3D0YB

Crystal structure of s100b in the calcium and zinc loaded state at ph 6.5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d0yB00
1KCYA 2KAVA 2L2EA 3MSEB 2KI4B 1RROA 1DF0B 2M97A 2LMUA 1KK8B 1ZACA 2ISDA 2OS8B 4PE4A 2H2KA 4D1EA 1KSOA 2EC6C 4I5NB 2JC2A 1K96A 1NIWA 1UHIA 3I5HB 4MVFA 2WORA 3H4SE 1J1EA 3PALA 1MXLC 1QASA 2BBMA 2JXCA 1SL7A 1F54A 1BJFA 3LL8B 4ZCVA 5KTYA 4PCWA 2B1UA 2JTTA 2JT8A 4YBHB 5FYXA 2HQ8A 3GOFA 1UHJA 4P2YB 1QIVA 3BUNB 2LMVA 3OB1B 1FBVA 2JQ6A 2WNDA 1WRZA 1X02A 3CZTX 4JWQA 1KQMB 5JOLA 2JXLA 3OP0A 2I7AA 1B9AA 2HQWA 3JTDC 1NYAA 1RJVA 1WDCB 4ORAB 1AUIB 2MRDA 3WHTB 5J3XA 1DJZA 2M0RA 4OV2A 2L98A 1QX5B 2COLB 2BKHB 2KGBC 3DVEA 1OE9B 1BR1B 2LMTA 1M31A 1A03A 3BUMB 1YURA 2BKIB 2Q4UA 2PASA 1TCFA 4PDZA 5F6TA 2LLSA 1CDLA 1LVCD 1SR6C 1ZFSA 2M3WA 1N0YA 2LHIA 4MZKA 1NX2A 2Y1NA 2NCPA 4R1EA 1C7WA 3LK1A 4DS7A 1QATA 1MF8B 2JOJA 3JVTB 1NX0A 4A4CA 1K94A 3TUYB 2KI4C 2EGDA 4GFTA 4CFRA 3KF9A 1TCOB 1K95A 3D10A 1KK8C 1IQ3A 1MWNA 4C0JA 2LCPA 1BMOA 1MXEA 4GGFA 4NDBA 1YR5A 1VRKA 3TS5B 2OTGB 1SMGA 3RLZA 1JBAA 1CFCA 2GGMA 5D7FA 4PE1A 2D8NA 1UHKA 3I5FB 3O2PA 1LA3A 2NLNA 4YGDB 2MBXA 2M7NA 1QXPA 4NDCA 4PHKA 1SY9A 1AP4A 1K8UA 5D69A 3VROA 4I5KA 4DRWA 1AK8A 1SRAA 4U8DA 1QV1A 4OCIA 2CTNA 3QRXA 4OR9B 4C0KA 1BG1A 1XK4C 2ZRTA 3VRNA 1H8BA 4IL1A 1SNLA 4MRXA 3DF0A 1ODBA 1BT6A 3CWGA 1KQMC 4WQ3A 1AJ4A 2K61A 1S6JA 3OHMB 1IJ5A 1J7OA 3SIAA 1WDCC 3IF7A 1XFYO 5BPJA 2ZN9A 3PN7C 4PHJA 1K9KA 1A29A 2JT0A 1KK7Z 2K7BA 4GUKA 4NQGA 3F45A 4GBAA 2KDHA 2L4IA 1HT9A 3PM8A 1XFXO 3FWCA 1B8RA 1EH2A 2HPSA 1PRWA 1S36A 4QJ5B 2JNFA 2A4JA 1EL4A 1C7VA 1B7TZ 1IKUA 2PMYA 3EK8A 2JTZA 1LKJA 2JU0A 4L9MA 3WXAA 1QX2A 1ALVA 1K9UA 4MRYA 3JVTC 3TUYC 1BOCA 3O4YA 3OX5A 3VRPA 1DGVA 4JPZB 1NP8A 2FOTA 5CSNA 1JF2A 3NSKA 1TNPA 2KYFA 2QACA 2JPTA 3C1VA 1HQVA 1Y1UA 2CT9A 3PSRA 2F3YA 1JF0A 3GK4X 4PHMA 1OMRA 1QTXA 3GK2A 3I5FC 1JSAA 1AJ5A 1PALA 3TDZA 1EJ3A 3NSOA 3EVUA 3BQ3A 2K7CA 1K2HA 4ICBA 2CNPA 1KQVA 2L51A 1S6IA 3DVJA 4OVNF 5KSZA 5DKRA 1G4YR 1NCYA 1RWYA 3AKAA 3WHUB 3I5IB 1QS7A 1SCMB 1RECA 1PULA 1KWOB 2I94A 2K7DA 2PSRA 2ZNDA 1B1GA 3A4UB 2JWWA 2KOTA 4GAOA 4A4BA 1YX8A 4UPGA 2M9GA 5I2QA 1N65A 1NX1A 4P5OE 2MHHA 3DF0B 1Y0VH 4HSZA 4M2QA 4E68A 1JFJA 1KK7Y 4DIRA 1YTZC 2ZRSA 3KPXA 4CLNA 1F70A 3DVKA 1PVAA 1IGVA 1BR4B 1CDNA 1FI5A 2I18A 3WNXB 1F4OA 3CS1A 2NCOA 3TZ1A 1M45A 1B7TY 1K90D 2K8MB 1UHHA 1WLMA 4MZLA 3ZWHA 1UWOA 1A75A 3LK0A 4JQ0D 4XJKB 5DKQA 1IQ5A 1K9PA 1SW8A 3FS7A 3EKJA 3CR4X 1NCXA 5TNCA 1KSMA 1LA0A 3IQOA 1S1EA 1GGWA 2K0JA 3EK4A 1XFZO 2F33A 2KI6C 1SCVA 1QV0A 2WOSA 2K2AA 2KGRA 4M2PA 1QVIZ 2LLTA 1G8IA 3EKHA 2LUCA 4HRHA 1XYDA 4GGFC 4HREE 2I2RE 1J55A 3O6BA 1YRUB 2OS8C 2NZ0A 5AEQA 3SG7A 3TDUA 3BYAA 3ICBA 1BU3A 2IS9A 2H61A 1CFPA 1U5IA 2LHLA 3KEVA 1G33A 1TRFA 3ZNIA 3I5IC 1DJHA 3I5HC 4AQJA 3I5GB 1Y1XA 2Y1MA 1A2XA 1XFVO 1KWOC 5G08A 4AOMA 3FIAA 1JUOA 4PE0A 5AERA 1NPQA 5CSJA 2AMIA 4MSPA 2KNEA 2BBNA 4ETOA 1DVIA 5IBWA 1B4CA 2K2FA 2QPTA 5CSFA 5I2LA 3SG3A 2KBMA 3DVMA 1SBJA 2KQ6A 2KAYA 1GQMA 2TN4A 4I5JA 3NXAA 4FQOA 5PALA 5K89A 1V1FA 3GK1A 4QJ3B 2PRUA 1S3PA 2ZNEA 1UP5A 2NXQA 2FJUB 2BCXA 1E8AA 1CMGA 2JT3A 1OMDA 2LVJA 5ER5A 3AAKA 4MEWA 1K93D 4XJKA 1TTXA 1UURA 3KHEA 1CM1A 2OPOA 4DUQA 1A75B 2WCBA 4GPLB 1OQPA 2ZN8A 4MBEA 4GGNA 2AAOA 1QLKA 1UHNA 2KQYA 2BE4A 1M39A 1TNQA 1MR8A 4CIDA 1TNXA 4YI9A 1QVIY 1OSAA 1KFXL 1SL9A 1S5GZ 4MZJA 4ORBB 3HX4A 2GV5A 1ALWA 3TS5C 2OTGC 2V53A 5I8NA 1CM4A 1DJWA 1EG4A 4MN0A 4YRUA 2BE6A 2F2PA 1Y1AA 2KYCA 1PVBA 2LAPA 3NSIA 1IJ6A 2BCAA 1U5IB 2LE9B 2LV7A 3PATA 3BUOB 2KFFA 3EVRA 2E6WA 3D0YA 1MHOA 4YI8A 1ZOTB 1XFUO 4TNCA 1NUBA 4CFQA 2BL0B 5HLVA 1J7PA 1ZUZA 3O78A 4N1GA 1NSHA 2WCEA 4MLWA 3CR2A 1B8CA 1BODA 1IWQA 1CKKA 2HETA 5CPVA 1IRJA 1EXRA 1WLZA 3HCMA 2E30A 3SG6A 1SYMA 3K21A 4F0ZB 3M0WA 1OMVA 1IG5A 3VGOA 2PVBA 1NX3A 1SK6D 5HLOA 2FCDA 1L2OB 2LNKA 5CSIA 1AHRA 1SKTA 2O60A 2G9BA 2CBLA 2Y4QA 1IH0A 2WC8A 3IQQA 2KBIA 1XFWO 1YVLA 2JZIA 1EG3A 2CCMA 4N1FA 1B47A 1KFUL 5KU1A 1TIZA 3AAJA 2JULA 1V1GA 1RFJA 1MUXA 1YUSA 2ZFDA 1FPWA 3SIBA 1J1DA 1LINA 1F4QA 2LP2A 1CTRA 1OZOA 2Q91A 4BY4A 4CPVA 1JWDA 5HKYA 1XO5A 1DJGA 1WY9A 3A8RA 1DJXA 1N2DA 1DGUA 1TOPA 2LVIA 5AANA 3DD4A 3BOWA 2WCFA 4YGCB 1FI6A 2P6BB 1L7ZA 1S26D 1DT7B 2AUCA 1QJTA 1BLQA 2LUXA 1S5GY 1DMOA 3PFVA 4OKHA 3SG5A 2M1KB 1SPYA 2HF5A 1CFFA 5ER4X 3FWBA 5HYDA 2KAXA 3BUWB 4I5LB 2PALA 1CMFA 2H61C 3VRRA 4M2OA 2LM5A 1GGZA 1CNPA 1DJIA 3PN7B 4WRIA 1OZSA 2LANA 1J7QA 4BY5A 1A4PA 4QJ4B 1RK9A 1JC2A 2BL0C 2MLEC 1PSRA 5B8IB 3SG4A 1Y6WA 1KFXS 1CLBA 1PK0D 4PE7A 1SCMC 2BECA 2G2BA 2LC5A 1B8LA 1CDPA 2M1UA 3D0YB 1DTLA 3CGAA 1GJYA 3CTNA 1H4BA 1L2OC 1CLMA 1QX7A 2FCEA 3PLFB 2LVKA 4NDDA 4DCKA 2L4HA 3TDIA 2K7OA 4YGAA 3BXKA 2KFHA 1YUTA 2DOQA 2SASA 4ZCUA 1YRTB 3E3RA 1DF0A 2KFGA 2BCBA 2F2OA 2MLFC 3RM1A 2M49B 4YGBB 2ZKMX 1CFDA 1W7JB 2JRFA 1YVHA 2SCPA 2LLUA 1MQ1A 2CXJA 1Q80A 2LP3A 4FTGA 1TNWA 1F8HA 1F71A 1UUSA 2GGZA 1YUUA 1R6PA 3CR5X 1W7IB 2MJWB 2EC6B 2R2IA 1QIWA 5HKWA 1NCZA 1J7RA 2O5GA 1F55A 2F8PA 1M46A 5GQQC 4PALA 1KFUS 1R2UA 1JFKA 1CB1A 1XK4A 3BOWB 1WRLA 3EVVA 1WRKA 1BF5A 1CLLA 1NWDA 3LLEA 2JNXA 2F3ZA 2MA2A 5HKZA 1XA5A 4GNKB 4USLA 5DKNA 1DJYA 2M29A 1M63B 2L5XB 1YX7A 3I5GC 1FF1A 3OB2B 4C0LA 3LCPC 1QLSA 5I2OA 3VRQA 3SG2A 1AVSA 3CLNA 1RTP1 4WQ2A 4ORCB 5JJGA 1OOJA 3SJSA 1FW4A 4Q04A 3JTDB 2KI6D 1SL8A 3OX6A 1TN4A 4AQIA 2VRGA 2M8UA 1XVJA 1D1OA 3BUXB 2MAZA 4XYNA 1PSBA 2KHNA 2Y5IA 1C07A 3EK7A 4N5XA 5AXIA 3AKBA 3KO0A 2KSPA 2L50A 4PHNA 1LXFC 2M7LA 4YGEB 1CDMA 2L0PA 2EHBA 1SR6B 5AFPA 3NSLA 1S6CA 2RGIA 4HRGA 1ZMZA 2LVVA
