2H61A

X-ray structure of human ca2+-loaded s100b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein, signaling protein
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 91
sequence length 91
chains with identical sequence B, E, F, H
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61A00
1JWDA 3TDIA 1KFXS 4YGAA 1JSAA 1NCZA 1G4YR 4I5LB 2LLSA 2M9GA 4IL1A 4UPGA 2KBIA 3KEVA 4YBHB 2BECA 2L51A 3HCMA 1F54A 4MSPA 1JFJA 1QV1A 1SPYA 3WNXB 2M1UA 4PE0A 2V53A 1NCXA 1Y0VH 1F4OA 1TIZA 1U5IB 5HKYA 2M8UA 2PRUA 3JTDC 4M2PA 2WCBA 3FWBA 2GGZA 4HSZA 4CFQA 1OMDA 2Q91A 4XJKB 1B4CA 3C1VA 1Y1AA 2BKHB 2PSRA 4OR9B 3PALA 1CNPA 1TNXA 1CTRA 4P2YB 5K89A 4CLNA 1N0YA 4JQ0D 4NDDA 2KQYA 4GBAA 4QJ5B 4MZJA 4YI9A 2M29A 4MZKA 1DJXA 2FJUB 1FW4A 3D10A 2Y1MA 5DKRA 1QTXA 1S36A 3BYAA 1RROA 2MHHA 2CTNA 3IQQA 1U5IA 1A29A 3CGAA 5DKNA 1FI5A 2K0JA 1K94A 1TNPA 4XJKA 4DIRA 2LUCA 2JNXA 1PULA 2PVBA 2H61A 1CMFA 2KNEA 1F55A 3CZTX 1CM1A 2JRFA 2KQ6A 2LVKA 1YR5A 3O6BA 1XK4A 1EL4A 4L9MA 2NCPA 2KOTA 2MLFC 1XVJA 4TNCA 1KQVA 1W7IB 2KFFA 1F8HA 2F8PA 2ZFDA 1SKTA 4PHJA 1L7ZA 2F2PA 1DF0B 2L0PA 1BG1A 3AKAA 4QJ3B 1A03A 2O60A 3CR4X 1B8LA 1TNWA 2I94A 4GGFC 5AFPA 3I5FC 1PK0D 2A4JA 1OMVA 2HQ8A 5HKWA 1SRAA 1QXPA 1GJYA 1IGVA 1MXEA 4YGEB 1AP4A 2ZRTA 2KI4C 3TZ1A 4PDZA 2LV7A 3AAKA 2KI4B 2QPTA 1IQ5A 2LMVA 1EH2A 3BQ3A 4JWQA 1MWNA 1W7JB 4CFRA 3AAJA 1NP8A 1PSRA 1SR6B 4PCWA 4NDBA 3VRNA 1SL7A 1EXRA 1S3PA 1DF0A 1KFUS 2PMYA 3CTNA 1NSHA 1QLSA 1M31A 2L98A 4ICBA 2KBMA 2ZKMX 4N1GA 3KF9A 2G2BA 2BL0C 3GK1A 1UWOA 3HX4A 3I5HC 3PSRA 1DJIA 1SNLA 3I5HB 1BODA 3DVMA 1WDCC 4YGDB 3EK8A 1IKUA 1SYMA 2JQ6A 2LCPA 1EG4A 2E6WA 3PN7C 1YX8A 2CCMA 2WC8A 1NUBA 3QRXA 1TNQA 4JPZB 3IQOA 1QS7A 2LLTA 2R2IA 3LCPC 5AERA 1M63B 4PHKA 1FBVA 4MBEA 5CSIA 4C0KA 3JVTC 2M7NA 3VROA 2IS9A 3SG4A 1LVCD 2M49B 2KYFA 2H2KA 1BT6A 3I5IB 4PHNA 1L2OC 2LLUA 5I2QA 1CFFA 1NWDA 2LVJA 1WY9A 2CBLA 1XFZO 2MBXA 1PALA 1FF1A 1DJYA 1NCYA 4PALA 1B7TZ 4GUKA 1QX2A 1OSAA 2L4HA 5AXIA 5KU1A 4M2QA 1NPQA 2CT9A 1J1EA 1RK9A 2JT3A 1XO5A 2NCOA 2EC6C 1NX0A 3IF7A 2LE9B 3LL8B 2BE6A 2KI6D 1AVSA 4MEWA 1SY9A 3BUMB 1UHNA 2JU0A 3SIBA 3VGOA 3JTDB 3FWCA 4OCIA 1TTXA 1TRFA 1QJTA 4BY5A 2NZ0A 2KFHA 2P6BB 1Y1XA 3D0YB 4ZCUA 3EVUA 3TDUA 2KHNA 2KAYA 1EG3A 1YTZC 2FCEA 2K7BA 1TCFA 1IJ6A 1J7OA 1CMGA 5AEQA 4CIDA 1B7TY 4GPLB 1K9KA 3DVJA 4ORCB 3SIAA 1YUSA 1NX1A 4CPVA 2M3WA 3O78A 2KSPA 2OS8C 4NDCA 1JF2A 2KI6C 1WRLA 3OX6A 2K7DA 2F3ZA 2JOJA 1CKKA 2E30A 1A4PA 4BY4A 2L2EA 1QVIY 2BBMA 1BF5A 5CPVA 2M1KB 3BUNB 4MRYA 3D0YA 4YRUA 4ORBB 2I2RE 1SL9A 1XFUO 1YRTB 1UURA 1ZUZA 3M0WA 5D7FA 3SG3A 2AMIA 1S6CA 1A75B 2HPSA 2M97A 3SG7A 1A2XA 1WLZA 1B8RA 2KYCA 2KAXA 5I8NA 1NX2A 2FCDA 2COLB 5GQQC 4FTGA 3DVEA 3OP0A 1WRKA 2K61A 3DF0B 1OZOA 2WCEA 3A4UB 1DJGA 1DT7B 4I5KA 5D69A 2LHIA 3TS5C 2JTTA 2VRGA 2KGRA 3I5FB 3OB2B 3DD4A 1FI6A 5B8IB 1OZSA 3GK4X 1KK8C 3F45A 5FYXA 2MRDA 5J3XA 1C07A 1CDNA 5F6TA 1XYDA 3EK7A 3TUYC 1TOPA 1DVIA 1BJFA 1OE9B 2M0RA 3VRQA 3TUYB 1CDMA 1R6PA 3CLNA 2K8MB 1B1GA 3PLFB 1QX7A 4N5XA 1SL8A 3BUXB 3CWGA 1J55A 4XYNA 2NXQA 1N2DA 4C0LA 1XA5A 2MJWB 3PM8A 4YI8A 3GK2A 1K8UA 1S26D 3WXAA 5JJGA 1GGZA 3NSIA 3OX5A 1SMGA 3KO0A 3DF0A 3NSKA 2NLNA 2EGDA 4GAOA 3WHUB 3WHTB 1CDLA 1M46A 3FIAA 1D1OA 1NX3A 2WNDA 1MF8B 4GGFA 4HRHA 1G33A 2BL0B 1K2HA 1JUOA 3A8RA 3OHMB 1PVBA 5HKZA 2FOTA 1QV0A 2G9BA 4DS7A 5ER4X 1WDCB 1QASA 2AAOA 1XFVO 3PN7B 4AQJA 3CR2A 4ETOA 1IJ5A 1CDPA 1JF0A 2OPOA 1SCVA 1KWOC 1LKJA 1EJ3A 2BE4A 2JXLA 1DTLA 4PHMA 1PVAA 5IBWA 3BOWB 4AQIA 1MUXA 2BBNA 4MVFA 3SG5A 3JVTB 2OTGC 2AUCA 1LXFC 4E68A 1KK7Y 3SG6A 1L2OB 2K7OA 1B9AA 4DCKA 5I2OA 2GGMA 4Q04A 1CFPA 1GGWA 1ZMZA 1B47A 2L50A 2RGIA 1ZACA 1SCMC 3PATA 2WORA 2BCXA 1BMOA 3E3RA 4F0ZB 1IG5A 3KHEA 1V1GA 2EC6B 1LA3A 2LAPA 2Y4QA 1YX7A 4YGCB 2WCFA 1QIWA 1QVIZ 1ZFSA 1BR1B 1K90D 1M45A 1OMRA 1N65A 3BOWA 3LK0A 1E8AA 2JT8A 1ODBA 1AUIB 2TN4A 1YUUA 1IH0A 2BKIB 1CLBA 1BLQA 2L5XB 1CLMA 4A4CA 1KFXL 2Q4UA 3EVVA 1MQ1A 3SJSA 1TN4A 1QIVA 1TCOB 3BUWB 3MSEB 1ALWA 5HLOA 1IRJA 5CSNA 1KQMC 2BCBA 1LINA 3FS7A 4PE7A 1KQMB 2JXCA 2M7LA 5KTYA 2K7CA 2SCPA 2ZRSA 3VRPA 4QJ4B 2K2AA 2ZN9A 4GGNA 2OS8B 1PRWA 1CFDA 1XFYO 2LMTA 3CS1A 4OV2A 4YGBB 1NYAA 1S6JA 4C0JA 1OQPA 4PE4A 5JOLA 2PASA 1DMOA 5BPJA 2BCAA 1OOJA 2H61C 1CM4A 2LVVA 5DKQA 2WOSA 3LLEA 2ISDA 1AJ5A 4D1EA 1GQMA 2LMUA 2I18A 4I5NB 1RECA 1S1EA 2KDHA 5I2LA 1K93D 1XK4C 2LP2A 3RLZA 1H4BA 1DJHA 1R2UA 3NXAA 1QATA 4GNKB 1QX5B 3ZNIA 1HT9A 1SW8A 2LUXA 4USLA 4HRGA 1K95A 4I5JA 2KGBC 1UHHA 1AK8A 1F71A 2ZN8A 2MLEC 1J7PA 1RTP1 2HETA 2JZIA 1VRKA 1RJVA 3GOFA 3VRRA 1F70A 1JFKA 1V1FA 2JT0A 1AHRA 2JWWA 1IQ3A 3RM1A 3PFVA 4U8DA 2LC5A 2LHLA 2QACA 1SBJA 3KPXA 3I5GC 4N1FA 2GV5A 1JBAA 1DGUA 2F3YA 1Y6WA 3I5GB 1M39A 2K2FA 2CXJA 3TS5B 1CB1A 1YUTA 2L4IA 3AKBA 4DRWA 1KSMA 2KFGA 2B1UA 1YVHA 2LNKA 1KK8B 1S5GZ 1WRZA 1YRUB 2JTZA 5ER5A 1Y1UA 3EK4A 3O2PA 3EVRA 2HQWA 1B8CA 2KAVA 3DVKA 1XFXO 1A75A 2O5GA 2DOQA 3LK1A 3H4SE 1MHOA 1UHIA 3CR5X 4R1EA 1Q80A 1BOCA 1KCYA 3NSLA 2PALA 1J1DA 1KK7Z 3BUOB 2JULA 4MN0A 4FQOA 4ZCVA 3EKJA 1QLKA 2Y5IA 2CNPA 4P5OE 2EHBA 1S6IA 1BU3A 1CLLA 5AANA 4AOMA 2ZNEA 4M2OA 2ZNDA 3BXKA 1DJZA 1F4QA 2D8NA 1ALVA 3K21A 2HF5A 5HLVA 2F2OA 1DJWA 1LA0A 1C7WA 2LM5A 1YURA 1X02A 5KSZA 1J7QA 3NSOA 2SASA 5CSFA 1UP5A 2LP3A 1JC2A 1J7RA 4WQ2A 1SR6C 1G8IA 1AJ4A 1K9UA 1KSOA 1S5GY 1BR4B 3ICBA 4WQ3A 2MA2A 5CSJA 3ZWHA 1UUSA 1RWYA 4PE1A 1XFWO 1KWOB 4MZLA 4A4BA 1MXLC 1K96A 1UHKA 2LVIA 2OTGB 1KFUL 1RFJA 1YVLA 5G08A 3OB1B 1DGVA 2Y1NA 2I7AA 5HYDA 1FPWA 1UHJA 4MLWA 2JNFA 4MRXA 2JPTA 4WRIA 4DUQA 1K9PA 4ORAB 3TDZA 1MR8A 5PALA 1SK6D 4GFTA 1WLMA 1SCMB 1H8BA 1IWQA 4HREE 1C7VA 3O4YA 4OVNF 2F33A 1HQVA 2LANA 3EKHA 3I5IC 5TNCA 3SG2A 1CFCA 4NQGA 4OKHA 1PSBA 2MAZA 2JC2A 1ZOTB 1NIWA
