2H61A

X-ray structure of human ca2+-loaded s100b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
b'MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B, E, F, H
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61A00
5ER4X 4AQIA 3ZWHA 2NLNA 2LLSA 1XFYO 3E3RA 4CFQA 1MXEA 1OZSA 1CDLA 1BJFA 1XA5A 2ZRTA 3DVEA 1PVBA 3BOWB 3KHEA 1NWDA 1TTXA 2KOTA 5BPJA 4NDDA 4YI8A 1OE9B 4I5NB 1JF0A 1OMVA 2ZNEA 4MLWA 1SCMC 1SL9A 1S6CA 2GGZA 2M1KB 1YUSA 3DF0B 2JTTA 3CGAA 2KBMA 3DVMA 2ZN9A 1DJIA 2LM5A 1WRLA 1X02A 3KO0A 3AAJA 1ZFSA 1K2HA 4NDCA 4QJ4B 1J7OA 1KQMC 2OPOA 4M2PA 2O60A 2G2BA 5I2OA 2KQYA 1JWDA 4C0KA 1B9AA 1XFVO 2B1UA 2M7LA 4HRHA 4PE1A 3NSIA 1M46A 3EK8A 5AXIA 2KFGA 5KSZA 1SKTA 1BF5A 2PVBA 1G33A 4GAOA 1KSMA 2BKIB 2JNXA 2MAZA 1K95A 2JXLA 1WY9A 1KK8C 2M29A 4YBHB 2F3ZA 3I5FC 1M45A 3BXKA 1ZUZA 2F33A 1KQVA 1IWQA 1S1EA 2BL0B 3I5IB 1UURA 4N1FA 5JJGA 4R1EA 2K7CA 4GNKB 1PALA 1FBVA 3F45A 4P2YB 1ODBA 3FWBA 1LKJA 1QTXA 1WDCC 2NZ0A 3EVVA 2A4JA 5PALA 3EVUA 1YUTA 1XFZO 3CR2A 1NPQA 1S36A 1CLLA 3EKJA 1EXRA 3PALA 3OB2B 1OZOA 1V1FA 1QV1A 3A4UB 2LVVA 1LINA 1K94A 2M7NA 2CCMA 2EC6B 3LK0A 1IQ3A 1YVLA 1BOCA 1R2UA 2KQ6A 1TRFA 5D69A 1B7TY 1CFFA 5HLOA 1NCYA 2P6BB 1J1DA 1XK4A 3D0YB 1SPYA 1PSRA 1HQVA 2OS8B 1YRUB 1MHOA 2JNFA 1QXPA 1SCVA 1UHKA 2R2IA 5GQQC 4A4BA 1AP4A 3O4YA 1LXFC 2Y1NA 1XFUO 1QASA 3CR4X 2BCAA 2K61A 2JT8A 2ZRSA 4MSPA 5AFPA 3TDUA 3EKHA 1JFJA 4JQ0D 5CPVA 1GGWA 2E30A 3PFVA 2IS9A 4ZCUA 1AUIB 3SJSA 2K0JA 1KFXS 1FI6A 1RK9A 1YVHA 1IGVA 2BBNA 2H61A 3PATA 2AMIA 2L0PA 4GBAA 5CSJA 1EL4A 1F4OA 3AKAA 1K96A 1NX2A 3PN7C 4XYNA 5I8NA 2K7BA 2MHHA 1SR6C 2JC2A 3GK2A 1DJZA 5TNCA 4MBEA 2NCPA 3JTDB 1QIVA 2FOTA 4MZKA 3TZ1A 4YGBB 1IG5A 1JF2A 1Y6WA 2BE6A 