chains in the Genus database with same CATH superfamily
1KCYA 2KAVA 2L2EA 3MSEB 2KI4B 1RROA 1DF0B 2M97A 2LMUA 1KK8B 1ZACA 2ISDA 2OS8B 4PE4A 2H2KA 4D1EA 1KSOA 2EC6C 4I5NB 2JC2A 1K96A 1NIWA 1UHIA 3I5HB 4MVFA 2WORA 3H4SE 1J1EA 3CDNA 3PALA 1MXLC 1QASA 2BBMA 2JXCA 1SL7A 2WCJA 3UNWA 1F54A 1BJFA 3LL8B 4ZCVA 5KTYA 4PCWA 2B1UA 2JTTA 2JT8A 4YBHB 5FYXA 3V2LA 2HQ8A 3GOFA 1UHJA 4P2YB 1QIVA 3BUNB 2LMVA 3OB1B 1FBVA 2JQ6A 2WNDA 1WRZA 1X02A 3CZTX 4JWQA 1KQMB 5JOLA 2JXLA 3OP0A 2I7AA 1B9AA 2HQWA 3JTDC 1NYAA 1RJVA 1WDCB 2KLDA 1LS8A 4ORAB 1AUIB 2MRDA 3WHTB 5J3XA 1DJZA 2M0RA 4OV2A 2L98A 1QX5B 2COLB 2BKHB 2KGBC 3DVEA 1OE9B 4OZDA 1BR1B 2LMTA 1M31A 1A03A 3BUMB 1YURA 2BKIB 2Q4UA 2PASA 1TCFA 4PDZA 5F6TA 2LLSA 1CDLA 1LVCD 1SR6C 1ZFSA 2M3WA 1N0YA 2LHIA 2P71A 4MZKA 1NX2A 2Y1NA 2NCPA 3FE9A 4R1EA 1C7WA 3LK1A 4DS7A 1QATA 1MF8B 2JOJA 1T14A 3BFAA 3JVTB 1NX0A 4A4CA 1K94A 3TUYB 3SS5A 2KI4C 2EGDA 2K60A 4GFTA 4CFRA 3KF9A 1TCOB 1K95A 3D10A 1KK8C 1IQ3A 2KPHA 1MWNA 3Q8IA 4C0JA 2LCPA 2JPOA 3CABA 1C3YA 3S0EA 1BMOA 1MXEA 4GGFA 4NDBA 1YR5A 1VRKA 3TS5B 2OTGB 1SMGA 3RLZA 1JBAA 3B88A 1CFCA 2GGMA 5D7FA 4PE1A 2D8NA 1UHKA 3DXLA 3I5FB 3O2PA 1LA3A 2NLNA 4YGDB 2MBXA 2M7NA 1QXPA 4NDCA 4PHKA 1SY9A 1AP4A 1K8UA 3OGNA 2PYQA 5D69A 3VROA 4I5KA 3FE8A 4DRWA 1SRAA 4U8DA 1AK8A 1QV1A 4OCIA 2CTNA 3QRXA 4OR9B 4C0KA 1BG1A 1XK4C 2ZRTA 3VRNA 1IIOA 1H8BA 4IL1A 1SNLA 2YGUA 4MRXA 3DF0A 1ODBA 1BT6A 3NHTA 3CWGA 1KQMC 4WQ3A 1AJ4A 2K61A 1S6JA 3OHMB 1IJ5A 1DC1A 1J7OA 3SIAA 1WDCC 3IF7A 1XFYO 5BPJA 2ZN9A 3PN7C 4PHJA 1K9KA 1A29A 2JT0A 1KK7Z 3S0AA 2K7BA 4GUKA 3BFBA 4NQGA 3F45A 4GBAA 2KDHA 2L4IA 1HT9A 3PM8A 1XFXO 2PQLA 1B8RA 3FWCA 1EH2A 2HPSA 1PRWA 1S36A 4QJ5B 1TWOA 2JNFA 2A4JA 1EL4A 1C7VA 1B7TZ 1IKUA 2PMYA 3EK8A 2JTZA 1LKJA 2JU0A 2P70A 4L9MA 1QX2A 3WXAA 1ALVA 1K9UA 4MRYA 3JVTC 3TUYC 1BOCA 3O4YA 3OX5A 3VRPA 1DGVA 1OOFA 1NP8A 2FOTA 4JPZB 5CSNA 1JF2A 3NSKA 1TNPA 2KYFA 2QACA 2JPTA 3C1VA 1HQVA 3DYEA 1Y1UA 2CT9A 3PSRA 2F3YA 1JF0A 3GK4X 4PHMA 1OMRA 1QTXA 3GK2A 3I5FC 1JSAA 1AJ5A 1PALA 3EG5B 1EJ3A 3TDZA 1QWVA 3NSOA 3EVUA 3BQ3A 2K7CA 5DICA 1K2HA 4ICBA 2CNPA 1KQVA 2L51A 1S6IA 3DVJA 4OVNF 5KSZA 5DKRA 1G4YR 1NCYA 1RWYA 1DEKA 3AKAA 3WHUB 3I5IB 1QS7A 3CYZA 1SCMB 1RECA 1C3ZA 1KWOB 1PULA 2I94A 2K7DA 2PSRA 2ZNDA 3A4UB 1B1GA 2JWWA 2KOTA 4GAOA 4A4BA 5I94A 1YX8A 4UPGA 2M9GA 5I2QA 1N65A 1NX1A 4P5OE 3OBVA 2MHHA 2WC5A 3D76A 3DF0B 1Y0VH 4HSZA 4M2QA 4E68A 1JFJA 1KK7Y 4DIRA 1YTZC 2ZRSA 3KPXA 4CLNA 3NGVA 1F70A 1OOHA 3DVKA 1PVAA 1IGVA 1BR4B 1CDNA 1FI5A 2I18A 3WNXB 1F4OA 3CS1A 2NCOA 3TZ1A 1M45A 1B7TY 1K90D 2K8MB 1UHHA 3L4AA 1WLMA 3PJIA 4MZLA 3ZWHA 1UWOA 1A75A 3LK0A 4JQ0D 4XJKB 5DKQA 1IQ5A 1K9PA 1SW8A 3FS7A 3EKJA 3B86A 1NCXA 2ERBA 3CR4X 5TNCA 1KSMA 1LA0A 3IQOA 1S1EA 1GGWA 2K0JA 3EK4A 1XFZO 2F33A 3S0BA 2KI6C 1SCVA 3O4XA 1QV0A 5FI7A 2WOSA 2K2AA 2KGRA 4M2PA 1QVIZ 2LLTA 1G8IA 3EKHA 2LUCA 4HRHA 1XYDA 2L5YA 4GGFC 4HREE 2I2RE 1J55A 2BAPA 3O6BA 1YRUB 2OS8C 2NZ0A 5AEQA 3SG7A 3TDUA 3BYAA 3ICBA 1BU3A 2IS9A 2H61A 1OW4A 1U5IA 1CFPA 2LHLA 2FJYA 3KEVA 1G33A 1TRFA 3ZNIA 3CZ2A 3I5IC 1DJHA 3I5HC 5EL2A 4AQJA 3I5GB 1Y1XA 2Y1MA 1A2XA 1XFVO 1KWOC 5G08A 4AOMA 3FIAA 1JUOA 4PE0A 5AERA 1NPQA 5CSJA 2AMIA 4MSPA 2KNEA 3D78A 2BBNA 4ETOA 1DVIA 5IBWA 3S0FA 1B4CA 2K2FA 2QPTA 5CSFA 5I2LA 3SG3A 2KBMA 1W9ZA 3DVMA 1SBJA 2KQ6A 3S0GA 2KAYA 1GQMA 2TN4A 4I5JA 3NXAA 4FQOA 5PALA 5K89A 1V1FA 3GK1A 4QJ3B 2PRUA 1S3PA 1GM0A 2ZNEA 1UP5A 2NXQA 3CZ0A 2FJUB 2BCXA 1E8AA 1CMGA 2JT3A 3UO9A 1OMDA 2LVJA 5ER5A 3AAKA 4MEWA 1K93D 4XJKA 1TTXA 1UURA 2QEOA 3KHEA 1CM1A 2OPOA 4DUQA 1A75B 1DQEA 2WCBA 5FI2A 4GPLB 1OQPA 2ZN8A 4INWA 4MBEA 4GGNA 2AAOA 2WCHA 1QLKA 1UHNA 3VB1A 2KQYA 2BE4A 3CZ1A 1M39A 1TNQA 1MR8A 2BNXA 4CIDA 1TNXA 4YI9A 1QVIY 1OSAA 1KFXL 3R1VA 2QDIA 1SL9A 1S5GZ 4JKTA 4MZJA 4ORBB 3HX4A 2GV5A 1ALWA 3TS5C 2OTGC 2V53A 5I8NA 1CM4A 1DJWA 1EG4A 4MN0A 4YRUA 2BE6A 2F2PA 1Y1AA 2KYCA 3D74A 1PVBA 2LAPA 3NSIA 1IJ6A 2BCAA 1U5IB 2LE9B 2LV7A 3PATA 3BUOB 2KFFA 3EVRA 2E6WA 3D0YA 1MHOA 4YI8A 5FI6A 1ZOTB 1XFUO 4TNCA 3FE6A 1NUBA 4CFQA 2BL0B 5HLVA 1J7PA 1ZUZA 3O78A 4N1GA 1NSHA 2WCEA 1TUJA 4INXA 4MLWA 3CR2A 1B8CA 1BODA 1IWQA 1CKKA 2HETA 5CPVA 1IRJA 1EXRA 1WLZA 3HCMA 2E30A 3SG6A 1SYMA 3K21A 4F0ZB 3M0WA 1OMVA 1IG5A 3VGOA 2PVBA 3SS3A 1NX3A 1SK6D 5HLOA 2FCDA 2WC6A 1L2OB 2LNKA 5CSIA 1AHRA 1SKTA 2O60A 2G9BA 2CBLA 2Y4QA 1IH0A 2WC8A 3IQQA 2KBIA 1XFWO 1YVLA 2JZIA 1EG3A 2CCMA 4N1FA 1B47A 1KFUL 3SS4A 1TIZA 5KU1A 3PM2A 3AAJA 2JULA 1V1GA 1Z4HA 1RFJA 1MUXA 1YUSA 2ZFDA 1FPWA 3SIBA 1J1DA 1LINA 1F4QA 2LP2A 1CTRA 1OZOA 2Q91A 3BFHA 4BY4A 2QEVA 4CPVA 1JWDA 5HKYA 1XO5A 1DJGA 1WY9A 3B7AA 3A8RA 1DJXA 1N2DA 1DGUA 1TOPA 1SSEB 2LVIA 3R1PA 3DD4A 3BOWA 5AANA 2KLEA 2WCFA 4YGCB 1FI6A 2P6BB 1L7ZA 1S26D 1DT7B 2AUCA 1QJTA 1BLQA 2LUXA 1S5GY 1DMOA 3PFVA 4OKHA 3SG5A 2M1KB 1SPYA 2HF5A 1CFFA 5ER4X 3DZTA 3FWBA 5HYDA 2KAXA 3BUWB 4I5LB 2PALA 1CMFA 2H61C 3VRRA 4M2OA 2LM5A 1GGZA 1CNPA 1DJIA 3PN7B 4WRIA 1OZSA 2LANA 1J7QA 1DELA 4BY5A 1A4PA 4QJ4B 1RK9A 4IJ7A 2BL0C 1JC2A 2MLEC 1PSRA 5B8IB 3SG4A 1Y6WA 1KFXS 1CLBA 1PK0D 4PE7A 1SCMC 2BECA 2G2BA 2LC5A 5HL1A 1B8LA 1CDPA 2M1UA 3D0YB 1DTLA 3CGAA 1OOGA 1GJYA 3BJHA 3NHIA 3CTNA 4FQTA 1H4BA 1L2OC 1CLMA 1QX7A 3RZSA 2FCEA 3PLFB 2LVKA 4NDDA 4DCKA 2L4HA 