chains in the Genus database with same CATH superfamily
1Z4HA 3TDIA 1KFXS 1JWDA 4YGAA 1JSAA 1NCZA 1G4YR 4I5LB 2LLSA 2M9GA 4IL1A 4UPGA 2KBIA 4JKTA 3KEVA 4YBHB 2BECA 2L51A 3HCMA 1F54A 4MSPA 3FE8A 1JFJA 1QV1A 1SPYA 3Q8IA 3WNXB 2M1UA 4PE0A 3NHTA 2V53A 1NCXA 1Y0VH 1F4OA 1TIZA 5D3OA 1U5IB 5HKYA 2M8UA 2PRUA 2WC5A 1DELA 3JTDC 2WCBA 3FWBA 4M2PA 2GGZA 4HSZA 3PM2A 1OMDA 1OOGA 3DYEA 4CFQA 2Q91A 4XJKB 1B4CA 3C1VA 1Y1AA 2BKHB 2PSRA 4OR9B 2WCMA 3PALA 1CNPA 1TNXA 3QMEA 1CTRA 4P2YB 5K89A 4CLNA 1N0YA 4JQ0D 4NDDA 2KQYA 2L2CA 4GBAA 4QJ5B 4MZJA 4YI9A 2M29A 4MZKA 1DJXA 2FJUB 1FW4A 3B86A 3D10A 2Y1MA 5DKRA 1QTXA 1S36A 3BYAA 1RROA 2MHHA 5HL1A 2CTNA 3IQQA 1U5IA 1A29A 3CGAA 3K1EA 5DKNA 1FI5A 2K0JA 1K94A 1TNPA 4XJKA 4DIRA 2LUCA 2JNXA 1PULA 2PVBA 2H61A 1CMFA 2KNEA 1F55A 3CZTX 1CM1A 2JRFA 2KQ6A 2LVKA 1YR5A 3O6BA 1XK4A 1EL4A 3S0GA 4L9MA 2NCPA 2KOTA 2MLFC 1XVJA 4IJ7A 4TNCA 3CZ0A 1KQVA 1W7IB 2KFFA 2QEVA 1F8HA 2F8PA 2ZFDA 1SKTA 4PHJA 1L7ZA 2F2PA 1DF0B 1LS8A 1W9ZA 2L0PA 1BG1A 3AKAA 4QJ3B 1A03A 2O60A 3CR4X 1B8LA 1OOFA 1TNWA 2I94A 4GGFC 5AFPA 1ORGA 3I5FC 1PK0D 1OMVA 2A4JA 2HQ8A 5HKWA 1SRAA 1QXPA 1GJYA 1IGVA 1MXEA 4YGEB 1AP4A 2ZRTA 2KI4C 3FE6A 4PDZA 2LV7A 3TZ1A 3AAKA 2KI4B 2FJYA 3B88A 3S0EA 2QPTA 1IQ5A 2LMVA 1EH2A 3BQ3A 4JWQA 1MWNA 1W7JB 4CFRA 3AAJA 1NP8A 1C3ZA 1PSRA 1SR6B 2BNXA 4PCWA 4NDBA 3VRNA 1SL7A 1EXRA 1S3PA 1DF0A 1KFUS 2PMYA 3CTNA 1NSHA 1QLSA 1M31A 2L98A 2WCJA 4ICBA 2KBMA 2ZKMX 4N1GA 3KF9A 2G2BA 2BL0C 3GK1A 1UWOA 3HX4A 3I5HC 3PSRA 1DJIA 1SNLA 3I5HB 1BODA 3DVMA 1WDCC 4YGDB 3EK8A 1IKUA 1SYMA 2JQ6A 2LCPA 3BFHA 1EG4A 2E6WA 3PN7C 1YX8A 2CCMA 2WC8A 1NUBA 3QRXA 1TNQA 4JPZB 3IQOA 1QS7A 2GTEA 2LLTA 2R2IA 3LCPC 5AERA 1M63B 4PHKA 1FBVA 4MBEA 5CSIA 4C0KA 3JVTC 3O4XA 2M7NA 3VROA 2IS9A 3SG4A 1LVCD 2M49B 2KYFA 2H2KA 1BT6A 3I5IB 4PHNA 1L2OC 2LLUA 5I2QA 1CFFA 1NWDA 2LVJA 1WY9A 2CBLA 1XFZO 2MBXA 1PALA 1FF1A 1DMOA 1DJYA 1NCYA 4PALA 1B7TZ 4GUKA 1QX2A 3B6XA 3OBVA 1OSAA 2L4HA 5AXIA 5KU1A 4M2QA 1NPQA 2CT9A 1J1EA 1TUJA 1QWVA 1RK9A 2JT3A 1XO5A 2NCOA 2EC6C 3L4LA 1NX0A 3IF7A 2LE9B 3LL8B 2BE6A 2KI6D 1AVSA 4MEWA 1SY9A 3BUMB 1UHNA 2JU0A 3SIBA 3VGOA 3JTDB 3FWCA 4OCIA 1TTXA 1TRFA 1QJTA 3D73A 2KLDA 3R1PA 2NZ0A 2KFHA 2P6BB 1Y1XA 4BY5A 3D0YB 4ZCUA 3EVUA 3N7HA 5FI6A 3TDUA 2KHNA 2KAYA 1EG3A 2QDIA 1YTZC 2FCEA 3SS5A 3B87A 2K7BA 1TCFA 1OOHA 1IJ6A 1J7OA 3UNWA 5AEQA 1CMGA 4CIDA 1B7TY 4GPLB 1K9KA 3DVJA 4JD9A 4ORCB 3SIAA 1YUSA 1NX1A 4CPVA 2M3WA 3O78A 2KSPA 2OS8C 2PQLA 2K60A 4NDCA 1JF2A 2KI6C 3FE9A 1WRLA 3OX6A 2WC6A 2K7DA 2F3ZA 2JOJA 3RZSA 1CKKA 2E30A 1A4PA 3DY9A 4BY4A 2L2EA 1QVIY 2BBMA 1BF5A 5CPVA 2M1KB 3BUNB 4MRYA 3D0YA 3CZ2A 4YRUA 4ORBB 2I2RE 3B7AA 1SL9A 1XFUO 1YRTB 1UURA 1ZUZA 3M0WA 5D7FA 3SG3A 2AMIA 1S6CA 1A75B 2HPSA 2M97A 3SG7A 1A2XA 3V2LA 1WLZA 1B8RA 2KYCA 2KAXA 5I8NA 1NX2A 2FCDA 2COLB 5GQQC 4FTGA 3DVEA 3OP0A 1WRKA 2K61A 3DF0B 1OZOA 2WCEA 3A4UB 5EL2A 1DJGA 1DT7B 4I5KA 5D69A 2LHIA 3TS5C 2JTTA 1SSEB 1DEKA 2KGRA 2VRGA 3I5FB 3OB2B 3DD4A 1FI6A 5B8IB 1OZSA 3GK4X 1GM0A 1KK8C 3F45A 5FYXA 2MRDA 5J3XA 1C07A 3CDNA 5F6TA 1XYDA 3EK7A 3TUYC 1TOPA 1DVIA 1BJFA 1OE9B 2M0RA 3R1VA 3VRQA 1Z2CB 1CDMA 1R6PA 3CLNA 2K8MB 3TUYB 1B1GA 3PLFB 1QX7A 4N5XA 1SL8A 3BUXB 3CWGA 1J55A 4XYNA 5FI7A 2NXQA 3DXLA 1N2DA 4C0LA 1XA5A 2MJWB 3PM8A 4YI8A 3GK2A 1K8UA 4INXA 1S26D 3WXAA 1TUZA 2JPOA 2QEBA 5JJGA 1GGZA 3NSIA 3OX5A 2ERBA 1SMGA 3KO0A 3DF0A 3NSKA 2NLNA 2EGDA 4GAOA 3WHUB 3VB1A 1CDLA 1M46A 3FIAA 3WHTB 3S0FA 1D1OA 1NX3A 4FQTA 2WNDA 1MF8B 4GGFA 4HRHA 1G33A 3L47A 2BL0B 1K2HA 1JUOA 3A8RA 3OHMB 1PVBA 3CYZA 5HKZA 2FOTA 1QV0A 2G9BA 4DS7A 2P70A 5ER4X 1WDCB 1QASA 2AAOA 5DICA 1XFVO 4KYNA 3BFAA 3PN7B 4AQJA 1IIOA 3CR2A 4ETOA 1IJ5A 1CDPA 3D76A 1JF0A 2OPOA 1SCVA 1KWOC 1LKJA 1EJ3A 2BE4A 2JXLA 1DTLA 4PHMA 1PVAA 5IBWA 3BOWB 4AQIA 1MUXA 2BBNA 3DZTA 4MVFA 3SG5A 3JVTB 2OTGC 2AUCA 1LXFC 4E68A 1KK7Y 3SG6A 1L2OB 2K7OA 1B9AA 4DCKA 5I2OA 2GGMA 4Q04A 1CFPA 1GGWA 1ZMZA 1B47A 2L50A 2RGIA 1ZACA 1SCMC 3PATA 3PJIA 2WORA 2BCXA 1BMOA 3E3RA 4F0ZB 1IG5A 3KHEA 1V1GA 4INWA 3R1OA 2EC6B 1LA3A 2LAPA 2Y4QA 1YX7A 4YGCB 1DQEA 2WCFA 1QIWA 1QVIZ 1ZFSA 1BR1B 1K90D 1M45A 1OMRA 1N65A 3BOWA 3LK0A 1E8AA 2JT8A 1ODBA 1AUIB 2TN4A 1YUUA 3EG5B 2QEOA 2BKIB 1CLBA 2YGUA 2P71A 2L5XB 1BLQA 1CLMA 4A4CA 1IH0A 1KFXL 2Q4UA 3EVVA 1MQ1A 2KPHA 1OOIX 3SJSA 3CABA 1TN4A 1QIVA 1TCOB 3BUWB 3MSEB 3BJHA 2QEHA 1ALWA 5HLOA 1IRJA 5CSNA 1KQMC 2BCBA 1LINA 3FS7A 4PE7A 1KQMB 2JXCA 2M7LA 4F7FA 5KTYA 2K7CA 2SCPA 2ZRSA 3S0DA 3VRPA 4QJ4B 2K2AA 2ZN9A 4GGNA 2OS8B 1PRWA 1CFDA 1T14A 1XFYO 2LMTA 3CS1A 4OV2A 1NYAA 1S6JA 4YGBB 1OQPA 4PE4A 5JOLA 2PASA 4C0JA 5BPJA 1OOJA 2BCAA 2H61C 1CM4A 2LVVA 5DKQA 3SS3A 2WOSA 3LLEA 3D77A 1AJ5A 2ISDA 4D1EA 1GQMA 2LMUA 2I18A 4I5NB 1RECA 1S1EA 2KDHA 5I2LA 1K93D 1XK4C 2LP2A 3RLZA 1H4BA 1DJHA 1R2UA 3NXAA 1QATA 4GNKB 1QX5B 2WCLA 3ZNIA 1HT9A 1SW8A 2LUXA 3IVTA 4USLA 4HRGA 1K95A 1CDNA 4I5JA 2KGBC 1UHHA 1AK8A 1F71A 2ZN8A 2MLEC 1J7PA 1RTP1 2HETA 2JZIA 1VRKA 1RJVA 3GOFA 3VRRA 4OZDA 1F70A 1JFKA 1V1FA 2JT0A 1AHRA 2JWWA 1IQ3A 3RM1A 3D75A 3PFVA 3NGVA 4U8DA 2LC5A 2LHLA 2QACA 1SBJA 3KPXA 3I5GC 1TWOA 2GV5A 4N1FA 5FI2A 