4MZLA 1QS7A 1B47A 1BMOA 2FJUB 2JPTA 4TNCA 2M1UA 2HQWA 1FF1A 1SW8A 1UUSA 1QLSA 2JQ6A 2L98A 1J7QA 2LVIA 1SYMA 1QVIZ 1L2OB 2AAOA 3D10A 3PM8A 1YR5A 4OV2A 1S5GY 5AERA 1MQ1A 1NX0A 4ZCVA 2WOSA 2KYCA 4D1EA 2BECA 2NXQA 3WXAA 4PALA 2LANA 3WNXB 3LK1A 1CMGA 1MF8B 1KWOB 1QX7A 1XK4C 3BOWA 4M2OA 1KK7Z 4M2QA 1SCMB 1WRZA 2KI4C 1OOJA 1OSAA 1C07A 4C0JA 5D7FA 1M63B 1ALWA 1QX2A 1TNQA 2KAXA 5IBWA 1SMGA 2G9BA 2ZFDA 3C1VA 2LUXA 4ORAB 3BQ3A 1TNXA 1MXLC 3SG2A 2K2FA 3MSEB 1KQMB 1KFXL 1Y1XA 4F0ZB 2H61C 4HRGA 1QLKA 5K89A 4Q04A 1NSHA 1F54A 4PHMA 1BODA 1TCOB 1YRTB 3CR5X 2MJWB 1KK8B 1H4BA 1PK0D 2MLFC 3WHUB 5CSNA 1J1EA 1B8CA 2JULA 2HPSA 2CBLA 2Y1MA 2MRDA 3IQOA 1DJXA 1K8UA 2LMTA 2HF5A 2KYFA 2MLEC 3BUMB 2O5GA 2MA2A 5KTYA 1PULA 1OMRA 1TCFA 1K93D 1HT9A 2OTGB 3GK1A 3BUOB 4I5KA 3SIAA 3OP0A 1PSBA 5DKQA 2CTNA 1DJYA 2D8NA 1F8HA 4N1GA 3BUWB 4ETOA 2KAVA 5JOLA 2EHBA 4PE7A 1W7JB 3I5HB 1LA0A 4HSZA 1ALVA 2KI6C 3SG5A 1CTRA 1BT6A 1CFDA 2LAPA 1FPWA 2LHIA 2F8PA 4PHJA 2LE9B 2AUCA 4WRIA 1LVCD 1YURA 2L4IA 1KSOA 3FWCA 3CTNA 1BR4B 3TUYB 4MEWA 1DJWA 3O6BA 2L5XB 2WCFA 1CMFA 2EGDA 1UP5A 4BY4A 1DTLA 3PSRA 4YRUA 1J7RA 4L9MA 1CLMA 1B4CA 2F2OA 1S26D 4I5JA 1SNLA 1WLZA 2L4HA 4HREE 2SCPA 2KHNA 2Q91A 1U5IB 3PN7B 4PHNA 1A75A 4MVFA 3NSOA 1GJYA 2L50A 2M49B 3TDIA 2KFHA 1M31A 1DGUA 5DKRA 1DF0B 2FCEA 1WRKA 2BL0C 4YGCB 1QIWA 4N5XA 1S3PA 3BYAA 1TIZA 2WC8A 1SL8A 2LVJA 2PSRA 1Y1AA 4PE0A 1CB1A 2ISDA 2KFFA 1F71A 3OX6A 1OMDA 2F2PA 1AK8A 2L2EA 3A8RA 1IJ5A 1Q80A 3LLEA 2LUCA 1QVIY 3OHMB 4A4CA 3VRRA 3ICBA 2FCDA 2PASA 2WCBA 1UHHA 2NCOA 4PDZA 4QJ5B 2EC6C 2LP3A 4AOMA 4NQGA 2M97A 4MN0A 4P5OE 4DRWA 1S6JA 2WORA 2KI4B 3AKBA 1CDNA 1KK7Y 1XVJA 2JRFA 2WCEA 1IRJA 5HLVA 2OS8C 1AJ5A 1TN4A 2Y4QA 1KCYA 