F;  5D3O A;  3BFB A;  1F54 A;  2AAO A;  2WCF A;  3NGV A;  1Q80 A;  1KQM B;  2ZN8 A;  2HQ8 A;  2SAS A;  1ODB A;  1PRW A;  1OSA A;  2F33 A;  3DF0 A;  2JUL A;  1WRL A;  2H61 C;  2KNE A;  2M9G A;  1OE9 B;  2LVJ A;  5HLV A;  1SSE B;  2GV5 A;  2M8U A;  3D76 A;  1SR6 B;  4MZL A;  3SG2 A;  1JFK A;  4MRY A;  3SG7 A;  1GJY A;  1NCZ A;  1IRJ A;  2L4I A;  3D73 A;  3OBV A;  2CXJ A;  1WDC C;  2JNF A;  1YX8 A;  2NZ0 A;  2JZI A;  3SG3 A;  2HQW A;  4QJ3 B;  1ALV A;  3B6X A;  1DVI A;  3S0B A;  3SS5 A;  4MZJ A;  3BXK A;  1XVJ A;  2JTZ A;  3TS5 B;  1XFW O;  1NX3 A;  1KCY A;  1TNX A;  3PSR A;  1AVS A;  4Q04 A;  1AJ5 A;  2L50 A;  2I94 A;  3D77 A;  3VRN A;  2I2R E;  2JOJ A;  1TNW A;  2V53 A;  5DIC A;  4UPG A;  4N5X A;  4PAL A;  1WY9 A;  2QDI A;  4YGB B;  3O4X A;  3IQO A;  3I5I C;  1QXP A;  2JPT A;  2OS8 B;  1DJX A;  5FI6 A;  2VRG A;  4PE1 A;  5GQQ C;  1K95 A;  4N1G A;  1IQ3 A;  4FQO A;  5I94 A;  2LM5 A;  1GGW A;  1SNL A;  1LS8 A;  1CFC A;  2M0R A;  3CR4 X;  4IL1 A;  3DZT A;  2KHN A;  1NP8 A;  2LLT A;  1UHI A;  1TWO A;  4TNC A;  2H8V A;  4GBA A;  3SG6 A;  1EL4 A;  3D78 A;  3FWC A;  3DVM A;  3I5F B;  2QEH A;  3L4L A;  1KK8 C;  3DY9 A;  1J7Q A;  1OZS A;  3BYA A;  1TCO B;  2P6B B;  4PE0 A;  1QTX A;  4CPV A;  1Y6W A;  1TUZ A;  2LVV A;  4GFT A;  1DJG A;  2MJW B;  2Y1M A;  1JSA A;  4PHJ A;  2G2B A;  5PAL A;  1DJI A;  3GK2 A;  2BL0 C;  3CZ0 A;  2P71 A;  2K2A A;  1QX7 A;  3CDN A;  1AJ4 A;  1OW4 A;  1SCM C;  2KYC A;  2Q91 A;  1F4O A;  1PUL A;  1XFX O;  3PFV A;  3GOF A;  1VRK A;  2KBI A;  1SL7 A;  2LUX A;  2ZND A;  4DRW A;  1ZAC A;  1W7J B;  1K93 D;  2FOT A;  4WQ3 A;  4INW A;  2KGB C;  1Y1A A;  2L5X B;  2PAS A;  1B7T Y;  3DVJ A;  1QAS A;  3TUY C;  2L4H A;  2NXQ A;  4I5N B;  4DUQ A;  3B86 A;  2GGZ A;  1IG5 A;  3D75 A;  1K90 D;  2KI6 C;  1UP5 A;  1KQM C;  2KPH A;  1QWV A;  4R1E A;  1FW4 A;  1BJF A;  1DJH A;  1K2H A;  2BCX A;  5FYX A;  2L51 A;  1SL8 A;  1KK8 B;  3ICB A;  2WCM A;  5D7F A;  1N2D A;  1P28 A;  1SR6 C;  1WRK A;  1K9U A;  1MF8 B;  3EG5 B;  1IKU A;  1J7O A;  2M97 A;  1SL9 A;  2L2E A;  3EK7 A;  1ZUZ A;  3PN7 B;  1PVA A;  5HL1 A;  5AFP A;  2ERB A;  1NX1 A;  1M39 A;  4GGF A;  1REC A;  1QX2 A;  1GM0 A;  3DXL A;  2JRF A;  4XJK B;  5AEQ A;  4MRX A;  1QIV A;  3EVU A;  1S3P A;  