3UO9A 1JBAA 1DGUA 2F3YA 1Y6WA 3BFBA 3I5GB 1M39A 2K2FA 3CZ1A 1OW4A 2CXJA 3TS5B 1CB1A 1YUTA 2BAPA 2L4IA 3AKBA 4DRWA 1KSMA 2KFGA 2B1UA 1YVHA 2LNKA 1KK8B 1S5GZ 1WRZA 1YRUB 3L4AA 2JTZA 5ER5A 1Y1UA 3EK4A 3O2PA 1P28A 3EVRA 2HQWA 1B8CA 2KAVA 3DVKA 1XFXO 1A75A 2O5GA 2DOQA 3LK1A 3H4SE 1MHOA 1UHIA 3CR5X 4R1EA 1Q80A 3S0AA 1C3YA 1BOCA 3NSLA 1KCYA 2PALA 1J1DA 1KK7Z 3BUOB 2KLEA 2JULA 4MN0A 2WCKA 3S0BA 4FQOA 4ZCVA 3EKJA 1QLKA 2Y5IA 2CNPA 4P5OE 2PYQA 2EHBA 1S6IA 1BU3A 1CLLA 2L5YA 5AANA 4AOMA 2WCHA 3D74A 2ZNEA 4M2OA 2ZNDA 3BXKA 1DJZA 3OGNA 1F4QA 2D8NA 1ALVA 3NHIA 3K21A 2HF5A 5HLVA 2F2OA 1DJWA 1LA0A 1C7WA 2LM5A 1YURA 1X02A 5KSZA 1J7QA 3NSOA 2SASA 5CSFA 1UP5A 2LP3A 1XFRA 1JC2A 1J7RA 4WQ2A 1SR6C 1G8IA 1AJ4A 1K9UA 1KSOA 1S5GY 1BR4B 3ICBA 3R72A 2MA2A 4WQ3A 5CSJA 3ZWHA 1UUSA 5I94A 1RWYA 4PE1A 1XFWO 1KWOB 4MZLA 4A4BA 1MXLC 1K96A 1UHKA 3D78A 2LVIA 2OTGB 1KFUL 1RFJA 1YVLA 5G08A 3OB1B 1DGVA 2Y1NA 2I7AA 5HYDA 1FPWA 1UHJA 4MLWA 2JNFA 4MRXA 2JPTA 4WRIA 2H8VA 1K9PA 4DUQA 4ORAB 3TDZA 1MR8A 4PT1A 5PALA 1SK6D 4GFTA 1WLMA 1SCMB 1H8BA 1IWQA 4HREE 1C7VA 3O4YA 4OVNF 2F33A 3SS4A 1HQVA 2LANA 3EKHA 3I5IC 5TNCA 3SG2A 1CFCA 1DC1A 4NQGA 4OKHA 1PSBA 2MAZA 2JC2A 1ZOTB 1NIWA
chains in the Genus database with same CATH topology
1JWDA 3TDIA 1KFXS 4YGAA 1JSAA 1NCZA 1G4YR 4I5LB 2LLSA 2M9GA 4IL1A 4UPGA 2KBIA 3KEVA 4YBHB 2BECA 2L51A 3HCMA 1F54A 4MSPA 1JFJA 1QV1A 1SPYA 3WNXB 2M1UA 4PE0A 2V53A 1NCXA 1Y0VH 1F4OA 1TIZA 1U5IB 5HKYA 2M8UA 2PRUA 3JTDC 4M2PA 2WCBA 3FWBA 2GGZA 4HSZA 4CFQA 1OMDA 2Q91A 4XJKB 1B4CA 3C1VA 1Y1AA 2BKHB 2PSRA 4OR9B 3PALA 1CNPA 1TNXA 1CTRA 4P2YB 5K89A 4CLNA 1N0YA 4JQ0D 4NDDA 2KQYA 4GBAA 4QJ5B 4MZJA 4YI9A 2M29A 4MZKA 1DJXA 2FJUB 1FW4A 3D10A 2Y1MA 5DKRA 1QTXA 1S36A 3BYAA 1RROA 2MHHA 2CTNA 3IQQA 1U5IA 1A29A 3CGAA 5DKNA 1FI5A 2K0JA 1K94A 1TNPA 4XJKA 4DIRA 2LUCA 2JNXA 1PULA 2PVBA 2H61A 1CMFA 2KNEA 1F55A 3CZTX 1CM1A 2JRFA 2KQ6A 2LVKA 1YR5A 3O6BA 1XK4A 1EL4A 4L9MA 2NCPA 2KOTA 2MLFC 1XVJA 4TNCA 1KQVA 1W7IB 2KFFA 1F8HA 2F8PA 2ZFDA 1SKTA 4PHJA 1L7ZA 2F2PA 1DF0B 2L0PA 1BG1A 3AKAA 4QJ3B 1A03A 2O60A 3CR4X 1B8LA 1TNWA 2I94A 4GGFC 5AFPA 3I5FC 1PK0D 2A4JA 1OMVA 2HQ8A 5HKWA 1SRAA 1QXPA 1GJYA 1IGVA 1MXEA 4YGEB 1AP4A 2ZRTA 2KI4C 3TZ1A 4PDZA 2LV7A 3AAKA 2KI4B 2QPTA 1IQ5A 2LMVA 1EH2A 3BQ3A 4JWQA 1MWNA 1W7JB 4CFRA 3AAJA 1NP8A 1PSRA 1SR6B 4PCWA 4NDBA 3VRNA 1SL7A 1EXRA 1S3PA 1DF0A 1KFUS 2PMYA 3CTNA 1NSHA 1QLSA 1M31A 2L98A 4ICBA 2KBMA 2ZKMX 4N1GA 3KF9A 2G2BA 2BL0C 3GK1A 1UWOA 3HX4A 3I5HC 3PSRA 1DJIA 1SNLA 3I5HB 1BODA 3DVMA 1WDCC 4YGDB 3EK8A 1IKUA 1SYMA 2JQ6A 2LCPA 1EG4A 2E6WA 3PN7C 1YX8A 2CCMA 2WC8A 1NUBA 3QRXA 1TNQA 4JPZB 3IQOA 1QS7A 2LLTA 2R2IA 3LCPC 5AERA 1M63B 4PHKA 1FBVA 4MBEA 5CSIA 4C0KA 3JVTC 2M7NA 3VROA 2IS9A 3SG4A 1LVCD 2M49B 2KYFA 2H2KA 1BT6A 3I5IB 4PHNA 1L2OC 2LLUA 5I2QA 1CFFA 1NWDA 2LVJA 1WY9A 2CBLA 1XFZO 2MBXA 1PALA 1FF1A 1DJYA 1NCYA 4PALA 1B7TZ 4GUKA 1QX2A 1OSAA 2L4HA 5AXIA 5KU1A 4M2QA 1NPQA 2CT9A 1J1EA 1RK9A 2JT3A 1XO5A 2NCOA 2EC6C 1NX0A 3IF7A 2LE9B 3LL8B 2BE6A 2KI6D 1AVSA 4MEWA 1SY9A 3BUMB 1UHNA 2JU0A 3SIBA 3VGOA 3JTDB 3FWCA 4OCIA 1TTXA 1TRFA 1QJTA 4BY5A 2NZ0A 2KFHA 2P6BB 1Y1XA 3D0YB 4ZCUA 3EVUA 3TDUA 2KHNA 2KAYA 1EG3A 1YTZC 2FCEA 2K7BA 1TCFA 1IJ6A 1J7OA 1CMGA 5AEQA 4CIDA 1B7TY 4GPLB 1K9KA 3DVJA 4ORCB 3SIAA 1YUSA 1NX1A 4CPVA 2M3WA 3O78A 2KSPA 2OS8C 4NDCA 1JF2A 2KI6C 1WRLA 3OX6A 2K7DA 2F3ZA 2JOJA 1CKKA 2E30A 1A4PA 4BY4A 2L2EA 1QVIY 2BBMA 1BF5A 5CPVA 2M1KB 3BUNB 4MRYA 3D0YA 4YRUA 4ORBB 2I2RE 1SL9A 1XFUO 1YRTB 1UURA 1ZUZA 3M0WA 5D7FA 3SG3A 2AMIA 1S6CA 1A75B 2HPSA 2M97A 3SG7A 1A2XA 1WLZA 1B8RA 2KYCA 2KAXA 5I8NA 1NX2A 2FCDA 2COLB 5GQQC 4FTGA 3DVEA 3OP0A 1WRKA 2K61A 3DF0B 1OZOA 2WCEA 3A4UB 1DJGA 1DT7B 4I5KA 5D69A 2LHIA 3TS5C 2JTTA 2VRGA 2KGRA 3I5FB 3OB2B 3DD4A 1FI6A 5B8IB 1OZSA 3GK4X 1KK8C 3F45A 5FYXA 2MRDA 5J3XA 1C07A 1CDNA 5F6TA 1XYDA 3EK7A 3TUYC 1TOPA 1DVIA 1BJFA 1OE9B 2M0RA 3VRQA 3TUYB 1CDMA 1R6PA 3CLNA 2K8MB 1B1GA 3PLFB 1QX7A 4N5XA 1SL8A 3BUXB 3CWGA 1J55A 4XYNA 2NXQA 1N2DA 4C0LA 1XA5A 2MJWB 3PM8A 4YI8A 3GK2A 1K8UA 1S26D 3WXAA 5JJGA 1GGZA 3NSIA 3OX5A 1SMGA 3KO0A 3DF0A 3NSKA 2NLNA 2EGDA 4GAOA 3WHUB 3WHTB 1CDLA 1M46A 3FIAA 1D1OA 1NX3A 2WNDA 1MF8B 4GGFA 4HRHA 1G33A 2BL0B 1K2HA 1JUOA 3A8RA 3OHMB 1PVBA 5HKZA 2FOTA 1QV0A 2G9BA 4DS7A 5ER4X 1WDCB 1QASA 2AAOA 1XFVO 3PN7B 4AQJA 3CR2A 4ETOA 1IJ5A 1CDPA 1JF0A 2OPOA 1SCVA 1KWOC 1LKJA 1EJ3A 2BE4A 2JXLA 1DTLA 4PHMA 1PVAA 5IBWA 3BOWB 4AQIA 1MUXA 2BBNA 4MVFA 3SG5A 3JVTB 2OTGC 2AUCA 1LXFC 4E68A 1KK7Y 3SG6A 1L2OB 2K7OA 1B9AA 4DCKA 5I2OA 2GGMA 4Q04A 1CFPA 1GGWA 1ZMZA 1B47A 2L50A 2RGIA 1ZACA 1SCMC 3PATA 2WORA 2BCXA 1BMOA 3E3RA 4F0ZB 1IG5A 3KHEA 1V1GA 2EC6B 1LA3A 2LAPA 2Y4QA 1YX7A 4YGCB 2WCFA 1QIWA 1QVIZ 1ZFSA 1BR1B 1K90D 1M45A 1OMRA 1N65A 3BOWA 3LK0A 1E8AA 2JT8A 1ODBA 1AUIB 2TN4A 1YUUA 1IH0A 2BKIB 1CLBA 1BLQA 2L5XB 1CLMA 4A4CA 1KFXL 2Q4UA 3EVVA 1MQ1A 3SJSA 1TN4A 1QIVA 1TCOB 3BUWB 3MSEB 1ALWA 5HLOA 1IRJA 5CSNA 1KQMC 2BCBA 1LINA 3FS7A 4PE7A 1KQMB 2JXCA 2M7LA 5KTYA 2K7CA 2SCPA 2ZRSA 3VRPA 4QJ4B 2K2AA 2ZN9A 4GGNA 2OS8B 1PRWA 1CFDA 1XFYO 2LMTA 3CS1A 4OV2A 4YGBB 1NYAA 1S6JA 4C0JA 1OQPA 4PE4A 5JOLA 2PASA 1DMOA 5BPJA 2BCAA 1OOJA 2H61C 1CM4A 2LVVA 5DKQA 2WOSA 3LLEA 2ISDA 1AJ5A 4D1EA 1GQMA 2LMUA 2I18A 4I5NB 1RECA 1S1EA 2KDHA 5I2LA 1K93D 1XK4C 2LP2A 3RLZA 1H4BA 1DJHA 1R2UA 3NXAA 1QATA 4GNKB 1QX5B 3ZNIA 1HT9A 1SW8A 2LUXA 4USLA 4HRGA 1K95A 