2CT9A 2Q4UA 3NSKA 4MRYA 2JU0A 2SASA 5G08A 3RLZA 2BCXA 3O78A 4YGAA 2V53A 1B1GA 1NCZA 4GFTA 3FIAA 1JSAA 1PVAA 3IF7A 1OQPA 4UPGA 3CLNA 3VRQA 1A2XA 3JVTC 1GGZA 1RJVA 1N65A 5I2LA 4E68A 1DJHA 2LMUA 5KU1A 1IH0A 4ICBA 3DF0A 1C7VA 1A4PA 2PRUA 3I5GC 1JFKA 4DCKA 4GPLB 3JTDC 1K9KA 1GQMA 1IQ5A 1SL7A 1LA3A 1JC2A 1G4YR 1J55A 2JT0A 1MR8A 1SK6D 1UHNA 1W7IB 3TS5C 3CWGA 2CXJA 2KBIA 1XYDA 1M39A 1CLBA 1N2DA 1BG1A 1QV0A 4XJKB 5DKNA 1L2OC 2JZIA 2HQ8A 1IJ6A 2LP2A 3IQQA 2M8UA 1TNWA 1F4QA 3I5FB 4DUQA 1E8AA 2BKHB 4PHKA 1XO5A 2I7AA 3M0WA 5HKZA 2LVKA 1RECA 3NSLA 1G8IA 1H8BA 2GV5A 1AJ4A 1KWOC 2LHLA 1NX3A 1YUUA 1WDCB 2PMYA 1MUXA 1SBJA 1R6PA 1FI5A 3KPXA 2HETA 5FYXA 4PE4A 3OX5A 1AHRA 5HKWA 4QJ3B 1K9UA 2ZNDA 2LCPA 5HKYA 1MWNA 3VROA 3HX4A 4GGFC 1RFJA 1UHJA 1VRKA 4MRXA 4AQJA 1NX1A 2LLTA 2ZN8A 1QX5B 3DVJA 4MZJA 2I2RE 3K21A 3WHTB 5CSIA 2WNDA 2KI6D 4YI9A 1NYAA 1TOPA 2QACA 3D0YA 1J7PA 1KFUS 2L51A 2RGIA 1B8LA 1CDPA 4GGNA 1CNPA 2BE4A 1S6IA 2MBXA 1U5IA 2CNPA 3SIBA 4NDBA 2JOJA 3EVRA 1F55A 5J3XA 5CSFA 2JWWA 1JBAA 1QATA 1F70A 1DF0A 3BUXB 2JTZA 1NUBA 2JXCA 2Y5IA 1QJTA 3RM1A 1ZACA 4IL1A 1EJ3A 1XFWO 3NXAA 3FS7A 2OTGC 3DD4A 1JUOA 3VGOA 4YGDB 1SR6B 5ER5A 2K2AA 4OVNF 1NIWA 2BBMA 1BR1B 3I5HC 1A03A 1XFXO 3HCMA 3I5IC 1A29A 2GGMA 2DOQA 1NP8A 4WQ2A 1EH2A 1CM1A 3EK4A 2KGRA 3SG6A 3GOFA 4I5LB 1SRAA 1Y0VH 4C0LA 3SG3A 4YGEB 3VRPA 3EK7A 1ZMZA 3TUYC 1Y1UA 2KSPA 2M9GA 2K7DA 3SG4A 4FQOA 4ORBB 3H4SE 1YX8A 4DIRA 5AANA 1TNPA 1SY9A 3DVKA 1EG4A 1RROA 2LC5A 2VRGA 1B7TZ 1WLMA 3BUNB 4OKHA 3ZNIA 3VRNA 4BY5A 2LNKA 3TDZA 4CLNA 2K8MB 1L7ZA 2JT3A 3JVTB 3LL8B 1YX7A 2KNEA 1KFUL 2LLUA 1A75B 1FW4A 2M0RA 3KF9A 3OB1B 4CPVA 1B8RA 1DT7B 2PALA 4GUKA 1CDMA 2H2KA 4PCWA 1DMOA 5AEQA 1BLQA 2F3YA 2COLB 