3TDIA 2K7OA 4YGAA 3L4LA 4KYNA 3BXKA 2KFHA 3S0DA 1YUTA 2DOQA 2SASA 4ZCUA 3DY9A 1YRTB 3E3RA 1DF0A 2KFGA 2BCBA 2F2OA 2MLFC 3D77A 2M49B 3RM1A 4YGBB 2ZKMX 1CFDA 1W7JB 2JRFA 1YVHA 2SCPA 3D73A 2LLUA 3N7HA 1MQ1A 2CXJA 1Q80A 2LP3A 4FTGA 1TNWA 1OOIX 1F8HA 1F71A 1UUSA 2WCLA 2GGZA 1YUUA 1R6PA 3CR5X 1W7IB 2MJWB 2EC6B 2R2IA 1QIWA 5HKWA 1NCZA 1J7RA 2QEHA 2O5GA 3B87A 1Z2CB 1F55A 2F8PA 1M46A 5GQQC 4PALA 1KFUS 1R2UA 1JFKA 1CB1A 1XK4A 3BOWB 3R1OA 1WRLA 3EVVA 1WRKA 3D75A 1ORGA 5D3OA 1BF5A 1CLLA 1NWDA 2WCKA 2JNXA 2F3ZA 2MA2A 2WCMA 3K1EA 3LLEA 5HKZA 1XA5A 3QMEA 4GNKB 2QEBA 4USLA 5DKNA 1DJYA 2M29A 1M63B 2L5XB 1YX7A 3I5GC 1FF1A 3OB2B 4C0LA 3LCPC 1QLSA 5I2OA 3VRQA 2H8VA 3R72A 3SG2A 1AVSA 3CLNA 1RTP1 4WQ2A 4ORCB 5JJGA 1OOJA 3SJSA 1FW4A 3IVTA 4Q04A 3JTDB 1XFRA 2KI6D 1SL8A 3OX6A 1TN4A 4AQIA 2VRGA 2M8UA 1XVJA 4PT1A 1D1OA 3L47A 2L2CA 1TUZA 2MAZA 1PSBA 2KHNA 3BUXB 4XYNA 2Y5IA 4F7FA 3EK7A 1C07A 4N5XA 5AXIA 3AKBA 4JD9A 3KO0A 2KSPA 2L50A 2GTEA 4PHNA 1LXFC 2M7LA 4YGEB 1CDMA 2L0PA 3B6XA 2EHBA 1SR6B 5AFPA 3NSLA 1S6CA 2RGIA 4HRGA 1ZMZA 1P28A 2LVVA
chains in the Genus database with same CATH topology
1KCYA 2KAVA 2L2EA 3MSEB 2KI4B 1RROA 1DF0B 2M97A 2LMUA 1KK8B 1ZACA 2ISDA 2OS8B 4PE4A 2H2KA 4D1EA 1KSOA 2EC6C 4I5NB 2JC2A 1K96A 1NIWA 1UHIA 3I5HB 4MVFA 2WORA 3H4SE 1J1EA 3PALA 1MXLC 1QASA 2BBMA 2JXCA 1SL7A 1F54A 1BJFA 3LL8B 4ZCVA 5KTYA 4PCWA 2B1UA 2JTTA 2JT8A 4YBHB 5FYXA 2HQ8A 3GOFA 1UHJA 4P2YB 1QIVA 3BUNB 2LMVA 3OB1B 1FBVA 2JQ6A 2WNDA 1WRZA 1X02A 3CZTX 4JWQA 1KQMB 5JOLA 2JXLA 3OP0A 2I7AA 1B9AA 2HQWA 3JTDC 1NYAA 1RJVA 1WDCB 4ORAB 1AUIB 2MRDA 3WHTB 5J3XA 1DJZA 2M0RA 4OV2A 2L98A 1QX5B 2COLB 2BKHB 2KGBC 3DVEA 1OE9B 1BR1B 2LMTA 1M31A 1A03A 3BUMB 1YURA 2BKIB 2Q4UA 2PASA 1TCFA 4PDZA 5F6TA 2LLSA 1CDLA 1LVCD 1SR6C 1ZFSA 2M3WA 1N0YA 2LHIA 4MZKA 1NX2A 2Y1NA 2NCPA 4R1EA 1C7WA 3LK1A 4DS7A 1QATA 1MF8B 2JOJA 3JVTB 1NX0A 4A4CA 1K94A 3TUYB 2KI4C 2EGDA 4GFTA 4CFRA 3KF9A 1TCOB 1K95A 3D10A 1KK8C 1IQ3A 1MWNA 4C0JA 2LCPA 1BMOA 1MXEA 4GGFA 4NDBA 1YR5A 1VRKA 3TS5B 2OTGB 1SMGA 3RLZA 1JBAA 1CFCA 2GGMA 5D7FA 4PE1A 2D8NA 1UHKA 3I5FB 3O2PA 1LA3A 2NLNA 4YGDB 2MBXA 2M7NA 1QXPA 4NDCA 4PHKA 1SY9A 1AP4A 1K8UA 5D69A 3VROA 4I5KA 4DRWA 1AK8A 1SRAA 4U8DA 1QV1A 4OCIA 2CTNA 3QRXA 4OR9B 4C0KA 1BG1A 1XK4C 2ZRTA 3VRNA 1H8BA 4IL1A 1SNLA 4MRXA 3DF0A 1ODBA 1BT6A 3CWGA 1KQMC 4WQ3A 1AJ4A 2K61A 1S6JA 3OHMB 1IJ5A 1J7OA 3SIAA 1WDCC 3IF7A 1XFYO 5BPJA 2ZN9A 3PN7C 4PHJA 1K9KA 1A29A 2JT0A 1KK7Z 2K7BA 4GUKA 4NQGA 3F45A 4GBAA 2KDHA 2L4IA 1HT9A 3PM8A 1XFXO 3FWCA 1B8RA 1EH2A 2HPSA 1PRWA 1S36A 4QJ5B 2JNFA 2A4JA 1EL4A 1C7VA 1B7TZ 1IKUA 2PMYA 3EK8A 2JTZA 1LKJA 2JU0A 4L9MA 3WXAA 1QX2A 1ALVA 1K9UA 4MRYA 3JVTC 3TUYC 1BOCA 3O4YA 3OX5A 3VRPA 1DGVA 4JPZB 1NP8A 2FOTA 5CSNA 1JF2A 3NSKA 1TNPA 2KYFA 2QACA 2JPTA 3C1VA 1HQVA 1Y1UA 2CT9A 3PSRA 2F3YA 1JF0A 3GK4X 4PHMA 1OMRA 1QTXA 3GK2A 3I5FC 1JSAA 1AJ5A 1PALA 3TDZA 1EJ3A 3NSOA 3EVUA 3BQ3A 2K7CA 1K2HA 4ICBA 2CNPA 1KQVA 2L51A 1S6IA 3DVJA 4OVNF 5KSZA 5DKRA 1G4YR 1NCYA 1RWYA 3AKAA 3WHUB 3I5IB 1QS7A 1SCMB 1RECA 1PULA 1KWOB 2I94A 2K7DA 2PSRA 2ZNDA 1B1GA 3A4UB 2JWWA 2KOTA 4GAOA 4A4BA 1YX8A 4UPGA 2M9GA 5I2QA 1N65A 1NX1A 4P5OE 2MHHA 3DF0B 1Y0VH 4HSZA 4M2QA 4E68A 1JFJA 1KK7Y 4DIRA 1YTZC 2ZRSA 3KPXA 4CLNA 1F70A 3DVKA 1PVAA 1IGVA 1BR4B 1CDNA 1FI5A 2I18A 3WNXB 1F4OA 3CS1A 2NCOA 3TZ1A 1M45A 1B7TY 1K90D 2K8MB 1UHHA 1WLMA 4MZLA 3ZWHA 1UWOA 1A75A 3LK0A 4JQ0D 4XJKB 5DKQA 1IQ5A 1K9PA 1SW8A 3FS7A 3EKJA 3CR4X 1NCXA 5TNCA 1KSMA 1LA0A 3IQOA 1S1EA 1GGWA 2K0JA 3EK4A 1XFZO 2F33A 2KI6C 1SCVA 1QV0A 2WOSA 2K2AA 2KGRA 4M2PA 1QVIZ 2LLTA 1G8IA 3EKHA 2LUCA 4HRHA 1XYDA 4GGFC 4HREE 2I2RE 1J55A 3O6BA 1YRUB 2OS8C 2NZ0A 5AEQA 3SG7A 3TDUA 3BYAA 3ICBA 1BU3A 2IS9A 2H61A 1CFPA 1U5IA 2LHLA 3KEVA 1G33A 1TRFA 3ZNIA 3I5IC 1DJHA 3I5HC 4AQJA 3I5GB 1Y1XA 2Y1MA 1A2XA 1XFVO 1KWOC 5G08A 4AOMA 3FIAA 1JUOA 4PE0A 5AERA 1NPQA 5CSJA 2AMIA 4MSPA 2KNEA 2BBNA 4ETOA 1DVIA 5IBWA 1B4CA 2K2FA 2QPTA 5CSFA 5I2LA 3SG3A 2KBMA 3DVMA 1SBJA 2KQ6A 2KAYA 1GQMA 2TN4A 4I5JA 3NXAA 4FQOA 5PALA 5K89A 1V1FA 3GK1A 4QJ3B 2PRUA 1S3PA 2ZNEA 1UP5A 2NXQA 2FJUB 2BCXA 1E8AA 1CMGA 2JT3A 1OMDA 2LVJA 5ER5A 3AAKA 4MEWA 1K93D 4XJKA 1TTXA 1UURA 3KHEA 1CM1A 2OPOA 4DUQA 1A75B 2WCBA 4GPLB 1OQPA 2ZN8A 4MBEA 4GGNA 2AAOA 1QLKA 1UHNA 2KQYA 2BE4A 1M39A 1TNQA 1MR8A 4CIDA 1TNXA 4YI9A 1QVIY 1OSAA 1KFXL 1SL9A 1S5GZ 4MZJA 4ORBB 3HX4A 2GV5A 1ALWA 3TS5C 2OTGC 2V53A 5I8NA 1CM4A 1DJWA 1EG4A 4MN0A 4YRUA 2BE6A 2F2PA 1Y1AA 2KYCA 1PVBA 2LAPA 3NSIA 1IJ6A 2BCAA 1U5IB 2LE9B 2LV7A 3PATA 3BUOB 2KFFA 3EVRA 2E6WA 3D0YA 1MHOA 4YI8A 1ZOTB 1XFUO 4TNCA 1NUBA 4CFQA 2BL0B 5HLVA 1J7PA 1ZUZA 3O78A 4N1GA 1NSHA 2WCEA 4MLWA 3CR2A 1B8CA 1BODA 1IWQA 1CKKA 2HETA 5CPVA 1IRJA 1EXRA 1WLZA 3HCMA 2E30A 3SG6A 1SYMA 3K21A 4F0ZB 3M0WA 1OMVA 1IG5A 3VGOA 2PVBA 1NX3A 1SK6D 5HLOA 2FCDA 1L2OB 2LNKA 5CSIA 1AHRA 1SKTA 2O60A 2G9BA 2CBLA 2Y4QA 1IH0A 2WC8A 3IQQA 2KBIA 1XFWO 1YVLA 2JZIA 1EG3A 2CCMA 4N1FA 1B47A 1KFUL 5KU1A 1TIZA 3AAJA 2JULA 1V1GA 1RFJA 1MUXA 1YUSA 2ZFDA 1FPWA 3SIBA 1J1DA 1LINA 1F4QA 2LP2A 1CTRA 1OZOA 2Q91A 4BY4A 4CPVA 1JWDA 5HKYA 1XO5A 1DJGA 1WY9A 3A8RA 1DJXA 1N2DA 1DGUA 1TOPA 2LVIA 5AANA 3DD4A 3BOWA 2WCFA 4YGCB 1FI6A 2P6BB 1L7ZA 1S26D 1DT7B 2AUCA 1QJTA 1BLQA 2LUXA 1S5GY 1DMOA 3PFVA 4OKHA 3SG5A 2M1KB 1SPYA 2HF5A 1CFFA 5ER4X 3FWBA 5HYDA 2KAXA 3BUWB 4I5LB 2PALA 1CMFA 2H61C 3VRRA 4M2OA 2LM5A 1GGZA 