4I5JA 2KGBC 1UHHA 1AK8A 1F71A 2ZN8A 2MLEC 1J7PA 1RTP1 2HETA 2JZIA 1VRKA 1RJVA 3GOFA 3VRRA 1F70A 1JFKA 1V1FA 2JT0A 1AHRA 2JWWA 1IQ3A 3RM1A 3PFVA 4U8DA 2LC5A 2LHLA 2QACA 1SBJA 3KPXA 3I5GC 4N1FA 2GV5A 1JBAA 1DGUA 2F3YA 1Y6WA 3I5GB 1M39A 2K2FA 2CXJA 3TS5B 1CB1A 1YUTA 2L4IA 3AKBA 4DRWA 1KSMA 2KFGA 2B1UA 1YVHA 2LNKA 1KK8B 1S5GZ 1WRZA 1YRUB 2JTZA 5ER5A 1Y1UA 3EK4A 3O2PA 3EVRA 2HQWA 1B8CA 2KAVA 3DVKA 1XFXO 1A75A 2O5GA 2DOQA 3LK1A 3H4SE 1MHOA 1UHIA 3CR5X 4R1EA 1Q80A 1BOCA 1KCYA 3NSLA 2PALA 1J1DA 1KK7Z 3BUOB 2JULA 4MN0A 4FQOA 4ZCVA 3EKJA 1QLKA 2Y5IA 2CNPA 4P5OE 2EHBA 1S6IA 1BU3A 1CLLA 5AANA 4AOMA 2ZNEA 4M2OA 2ZNDA 3BXKA 1DJZA 1F4QA 2D8NA 1ALVA 3K21A 2HF5A 5HLVA 2F2OA 1DJWA 1LA0A 1C7WA 2LM5A 1YURA 1X02A 5KSZA 1J7QA 3NSOA 2SASA 5CSFA 1UP5A 2LP3A 1JC2A 1J7RA 4WQ2A 1SR6C 1G8IA 1AJ4A 1K9UA 1KSOA 1S5GY 1BR4B 3ICBA 4WQ3A 2MA2A 5CSJA 3ZWHA 1UUSA 1RWYA 4PE1A 1XFWO 1KWOB 4MZLA 4A4BA 1MXLC 1K96A 1UHKA 2LVIA 2OTGB 1KFUL 1RFJA 1YVLA 5G08A 3OB1B 1DGVA 2Y1NA 2I7AA 5HYDA 1FPWA 1UHJA 4MLWA 2JNFA 4MRXA 2JPTA 4WRIA 4DUQA 1K9PA 4ORAB 3TDZA 1MR8A 5PALA 1SK6D 4GFTA 1WLMA 1SCMB 1H8BA 1IWQA 4HREE 1C7VA 3O4YA 4OVNF 2F33A 1HQVA 2LANA 3EKHA 3I5IC 5TNCA 3SG2A 1CFCA 4NQGA 4OKHA 1PSBA 2MAZA 2JC2A 1ZOTB 1NIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWD A;  3TDI A;  1KFX S;  4YGA A;  1JSA A;  1NCZ A;  1G4Y R;  4I5L B;  2LLS A;  2M9G A;  4IL1 A;  4UPG A;  2KBI A;  3KEV A;  4YBH B;  2BEC A;  2L51 A;  3HCM A;  1F54 A;  4MSP A;  1JFJ A;  1QV1 A;  1SPY A;  3WNX B;  2M1U A;  4PE0 A;  2V53 A;  1NCX A;  1Y0V H;  1F4O A;  1TIZ A;  1U5I B;  5HKY A;  2M8U A;  2PRU A;  3JTD C;  4M2P A;  2WCB A;  3FWB A;  2GGZ A;  4HSZ A;  4CFQ A;  1OMD A;  2Q91 A;  4XJK B;  1B4C A;  3C1V A;  1Y1A A;  2BKH B;  2PSR A;  4OR9 B;  3PAL A;  1CNP A;  1TNX A;  1CTR A;  4P2Y B;  5K89 A;  4CLN A;  1N0Y A;  4JQ0 D;  4NDD A;  2KQY A;  4GBA A;  4QJ5 B;  4MZJ A;  4YI9 A;  2M29 A;  4MZK A;  1DJX A;  2FJU B;  1FW4 A;  3D10 A;  2Y1M A;  5DKR A;  1QTX A;  1S36 A;  3BYA A;  1RRO A;  2MHH A;  2CTN A;  3IQQ A;  1U5I A;  1A29 A;  3CGA A;  5DKN A;  1FI5 A;  2K0J A;  1K94 A;  1TNP A;  4XJK A;  4DIR A;  2LUC A;  2JNX A;  1PUL A;  2PVB A;  2H61 A;  1CMF A;  2KNE A;  1F55 A;  3CZT X;  1CM1 A;  2JRF A;  2KQ6 A;  2LVK A;  1YR5 A;  3O6B A;  1XK4 A;  1EL4 A;  4L9M A;  2NCP A;  2KOT A;  2MLF C;  1XVJ A;  4TNC A;  1KQV A;  1W7I B;  2KFF A;  1F8H A;  2F8P A;  2ZFD A;  1SKT A;  4PHJ A;  1L7Z A;  2F2P A;  1DF0 B;  2L0P A;  1BG1 A;  3AKA A;  4QJ3 B;  1A03 A;  2O60 A;  3CR4 X;  1B8L A;  1TNW A;  2I94 A;  4GGF C;  5AFP A;  3I5F C;  1PK0 D;  2A4J A;  1OMV A;  2HQ8 A;  5HKW A;  1SRA A;  1QXP A;  1GJY A;  1IGV A;  1MXE A;  4YGE B;  1AP4 A;  2ZRT A;  2KI4 C;  3TZ1 A;  4PDZ A;  2LV7 A;  3AAK A;  2KI4 B;  2QPT A;  1IQ5 A;  2LMV A;  1EH2 A;  3BQ3 A;  4JWQ A;  1MWN A;  1W7J B;  4CFR A;  3AAJ A;  1NP8 A;  1PSR A;  1SR6 B;  4PCW A;  4NDB A;  3VRN A;  1SL7 A;  1EXR A;  1S3P A;  1DF0 A;  1KFU S;  2PMY A;  3CTN A;  1NSH A;  1QLS A;  1M31 A;  2L98 A;  4ICB A;  2KBM A;  2ZKM X;  4N1G A;  3KF9 A;  2G2B A;  2BL0 C;  3GK1 A;  1UWO A;  3HX4 A;  3I5H C;  3PSR A;  1DJI A;  1SNL A;  3I5H B;  1BOD A;  3DVM A;  1WDC C;  4YGD B;  3EK8 A;  1IKU A;  1SYM A;  2JQ6 A;  2LCP A;  1EG4 A;  2E6W A;  3PN7 C;  1YX8 A;  2CCM A;  2WC8 A;  1NUB A;  3QRX A;  1TNQ A;  4JPZ B;  3IQO A;  1QS7 A;  2LLT A;  2R2I A;  3LCP C;  5AER A;  1M63 B;  4PHK A;  1FBV A;  4MBE A;  5CSI A;  4C0K A;  3JVT C;  2M7N A;  3VRO A;  2IS9 A;  3SG4 A;  1LVC D;  2M49 B;  2KYF A;  2H2K A;  1BT6 A;  3I5I B;  4PHN A;  1L2O C;  2LLU A;  5I2Q A;  1CFF A;  1NWD A;  2LVJ A;  1WY9 A;  2CBL A;  1XFZ O;  2MBX A;  1PAL A;  1FF1 A;  1DJY A;  1NCY A;  4PAL A;  1B7T Z;  4GUK A;  1QX2 A;  1OSA A;  2L4H A;  5AXI A;  5KU1 A;  4M2Q A;  1NPQ A;  2CT9 A;  1J1E A;  1RK9 A;  2JT3 A;  1XO5 A;  2NCO A;  2EC6 C;  1NX0 A;  3IF7 A;  2LE9 B;  3LL8 B;  2BE6 A;  2KI6 D;  1AVS A;  4MEW A;  1SY9 A;  3BUM B;  1UHN A;  2JU0 A;  3SIB A;  3VGO A;  3JTD B;  3FWC A;  4OCI A;  1TTX A;  1TRF A;  1QJT A;  4BY5 A;  2NZ0 A;  2KFH A;  2P6B B;  1Y1X A;  3D0Y B;  4ZCU A;  3EVU A;  3TDU A;  2KHN A;  2KAY A;  1EG3 A;  1YTZ C;  2FCE A;  2K7B A;  1TCF A;  1IJ6 A;  1J7O A;  1CMG A;  5AEQ A;  4CID A;  1B7T Y;  4GPL B;  1K9K A;  3DVJ A;  4ORC B;  3SIA A;  1YUS A;  1NX1 A;  4CPV A;  2M3W A;  3O78 A;  2KSP A;  2OS8 C;  4NDC A;  1JF2 A;  2KI6 C;  1WRL A;  3OX6 A;  2K7D A;  2F3Z A;  2JOJ A;  1CKK A;  2E30 A;  1A4P A;  4BY4 A;  2L2E A;  1QVI Y;  2BBM A;  1BF5 A;  5CPV A;  2M1K B;  3BUN B;  4MRY A;  3D0Y A;  4YRU A;  4ORB B;  2I2R E;  1SL9 A;  1XFU O;  1YRT B;  1UUR A;  1ZUZ A;  3M0W A;  5D7F A;  3SG3 A;  2AMI A;  1S6C A;  1A75 B;  2HPS A;  2M97 A;  3SG7 A;  1A2X A;  1WLZ A;  1B8R A;  2KYC A;  2KAX A;  5I8N A;  1NX2 A;  2FCD A;  2COL B;  5GQQ C;  4FTG A;  3DVE A;  3OP0 A;  1WRK A;  2K61 A;  3DF0 B;  1OZO A;  2WCE A;  3A4U B;  1DJG A;  1DT7 B;  4I5K A;  5D69 A;  2LHI A;  3TS5 C;  2JTT A;  2VRG A;  2KGR A;  3I5F B;  3OB2 B;  3DD4 A;  1FI6 A;  5B8I B;  1OZS A;  3GK4 X;  1KK8 C;  3F45 A;  5FYX A;  2MRD A;  5J3X A;  1C07 A;  1CDN A;  5F6T A;  1XYD A;  3EK7 A;  3TUY C;  1TOP A;  1DVI A;  1BJF A;  1OE9 B;  2M0R A;  3VRQ A;  3TUY B;  1CDM A;  1R6P A;  3CLN A;  2K8M B;  1B1G A;  3PLF B;  1QX7 A;  4N5X A;  1SL8 A;  3BUX B;  3CWG A;  1J55 A;  4XYN