3I5GB 3QRXA 2I18A 1K90D 2I94A 2LV7A 4GGFA 4ORCB 1PRWA 5B8IB 3O2PA 5I2QA 1UWOA 4FTGA 3CS1A 3TS5B 1IKUA 1DJGA 2M3WA 2QPTA 3GK4X 1YTZC 2KGBC 3AAKA 1N0YA 1RTP1 4OCIA 1RWYA 1DGVA 3KEVA 4U8DA 5HYDA 1V1GA 1DVIA 4XJKA 3SG7A 2BCBA 1CFPA 1AVSA 4OR9B 1ZOTB 1CKKA 1C7WA 2E6WA 4JWQA 1BU3A 4WQ3A 2KAYA 4CIDA 4CFRA 1CFCA 1CM4A 1NCXA 4JPZB 2TN4A 5F6TA 1K9PA 3LCPC 2KDHA 2K7OA 4DS7A 1UHIA 2LMVA 3PLFB 2ZKMX 1S5GZ 1EG3A 3CZTX 4USLA 1D1OA
chains in the Genus database with same CATH superfamily
5ER4X 3PJIA 4AQIA 3ZWHA 2NLNA 2LLSA 1XFYO 3E3RA 4CFQA 1MXEA 1OZSA 1CDLA 1BJFA 1XA5A 2ZRTA 3DVEA 1PVBA 2L2CA 3BOWB 1NWDA 3KHEA 1TTXA 2KOTA 5BPJA 4NDDA 4YI8A 1OE9B 4I5NB 1JF0A 1OMVA 2ZNEA 4MLWA 1SCMC 4F7FA 1SL9A 1S6CA 2GGZA 2M1KB 1YUSA 3DF0B 2JTTA 3CGAA 2KBMA 3DVMA 2ZN9A 1DJIA 2LM5A 1WRLA 1X02A 2WC6A 3KO0A 3AAJA 1ZFSA 1K2HA 4FQTA 4NDCA 4QJ4B 1J7OA 1KQMC 2OPOA 4JD9A 4M2PA 2O60A 2G2BA 5I2OA 2KQYA 1JWDA 4C0KA 1B9AA 1XFVO 2B1UA 2M7LA 1W9ZA 4HRHA 4PE1A 3NSIA 1M46A 3EK8A 5AXIA 2KFGA 5KSZA 1SKTA 1BF5A 2PVBA 1G33A 4GAOA 1KSMA 2BKIB 2JNXA 2MAZA 1K95A 2JXLA 1WY9A 1KK8C 2M29A 4YBHB 2F3ZA 1OW4A 3I5FC 1M45A 3BXKA 1ZUZA 2F33A 1KQVA 1IWQA 1S1EA 2BL0B 3I5IB 1UURA 4N1FA 5JJGA 3BFHA 4R1EA 2K7CA 3R72A 4GNKB 1PALA 1IIOA 1FBVA 3F45A 4P2YB 1ODBA 1SSEB 3FWBA 1LKJA 1QTXA 1WDCC 2KLDA 2NZ0A 2A4JA 3EVVA 5PALA 3EVUA 1YUTA 3B7AA 1XFZO 3CR2A 1NPQA 1S36A 1CLLA 1OOHA 3EKJA 1EXRA 3PALA 3OB2B 1OZOA 1V1FA 1QV1A 3B86A 3A4UB 2LVVA 1LINA 3DZTA 1K94A 2M7NA 2CCMA 2EC6B 3NHTA 3LK0A 1IQ3A 1YVLA 3CABA 1BOCA 3NHIA 1R2UA 2KQ6A 1TRFA 5D69A 1B7TY 1CFFA 5HLOA 1NCYA 2P6BB 1J1DA 1XK4A 3D0YB 1SPYA 1PSRA 1HQVA 2OS8B 1YRUB 1MHOA 2JNFA 1QXPA 1SCVA 1UHKA 2R2IA 5GQQC 4A4BA 1AP4A 3O4YA 1LXFC 2Y1NA 