1CNPA 1DJIA 3PN7B 4WRIA 1OZSA 2LANA 1J7QA 4BY5A 1A4PA 4QJ4B 1RK9A 1JC2A 2BL0C 2MLEC 1PSRA 5B8IB 3SG4A 1Y6WA 1KFXS 1CLBA 1PK0D 4PE7A 1SCMC 2BECA 2G2BA 2LC5A 1B8LA 1CDPA 2M1UA 3D0YB 1DTLA 3CGAA 1GJYA 3CTNA 1H4BA 1L2OC 1CLMA 1QX7A 2FCEA 3PLFB 2LVKA 4NDDA 4DCKA 2L4HA 3TDIA 2K7OA 4YGAA 3BXKA 2KFHA 1YUTA 2DOQA 2SASA 4ZCUA 1YRTB 3E3RA 1DF0A 2KFGA 2BCBA 2F2OA 2MLFC 3RM1A 2M49B 4YGBB 2ZKMX 1CFDA 1W7JB 2JRFA 1YVHA 2SCPA 2LLUA 1MQ1A 2CXJA 1Q80A 2LP3A 4FTGA 1TNWA 1F8HA 1F71A 1UUSA 2GGZA 1YUUA 1R6PA 3CR5X 1W7IB 2MJWB 2EC6B 2R2IA 1QIWA 5HKWA 1NCZA 1J7RA 2O5GA 1F55A 2F8PA 1M46A 5GQQC 4PALA 1KFUS 1R2UA 1JFKA 1CB1A 1XK4A 3BOWB 1WRLA 3EVVA 1WRKA 1BF5A 1CLLA 1NWDA 3LLEA 2JNXA 2F3ZA 2MA2A 5HKZA 1XA5A 4GNKB 4USLA 5DKNA 1DJYA 2M29A 1M63B 2L5XB 1YX7A 3I5GC 1FF1A 3OB2B 4C0LA 3LCPC 1QLSA 5I2OA 3VRQA 3SG2A 1AVSA 3CLNA 1RTP1 4WQ2A 4ORCB 5JJGA 1OOJA 3SJSA 1FW4A 4Q04A 3JTDB 2KI6D 1SL8A 3OX6A 1TN4A 4AQIA 2VRGA 2M8UA 1XVJA 1D1OA 3BUXB 2MAZA 4XYNA 1PSBA 2KHNA 2Y5IA 1C07A 3EK7A 4N5XA 5AXIA 3AKBA 3KO0A 2KSPA 2L50A 4PHNA 1LXFC 2M7LA 4YGEB 1CDMA 2L0PA 2EHBA 1SR6B 5AFPA 3NSLA 1S6CA 2RGIA 4HRGA 1ZMZA 2LVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCY A;  2KAV A;  2L2E A;  3MSE B;  2KI4 B;  1RRO A;  1DF0 B;  2M97 A;  2LMU A;  1KK8 B;  1ZAC A;  2ISD A;  2OS8 B;  4PE4 A;  2H2K A;  4D1E A;  1KSO A;  2EC6 C;  4I5N B;  2JC2 A;  1K96 A;  1NIW A;  1UHI A;  3I5H B;  4MVF A;  2WOR A;  3H4S E;  1J1E A;  3PAL A;  1MXL C;  1QAS A;  2BBM A;  2JXC A;  1SL7 A;  1F54 A;  1BJF A;  3LL8 B;  4ZCV A;  5KTY A;  4PCW A;  2B1U A;  2JTT A;  2JT8 A;  4YBH B;  5FYX A;  2HQ8 A;  3GOF A;  1UHJ A;  4P2Y B;  1QIV A;  3BUN B;  2LMV A;  3OB1 B;  1FBV A;  2JQ6 A;  2WND A;  1WRZ A;  1X02 A;  3CZT X;  4JWQ A;  1KQM B;  5JOL A;  2JXL A;  3OP0 A;  2I7A A;  1B9A A;  2HQW A;  3JTD C;  1NYA A;  1RJV A;  1WDC B;  4ORA B;  1AUI B;  2MRD A;  3WHT B;  5J3X A;  1DJZ A;  2M0R A;  4OV2 A;  2L98 A;  1QX5 B;  2COL B;  2BKH B;  2KGB C;  3DVE A;  1OE9 B;  1BR1 B;  2LMT A;  1M31 A;  1A03 A;  3BUM B;  1YUR A;  2BKI B;  2Q4U A;  2PAS A;  1TCF A;  4PDZ A;  5F6T A;  2LLS A;  1CDL A;  1LVC D;  1SR6 C;  1ZFS A;  2M3W A;  1N0Y A;  2LHI A;  4MZK A;  1NX2 A;  2Y1N A;  2NCP A;  4R1E A;  1C7W A;  3LK1 A;  4DS7 A;  1QAT A;  1MF8 B;  2JOJ A;  3JVT B;  1NX0 A;  4A4C A;  1K94 A;  3TUY B;  2KI4 C;  2EGD A;  4GFT A;  4CFR A;  3KF9 A;  1TCO B;  1K95 A;  3D10 A;  1KK8 C;  1IQ3 A;  1MWN A;  4C0J A;  2LCP A;  1BMO A;  1MXE A;  4GGF A;  4NDB A;  1YR5 A;  1VRK A;  3TS5 B;  2OTG B;  1SMG A;  3RLZ A;  1JBA A;  1CFC A;  2GGM A;  5D7F A;  4PE1 A;  2D8N A;  1UHK A;  3I5F B;  3O2P A;  1LA3 A;  2NLN A;  4YGD B;  2MBX A;  2M7N A;  1QXP A;  4NDC A;  4PHK A;  1SY9 A;  1AP4 A;  1K8U A;  5D69 A;  3VRO A;  4I5K A;  4DRW A;  1AK8 A;  1SRA A;  4U8D A;  1QV1 A;  4OCI A;  2CTN A;  3QRX A;  4OR9 B;  4C0K A;  1BG1 A;  1XK4 C;  2ZRT A;  3VRN A;  1H8B A;  4IL1 A;  1SNL A;  4MRX A;  3DF0 A;  1ODB A;  1BT6 A;  3CWG A;  1KQM C;  4WQ3 A;  1AJ4 A;  2K61 A;  1S6J A;  3OHM B;  1IJ5 A;  1J7O A;  3SIA A;  1WDC C;  3IF7 A;  1XFY O;  5BPJ A;  2ZN9 A;  3PN7 C;  4PHJ A;  1K9K A;  1A29 A;  2JT0 A;  1KK7 Z;  2K7B A;  4GUK A;  4NQG A;  3F45 A;  4GBA A;  2KDH A;  2L4I A;  1HT9 A;  3PM8 A;  1XFX O;  3FWC A;  1B8R A;  1EH2 A;  2HPS A;  1PRW A;  1S36 A;  4QJ5 B;  2JNF A;  2A4J A;  1EL4 A;  1C7V A;  1B7T Z;  1IKU A;  2PMY A;  3EK8 A;  2JTZ A;  1LKJ A;  2JU0 A;  4L9M A;  3WXA A;  1QX2 A;  1ALV A;  1K9U A;  4MRY A;  3JVT C;  3TUY C;  1BOC A;  3O4Y A;  3OX5 A;  3VRP A;  1DGV A;  4JPZ B;  1NP8 A;  2FOT A;  5CSN A;  1JF2 A;  3NSK A;  1TNP A;  2KYF A;  2QAC A;  2JPT A;  3C1V A;  1HQV A;  1Y1U A;  2CT9 A;  3PSR A;  2F3Y A;  1JF0 A;  3GK4 X;  4PHM A;  1OMR A;  1QTX A;  3GK2 A;  3I5F C;  1JSA A;  1AJ5 A;  1PAL A;  3TDZ A;  1EJ3 A;  3NSO A;  3EVU A;  3BQ3 A;  2K7C A;  1K2H A;  4ICB A;  2CNP A;  1KQV A;  2L51 A;  1S6I A;  3DVJ A;  4OVN F;  5KSZ A;  5DKR A;  1G4Y R;  1NCY A;  1RWY A;  3AKA A;  3WHU B;  3I5I B;  1QS7 A;  1SCM B;  1REC A;  1PUL A;  1KWO B;  2I94 A;  2K7D A;  2PSR A;  2ZND A;  1B1G A;  3A4U B;  2JWW A;  2KOT A;  4GAO A;  4A4B A;  1YX8 A;  4UPG A;  2M9G A;  5I2Q A;  1N65 A;  1NX1 A;  4P5O E;  2MHH A;  3DF0 B;  1Y0V H;  4HSZ A;  4M2Q A;  4E68 A;  1JFJ A;  1KK7 Y;  4DIR A;  1YTZ C;  2ZRS A;  3KPX A;  4CLN A;  1F70 A;  3DVK A;  1PVA A;  1IGV A;  1BR4 B;  1CDN A;  1FI5 A;  2I18 A;  3WNX B;  1F4O A;  3CS1 A;  2NCO A;  3TZ1 A;  1M45 A;  1B7T Y;  1K90 D;  2K8M B;  1UHH A;  1WLM A;  4MZL A;  3ZWH A;  1UWO A;  1A75 A;  3LK0 A;  4JQ0 D;  4XJK B;  5DKQ A;  1IQ5 A;  1K9P A;  1SW8 A;  3FS7 A;  3EKJ A;  3CR4 X;  1NCX A;  5TNC A;  1KSM A;  1LA0 A;  3IQO A;  1S1E A;  1GGW A;  2K0J A;  3EK4 A;  1XFZ O;  2F33 A;  2KI6 C;  1SCV A;  1QV0 A;  2WOS A;  2K2A A;  2KGR A;  4M2P A;  1QVI Z;  2LLT A;  1G8I A;  3EKH A;  2LUC A;  4HRH A;  1XYD A;  4GGF C;  4HRE E;  2I2R E;  1J55 A;  3O6B A;  1YRU B;  2OS8 C;  2NZ0 A;  5AEQ A;  3SG7 A;  3TDU A;  3BYA A;  3ICB A;  1BU3 A;  2IS9 A;  2H61 A;  1CFP A;  1U5I A;  2LHL A;  3KEV A;  1G33 A;  1TRF A;  3ZNI A;  3I5I C;  1DJH A;  3I5H C;  4AQJ A;  3I5G B;  1Y1X A;  2Y1M A;  1A2X A;  1XFV O;  1KWO C;  5G08 A;  4AOM A;  3FIA A;  1JUO A;  4PE0 A;  5AER A;  1NPQ A;  5CSJ A;  2AMI A;  4MSP A;  2KNE A;  2BBN A;  4ETO A;  1DVI A;  5IBW