A;  2NXQ A;  1N2D A;  4C0L A;  1XA5 A;  2MJW B;  3PM8 A;  4YI8 A;  3GK2 A;  1K8U A;  1S26 D;  3WXA A;  5JJG A;  1GGZ A;  3NSI A;  3OX5 A;  1SMG A;  3KO0 A;  3DF0 A;  3NSK A;  2NLN A;  2EGD A;  4GAO A;  3WHU B;  3WHT B;  1CDL A;  1M46 A;  3FIA A;  1D1O A;  1NX3 A;  2WND A;  1MF8 B;  4GGF A;  4HRH A;  1G33 A;  2BL0 B;  1K2H A;  1JUO A;  3A8R A;  3OHM B;  1PVB A;  5HKZ A;  2FOT A;  1QV0 A;  2G9B A;  4DS7 A;  5ER4 X;  1WDC B;  1QAS A;  2AAO A;  1XFV O;  3PN7 B;  4AQJ A;  3CR2 A;  4ETO A;  1IJ5 A;  1CDP A;  1JF0 A;  2OPO A;  1SCV A;  1KWO C;  1LKJ A;  1EJ3 A;  2BE4 A;  2JXL A;  1DTL A;  4PHM A;  1PVA A;  5IBW A;  3BOW B;  4AQI A;  1MUX A;  2BBN A;  4MVF A;  3SG5 A;  3JVT B;  2OTG C;  2AUC A;  1LXF C;  4E68 A;  1KK7 Y;  3SG6 A;  1L2O B;  2K7O A;  1B9A A;  4DCK A;  5I2O A;  2GGM A;  4Q04 A;  1CFP A;  1GGW A;  1ZMZ A;  1B47 A;  2L50 A;  2RGI A;  1ZAC A;  1SCM C;  3PAT A;  2WOR A;  2BCX A;  1BMO A;  3E3R A;  4F0Z B;  1IG5 A;  3KHE A;  1V1G A;  2EC6 B;  1LA3 A;  2LAP A;  2Y4Q A;  1YX7 A;  4YGC B;  2WCF A;  1QIW A;  1QVI Z;  1ZFS A;  1BR1 B;  1K90 D;  1M45 A;  1OMR A;  1N65 A;  3BOW A;  3LK0 A;  1E8A A;  2JT8 A;  1ODB A;  1AUI B;  2TN4 A;  1YUU A;  1IH0 A;  2BKI B;  1CLB A;  1BLQ A;  2L5X B;  1CLM A;  4A4C A;  1KFX L;  2Q4U A;  3EVV A;  1MQ1 A;  3SJS A;  1TN4 A;  1QIV A;  1TCO B;  3BUW B;  3MSE B;  1ALW A;  5HLO A;  1IRJ A;  5CSN A;  1KQM C;  2BCB A;  1LIN A;  3FS7 A;  4PE7 A;  1KQM B;  2JXC A;  2M7L A;  5KTY A;  2K7C A;  2SCP A;  2ZRS A;  3VRP A;  4QJ4 B;  2K2A A;  2ZN9 A;  4GGN A;  2OS8 B;  1PRW A;  1CFD A;  1XFY O;  2LMT A;  3CS1 A;  4OV2 A;  4YGB B;  1NYA A;  1S6J A;  4C0J A;  1OQP A;  4PE4 A;  5JOL A;  2PAS A;  1DMO A;  5BPJ A;  2BCA A;  1OOJ A;  2H61 C;  1CM4 A;  2LVV A;  5DKQ A;  2WOS A;  3LLE A;  2ISD A;  1AJ5 A;  4D1E A;  1GQM A;  2LMU A;  2I18 A;  4I5N B;  1REC A;  1S1E A;  2KDH A;  5I2L A;  1K93 D;  1XK4 C;  2LP2 A;  3RLZ A;  1H4B A;  1DJH A;  1R2U A;  3NXA A;  1QAT A;  4GNK B;  1QX5 B;  3ZNI A;  1HT9 A;  1SW8 A;  2LUX A;  4USL A;  4HRG A;  1K95 A;  4I5J A;  2KGB C;  1UHH A;  1AK8 A;  1F71 A;  2ZN8 A;  2MLE C;  1J7P A;  1RTP 1;  2HET A;  2JZI A;  1VRK A;  1RJV A;  3GOF A;  3VRR A;  1F70 A;  1JFK A;  1V1F A;  2JT0 A;  1AHR A;  2JWW A;  1IQ3 A;  3RM1 A;  3PFV A;  4U8D A;  2LC5 A;  2LHL A;  2QAC A;  1SBJ A;  3KPX A;  3I5G C;  4N1F A;  2GV5 A;  1JBA A;  1DGU A;  2F3Y A;  1Y6W A;  3I5G B;  1M39 A;  2K2F A;  2CXJ A;  3TS5 B;  1CB1 A;  1YUT A;  2L4I A;  3AKB A;  4DRW A;  1KSM A;  2KFG A;  2B1U A;  1YVH A;  2LNK A;  1KK8 B;  1S5G Z;  1WRZ A;  1YRU B;  2JTZ A;  5ER5 A;  1Y1U A;  3EK4 A;  3O2P A;  3EVR A;  2HQW A;  1B8C A;  2KAV A;  3DVK A;  1XFX O;  1A75 A;  2O5G A;  2DOQ A;  3LK1 A;  3H4S E;  1MHO A;  1UHI A;  3CR5 X;  4R1E A;  1Q80 A;  1BOC A;  1KCY A;  3NSL A;  2PAL A;  1J1D A;  1KK7 Z;  3BUO B;  2JUL A;  4MN0 A;  4FQO A;  4ZCV A;  3EKJ A;  1QLK A;  2Y5I A;  2CNP A;  4P5O E;  2EHB A;  1S6I A;  1BU3 A;  1CLL A;  5AAN A;  4AOM A;  2ZNE A;  4M2O A;  2ZND A;  3BXK A;  1DJZ A;  1F4Q A;  2D8N A;  1ALV A;  3K21 A;  2HF5 A;  5HLV A;  2F2O A;  1DJW A;  1LA0 A;  1C7W A;  2LM5 A;  1YUR A;  1X02 A;  5KSZ A;  1J7Q A;  3NSO A;  2SAS A;  5CSF A;  1UP5 A;  2LP3 A;  1JC2 A;  1J7R A;  4WQ2 A;  1SR6 C;  1G8I A;  1AJ4 A;  1K9U A;  1KSO A;  1S5G Y;  1BR4 B;  3ICB A;  4WQ3 A;  2MA2 A;  5CSJ A;  3ZWH A;  1UUS A;  1RWY A;  4PE1 A;  1XFW O;  1KWO B;  4MZL A;  4A4B A;  1MXL C;  1K96 A;  1UHK A;  2LVI A;  2OTG B;  1KFU L;  1RFJ A;  1YVL A;  5G08 A;  3OB1 B;  1DGV A;  2Y1N A;  2I7A A;  5HYD A;  1FPW A;  1UHJ A;  4MLW A;  2JNF A;  4MRX A;  2JPT A;  4WRI A;  4DUQ A;  1K9P A;  4ORA B;  3TDZ A;  1MR8 A;  5PAL A;  1SK6 D;  4GFT A;  1WLM A;  1SCM B;  1H8B A;  1IWQ A;  4HRE E;  1C7V A;  3O4Y A;  4OVN F;  2F33 A;  1HQV A;  2LAN A;  3EKH A;  3I5I C;  5TNC A;  3SG2 A;  1CFC A;  4NQG A;  4OKH A;  1PSB A;  2MAZ A;  2JC2 A;  1ZOT B;  1NIW A; 
#chains in the Genus database with same CATH topology
 1Z4H A;  3TDI A;  1KFX S;  1JWD A;  4YGA A;  1JSA A;  1NCZ A;  1G4Y R;  4I5L B;  2LLS A;  2M9G A;  4IL1 A;  4UPG A;  2KBI A;  4JKT A;  3KEV A;  4YBH B;  2BEC A;  2L51 A;  3HCM A;  1F54 A;  4MSP A;  3FE8 A;  1JFJ A;  1QV1 A;  1SPY A;  3Q8I A;  3WNX B;  2M1U A;  4PE0 A;  3NHT A;  2V53 A;  1NCX A;  1Y0V H;  1F4O A;  1TIZ A;  5D3O A;  1U5I B;  5HKY A;  2M8U A;  2PRU A;  2WC5 A;  1DEL A;  3JTD C;  2WCB A;  3FWB A;  4M2P A;  2GGZ A;  4HSZ A;  3PM2 A;  1OMD A;  1OOG A;  3DYE A;  4CFQ A;  2Q91 A;  4XJK B;  1B4C A;  3C1V A;  1Y1A A;  2BKH B;  2PSR A;  4OR9 B;  2WCM A;  3PAL A;  1CNP A;  1TNX A;  3QME A;  1CTR A;  4P2Y B;  5K89 A;  4CLN A;  1N0Y A;  4JQ0 D;  4NDD A;  2KQY A;  2L2C A;  4GBA A;  4QJ5 B;  4MZJ A;  4YI9 A;  2M29 A;  4MZK A;  1DJX A;  2FJU B;  1FW4 A;  3B86 A;  3D10 A;  2Y1M A;  5DKR A;  1QTX A;  1S36 A;  3BYA A;  1RRO A;  2MHH A;  5HL1 A;  2CTN A;  3IQQ A;  1U5I A;  1A29 A;  3CGA A;  3K1E A;  5DKN A;  1FI5 A;  2K0J A;  1K94 A;  1TNP A;  4XJK A;  4DIR A;  2LUC A;  2JNX A;  1PUL A;  2PVB A;  2H61 A;  1CMF A;  2KNE A;  1F55 A;  3CZT X;  1CM1 A;  2JRF A;  2KQ6 A;  2LVK A;  1YR5 A;  3O6B A;  1XK4 A;  1EL4 A;  3S0G A;  4L9M A;  2NCP A;  2KOT A;  2MLF C;  1XVJ A;  4IJ7 A;  4TNC A;  3CZ0 A;  1KQV A;  1W7I B;  2KFF A;  2QEV A;  1F8H A;  2F8P A;  2ZFD A;  1SKT A;  4PHJ A;  1L7Z