1C3Z A;  1AUI B;  1XFY O;  3CZ1 A;  3KF9 A;  3TS5 C;  3QME A;  2NLN A;  1A29 A;  2LP2 A;  1F8H A;  2ZNE A;  3OP0 A;  2LLU A;  4HSZ A;  1EH2 A;  3R1O A;  4WRI A;  1M31 A;  4MVF A;  3CS1 A;  3LK1 A;  5JJG A;  2ISD A;  3TUY B;  1NUB A;  3S0A A;  1RK9 A;  4PHN A;  1U5I B;  2LE9 B;  4MN0 A;  2OS8 C;  1DMO A;  2JXC A;  1B7T Z;  4NDB A;  2JT3 A;  1BMO A;  2K8M B;  1JBA A;  4ZCU A;  1EXR A;  5FI7 A;  1MR8 A;  2ZN9 A;  2KQY A;  3BOW B;  2MAZ A;  4I5J A;  3KHE A;  2MHH A;  5DKQ A;  5ER5 A;  3EVV A;  1QS7 A;  2LUC A;  4F0Z B;  1CMF A;  2BE6 A;  2PSR A;  1DJZ A;  1OOI X;  1DGV A;  4A4C A;  2L2C A;  3R1V A;  3OHM B;  1PAL A;  3RZS A;  1KQV A;  2WCJ A;  3OGN A;  4KYN A;  3EK4 A;  1YUT A;  5J3X A;  1SBJ A;  2JT8 A;  3WHT B;  4GNK B;  2KAV A;  3I5F C;  1DEL A;  1G4Y R;  3UO9 A;  1N65 A;  1ALW A;  2I18 A;  4OR9 B;  1KSM A;  1M63 B;  2PMY A;  4HRG A;  5EL2 A;  2AMI A;  1K9K A;  3DYE A;  1B8C A;  2Y1N A;  2PVB A;  1J55 A;  2M7L A;  2BCB A;  2CBL A;  4JKT A;  1J1D A;  1MXE A;  3S0D A;  1F70 A;  3PLF B; 
#chains in the Genus database with same CATH homology
 2WC8 A;  5HKZ A;  1CNP A;  2IS9 A;  1SK6 D;  3CTN A;  2FCD A;  2L0P A;  2QAC A;  5DKR A;  3MSE B;  3VGO A;  5I8N A;  1TTX A;  3CLN A;  3NSO A;  3OB1 B;  3PAL A;  1CM1 A;  2EHB A;  1F55 A;  1CLB A;  3HX4 A;  3IQQ A;  1B8R A;  4ORC B;  2BKI B;  1QV1 A;  2KFH A;  2ZRS A;  1EG4 A;  2KFF A;  2WOS A;  2BKH B;  1S6C A;  4MBE A;  1CFF A;  4NQG A;  1H4B A;  2FJU B;  3TDU A;  5AER A;  4FTG A;  4C0J A;  2LNK A;  3SJS A;  4WQ2 A;  2KFG A;  5JOL A;  1G33 A;  3TDZ A;  3CWG A;  1XFV O;  1Y1U A;  1K9P A;  1SRA A;  2EC6 B;  3C1V A;  3LK0 A;  2K61 A;  3KPX A;  4OV2 A;  1QVI Y;  2PAL A;  3RLZ A;  1A03 A;  1YTZ C;  3KEV A;  2MBX A;  1BLQ A;  2WCB A;  1KK7 Y;  1PK0 D;  1KWO B;  1JWD A;  1MXL C;  1J1E A;  1C07 A;  2BBN A;  1DGU A;  3PN7 C;  2KGR A;  2K2F A;  1NYA A;  2M1U A;  1DTL A;  3IF7 A;  3OX6 A;  3GK1 A;  4OCI A;  1HT9 A;  4ORB B;  2E30 A;  3HCM A;  1QLK A;  1Y0V H;  1SYM A;  1C7W A;  2LMT A;  1TNQ A;  4ORA B;  2KAY A;  4QJ5 B;  1CDP A;  5G08 A;  2KQ6 A;  2KI6 D;  1YVH A;  2I7A A;  4M2P A;  1R2U A;  1OMD A;  1LIN A;  1OOJ A;  2COL B;  3CGA A;  3K21 A;  3BOW A;  1KFX L;  3NXA A;  4PCW A;  1F4Q A;  3FIA A;  1ZMZ A;  2FCE A;  3H4S E;  