A;  1B4C A;  2K2F A;  2QPT A;  5CSF A;  5I2L A;  3SG3 A;  2KBM A;  3DVM A;  1SBJ A;  2KQ6 A;  2KAY A;  1GQM A;  2TN4 A;  4I5J A;  3NXA A;  4FQO A;  5PAL A;  5K89 A;  1V1F A;  3GK1 A;  4QJ3 B;  2PRU A;  1S3P A;  2ZNE A;  1UP5 A;  2NXQ A;  2FJU B;  2BCX A;  1E8A A;  1CMG A;  2JT3 A;  1OMD A;  2LVJ A;  5ER5 A;  3AAK A;  4MEW A;  1K93 D;  4XJK A;  1TTX A;  1UUR A;  3KHE A;  1CM1 A;  2OPO A;  4DUQ A;  1A75 B;  2WCB A;  4GPL B;  1OQP A;  2ZN8 A;  4MBE A;  4GGN A;  2AAO A;  1QLK A;  1UHN A;  2KQY A;  2BE4 A;  1M39 A;  1TNQ A;  1MR8 A;  4CID A;  1TNX A;  4YI9 A;  1QVI Y;  1OSA A;  1KFX L;  1SL9 A;  1S5G Z;  4MZJ A;  4ORB B;  3HX4 A;  2GV5 A;  1ALW A;  3TS5 C;  2OTG C;  2V53 A;  5I8N A;  1CM4 A;  1DJW A;  1EG4 A;  4MN0 A;  4YRU A;  2BE6 A;  2F2P A;  1Y1A A;  2KYC A;  1PVB A;  2LAP A;  3NSI A;  1IJ6 A;  2BCA A;  1U5I B;  2LE9 B;  2LV7 A;  3PAT A;  3BUO B;  2KFF A;  3EVR A;  2E6W A;  3D0Y A;  1MHO A;  4YI8 A;  1ZOT B;  1XFU O;  4TNC A;  1NUB A;  4CFQ A;  2BL0 B;  5HLV A;  1J7P A;  1ZUZ A;  3O78 A;  4N1G A;  1NSH A;  2WCE A;  4MLW A;  3CR2 A;  1B8C A;  1BOD A;  1IWQ A;  1CKK A;  2HET A;  5CPV A;  1IRJ A;  1EXR A;  1WLZ A;  3HCM A;  2E30 A;  3SG6 A;  1SYM A;  3K21 A;  4F0Z B;  3M0W A;  1OMV A;  1IG5 A;  3VGO A;  2PVB A;  1NX3 A;  1SK6 D;  5HLO A;  2FCD A;  1L2O B;  2LNK A;  5CSI A;  1AHR A;  1SKT A;  2O60 A;  2G9B A;  2CBL A;  2Y4Q A;  1IH0 A;  2WC8 A;  3IQQ A;  2KBI A;  1XFW O;  1YVL A;  2JZI A;  1EG3 A;  2CCM A;  4N1F A;  1B47 A;  1KFU L;  5KU1 A;  1TIZ A;  3AAJ A;  2JUL A;  1V1G A;  1RFJ A;  1MUX A;  1YUS A;  2ZFD A;  1FPW A;  3SIB A;  1J1D A;  1LIN A;  1F4Q A;  2LP2 A;  1CTR A;  1OZO A;  2Q91 A;  4BY4 A;  4CPV A;  1JWD A;  5HKY A;  1XO5 A;  1DJG A;  1WY9 A;  3A8R A;  1DJX A;  1N2D A;  1DGU A;  1TOP A;  2LVI A;  5AAN A;  3DD4 A;  3BOW A;  2WCF A;  4YGC B;  1FI6 A;  2P6B B;  1L7Z A;  1S26 D;  1DT7 B;  2AUC A;  1QJT A;  1BLQ A;  2LUX A;  1S5G Y;  1DMO A;  3PFV A;  4OKH A;  3SG5 A;  2M1K B;  1SPY A;  2HF5 A;  1CFF A;  5ER4 X;  3FWB A;  5HYD A;  2KAX A;  3BUW B;  4I5L B;  2PAL A;  1CMF A;  2H61 C;  3VRR A;  4M2O A;  2LM5 A;  1GGZ A;  1CNP A;  1DJI A;  3PN7 B;  4WRI A;  1OZS A;  2LAN A;  1J7Q A;  4BY5 A;  1A4P A;  4QJ4 B;  1RK9 A;  1JC2 A;  2BL0 C;  2MLE C;  1PSR A;  5B8I B;  3SG4 A;  1Y6W A;  1KFX S;  1CLB A;  1PK0 D;  4PE7 A;  1SCM C;  2BEC A;  2G2B A;  2LC5 A;  1B8L A;  1CDP A;  2M1U A;  3D0Y B;  1DTL A;  3CGA A;  1GJY A;  3CTN A;  1H4B A;  1L2O C;  1CLM A;  1QX7 A;  2FCE A;  3PLF B;  2LVK A;  4NDD A;  4DCK A;  2L4H A;  3TDI A;  2K7O A;  4YGA A;  3BXK A;  2KFH A;  1YUT A;  2DOQ A;  2SAS A;  4ZCU A;  1YRT B;  3E3R A;  1DF0 A;  2KFG A;  2BCB A;  2F2O A;  2MLF C;  3RM1 A;  2M49 B;  4YGB B;  2ZKM X;  1CFD A;  1W7J B;  2JRF A;  1YVH A;  2SCP A;  2LLU A;  1MQ1 A;  2CXJ A;  1Q80 A;  2LP3 A;  4FTG A;  1TNW A;  1F8H A;  1F71 A;  1UUS A;  2GGZ A;  1YUU A;  1R6P A;  3CR5 X;  1W7I B;  2MJW B;  2EC6 B;  2R2I A;  1QIW A;  5HKW A;  1NCZ A;  1J7R A;  2O5G A;  1F55 A;  2F8P A;  1M46 A;  5GQQ C;  4PAL A;  1KFU S;  1R2U A;  1JFK A;  1CB1 A;  1XK4 A;  3BOW B;  1WRL A;  3EVV A;  1WRK A;  1BF5 A;  1CLL A;  1NWD A;  3LLE A;  2JNX A;  2F3Z A;  2MA2 A;  5HKZ A;  1XA5 A;  4GNK B;  4USL A;  5DKN A;  1DJY A;  2M29 A;  1M63 B;  2L5X B;  1YX7 A;  3I5G C;  1FF1 A;  3OB2 B;  4C0L A;  3LCP C;  1QLS A;  5I2O A;  3VRQ A;  3SG2 A;  1AVS A;  3CLN A;  1RTP 1;  4WQ2 A;  4ORC B;  5JJG A;  1OOJ A;  3SJS A;  1FW4 A;  4Q04 A;  3JTD B;  2KI6 D;  1SL8 A;  3OX6 A;  1TN4 A;  4AQI A;  2VRG A;  2M8U A;  1XVJ A;  1D1O A;  3BUX B;  2MAZ A;  4XYN A;  1PSB A;  2KHN A;  2Y5I A;  1C07 A;  3EK7 A;  4N5X A;  5AXI A;  3AKB A;  3KO0 A;  2KSP A;  2L50 A;  4PHN A;  1LXF C;  2M7L A;  4YGE B;  1CDM A;  2L0P A;  2EHB A;  1SR6 B;  5AFP A;  3NSL A;  1S6C A;  2RGI A;  4HRG A;  1ZMZ A;  2LVV A; 
#chains in the Genus database with same CATH topology
 1KCY A;  2KAV A;  2L2E A;  3MSE B;  2KI4 B;  1RRO A;  1DF0 B;  2M97 A;  2LMU A;  1KK8 B;  1ZAC A;  2ISD A;  2OS8 B;  4PE4 A;  2H2K A;  4D1E A;  1KSO A;  2EC6 C;  4I5N B;  2JC2 A;  1K96 A;  1NIW A;  1UHI A;  3I5H B;  4MVF A;  2WOR A;  3H4S E;  1J1E A;  3CDN A;  3PAL A;  1MXL C;  1QAS A;  2BBM A;  2JXC A;  1SL7 A;  2WCJ A;  3UNW A;  1F54 A;  1BJF A;  3LL8 B;  4ZCV A;  5KTY A;  4PCW A;  2B1U A;  2JTT A;  2JT8 A;  4YBH B;  5FYX A;  3V2L A;  2HQ8 A;  3GOF A;  1UHJ A;  4P2Y B;  1QIV A;  3BUN B;  2LMV A;  3OB1 B;  1FBV A;  2JQ6 A;  2WND A;  1WRZ A;  1X02 A;  3CZT X;  4JWQ A;  1KQM B;  5JOL A;  2JXL A;  3OP0 A;  2I7A A;  1B9A A;  2HQW A;  3JTD C;  1NYA A;  1RJV A;  1WDC B;  2KLD A;  1LS8 A;  4ORA B;  1AUI B;  2MRD A;  3WHT B;  5J3X A;  1DJZ A;  2M0R A;  4OV2 A;  2L98 A;  1QX5 B;  2COL B;  2BKH B;  2KGB C;  3DVE A;  1OE9 B;  4OZD A;  1BR1 B;  2LMT A;  1M31 A;  1A03 A;  3BUM B;  1YUR A;  2BKI B;  2Q4U A;  2PAS A;  1TCF A;  4PDZ A;  5F6T A;  2LLS A;  1CDL A;  1LVC D;  1SR6 C;  1ZFS A;  2M3W A;  1N0Y A;  2LHI A;  2P71 A;  4MZK A;  1NX2 A;  2Y1N A;  2NCP A;  3FE9 A;  4R1E A;  1C7W A;  3LK1 A;  4DS7 A;  1QAT A;  1MF8 B;  2JOJ A;  1T14 A;  3BFA A;  3JVT B;  1NX0 A;  4A4C A;  1K94 A;  3TUY B;  3SS5 A;  2KI4 C;  2EGD A;  2K60 A;  4GFT A;  4CFR A;  3KF9 A;  1TCO B;  1K95 A;  3D10 A;  1KK8 C;  1IQ3 A;  2KPH A;  1MWN A;  3Q8I A;  4C0J A;  2LCP A;  