1XFUO 1QASA 3L4LA 3CR4X 2BCAA 2K61A 1XFRA 2JT8A 2ZRSA 3BFBA 4MSPA 5AFPA 3TDUA 3FE9A 3EKHA 1JFJA 4JQ0D 5CPVA 1GGWA 2E30A 3PFVA 2IS9A 4ZCUA 1AUIB 3SJSA 2K0JA 1KFXS 2QEVA 1FI6A 1RK9A 1YVHA 1IGVA 2BBNA 2H61A 3D75A 3PATA 2AMIA 2L0PA 4GBAA 5CSJA 1EL4A 1F4OA 3AKAA 1K96A 1NX2A 3PN7C 3S0GA 5FI7A 4XYNA 5I8NA 2K7BA 2MHHA 1SR6C 2JC2A 2WCHA 1DJZA 3GK2A 4MBEA 2NCPA 3JTDB 1QIVA 2FOTA 4MZKA 5TNCA 3TZ1A 4YGBB 3CYZA 1IG5A 5I94A 2BNXA 1JF2A 3CZ1A 1Y6WA 2BE6A 4MZLA 1QS7A 1B47A 1BMOA 2FJUB 4KYNA 2JPTA 4TNCA 5DICA 2M1UA 2HQWA 3BJHA 1FF1A 1SW8A 1UUSA 1QLSA 2JQ6A 2L98A 1C3YA 1J7QA 2LVIA 1SYMA 1QVIZ 1L2OB 2AAOA 3D10A 3PM8A 1YR5A 4OV2A 1S5GY 5AERA 1MQ1A 1NX0A 4ZCVA 2WOSA 2KYCA 4D1EA 2BECA 2ERBA 2NXQA 3WXAA 4PALA 2LANA 3WNXB 3LK1A 3S0FA 1CMGA 1MF8B 1KWOB 3FE8A 1QX7A 1XK4C 3BOWA 4M2OA 1KK7Z 1Z2CB 1SCMB 1WRZA 2KI4C 4M2QA 1OOJA 1OSAA 1C07A 4C0JA 3BFAA 5D7FA 1M63B 1ALWA 1QX2A 1TNQA 2KAXA 5IBWA 1SMGA 2G9BA 2ZFDA 3C1VA 2LUXA 4ORAB 3BQ3A 1TNXA 1MXLC 3SG2A 2K2FA 3MSEB 3D73A 1KQMB 1KFXL 1Y1XA 4F0ZB 2H61C 4HRGA 1QLKA 5K89A 4Q04A 1NSHA 1F54A 3DXLA 4PHMA 3D74A 2PYQA 1BODA 1TCOB 1YRTB 3CR5X 3SS4A 2P71A 1DQEA 1KK8B 2MJWB 1H4BA 1PK0D 2MLFC 3WHUB 3PM2A 5CSNA 1J1EA 1B8CA 2JULA 2HPSA 2CBLA 2Y1MA 1TUJA 2MRDA 3CZ0A 3IQOA 1DJXA 1K8UA 2H8VA 2WCKA 2LMTA 2HF5A 2KYFA 1ORGA 2MLEC 3BUMB 2O5GA 2MA2A 4INXA 1PULA 5KTYA 1OMRA 1TCFA 1K93D 1HT9A 2OTGB 3GK1A 3BUOB 4I5KA 3SIAA 3OP0A 1PSBA 5DKQA 2CTNA 1DJYA 2D8NA 1F8HA 4N1GA 3BUWB 4ETOA 2KAVA 5JOLA 2EHBA 2QDIA 4PE7A 1W7JB 3I5HB 1LA0A 4HSZA 1ALVA 1C3ZA 2KI6C 3SG5A 1CTRA 1BT6A 2WC5A 1CFDA 2LAPA 1FPWA 3SS3A 4JKTA 2LHIA 2F8PA 4PHJA 2LE9B 2AUCA 4WRIA 1LVCD 1YURA 2L4IA 1KSOA 3FWCA 4OZDA 3CTNA 1BR4B 3TUYB 4MEWA 1DJWA 3O6BA 