1GGZ A;  3NSI A;  1CKK A;  3BQ3 A;  3BUX B;  1QV0 A;  2E6W A;  3I5G B;  3WXA A;  1FBV A;  2O60 A;  4BY4 A;  1B1G A;  4DCK A;  1SW8 A;  2MLE C;  1KSO A;  1TRF A;  1W7I B;  1L2O B;  3NSL A;  2M1K B;  1IJ5 A;  1S5G Y;  2F3Y A;  1DF0 B;  3D0Y B;  1YRU B;  1C7V A;  1QVI Z;  2BEC A;  3F45 A;  3LCP C;  2A4J A;  3LLE A;  2BE4 A;  1KK7 Z;  2KBM A;  1PVB A;  1YX7 A;  1GQM A;  4YRU A;  1RRO A;  1EG3 A;  2HF5 A;  5CSN A;  4AQJ A;  1SCV A;  1FI6 A;  1ZFS A;  2F2P A;  1Y1X A;  2M49 B;  2LP3 A;  1CDM A;  2OTG B;  1DT7 B;  1RWY A;  5CPV A;  4GUK A;  3ZNI A;  1DJW A;  1SKT A;  2K0J A;  5HKW A;  1CLM A;  3A8R A;  1RJV A;  1TNP A;  2CT9 A;  3PM8 A;  1BF5 A;  1N0Y A;  2B1U A;  1RFJ A;  3VRP A;  1YUR A;  3CZT X;  1CMG A;  2CNP A;  4YGE B;  1S36 A;  1V1G A;  2G9B A;  5KSZ A;  1FF1 A;  1A4P A;  1AP4 A;  1CLL A;  1NWD A;  4M2O A;  4GPL B;  3GK4 X;  1QJT A;  4NDC A;  1M45 A;  1KFU L;  1CDL A;  2KOT A;  4P2Y B;  1H8B A;  1SY9 A;  5BPJ A;  5IBW A;  2NCO A;  1X02 A;  1YUU A;  1BU3 A;  2LV7 A;  2EGD A;  1NCY A;  2LMV A;  4ZCV A;  2MLF C;  1UWO A;  4YGC B;  2JWW A;  1XYD A;  4PDZ A;  2ZFD A;  2WCE A;  3EKJ A;  3NSK A;  1MUX A;  3CR5 X;  2EC6 C;  1JF2 A;  1AK8 A;  1S5G Z;  3A4U B;  5CSI A;  1CB1 A;  3JVT B;  3JTD B;  1LA0 A;  5CSF A;  3AAK A;  1KWO C;  1JF0 A;  2DOQ A;  1XK4 C;  4A4B A;  1TN4 A;  2JU0 A;  2Y5I A;  1L7Z A;  1OQP A;  2LVI A;  1XO5 A;  1IQ5 A;  4I5L B;  3FWB A;  4AQI A;  1B8L A;  2KI4 B;  4YI9 A;  3TDI A;  1SMG A;  2OPO A;  2CCM A;  5F6T A;  3OB2 B;  2KYF A;  2TN4 A;  5K89 A;  2MA2 A;  1B4C A;  2H2K A;  3DVK A;  1LXF C;  4CFR A;  1M46 A;  3I5H B;  2Q4U A;  1G8I A;  4XYN A;  2LHL A;  2LLS A;  4JPZ B;  4QJ4 B;  2ZKM X;  4E68 A;  4N1F A;  2K7D A;  1CM4 A;  1LA3 A;  5CSJ A;  4CFQ A;  1FI5 A;  2AUC A;  4BY5 A;  2HPS A;  3VRQ A;  3OX5 A;  1MWN A;  3I5G C;  1YRT B;  1ZOT B;  3WNX B;  2D8N A;  2BCA A;  3KO0 A;  4P5O E;  4AOM A;  1A75 B;  1B9A A;  1DF0 A;  3D0Y A;  1BOC A;  1IJ6 A;  1E8A A;  4YGA A;  2M29 A;  4C0K A;  2BBM A;  1OZO A;  2LC5 A;  3O2P A;  1NCX A;  2JXL A;  1TOP A;  3EKH A;  1L2O C;  4GGN A;  4XJK A;  1K96 A;  4CID A;  1K8U A;  1BOD A;  1JC2 A;  2JC2 A;  3E3R A;  2M3W A;  4ICB A;  2CTN A;  4YBH B;  3AKA A;  2LAP A;  4D1E A;  3DVE A;  3M0W A;  3O78 A;  1QAT