2JPO A;  3CAB A;  1C3Y A;  3S0E A;  1BMO A;  1MXE A;  4GGF A;  4NDB A;  1YR5 A;  1VRK A;  3TS5 B;  2OTG B;  1SMG A;  3RLZ A;  1JBA A;  3B88 A;  1CFC A;  2GGM A;  5D7F A;  4PE1 A;  2D8N A;  1UHK A;  3DXL A;  3I5F B;  3O2P A;  1LA3 A;  2NLN A;  4YGD B;  2MBX A;  2M7N A;  1QXP A;  4NDC A;  4PHK A;  1SY9 A;  1AP4 A;  1K8U A;  3OGN A;  2PYQ A;  5D69 A;  3VRO A;  4I5K A;  3FE8 A;  4DRW A;  1SRA A;  4U8D A;  1AK8 A;  1QV1 A;  4OCI A;  2CTN A;  3QRX A;  4OR9 B;  4C0K A;  1BG1 A;  1XK4 C;  2ZRT A;  3VRN A;  1IIO A;  1H8B A;  4IL1 A;  1SNL A;  2YGU A;  4MRX A;  3DF0 A;  1ODB A;  1BT6 A;  3NHT A;  3CWG A;  1KQM C;  4WQ3 A;  1AJ4 A;  2K61 A;  1S6J A;  3OHM B;  1IJ5 A;  1DC1 A;  1J7O A;  3SIA A;  1WDC C;  3IF7 A;  1XFY O;  5BPJ A;  2ZN9 A;  3PN7 C;  4PHJ A;  1K9K A;  1A29 A;  2JT0 A;  1KK7 Z;  3S0A A;  2K7B A;  4GUK A;  3BFB A;  4NQG A;  3F45 A;  4GBA A;  2KDH A;  2L4I A;  1HT9 A;  3PM8 A;  1XFX O;  2PQL A;  1B8R A;  3FWC A;  1EH2 A;  2HPS A;  1PRW A;  1S36 A;  4QJ5 B;  1TWO A;  2JNF A;  2A4J A;  1EL4 A;  1C7V A;  1B7T Z;  1IKU A;  2PMY A;  3EK8 A;  2JTZ A;  1LKJ A;  2JU0 A;  2P70 A;  4L9M A;  1QX2 A;  3WXA A;  1ALV A;  1K9U A;  4MRY A;  3JVT C;  3TUY C;  1BOC A;  3O4Y A;  3OX5 A;  3VRP A;  1DGV A;  1OOF A;  1NP8 A;  2FOT A;  4JPZ B;  5CSN A;  1JF2 A;  3NSK A;  1TNP A;  2KYF A;  2QAC A;  2JPT A;  3C1V A;  1HQV A;  3DYE A;  1Y1U A;  2CT9 A;  3PSR A;  2F3Y A;  1JF0 A;  3GK4 X;  4PHM A;  1OMR A;  1QTX A;  3GK2 A;  3I5F C;  1JSA A;  1AJ5 A;  1PAL A;  3EG5 B;  1EJ3 A;  3TDZ A;  1QWV A;  3NSO A;  3EVU A;  3BQ3 A;  2K7C A;  5DIC A;  1K2H A;  4ICB A;  2CNP A;  1KQV A;  2L51 A;  1S6I A;  3DVJ A;  4OVN F;  5KSZ A;  5DKR A;  1G4Y R;  1NCY A;  1RWY A;  1DEK A;  3AKA A;  3WHU B;  3I5I B;  1QS7 A;  3CYZ A;  1SCM B;  1REC A;  1C3Z A;  1KWO B;  1PUL A;  2I94 A;  2K7D A;  2PSR A;  2ZND A;  3A4U B;  1B1G A;  2JWW A;  2KOT A;  4GAO A;  4A4B A;  5I94 A;  1YX8 A;  4UPG A;  2M9G A;  5I2Q A;  1N65 A;  1NX1 A;  4P5O E;  3OBV A;  2MHH A;  2WC5 A;  3D76 A;  3DF0 B;  1Y0V H;  4HSZ A;  4M2Q A;  4E68 A;  1JFJ A;  1KK7 Y;  4DIR A;  1YTZ C;  2ZRS A;  3KPX A;  4CLN A;  3NGV A;  1F70 A;  1OOH A;  3DVK A;  1PVA A;  1IGV A;  1BR4 B;  1CDN A;  1FI5 A;  2I18 A;  3WNX B;  1F4O A;  3CS1 A;  2NCO A;  3TZ1 A;  1M45 A;  1B7T Y;  1K90 D;  2K8M B;  1UHH A;  3L4A A;  1WLM A;  3PJI A;  4MZL A;  3ZWH A;  1UWO A;  1A75 A;  3LK0 A;  4JQ0 D;  4XJK B;  5DKQ A;  1IQ5 A;  1K9P A;  1SW8 A;  3FS7 A;  3EKJ A;  3B86 A;  1NCX A;  2ERB A;  3CR4 X;  5TNC A;  1KSM A;  1LA0 A;  3IQO A;  1S1E A;  1GGW A;  2K0J A;  3EK4 A;  1XFZ O;  2F33 A;  3S0B A;  2KI6 C;  1SCV A;  3O4X A;  1QV0 A;  5FI7 A;  2WOS A;  2K2A A;  2KGR A;  4M2P A;  1QVI Z;  2LLT A;  1G8I A;  3EKH A;  2LUC A;  4HRH A;  1XYD A;  2L5Y A;  4GGF C;  4HRE E;  2I2R E;  1J55 A;  2BAP A;  3O6B A;  1YRU B;  2OS8 C;  2NZ0 A;  5AEQ A;  3SG7 A;  3TDU A;  3BYA A;  3ICB A;  1BU3 A;  2IS9 A;  2H61 A;  1OW4 A;  1U5I A;  1CFP A;  2LHL A;  2FJY A;  3KEV A;  1G33 A;  1TRF A;  3ZNI A;  3CZ2 A;  3I5I C;  1DJH A;  3I5H C;  5EL2 A;  4AQJ A;  3I5G B;  1Y1X A;  2Y1M A;  1A2X A;  1XFV O;  1KWO C;  5G08 A;  4AOM A;  3FIA A;  1JUO A;  4PE0 A;  5AER A;  1NPQ A;  5CSJ A;  2AMI A;  4MSP A;  2KNE A;  3D78 A;  2BBN A;  4ETO A;  1DVI A;  5IBW A;  3S0F A;  1B4C A;  2K2F A;  2QPT A;  5CSF A;  5I2L A;  3SG3 A;  2KBM A;  1W9Z A;  3DVM A;  1SBJ A;  2KQ6 A;  3S0G A;  2KAY A;  1GQM A;  2TN4 A;  4I5J A;  3NXA A;  4FQO A;  5PAL A;  5K89 A;  1V1F A;  3GK1 A;  4QJ3 B;  2PRU A;  1S3P A;  1GM0 A;  2ZNE A;  1UP5 A;  2NXQ A;  3CZ0 A;  2FJU B;  2BCX A;  1E8A A;  1CMG A;  2JT3 A;  3UO9 A;  1OMD A;  2LVJ A;  5ER5 A;  3AAK A;  4MEW A;  1K93 D;  4XJK A;  1TTX A;  1UUR A;  2QEO A;  3KHE A;  1CM1 A;  2OPO A;  4DUQ A;  1A75 B;  1DQE A;  2WCB A;  5FI2 A;  4GPL B;  1OQP A;  2ZN8 A;  4INW A;  4MBE A;  4GGN A;  2AAO A;  2WCH A;  1QLK A;  1UHN A;  3VB1 A;  2KQY A;  2BE4 A;  3CZ1 A;  1M39 A;  1TNQ A;  1MR8 A;  2BNX A;  4CID A;  1TNX A;  4YI9 A;  1QVI Y;  1OSA A;  1KFX L;  3R1V A;  2QDI A;  1SL9 A;  1S5G Z;  4JKT A;  4MZJ A;  4ORB B;  3HX4 A;  2GV5 A;  1ALW A;  3TS5 C;  2OTG C;  2V53 A;  5I8N A;  1CM4 A;  1DJW A;  1EG4 A;  4MN0 A;  4YRU A;  2BE6 A;  2F2P A;  1Y1A A;  2KYC A;  3D74 A;  1PVB A;  2LAP A;  3NSI A;  1IJ6 A;  2BCA A;  1U5I B;  2LE9 B;  2LV7 A;  3PAT A;  3BUO B;  2KFF A;  3EVR A;  2E6W A;  3D0Y A;  1MHO A;  4YI8 A;  5FI6 A;  1ZOT B;  1XFU O;  4TNC A;  3FE6 A;  1NUB A;  4CFQ A;  2BL0 B;  5HLV A;  1J7P A;  1ZUZ A;  3O78 A;  4N1G A;  1NSH A;  2WCE A;  1TUJ A;  4INX A;  4MLW A;  3CR2 A;  1B8C A;  1BOD A;  1IWQ A;  1CKK A;  2HET A;  5CPV A;  1IRJ A;  1EXR A;  1WLZ A;  3HCM A;  2E30 A;  3SG6 A;  1SYM A;  3K21 A;  4F0Z B;  3M0W A;  1OMV A;  1IG5 A;  3VGO A;  2PVB A;  3SS3 A;  1NX3 A;  1SK6 D;  5HLO A;  2FCD A;  2WC6 A;  1L2O B;  2LNK A;  5CSI A;  1AHR A;  1SKT A;  2O60 A;  2G9B A;  2CBL A;  2Y4Q A;  1IH0 A;  2WC8 A;  3IQQ A;  2KBI A;  1XFW O;  1YVL A;  2JZI A;  1EG3 A;  2CCM A;  4N1F A;  1B47 A;  1KFU L;  3SS4 A;  1TIZ A;  5KU1 A;  3PM2 A;  3AAJ A;  2JUL A;  1V1G A;  1Z4H A;  1RFJ A;  1MUX A;  1YUS A;  2ZFD A;  1FPW A;  3SIB A;  1J1D A;  1LIN A;  1F4Q A;  2LP2 A;  1CTR A;  1OZO A;  2Q91 A;  3BFH A;  4BY4 A;  2QEV A;  4CPV A;  1JWD A;  5HKY A;  1XO5 A;  1DJG A;  1WY9 