2L5XB 2WCFA 3UNWA 3B87A 4PT1A 1CMFA 2EGDA 1UP5A 3CZ2A 4BY4A 1DTLA 3PSRA 4YRUA 1J7RA 4L9MA 1CLMA 1B4CA 2F2OA 1S26D 4I5JA 1SNLA 1T14A 1WLZA 2L4HA 4HREE 2SCPA 2KHNA 2Q91A 1U5IB 3PN7B 3R1OA 4PHNA 1A75A 4MVFA 3NSOA 1GJYA 2L50A 2M49B 3TDIA 2KFHA 1M31A 3UO9A 3FE6A 1DGUA 5DKRA 1DF0B 2FCEA 1WRKA 2BL0C 4YGCB 3QMEA 1QIWA 4N5XA 1S3PA 3BYAA 1TIZA 2WC8A 1SL8A 2KPHA 2LVJA 1Y1AA 2PSRA 4PE0A 1CB1A 2YGUA 2ISDA 2KFFA 1F71A 3OX6A 1OMDA 2F2PA 3V2LA 1AK8A 2L2EA 3A8RA 1IJ5A 1Q80A 3DYEA 3LLEA 2LUCA 3SS5A 1QVIY 3OHMB 4A4CA 3VRRA 1TUZA 3ICBA 2FCDA 2PASA 1DEKA 2WCBA 1UHHA 2NCOA 4PDZA 4QJ5B 2EC6C 2LP3A 4AOMA 4NQGA 2M97A 2WCJA 4MN0A 4P5OE 1S6JA 2WORA 2KI4B 3AKBA 4DRWA 1CDNA 1KK7Y 1XVJA 2JRFA 2WCEA 1IRJA 5HLVA 2OS8C 1AJ5A 1TN4A 2Y4QA 1KCYA 2CT9A 2Q4UA 3NSKA 4MRYA 2JU0A 2SASA 5G08A 3RLZA 2BCXA 3O78A 4YGAA 2V53A 1B1GA 1NCZA 2JPOA 3Q8IA 4GFTA 3FIAA 3IVTA 3DY9A 1QWVA 1JSAA 1PVAA 3IF7A 1OQPA 4UPGA 3CLNA 3VRQA 1A2XA 3JVTC 3B6XA 1GGZA 1RJVA 1N65A 5I2LA 4E68A 1DJHA 2LMUA 5KU1A 1IH0A 4ICBA 3DF0A 1C7VA 1OOFA 4IJ7A 1A4PA 2PRUA 3I5GC 1JFKA 4DCKA 4GPLB 3JTDC 1K9KA 1GQMA 1IQ5A 1SL7A 1LA3A 1JC2A 1G4YR 1J55A 2JT0A 1MR8A 1SK6D 1UHNA 1W7IB 2L5YA 3CWGA 2CXJA 3TS5C 2KBIA 1XYDA 2PQLA 3L47A 1M39A 1CLBA 3CDNA 1N2DA 1BG1A 1OOGA 1QV0A 4XJKB 5DKNA 1L2OC 2JZIA 2K60A 3S0AA 2HQ8A 1IJ6A 2LP2A 3IQQA 2M8UA 1TNWA 1F4QA 3I5FB 4DUQA 1E8AA 2BKHB 4PHKA 1XO5A 2I7AA 3M0WA 3VB1A 1DELA 5HKZA 2LVKA 1RECA 3NSLA 1G8IA 2QEBA 1H8BA 2GV5A 1AJ4A 5EL2A 1KWOC 1LS8A 2LHLA 1NX3A 1YUUA 1WDCB 2PMYA 1MUXA 1SBJA 3R1PA 3D78A 1R6PA 1TWOA 3KPXA 2HETA 4INWA 4PE4A 3OX5A 5FYXA 1FI5A 1AHRA 5HKWA 4QJ3B 1K9UA 2ZNDA 2LCPA 5HKYA 1MWNA 3OBVA 3VROA 3HX4A 4GGFC 1RFJA 1UHJA 1VRKA 4MRXA 3NGVA 4AQJA 1NX1A 