A;  3SG4 A;  1QIW A;  1KFX S;  3DF0 B;  1S26 D;  2KSP A;  2OTG C;  4MEW A;  3RM1 A;  3VRO A;  1B47 A;  4I5K A;  1CFP A;  2LHI A;  2WND A;  1PSB A;  1U5I A;  2JTT A;  1WDC B;  4YI8 A;  1XA5 A;  2R2I A;  1QLS A;  1UHN A;  5I2L A;  5ER4 X;  3SG5 A;  1IWQ A;  2KAX A;  5I2Q A;  1V1F A;  2K7O A;  3CR2 A;  5B8I B;  1OMR A;  1UUS A;  2HET A;  2ZRT A;  1LVC D;  5HKY A;  1EJ3 A;  3O6B A;  4PHM A;  1BR1 B;  4JWQ A;  2K7C A;  2LMU A;  4C0L A;  4L9M A;  4DS7 A;  3I5I B;  2NCP A;  3LL8 B;  1S6I A;  1A2X A;  1IGV A;  5HYD A;  5I2O A;  2F8P A;  4HRE E;  2JNX A;  1CFD A;  1NIW A;  2F2O A;  3AAJ A;  5D69 A;  5KU1 A;  1F71 A;  4OKH A;  4MSP A;  1WRZ A;  2M7N A;  3PAT A;  1OMV A;  1BT6 A;  1DJY A;  1UHJ A;  3JVT C;  1WLM A;  5AAN A;  3JTD C;  1IH0 A;  3DD4 A;  2PRU A;  3SIA A;  1UHK A;  1RTP 1;  2RGI A;  3BUN B;  2L98 A;  1BR4 B;  1LKJ A;  2GGM A;  1MQ1 A;  1D1O A;  2QPT A;  3BUO B;  3EK8 A;  1XFU O;  2JQ6 A;  2MRD A;  5AXI A;  3VRR A;  1J7R A;  1XFZ O;  1NX2 A;  1NX0 A;  3BUM B;  1WLZ A;  1KFU S;  2KI4 C;  1R6P A;  1JUO A;  2F3Z A;  1TCF A;  4USL A;  3WHU B;  2SCP A;  1TIZ A;  1CDN A;  4GAO A;  2K7B A;  1S6J A;  4JQ0 D;  3ZWH A;  2BL0 B;  2KDH A;  1QX5 B;  5KTY A;  2LAN A;  3I5H C;  2JT0 A;  3AKB A;  3SIB A;  3D10 A;  1UUR A;  3EVR A;  1SCM B;  4PE4 A;  4MLW A;  3O4Y A;  1NSH A;  1A75 A;  5DKN A;  3TZ1 A;  4DIR A;  1UHH A;  1NPQ A;  5TNC A;  4GGF C;  4M2Q A;  4ETO A;  1BG1 A;  2LCP A;  4YGD B;  1YR5 A;  4CLN A;  1J7P A;  2LVK A;  2WOR A;  3QRX A;  1AHR A;  4NDD A;  4MZK A;  1MHO A;  1S1E A;  1CTR A;  1HQV A;  1PSR A;  3BUW B;  4U8D A;  2O5G A;  1JFJ A;  4HRH A;  1XK4 A;  1YVL A;  1YUS A;  3FS7 A;  1SPY A;  2Y4Q A;  1K94 A;  2H61 A;  4PHK A;  5HLO A;  4PE7 A;  4OVN F;  1F54 A;  2AAO A;  2WCF A;  1Q80 A;  1KQM B;  2ZN8 A;  2HQ8 A;  2SAS A;  1ODB A;  1PRW A;  1OSA A;  2F33 A;  3DF0 A;  2JUL A;  1WRL A;  2H61 C;  2KNE A;  2M9G A;  1OE9 B;  2LVJ A;  5HLV A;  2GV5 A;  2M8U A;  1SR6 B;  4MZL A;  3SG2 A;  1JFK A;  4MRY A;  3SG7 A;  1GJY A;  1NCZ A;  1IRJ A;  2L4I A;  2CXJ A;  1WDC C;  2JNF A;  1YX8 A;  2NZ0 A;  2JZI A;  3SG3 A;  2HQW A;  4QJ3 B;  1ALV A;  1DVI A;  4MZJ A;  3BXK A;  1XVJ A;  2JTZ A;  3TS5 B;  1XFW O;  1NX3 A;  1KCY A;  1TNX A;  3PSR A;  1AVS A;  4Q04 A;  