A;  3B7A A;  3A8R A;  1DJX A;  1N2D A;  1DGU A;  1TOP A;  1SSE B;  2LVI A;  3R1P A;  3DD4 A;  3BOW A;  5AAN A;  2KLE A;  2WCF A;  4YGC B;  1FI6 A;  2P6B B;  1L7Z A;  1S26 D;  1DT7 B;  2AUC A;  1QJT A;  1BLQ A;  2LUX A;  1S5G Y;  1DMO A;  3PFV A;  4OKH A;  3SG5 A;  2M1K B;  1SPY A;  2HF5 A;  1CFF A;  5ER4 X;  3DZT A;  3FWB A;  5HYD A;  2KAX A;  3BUW B;  4I5L B;  2PAL A;  1CMF A;  2H61 C;  3VRR A;  4M2O A;  2LM5 A;  1GGZ A;  1CNP A;  1DJI A;  3PN7 B;  4WRI A;  1OZS A;  2LAN A;  1J7Q A;  1DEL A;  4BY5 A;  1A4P A;  4QJ4 B;  1RK9 A;  4IJ7 A;  2BL0 C;  1JC2 A;  2MLE C;  1PSR A;  5B8I B;  3SG4 A;  1Y6W A;  1KFX S;  1CLB A;  1PK0 D;  4PE7 A;  1SCM C;  2BEC A;  2G2B A;  2LC5 A;  5HL1 A;  1B8L A;  1CDP A;  2M1U A;  3D0Y B;  1DTL A;  3CGA A;  1OOG A;  1GJY A;  3BJH A;  3NHI A;  3CTN A;  4FQT A;  1H4B A;  1L2O C;  1CLM A;  1QX7 A;  3RZS A;  2FCE A;  3PLF B;  2LVK A;  4NDD A;  4DCK A;  2L4H A;  3TDI A;  2K7O A;  4YGA A;  3L4L A;  4KYN A;  3BXK A;  2KFH A;  3S0D A;  1YUT A;  2DOQ A;  2SAS A;  4ZCU A;  3DY9 A;  1YRT B;  3E3R A;  1DF0 A;  2KFG A;  2BCB A;  2F2O A;  2MLF C;  3D77 A;  2M49 B;  3RM1 A;  4YGB B;  2ZKM X;  1CFD A;  1W7J B;  2JRF A;  1YVH A;  2SCP A;  3D73 A;  2LLU A;  3N7H A;  1MQ1 A;  2CXJ A;  1Q80 A;  2LP3 A;  4FTG A;  1TNW A;  1OOI X;  1F8H A;  1F71 A;  1UUS A;  2WCL A;  2GGZ A;  1YUU A;  1R6P A;  3CR5 X;  1W7I B;  2MJW B;  2EC6 B;  2R2I A;  1QIW A;  5HKW A;  1NCZ A;  1J7R A;  2QEH A;  2O5G A;  3B87 A;  1Z2C B;  1F55 A;  2F8P A;  1M46 A;  5GQQ C;  4PAL A;  1KFU S;  1R2U A;  1JFK A;  1CB1 A;  1XK4 A;  3BOW B;  3R1O A;  1WRL A;  3EVV A;  1WRK A;  3D75 A;  1ORG A;  5D3O A;  1BF5 A;  1CLL A;  1NWD A;  2WCK A;  2JNX A;  2F3Z A;  2MA2 A;  2WCM A;  3K1E A;  3LLE A;  5HKZ A;  1XA5 A;  3QME A;  4GNK B;  2QEB A;  4USL A;  5DKN A;  1DJY A;  2M29 A;  1M63 B;  2L5X B;  1YX7 A;  3I5G C;  1FF1 A;  3OB2 B;  4C0L A;  3LCP C;  1QLS A;  5I2O A;  3VRQ A;  2H8V A;  3R72 A;  3SG2 A;  1AVS A;  3CLN A;  1RTP 1;  4WQ2 A;  4ORC B;  5JJG A;  1OOJ A;  3SJS A;  1FW4 A;  3IVT A;  4Q04 A;  3JTD B;  1XFR A;  2KI6 D;  1SL8 A;  3OX6 A;  1TN4 A;  4AQI A;  2VRG A;  2M8U A;  1XVJ A;  4PT1 A;  1D1O A;  3L47 A;  2L2C A;  1TUZ A;  2MAZ A;  1PSB A;  2KHN A;  3BUX B;  4XYN A;  2Y5I A;  4F7F A;  3EK7 A;  1C07 A;  4N5X A;  5AXI A;  3AKB A;  4JD9 A;  3KO0 A;  2KSP A;  2L50 A;  2GTE A;  4PHN A;  1LXF C;  2M7L A;  4YGE B;  1CDM A;  2L0P A;  3B6X A;  2EHB A;  1SR6 B;  5AFP A;  3NSL A;  1S6C A;  2RGI A;  4HRG A;  1ZMZ A;  1P28 A;  2LVV A; 
#chains in the Genus database with same CATH homology
 1KCY A;  2KAV A;  2L2E A;  3MSE B;  2KI4 B;  1RRO A;  1DF0 B;  2M97 A;  2LMU A;  1KK8 B;  1ZAC A;  2ISD A;  2OS8 B;  4PE4 A;  2H2K A;  4D1E A;  1KSO A;  2EC6 C;  4I5N B;  2JC2 A;  1K96 A;  1NIW A;  1UHI A;  3I5H B;  4MVF A;  2WOR A;  3H4S E;  1J1E A;  3PAL A;  1MXL C;  1QAS A;  2BBM A;  2JXC A;  1SL7 A;  1F54 A;  1BJF A;  3LL8 B;  4ZCV A;  5KTY A;  4PCW A;  2B1U A;  2JTT A;  2JT8 A;  4YBH B;  5FYX A;  2HQ8 A;  3GOF A;  1UHJ A;  4P2Y B;  1QIV A;  3BUN B;  2LMV A;  3OB1 B;  1FBV A;  2JQ6 A;  2WND A;  1WRZ A;  1X02 A;  3CZT X;  4JWQ A;  1KQM B;  5JOL A;  2JXL A;  3OP0 A;  2I7A A;  1B9A A;  2HQW A;  3JTD C;  1NYA A;  1RJV A;  1WDC B;  4ORA B;  1AUI B;  2MRD A;  3WHT B;  5J3X A;  1DJZ A;  2M0R A;  4OV2 A;  2L98 A;  1QX5 B;  2COL B;  2BKH B;  2KGB C;  3DVE A;  1OE9 B;  1BR1 B;  2LMT A;  1M31 A;  1A03 A;  3BUM B;  1YUR A;  2BKI B;  2Q4U A;  2PAS A;  1TCF A;  4PDZ A;  5F6T A;  2LLS A;  1CDL A;  1LVC D;  1SR6 C;  1ZFS A;  2M3W A;  1N0Y A;  2LHI A;  4MZK A;  1NX2 A;  2Y1N A;  2NCP A;  4R1E A;  1C7W A;  3LK1 A;  4DS7 A;  1QAT A;  1MF8 B;  2JOJ A;  3JVT B;  1NX0 A;  4A4C A;  1K94 A;  3TUY B;  2KI4 C;  2EGD A;  4GFT A;  4CFR A;  3KF9 A;  1TCO B;  1K95 A;  3D10 A;  1KK8 C;  1IQ3 A;  1MWN A;  4C0J A;  2LCP A;  1BMO A;  1MXE A;  4GGF A;  4NDB A;  1YR5 A;  1VRK A;  3TS5 B;  2OTG B;  1SMG A;  3RLZ A;  1JBA A;  1CFC A;  2GGM A;  5D7F A;  4PE1 A;  2D8N A;  1UHK A;  3I5F B;  3O2P A;  1LA3 A;  2NLN A;  4YGD B;  2MBX A;  2M7N A;  1QXP A;  4NDC A;  4PHK A;  1SY9 A;  1AP4 A;  1K8U A;  5D69 A;  3VRO A;  4I5K A;  4DRW A;  1AK8 A;  1SRA A;  4U8D A;  1QV1 A;  4OCI A;  2CTN A;  3QRX A;  4OR9 B;  4C0K A;  1BG1 A;  1XK4 C;  2ZRT A;  3VRN A;  1H8B A;  4IL1 A;  1SNL A;  4MRX A;  3DF0 A;  1ODB A;  1BT6 A;  3CWG A;  1KQM C;  4WQ3 A;  1AJ4 A;  2K61 A;  1S6J A;  3OHM B;  1IJ5 A;  1J7O A;  3SIA A;  1WDC C;  3IF7 A;  1XFY O;  5BPJ A;  2ZN9 A;  3PN7 C;  4PHJ A;  1K9K A;  1A29 A;  2JT0 A;  1KK7 Z;  2K7B A;  4GUK A;  4NQG A;  3F45 A;  4GBA A;  2KDH A;  2L4I A;  1HT9 A;  3PM8 A;  1XFX O;  3FWC A;  1B8R A;  1EH2 A;  2HPS A;  1PRW A;  1S36 A;  4QJ5 B;  2JNF A;  2A4J A;  1EL4 A;  1C7V A;  1B7T Z;  1IKU A;  2PMY A;  3EK8 A;  2JTZ A;  1LKJ A;  2JU0 A;  4L9M A;  3WXA A;  1QX2 A;  1ALV A;  1K9U A;  4MRY A;  3JVT C;  3TUY C;  1BOC A;  3O4Y A;  3OX5 A;  3VRP A;  1DGV A;  4JPZ B;  1NP8 A;  2FOT A;  5CSN A;  1JF2 A;  3NSK A;  1TNP A;  2KYF A;  2QAC A;  2JPT A;  3C1V A;  1HQV A;  1Y1U A;  2CT9 A;  3PSR A;  2F3Y A;  1JF0 A;  3GK4 X;  4PHM A;  1OMR A;  1QTX A;  3GK2 A;  3I5F C;  1JSA A;  1AJ5 A;  1PAL A;  3TDZ A;  1EJ3 A;  3NSO A;  3EVU A;  3BQ3 A;  2K7C A;  1K2H A;  4ICB A;  2CNP A;  1KQV A;  2L51 A;  1S6I A;  