2KLEA 2LLTA 2ZN8A 1QX5B 2WCLA 3DVJA 4MZJA 1OOIX 2I2RE 3K21A 3WHTB 5HL1A 5CSIA 3N7HA 2WNDA 2KI6D 4YI9A 5D3OA 1NYAA 1TOPA 2QACA 3D0YA 1J7PA 1KFUS 2L51A 2RGIA 1B8LA 1CDPA 3OGNA 4GGNA 2BE4A 1S6IA 2MBXA 1CNPA 1U5IA 2CNPA 3RZSA 3SIBA 4NDBA 2JOJA 3EVRA 1F55A 5J3XA 5CSFA 2JWWA 1JBAA 1QATA 1F70A 1DF0A 3BUXB 2JTZA 1NUBA 2JXCA 2Y5IA 1QJTA 3RM1A 1ZACA 4IL1A 3EG5B 1EJ3A 1XFWO 3NXAA 3FS7A 2OTGC 3DD4A 1JUOA 3VGOA 4YGDB 1SR6B 5ER5A 2K2AA 4OVNF 1NIWA 2BBMA 1BR1B 3I5HC 1A03A 1XFXO 3HCMA 2FJYA 3I5IC 5FI2A 1A29A 2GGMA 2DOQA 1NP8A 4WQ2A 1EH2A 1CM1A 3EK4A 2BAPA 2QEHA 2KGRA 3SG6A 3L4AA 3GOFA 4I5LB 1SRAA 1Y0VH 4C0LA 2WCMA 3SG3A 4YGEB 3B88A 3VRPA 3EK7A 1ZMZA 3TUYC 1Y1UA 2KSPA 2M9GA 2K7DA 3SG4A 4FQOA 4ORBB 1P28A 3H4SE 1YX8A 4DIRA 5AANA 1TNPA 1SY9A 1Z4HA 1EG4A 3DVKA 1RROA 2LC5A 2VRGA 1B7TZ 1WLMA 3BUNB 4OKHA 3ZNIA 3VRNA 4BY5A 2LNKA 3TDZA 4CLNA 2K8MB 1L7ZA 2JT3A 3JVTB 3LL8B 1YX7A 2KNEA 1KFUL 2LLUA 1A75B 1FW4A 2M0RA 3KF9A 3OB1B 3S0BA 4CPVA 1B8RA 1DT7B 2PALA 4GUKA 1CDMA 2H2KA 4PCWA 1DMOA 5AEQA 3R1VA 2F3YA 2COLB 3I5GB 3QRXA 3S0EA 5FI6A 1BLQA 2I18A 1K90D 2I94A 2LV7A 4GGFA 4ORCB 1PRWA 5B8IB 3O2PA 5I2QA 3O4XA 1UWOA 4FTGA 2P70A 3CS1A 3TS5B 1IKUA 1DJGA 2M3WA 1DC1A 2QPTA 3GK4X 3D77A 1YTZC 2KGBC 3AAKA 1N0YA 1RTP1 2GTEA 4OCIA 1RWYA 1DGVA 2QEOA 3KEVA 4U8DA 3S0DA 1V1GA 5HYDA 1GM0A 1DVIA 4XJKA 3SG7A 2BCBA 1CFPA 1AVSA 4OR9B 1ZOTB 1CKKA 1C7WA 2E6WA 4JWQA 1BU3A 4WQ3A 2KAYA 4CIDA 4CFRA 1CFCA 1CM4A 1NCXA 4JPZB 2TN4A 3K1EA 5F6TA 1K9PA 3D76A 3LCPC 2KDHA 2K7OA 4DS7A 1UHIA 2LMVA 3PLFB 2ZKMX 1S5GZ 1EG3A 3CZTX 4USLA 1D1OA
chains in the Genus database with same CATH topology