1AJ5 A;  2L50 A;  2I94 A;  3VRN A;  2I2R E;  2JOJ A;  1TNW A;  2V53 A;  4UPG A;  4N5X A;  4PAL A;  1WY9 A;  4YGB B;  3IQO A;  3I5I C;  1QXP A;  2JPT A;  2OS8 B;  1DJX A;  2VRG A;  4PE1 A;  5GQQ C;  1K95 A;  4N1G A;  1IQ3 A;  4FQO A;  2LM5 A;  1GGW A;  1SNL A;  1CFC A;  2M0R A;  3CR4 X;  4IL1 A;  2KHN A;  1NP8 A;  2LLT A;  1UHI A;  4TNC A;  4GBA A;  3SG6 A;  1EL4 A;  3FWC A;  3DVM A;  3I5F B;  1KK8 C;  1J7Q A;  1OZS A;  3BYA A;  1TCO B;  2P6B B;  4PE0 A;  1QTX A;  4CPV A;  1Y6W A;  2LVV A;  4GFT A;  1DJG A;  2MJW B;  2Y1M A;  1JSA A;  4PHJ A;  2G2B A;  5PAL A;  1DJI A;  3GK2 A;  2BL0 C;  2K2A A;  1QX7 A;  1AJ4 A;  1SCM C;  2KYC A;  2Q91 A;  1FPW A;  1F4O A;  1PUL A;  1XFX O;  3PFV A;  3GOF A;  1VRK A;  2KBI A;  1SL7 A;  2LUX A;  2ZND A;  4DRW A;  1ZAC A;  1W7J B;  1K93 D;  2FOT A;  4WQ3 A;  2KGB C;  1Y1A A;  2L5X B;  2PAS A;  1B7T Y;  3DVJ A;  1QAS A;  3TUY C;  2L4H A;  2NXQ A;  4I5N B;  4DUQ A;  2GGZ A;  1IG5 A;  1K90 D;  2KI6 C;  1UP5 A;  1KQM C;  4R1E A;  1K2H A;  1FW4 A;  1BJF A;  1DJH A;  2BCX A;  5FYX A;  2L51 A;  1SL8 A;  1KK8 B;  3ICB A;  5D7F A;  1N2D A;  1SR6 C;  1WRK A;  1K9U A;  1MF8 B;  1J7O A;  1IKU A;  2M97 A;  1SL9 A;  2L2E A;  3EK7 A;  1ZUZ A;  3PN7 B;  1PVA A;  5AFP A;  1NX1 A;  1M39 A;  4GGF A;  1REC A;  1QX2 A;  2JRF A;  4XJK B;  5AEQ A;  4MRX A;  1QIV A;  3EVU A;  1S3P A;  1AUI B;  1XFY O;  3KF9 A;  3TS5 C;  2NLN A;  1A29 A;  2LP2 A;  1F8H A;  2ZNE A;  3OP0 A;  2LLU A;  4HSZ A;  1EH2 A;  4WRI A;  1M31 A;  4MVF A;  3CS1 A;  3LK1 A;  2ISD A;  3TUY B;  1NUB A;  1RK9 A;  4PHN A;  1U5I B;  2LE9 B;  4MN0 A;  2OS8 C;  1DMO A;  2JXC A;  1B7T Z;  4NDB A;  2JT3 A;  1BMO A;  2K8M B;  1JBA A;  4ZCU A;  1EXR A;  1MR8 A;  2ZN9 A;  2KQY A;  3BOW B;  2MAZ A;  4I5J A;  3KHE A;  2MHH A;  5DKQ A;  5ER5 A;  3EVV A;  1QS7 A;  2LUC A;  4F0Z B;  1CMF A;  2BE6 A;  2PSR A;  1DJZ A;  1DGV A;  4A4C A;  3OHM B;  1PAL A;  1KQV A;  3EK4 A;  1YUT A;  5J3X A;  1SBJ A;  2JT8 A;  3WHT B;  4GNK B;  2KAV A;  3I5F C;  1G4Y R;  1N65 A;  1ALW A;  2I18 A;  4OR9 B;  1KSM A;  1M63 B;  2PMY A;  4HRG A;  2AMI A;  1K9K A;  1B8C A;  2Y1N A;  2PVB A;  1J55 A;  2M7L A;  2BCB A;  2CBL A;  1J1D A;  1MXE A;  5JJG A;  1F70 A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...