3DVJ A;  4OVN F;  5KSZ A;  5DKR A;  1G4Y R;  1NCY A;  1RWY A;  3AKA A;  3WHU B;  3I5I B;  1QS7 A;  1SCM B;  1REC A;  1PUL A;  1KWO B;  2I94 A;  2K7D A;  2PSR A;  2ZND A;  1B1G A;  3A4U B;  2JWW A;  2KOT A;  4GAO A;  4A4B A;  1YX8 A;  4UPG A;  2M9G A;  5I2Q A;  1N65 A;  1NX1 A;  4P5O E;  2MHH A;  3DF0 B;  1Y0V H;  4HSZ A;  4M2Q A;  4E68 A;  1JFJ A;  1KK7 Y;  4DIR A;  1YTZ C;  2ZRS A;  3KPX A;  4CLN A;  1F70 A;  3DVK A;  1PVA A;  1IGV A;  1BR4 B;  1CDN A;  1FI5 A;  2I18 A;  3WNX B;  1F4O A;  3CS1 A;  2NCO A;  3TZ1 A;  1M45 A;  1B7T Y;  1K90 D;  2K8M B;  1UHH A;  1WLM A;  4MZL A;  3ZWH A;  1UWO A;  1A75 A;  3LK0 A;  4JQ0 D;  4XJK B;  5DKQ A;  1IQ5 A;  1K9P A;  1SW8 A;  3FS7 A;  3EKJ A;  3CR4 X;  1NCX A;  5TNC A;  1KSM A;  1LA0 A;  3IQO A;  1S1E A;  1GGW A;  2K0J A;  3EK4 A;  1XFZ O;  2F33 A;  2KI6 C;  1SCV A;  1QV0 A;  2WOS A;  2K2A A;  2KGR A;  4M2P A;  1QVI Z;  2LLT A;  1G8I A;  3EKH A;  2LUC A;  4HRH A;  1XYD A;  4GGF C;  4HRE E;  2I2R E;  1J55 A;  3O6B A;  1YRU B;  2OS8 C;  2NZ0 A;  5AEQ A;  3SG7 A;  3TDU A;  3BYA A;  3ICB A;  1BU3 A;  2IS9 A;  2H61 A;  1CFP A;  1U5I A;  2LHL A;  3KEV A;  1G33 A;  1TRF A;  3ZNI A;  3I5I C;  1DJH A;  3I5H C;  4AQJ A;  3I5G B;  1Y1X A;  2Y1M A;  1A2X A;  1XFV O;  1KWO C;  5G08 A;  4AOM A;  3FIA A;  1JUO A;  4PE0 A;  5AER A;  1NPQ A;  5CSJ A;  2AMI A;  4MSP A;  2KNE A;  2BBN A;  4ETO A;  1DVI A;  5IBW A;  1B4C A;  2K2F A;  2QPT A;  5CSF A;  5I2L A;  3SG3 A;  2KBM A;  3DVM A;  1SBJ A;  2KQ6 A;  2KAY A;  1GQM A;  2TN4 A;  4I5J A;  3NXA A;  4FQO A;  5PAL A;  5K89 A;  1V1F A;  3GK1 A;  4QJ3 B;  2PRU A;  1S3P A;  2ZNE A;  1UP5 A;  2NXQ A;  2FJU B;  2BCX A;  1E8A A;  1CMG A;  2JT3 A;  1OMD A;  2LVJ A;  5ER5 A;  3AAK A;  4MEW A;  1K93 D;  4XJK A;  1TTX A;  1UUR A;  3KHE A;  1CM1 A;  2OPO A;  4DUQ A;  1A75 B;  2WCB A;  4GPL B;  1OQP A;  2ZN8 A;  4MBE A;  4GGN A;  2AAO A;  1QLK A;  1UHN A;  2KQY A;  2BE4 A;  1M39 A;  1TNQ A;  1MR8 A;  4CID A;  1TNX A;  4YI9 A;  1QVI Y;  1OSA A;  1KFX L;  1SL9 A;  1S5G Z;  4MZJ A;  4ORB B;  3HX4 A;  2GV5 A;  1ALW A;  3TS5 C;  2OTG C;  2V53 A;  5I8N A;  1CM4 A;  1DJW A;  1EG4 A;  4MN0 A;  4YRU A;  2BE6 A;  2F2P A;  1Y1A A;  2KYC A;  1PVB A;  2LAP A;  3NSI A;  1IJ6 A;  2BCA A;  1U5I B;  2LE9 B;  2LV7 A;  3PAT A;  3BUO B;  2KFF A;  3EVR A;  2E6W A;  3D0Y A;  1MHO A;  4YI8 A;  1ZOT B;  1XFU O;  4TNC A;  1NUB A;  4CFQ A;  2BL0 B;  5HLV A;  1J7P A;  1ZUZ A;  3O78 A;  4N1G A;  1NSH A;  2WCE A;  4MLW A;  3CR2 A;  1B8C A;  1BOD A;  1IWQ A;  1CKK A;  2HET A;  5CPV A;  1IRJ A;  1EXR A;  1WLZ A;  3HCM A;  2E30 A;  3SG6 A;  1SYM A;  3K21 A;  4F0Z B;  3M0W A;  1OMV A;  1IG5 A;  3VGO A;  2PVB A;  1NX3 A;  1SK6 D;  5HLO A;  2FCD A;  1L2O B;  2LNK A;  5CSI A;  1AHR A;  1SKT A;  2O60 A;  2G9B A;  2CBL A;  2Y4Q A;  1IH0 A;  2WC8 A;  3IQQ A;  2KBI A;  1XFW O;  1YVL A;  2JZI A;  1EG3 A;  2CCM A;  4N1F A;  1B47 A;  1KFU L;  5KU1 A;  1TIZ A;  3AAJ A;  2JUL A;  1V1G A;  1RFJ A;  1MUX A;  1YUS A;  2ZFD A;  1FPW A;  3SIB A;  1J1D A;  1LIN A;  1F4Q A;  2LP2 A;  1CTR A;  1OZO A;  2Q91 A;  4BY4 A;  4CPV A;  1JWD A;  5HKY A;  1XO5 A;  1DJG A;  1WY9 A;  3A8R A;  1DJX A;  1N2D A;  1DGU A;  1TOP A;  2LVI A;  5AAN A;  3DD4 A;  3BOW A;  2WCF A;  4YGC B;  1FI6 A;  2P6B B;  1L7Z A;  1S26 D;  1DT7 B;  2AUC A;  1QJT A;  1BLQ A;  2LUX A;  1S5G Y;  1DMO A;  3PFV A;  4OKH A;  3SG5 A;  2M1K B;  1SPY A;  2HF5 A;  1CFF A;  5ER4 X;  3FWB A;  5HYD A;  2KAX A;  3BUW B;  4I5L B;  2PAL A;  1CMF A;  2H61 C;  3VRR A;  4M2O A;  2LM5 A;  1GGZ A;  1CNP A;  1DJI A;  3PN7 B;  4WRI A;  1OZS A;  2LAN A;  1J7Q A;  4BY5 A;  1A4P A;  4QJ4 B;  1RK9 A;  1JC2 A;  2BL0 C;  2MLE C;  1PSR A;  5B8I B;  3SG4 A;  1Y6W A;  1KFX S;  1CLB A;  1PK0 D;  4PE7 A;  1SCM C;  2BEC A;  2G2B A;  2LC5 A;  1B8L A;  1CDP A;  2M1U A;  3D0Y B;  1DTL A;  3CGA A;  1GJY A;  3CTN A;  1H4B A;  1L2O C;  1CLM A;  1QX7 A;  2FCE A;  3PLF B;  2LVK A;  4NDD A;  4DCK A;  2L4H A;  3TDI A;  2K7O A;  4YGA A;  3BXK A;  2KFH A;  1YUT A;  2DOQ A;  2SAS A;  4ZCU A;  1YRT B;  3E3R A;  1DF0 A;  2KFG A;  2BCB A;  2F2O A;  2MLF C;  3RM1 A;  2M49 B;  4YGB B;  2ZKM X;  1CFD A;  1W7J B;  2JRF A;  1YVH A;  2SCP A;  2LLU A;  1MQ1 A;  2CXJ A;  1Q80 A;  2LP3 A;  4FTG A;  1TNW A;  1F8H A;  1F71 A;  1UUS A;  2GGZ A;  1YUU A;  1R6P A;  3CR5 X;  1W7I B;  2MJW B;  2EC6 B;  2R2I A;  1QIW A;  5HKW A;  1NCZ A;  1J7R A;  2O5G A;  1F55 A;  2F8P A;  1M46 A;  5GQQ C;  4PAL A;  1KFU S;  1R2U A;  1JFK A;  1CB1 A;  1XK4 A;  3BOW B;  1WRL A;  3EVV A;  1WRK A;  1BF5 A;  1CLL A;  1NWD A;  3LLE A;  2JNX A;  2F3Z A;  2MA2 A;  5HKZ A;  1XA5 A;  4GNK B;  4USL A;  5DKN A;  1DJY A;  2M29 A;  1M63 B;  2L5X B;  1YX7 A;  3I5G C;  1FF1 A;  3OB2 B;  4C0L A;  3LCP C;  1QLS A;  5I2O A;  3VRQ A;  3SG2 A;  1AVS A;  3CLN A;  1RTP 1;  4WQ2 A;  4ORC B;  5JJG A;  1OOJ A;  3SJS A;  1FW4 A;  4Q04 A;  3JTD B;  2KI6 D;  1SL8 A;  3OX6 A;  1TN4 A;  4AQI A;  2VRG A;  2M8U A;  1XVJ A;  1D1O A;  3BUX B;  2MAZ A;  4XYN A;  1PSB A;  2KHN A;  2Y5I A;  1C07 A;  3EK7 A;  4N5X A;  5AXI A;  3AKB A;  3KO0 A;  2KSP A;  2L50 A;  4PHN A;  1LXF C;  2M7L A;  4YGE B;  1CDM A;  2L0P A;  2EHB A;  1SR6 B;  5AFP A;  3NSL A;  1S6C A;  2RGI A;  4HRG A;  1ZMZ A;  2LVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...