A;  2F2P A;  1DF0 B;  1LS8 A;  1W9Z A;  2L0P A;  1BG1 A;  3AKA A;  4QJ3 B;  1A03 A;  2O60 A;  3CR4 X;  1B8L A;  1OOF A;  1TNW A;  2I94 A;  4GGF C;  5AFP A;  1ORG A;  3I5F C;  1PK0 D;  1OMV A;  2A4J A;  2HQ8 A;  5HKW A;  1SRA A;  1QXP A;  1GJY A;  1IGV A;  1MXE A;  4YGE B;  1AP4 A;  2ZRT A;  2KI4 C;  3FE6 A;  4PDZ A;  2LV7 A;  3TZ1 A;  3AAK A;  2KI4 B;  2FJY A;  3B88 A;  3S0E A;  2QPT A;  1IQ5 A;  2LMV A;  1EH2 A;  3BQ3 A;  4JWQ A;  1MWN A;  1W7J B;  4CFR A;  3AAJ A;  1NP8 A;  1C3Z A;  1PSR A;  1SR6 B;  2BNX A;  4PCW A;  4NDB A;  3VRN A;  1SL7 A;  1EXR A;  1S3P A;  1DF0 A;  1KFU S;  2PMY A;  3CTN A;  1NSH A;  1QLS A;  1M31 A;  2L98 A;  2WCJ A;  4ICB A;  2KBM A;  2ZKM X;  4N1G A;  3KF9 A;  2G2B A;  2BL0 C;  3GK1 A;  1UWO A;  3HX4 A;  3I5H C;  3PSR A;  1DJI A;  1SNL A;  3I5H B;  1BOD A;  3DVM A;  1WDC C;  4YGD B;  3EK8 A;  1IKU A;  1SYM A;  2JQ6 A;  2LCP A;  3BFH A;  1EG4 A;  2E6W A;  3PN7 C;  1YX8 A;  2CCM A;  2WC8 A;  1NUB A;  3QRX A;  1TNQ A;  4JPZ B;  3IQO A;  1QS7 A;  2GTE A;  2LLT A;  2R2I A;  3LCP C;  5AER A;  1M63 B;  4PHK A;  1FBV A;  4MBE A;  5CSI A;  4C0K A;  3JVT C;  3O4X A;  2M7N A;  3VRO A;  2IS9 A;  3SG4 A;  1LVC D;  2M49 B;  2KYF A;  2H2K A;  1BT6 A;  3I5I B;  4PHN A;  1L2O C;  2LLU A;  5I2Q A;  1CFF A;  1NWD A;  2LVJ A;  1WY9 A;  2CBL A;  1XFZ O;  2MBX A;  1PAL A;  1FF1 A;  1DMO A;  1DJY A;  1NCY A;  4PAL A;  1B7T Z;  4GUK A;  1QX2 A;  3B6X A;  3OBV A;  1OSA A;  2L4H A;  5AXI A;  5KU1 A;  4M2Q A;  1NPQ A;  2CT9 A;  1J1E A;  1TUJ A;  1QWV A;  1RK9 A;  2JT3 A;  1XO5 A;  2NCO A;  2EC6 C;  3L4L A;  1NX0 A;  3IF7 A;  2LE9 B;  3LL8 B;  2BE6 A;  2KI6 D;  1AVS A;  4MEW A;  1SY9 A;  3BUM B;  1UHN A;  2JU0 A;  3SIB A;  3VGO A;  3JTD B;  3FWC A;  4OCI A;  1TTX A;  1TRF A;  1QJT A;  3D73 A;  2KLD A;  3R1P A;  2NZ0 A;  2KFH A;  2P6B B;  1Y1X A;  4BY5 A;  3D0Y B;  4ZCU A;  3EVU A;  3N7H A;  5FI6 A;  3TDU A;  2KHN A;  2KAY A;  1EG3 A;  2QDI A;  1YTZ C;  2FCE A;  3SS5 A;  3B87 A;  2K7B A;  1TCF A;  1OOH A;  1IJ6 A;  1J7O A;  3UNW A;  5AEQ A;  1CMG A;  4CID A;  1B7T Y;  4GPL B;  1K9K A;  3DVJ A;  4JD9 A;  4ORC B;  3SIA A;  1YUS A;  1NX1 A;  4CPV A;  2M3W A;  3O78 A;  2KSP A;  2OS8 C;  2PQL A;  2K60 A;  4NDC A;  1JF2 A;  2KI6 C;  3FE9 A;  1WRL A;  3OX6 A;  2WC6 A;  2K7D A;  2F3Z A;  2JOJ A;  3RZS A;  1CKK A;  2E30 A;  1A4P A;  3DY9 A;  4BY4 A;  2L2E A;  1QVI Y;  2BBM A;  1BF5 A;  5CPV A;  2M1K B;  3BUN B;  4MRY A;  3D0Y A;  3CZ2 A;  4YRU A;  4ORB B;  2I2R E;  3B7A A;  1SL9 A;  1XFU O;  1YRT B;  1UUR A;  1ZUZ A;  3M0W A;  5D7F A;  3SG3 A;  2AMI A;  1S6C A;  1A75 B;  2HPS A;  2M97 A;  3SG7 A;  1A2X A;  3V2L A;  1WLZ A;  1B8R A;  2KYC A;  2KAX A;  5I8N A;  1NX2 A;  2FCD A;  2COL B;  5GQQ C;  4FTG A;  3DVE A;  3OP0 A;  1WRK A;  2K61 A;  3DF0 B;  1OZO A;  2WCE A;  3A4U B;  5EL2 A;  1DJG A;  1DT7 B;  4I5K A;  5D69 A;  2LHI A;  3TS5 C;  2JTT A;  1SSE B;  1DEK A;  2KGR A;  2VRG A;  3I5F B;  3OB2 B;  3DD4 A;  1FI6 A;  5B8I B;  1OZS A;  3GK4 X;  1GM0 A;  1KK8 C;  3F45 A;  5FYX A;  2MRD A;  5J3X A;  1C07 A;  3CDN A;  5F6T A;  1XYD A;  3EK7 A;  3TUY C;  1TOP A;  1DVI A;  1BJF A;  1OE9 B;  2M0R A;  3R1V A;  3VRQ A;  1Z2C B;  1CDM A;  1R6P A;  3CLN A;  2K8M B;  3TUY B;  1B1G A;  3PLF B;  1QX7 A;  4N5X A;  1SL8 A;  3BUX B;  3CWG A;  1J55 A;  4XYN A;  5FI7 A;  2NXQ A;  3DXL A;  1N2D A;  4C0L A;  1XA5 A;  2MJW B;  3PM8 A;  4YI8 A;  3GK2 A;  1K8U A;  4INX A;  1S26 D;  3WXA A;  1TUZ A;  2JPO A;  2QEB A;  5JJG A;  1GGZ A;  3NSI A;  3OX5 A;  2ERB A;  1SMG A;  3KO0 A;  3DF0 A;  3NSK A;  2NLN A;  2EGD A;  4GAO A;  3WHU B;  3VB1 A;  1CDL A;  1M46 A;  3FIA A;  3WHT B;  3S0F A;  1D1O A;  1NX3 A;  4FQT A;  2WND A;  1MF8 B;  4GGF A;  4HRH A;  1G33 A;  3L47 A;  2BL0 B;  1K2H A;  1JUO A;  3A8R A;  3OHM B;  1PVB A;  3CYZ A;  5HKZ A;  2FOT A;  1QV0 A;  2G9B A;  4DS7 A;  2P70 A;  5ER4 X;  1WDC B;  1QAS A;  2AAO A;  5DIC A;  1XFV O;  4KYN A;  3BFA A;  3PN7 B;  4AQJ A;  1IIO A;  3CR2 A;  4ETO A;  1IJ5 A;  1CDP A;  3D76 A;  1JF0 A;  2OPO A;  1SCV A;  1KWO C;  1LKJ A;  1EJ3 A;  2BE4 A;  2JXL A;  1DTL A;  4PHM A;  1PVA A;  5IBW A;  3BOW B;  4AQI A;  1MUX A;  2BBN A;  3DZT A;  4MVF A;  3SG5 A;  3JVT B;  2OTG C;  2AUC A;  1LXF C;  4E68 A;  1KK7 Y;  3SG6 A;  1L2O B;  2K7O A;  1B9A A;  4DCK A;  5I2O A;  2GGM A;  4Q04 A;  1CFP A;  1GGW A;  1ZMZ A;  1B47 A;  2L50 A;  2RGI A;  1ZAC A;  1SCM C;  3PAT A;  3PJI A;  2WOR A;  2BCX A;  1BMO A;  3E3R A;  4F0Z B;  1IG5 A;  3KHE A;  1V1G A;  4INW A;  3R1O A;  2EC6 B;  1LA3 A;  2LAP A;  2Y4Q A;  1YX7 A;  4YGC B;  1DQE A;  2WCF A;  1QIW A;  1QVI Z;  1ZFS A;  1BR1 B;  1K90 D;  1M45 A;  1OMR A;  1N65 A;  3BOW A;  3LK0 A;  1E8A A;  2JT8 A;  1ODB A;  1AUI B;  2TN4 A;  1YUU A;  3EG5 B;  2QEO A;  2BKI B;  1CLB A;  2YGU A;  2P71 A;  2L5X B;  1BLQ A;  1CLM A;  4A4C A;  1IH0 A;  1KFX L;  2Q4U A;  3EVV A;  1MQ1 A;  2KPH A;  1OOI X;  3SJS A;  3CAB A;  1TN4 A;  1QIV A;  1TCO B;  3BUW B;  3MSE B;  3BJH A;  2QEH A;  1ALW A;  5HLO A;  1IRJ A;  5CSN A;  1KQM C;  2BCB A;  1LIN A;  3FS7 A;  4PE7 A;  1KQM B;  2JXC A;  2M7L A;  4F7F A;  5KTY A;  2K7C A;  2SCP A;  2ZRS A;  3S0D A;  3VRP A;  4QJ4 B;  2K2A A;  2ZN9 A;  4GGN A;  2OS8 B;  1PRW A;  1CFD A;  1T14 A;  1XFY O;  2LMT A;  3CS1 A;  4OV2 A;  1NYA A;  1S6J A;  4YGB B;  1OQP A;  4PE4 A;  5JOL A;  2PAS A;  4C0J A;  5BPJ A;  1OOJ A;  2BCA A;  2H61 C;  1CM4 A;  2LVV A;  5DKQ A;  3SS3 A;  2WOS A;  3LLE A;  3D77 A;  1AJ5 A;  2ISD A;  4D1E A;  1GQM A;  2LMU A;  2I18 A;  4I5N B;  1REC A;  1S1E A;  2KDH A;  5I2L A;  1K93 D;  1XK4 C;  2LP2 A;  3RLZ A;  1H4B A;  1DJH A;  1R2U A;  3NXA A;  1QAT A;  4GNK B;  1QX5 B;  2WCL A;  3ZNI A;  1HT9 A;  1SW8 A;  2LUX A;  3IVT A;  4USL A;  4HRG A;  1K95 A;  1CDN A;  4I5J A;  2KGB C;  1UHH A;  1AK8 A;  1F71 A;  2ZN8 A;  2MLE C;  1J7P A;  1RTP 1;  2HET A;  2JZI A;  1VRK A;  1RJV A;  3GOF A;  3VRR A;  4OZD A;  1F70 A;  1JFK A;  1V1F A;  2JT0 A;  1AHR A;  2JWW A;  1IQ3 A;  3RM1 A;  3D75 A;  3PFV A;  3NGV A;  4U8D A;  2LC5 A;  2LHL A;  2QAC A;  1SBJ A;  3KPX A;  3I5G C;  1TWO A;  2GV5 A;  4N1F A;  5FI2 A;  3UO9 A;  1JBA A;  1DGU A;  2F3Y A;  1Y6W A;  3BFB A;  3I5G B;  1M39 A;  2K2F A;  3CZ1 A;  1OW4 A;  2CXJ A;  3TS5 B;  1CB1 A;  1YUT A;  2BAP A;  2L4I A;  3AKB A;  4DRW A;  1KSM A;  2KFG A;  2B1U A;  1YVH A;  2LNK A;  1KK8 B;  1S5G Z;  1WRZ A;  1YRU B;  3L4A A;  2JTZ A;  5ER5 A;  1Y1U A;  3EK4 A;  3O2P A;  1P28 A;  3EVR A;  2HQW A;  1B8C A;  2KAV A;  3DVK A;  1XFX O;  1A75 A;  2O5G A;  2DOQ A;  3LK1 A;  3H4S E;  1MHO A;  1UHI A;  3CR5 X;  4R1E A;  1Q80 A;  3S0A A;  1C3Y A;  1BOC A;  3NSL A;  1KCY A;  2PAL A;  1J1D A;  1KK7 Z;  3BUO B;  2KLE A;  2JUL A;  4MN0 A;  2WCK A;  3S0B A;  4FQO A;  4ZCV A;  3EKJ A;  1QLK A;  2Y5I A;  2CNP A;  4P5O E;  2PYQ A;  2EHB A;  1S6I A;  1BU3 A;  1CLL A;  2L5Y A;  5AAN A;  4AOM A;  2WCH A;  3D74 A;  2ZNE A;  4M2O A;  2ZND A;  3BXK A;  1DJZ A;  3OGN A;  1F4Q A;  2D8N A;  1ALV A;  3NHI A;  3K21 A;  2HF5 A;  5HLV A;  2F2O A;  1DJW A;  1LA0 A;  1C7W A;  2LM5 A;  1YUR A;  1X02 A;  5KSZ A;  1J7Q A;  3NSO A;  2SAS A;  5CSF A;  1UP5 A;  2LP3 A;  1XFR A;  1JC2 A;  1J7R A;  4WQ2 A;  1SR6 C;  1G8I A;  1AJ4 A;  1K9U A;  1KSO A;  1S5G Y;  1BR4 B;  3ICB A;  3R72 A;  2MA2 A;  4WQ3 A;  5CSJ A;  3ZWH A;  1UUS A;  5I94 A;  1RWY A;  4PE1 A;  1XFW O;  1KWO B;  4MZL A;  4A4B A;  1MXL C;  1K96 A;  1UHK A;  3D78 A;  2LVI A;  2OTG B;  1KFU L;  1RFJ A;  1YVL A;  5G08 A;  3OB1 B;  1DGV A;  2Y1N A;  2I7A A;  5HYD A;  1FPW A;  1UHJ A;  4MLW A;  2JNF A;  4MRX A;  2JPT A;  4WRI A;  2H8V A;  1K9P A;  4DUQ A;  4ORA B;  3TDZ A;  1MR8 A;  4PT1 A;  5PAL A;  1SK6 D;  4GFT A;  1WLM A;  1SCM B;  1H8B A;  1IWQ A;  4HRE E;  1C7V A;  3O4Y A;  4OVN F;  2F33 A;  3SS4 A;  1HQV A;  2LAN A;  3EKH A;  3I5I C;  5TNC A;  3SG2 A;  1CFC A;  1DC1 A;  4NQG A;  4OKH A;  1PSB A;  2MAZ A;  2JC2 A;  1ZOT B;  1NIW A; 
#chains in the Genus database with same CATH homology
 1JWD A;  3TDI A;  1KFX S;  4YGA A;  1JSA A;  1NCZ A;  1G4Y R;  4I5L B;  2LLS A;  2M9G A;  4IL1 A;  4UPG A;  2KBI A;  3KEV A;  4YBH B;  2BEC A;  2L51 A;  3HCM A;  1F54 A;  4MSP A;  1JFJ A;  1QV1 A;  1SPY A;  3WNX B;  2M1U A;  4PE0 A;  2V53 A;  1NCX A;  1Y0V H;  1F4O A;  1TIZ A;  1U5I B;  5HKY A;  2M8U A;  2PRU A;  3JTD C;  4M2P A;  2WCB A;  3FWB A;  2GGZ A;  4HSZ A;  4CFQ A;  1OMD A;  2Q91 A;  4XJK B;  1B4C A;  3C1V A;  1Y1A A;  2BKH B;  2PSR A;  4OR9 B;  3PAL A;  1CNP A;  1TNX A;  1CTR A;  4P2Y B;  5K89 A;  4CLN A;  1N0Y A;  4JQ0 D;  4NDD A;  2KQY A;  4GBA A;  4QJ5 B;  4MZJ A;  4YI9 A;  2M29 A;  4MZK A;  1DJX A;  2FJU B;  1FW4 A;  3D10 A;  2Y1M A;  5DKR A;  1QTX A;  1S36 A;  3BYA A;  1RRO A;  2MHH A;  2CTN A;  3IQQ A;  1U5I A;  1A29 A;  3CGA A;  5DKN A;  1FI5 A;  2K0J A;  1K94 A;  1TNP A;  4XJK A;  4DIR A;  2LUC A;  2JNX A;  1PUL A;  2PVB A;  2H61 A;  1CMF A;  2KNE A;  1F55 A;  3CZT X;  1CM1 A;  2JRF A;  2KQ6 A;  2LVK A;  1YR5 A;  3O6B A;  1XK4 A;  1EL4 A;  4L9M A;  2NCP A;  2KOT A;  2MLF C;  1XVJ A;  4TNC A;  1KQV A;  1W7I B;  2KFF A;  1F8H A;  2F8P A;  2ZFD A;  1SKT A;  4PHJ A;  1L7Z A;  2F2P A;  1DF0 B;  2L0P A;  1BG1 A;  3AKA A;  4QJ3 B;  1A03 A;  2O60 A;  3CR4 X;  1B8L A;  1TNW A;  2I94 A;  4GGF C;  5AFP A;  3I5F C;  1PK0 D;  2A4J A;  1OMV A;  2HQ8 A;  5HKW A;  1SRA A;  1QXP A;  1GJY A;  1IGV A;  1MXE A;  4YGE B;  1AP4 A;  2ZRT A;  2KI4 C;  3TZ1 A;  4PDZ A;  2LV7 A;  3AAK A;  2KI4 B;  2QPT A;  1IQ5 A;  2LMV A;  1EH2 A;  3BQ3 A;  4JWQ A;  1MWN A;  1W7J B;  4CFR A;  3AAJ A;  1NP8 A;  1PSR A;  1SR6 B;  4PCW A;  4NDB A;  3VRN A;  1SL7 A;  1EXR A;  1S3P A;  1DF0 A;  1KFU S;  2PMY A;  3CTN A;  1NSH A;  1QLS A;  1M31 A;  2L98 A;  4ICB A;  2KBM A;  2ZKM X;  4N1G A;  3KF9 A;  2G2B A;  2BL0 C;  3GK1 A;  1UWO A;  3HX4 A;  3I5H C;  3PSR A;  1DJI A;  1SNL A;  3I5H B;  1BOD A;  3DVM A;  1WDC C;  4YGD B;  3EK8 A;  1IKU A;  1SYM A;  2JQ6 A;  2LCP A;  1EG4 A;  2E6W A;  3PN7 C;  1YX8 A;  2CCM A;  2WC8 A;  1NUB A;  3QRX A;  1TNQ A;  4JPZ B;  3IQO A;  1QS7 A;  2LLT A;  2R2I A;  3LCP C;  5AER A;  1M63 B;  4PHK A;  1FBV A;  4MBE A;  5CSI A;  4C0K A;  3JVT C;  2M7N A;  3VRO A;  2IS9 A;  3SG4 A;  1LVC D;  2M49 B;  2KYF A;  2H2K A;  1BT6 A;  3I5I B;  4PHN A;  1L2O C;  2LLU A;  5I2Q A;  1CFF A;  1NWD A;  2LVJ A;  1WY9 A;  2CBL A;  1XFZ O;  2MBX A;  1PAL A;  1FF1 A;  1DJY A;  1NCY A;  4PAL A;  1B7T Z;  4GUK A;  1QX2 A;  1OSA A;  2L4H A;  5AXI A;  5KU1 A;  4M2Q A;  1NPQ A;  2CT9 A;  1J1E A;  1RK9 A;  2JT3 A;  1XO5 A;  2NCO A;  2EC6 C;  1NX0 A;  3IF7 A;  2LE9 B;  3LL8 B;  2BE6 A;  2KI6 D;  1AVS A;  4MEW A;  1SY9 A;  3BUM B;  1UHN A;  2JU0 A;  3SIB A;  3VGO A;  3JTD B;  3FWC A;  4OCI A;  1TTX A;  1TRF A;  1QJT A;  4BY5 A;  2NZ0 A;  2KFH A;  2P6B B;  1Y1X A;  3D0Y B;  4ZCU A;  3EVU A;  3TDU A;  2KHN A;  2KAY A;  1EG3 A;  1YTZ C;  2FCE A;  2K7B A;  1TCF A;  1IJ6 A;  1J7O A;  1CMG A;  5AEQ A;  4CID A;  1B7T Y;  4GPL B;  1K9K A;  3DVJ A;  4ORC B;  3SIA A;  1YUS A;  1NX1 A;  4CPV A;  2M3W A;  3O78 A;  2KSP A;  2OS8 C;  4NDC A;  1JF2 A;  2KI6 C;  1WRL A;  3OX6 A;  2K7D A;  2F3Z A;  2JOJ A;  1CKK A;  2E30 A;  1A4P A;  4BY4 A;  2L2E A;  1QVI Y;  2BBM A;  1BF5 A;  5CPV A;  2M1K B;  3BUN B;  4MRY A;  3D0Y A;  4YRU A;  4ORB B;  2I2R E;  1SL9 A;  1XFU O;  1YRT B;  1UUR A;  1ZUZ A;  3M0W A;  5D7F A;  3SG3 A;  2AMI A;  1S6C A;  1A75 B;  2HPS A;  2M97 A;  3SG7 A;  1A2X A;  1WLZ A;  1B8R A;  2KYC A;  2KAX A;  5I8N A;  1NX2 A;  2FCD A;  2COL B;  5GQQ C;  4FTG A;  3DVE A;  3OP0 A;  1WRK A;  2K61 A;  3DF0 B;  1OZO A;  2WCE A;  3A4U B;  1DJG A;  1DT7 B;  4I5K A;  5D69 A;  2LHI A;  3TS5 C;  2JTT A;  2VRG A;  2KGR A;  3I5F B;  3OB2 B;  3DD4 A;  1FI6 A;  5B8I B;  1OZS A;  3GK4 X;  1KK8 C;  3F45 A;  5FYX A;  2MRD A;  5J3X A;  1C07 A;  1CDN A;  5F6T A;  1XYD A;  3EK7 A;  3TUY C;  1TOP A;  1DVI A;  1BJF A;  1OE9 B;  2M0R A;  3VRQ A;  3TUY B;  1CDM A;  1R6P A;  3CLN A;  2K8M B;  1B1G A;  3PLF B;  1QX7 A;  4N5X A;  1SL8 A;  3BUX B;  3CWG A;  1J55 A;  4XYN A;  2NXQ A;  1N2D A;  4C0L A;  1XA5 A;  2MJW B;  3PM8 A;  4YI8 A;  3GK2 A;  1K8U A;  1S26 D;  3WXA A;  5JJG A;  1GGZ A;  3NSI A;  3OX5 A;  1SMG A;  3KO0 A;  3DF0 A;  3NSK A;  2NLN A;  2EGD A;  4GAO A;  3WHU B;  3WHT B;  1CDL A;  1M46 A;  3FIA A;  1D1O A;  1NX3 A;  2WND A;  1MF8 B;  4GGF A;  4HRH A;  1G33 A;  2BL0 B;  1K2H A;  1JUO A;  3A8R A;  3OHM B;  1PVB A;  5HKZ A;  2FOT A;  1QV0 A;  2G9B A;  4DS7 A;  5ER4 X;  1WDC B;  1QAS A;  2AAO A;  1XFV O;  3PN7 B;  4AQJ A;  3CR2 A;  4ETO A;  1IJ5 A;  1CDP A;  1JF0 A;  2OPO A;  1SCV A;  1KWO C;  1LKJ A;  1EJ3 A;  2BE4 A;  2JXL A;  1DTL A;  4PHM A;  1PVA A;  5IBW A;  3BOW B;  4AQI A;  1MUX A;  2BBN A;  4MVF A;  3SG5 A;  3JVT B;  2OTG C;  2AUC A;  1LXF C;  4E68 A;  1KK7 Y;  3SG6 A;  1L2O B;  2K7O A;  1B9A A;  4DCK A;  5I2O A;  2GGM A;  4Q04 A;  1CFP A;  1GGW A;  1ZMZ A;  1B47 A;  2L50 A;  2RGI A;  1ZAC A;  1SCM C;  3PAT A;  2WOR A;  2BCX A;  1BMO A;  3E3R A;  4F0Z B;  1IG5 A;  3KHE A;  1V1G A;  2EC6 B;  1LA3 A;  2LAP A;  2Y4Q A;  1YX7 A;  4YGC B;  2WCF A;  1QIW A;  1QVI Z;  1ZFS A;  1BR1 B;  1K90 D;  1M45 A;  1OMR A;  1N65 A;  3BOW A;  3LK0 A;  1E8A A;  2JT8 A;  1ODB A;  1AUI B;  2TN4 A;  1YUU A;  1IH0 A;  2BKI B;  1CLB A;  1BLQ A;  2L5X B;  1CLM A;  4A4C A;  1KFX L;  2Q4U A;  3EVV A;  1MQ1 A;  3SJS A;  1TN4 A;  1QIV A;  1TCO B;  3BUW B;  3MSE B;  1ALW A;  5HLO A;  1IRJ A;  5CSN A;  1KQM C;  2BCB A;  1LIN A;  3FS7 A;  4PE7 A;  1KQM B;  2JXC A;  2M7L A;  5KTY A;  2K7C A;  2SCP A;  2ZRS A;  3VRP A;  4QJ4 B;  2K2A A;  2ZN9 A;  4GGN A;  2OS8 B;  1PRW A;  1CFD A;  1XFY O;  2LMT A;  3CS1 A;  4OV2 A;  4YGB B;  1NYA A;  1S6J A;  4C0J A;  1OQP A;  4PE4 A;  5JOL A;  2PAS A;  1DMO A;  5BPJ A;  2BCA A;  1OOJ A;  2H61 C;  1CM4 A;  2LVV A;  5DKQ A;  2WOS A;  3LLE A;  2ISD A;  1AJ5 A;  4D1E A;  1GQM A;  2LMU A;  2I18 A;  4I5N B;  1REC A;  1S1E A;  2KDH A;  5I2L A;  1K93 D;  1XK4 C;  2LP2 A;  3RLZ A;  1H4B A;  1DJH A;  1R2U A;  3NXA A;  1QAT A;  4GNK B;  1QX5 B;  3ZNI A;  1HT9 A;  1SW8 A;  2LUX A;  4USL A;  4HRG A;  1K95 A;  4I5J A;  2KGB C;  1UHH A;  1AK8 A;  1F71 A;  2ZN8 A;  2MLE C;  1J7P A;  1RTP 1;  2HET A;  2JZI A;  1VRK A;  1RJV A;  3GOF A;  3VRR A;  1F70 A;  1JFK A;  1V1F A;  2JT0 A;  1AHR A;  2JWW A;  1IQ3 A;  3RM1 A;  3PFV A;  4U8D A;  2LC5 A;  2LHL A;  2QAC A;  1SBJ A;  3KPX A;  3I5G C;  4N1F A;  2GV5 A;  1JBA A;  1DGU A;  2F3Y A;  1Y6W A;  3I5G B;  1M39 A;  2K2F A;  2CXJ A;  3TS5 B;  1CB1 A;  1YUT A;  2L4I A;  3AKB A;  4DRW A;  1KSM A;  2KFG A;  2B1U A;  1YVH A;  2LNK A;  1KK8 B;  1S5G Z;  1WRZ A;  1YRU B;  2JTZ A;  5ER5 A;  1Y1U A;  3EK4 A;  3O2P A;  3EVR A;  2HQW A;  1B8C A;  2KAV A;  3DVK A;  1XFX O;  1A75 A;  2O5G A;  2DOQ A;  3LK1 A;  3H4S E;  1MHO A;  1UHI A;  3CR5 X;  4R1E A;  1Q80 A;  1BOC A;  1KCY A;  3NSL A;  2PAL A;  1J1D A;  1KK7 Z;  3BUO B;  2JUL A;  4MN0 A;  4FQO A;  4ZCV A;  3EKJ A;  1QLK A;  2Y5I A;  2CNP A;  4P5O E;  2EHB A;  1S6I A;  1BU3 A;  1CLL A;  5AAN A;  4AOM A;  2ZNE A;  4M2O A;  2ZND A;  3BXK A;  1DJZ A;  1F4Q A;  2D8N A;  1ALV A;  3K21 A;  2HF5 A;  5HLV A;  2F2O A;  1DJW A;  1LA0 A;  1C7W A;  2LM5 A;  1YUR A;  1X02 A;  5KSZ A;  1J7Q A;  3NSO A;  2SAS A;  5CSF A;  1UP5 A;  2LP3 A;  1JC2 A;  1J7R A;  4WQ2 A;  1SR6 C;  1G8I A;  1AJ4 A;  1K9U A;  1KSO A;  1S5G Y;  1BR4 B;  3ICB A;  4WQ3 A;  2MA2 A;  5CSJ A;  3ZWH A;  1UUS A;  1RWY A;  4PE1 A;  1XFW O;  1KWO B;  4MZL A;  4A4B A;  1MXL C;  1K96 A;  1UHK A;  2LVI A;  2OTG B;  1KFU L;  1RFJ A;  1YVL A;  5G08 A;  3OB1 B;  1DGV A;  2Y1N A;  2I7A A;  5HYD A;  1FPW A;  1UHJ A;  4MLW A;  2JNF A;  4MRX A;  2JPT A;  4WRI A;  4DUQ A;  1K9P A;  4ORA B;  3TDZ A;  1MR8 A;  5PAL A;  1SK6 D;  4GFT A;  1WLM A;  1SCM B;  1H8B A;  1IWQ A;  4HRE E;  1C7V A;  3O4Y A;  4OVN F;  2F33 A;  1HQV A;  2LAN A;  3EKH A;  3I5I C;  5TNC A;  3SG2 A;  1CFC A;  4NQG A;  4OKH A;  1PSB A;  2MAZ A;  2JC2 A;  1ZOT B;  1NIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...