5ER4X 4AQIA 3ZWHA 2NLNA 2LLSA 1XFYO 3E3RA 4CFQA 1MXEA 1OZSA 1CDLA 1BJFA 1XA5A 2ZRTA 3DVEA 1PVBA 3BOWB 3KHEA 1NWDA 1TTXA 2KOTA 5BPJA 4NDDA 4YI8A 1OE9B 4I5NB 1JF0A 1OMVA 2ZNEA 4MLWA 1SCMC 1SL9A 1S6CA 2GGZA 2M1KB 1YUSA 3DF0B 2JTTA 3CGAA 2KBMA 3DVMA 2ZN9A 1DJIA 2LM5A 1WRLA 1X02A 3KO0A 3AAJA 1ZFSA 1K2HA 4NDCA 4QJ4B 1J7OA 1KQMC 2OPOA 4M2PA 2O60A 2G2BA 5I2OA 2KQYA 1JWDA 4C0KA 1B9AA 1XFVO 2B1UA 2M7LA 4HRHA 4PE1A 3NSIA 1M46A 3EK8A 5AXIA 2KFGA 5KSZA 1SKTA 1BF5A 2PVBA 1G33A 4GAOA 1KSMA 2BKIB 2JNXA 2MAZA 1K95A 2JXLA 1WY9A 1KK8C 2M29A 4YBHB 2F3ZA 3I5FC 1M45A 3BXKA 1ZUZA 2F33A 1KQVA 1IWQA 1S1EA 2BL0B 3I5IB 1UURA 4N1FA 5JJGA 4R1EA 2K7CA 4GNKB 1PALA 1FBVA 3F45A 4P2YB 1ODBA 3FWBA 1LKJA 1QTXA 1WDCC 2NZ0A 3EVVA 2A4JA 5PALA 3EVUA 1YUTA 1XFZO 3CR2A 1NPQA 1S36A 1CLLA 3EKJA 1EXRA 3PALA 3OB2B 1OZOA 1V1FA 1QV1A 3A4UB 2LVVA 1LINA 1K94A 2M7NA 2CCMA 2EC6B 3LK0A 1IQ3A 1YVLA 1BOCA 1R2UA 2KQ6A 1TRFA 5D69A 1B7TY 1CFFA 5HLOA 1NCYA 2P6BB 1J1DA 1XK4A 3D0YB 1SPYA 1PSRA 1HQVA 2OS8B 1YRUB 1MHOA 2JNFA 1QXPA 1SCVA 1UHKA 2R2IA 5GQQC 4A4BA 1AP4A 3O4YA 1LXFC 2Y1NA 1XFUO 1QASA 3CR4X 2BCAA 2K61A 2JT8A 2ZRSA 4MSPA 5AFPA 3TDUA 3EKHA 1JFJA 4JQ0D 5CPVA 1GGWA 2E30A 3PFVA 2IS9A 4ZCUA 1AUIB 3SJSA 2K0JA 1KFXS 1FI6A 1RK9A 1YVHA 1IGVA 2BBNA 2H61A 3PATA 2AMIA 2L0PA 4GBAA 5CSJA 1EL4A 1F4OA 3AKAA 1K96A 1NX2A 3PN7C 4XYNA 5I8NA 2K7BA 2MHHA 1SR6C 2JC2A 3GK2A 1DJZA 5TNCA 4MBEA 2NCPA 3JTDB 1QIVA 2FOTA 4MZKA 3TZ1A 4YGBB 1IG5A 1JF2A 1Y6WA 2BE6A 4MZLA 1QS7A 1B47A 1BMOA 2FJUB 2JPTA 4TNCA 2M1UA 2HQWA 1FF1A 1SW8A 1UUSA 1QLSA 2JQ6A 2L98A 1J7QA 2LVIA 1SYMA 1QVIZ 1L2OB 2AAOA 3D10A 3PM8A 1YR5A 4OV2A 1S5GY 5AERA 1MQ1A 1NX0A 4ZCVA 2WOSA 2KYCA 4D1EA 2BECA 2NXQA 3WXAA 4PALA 2LANA 3WNXB 3LK1A 1CMGA 1MF8B 1KWOB 1QX7A 1XK4C 3BOWA 4M2OA 1KK7Z 4M2QA 1SCMB 1WRZA 2KI4C 1OOJA 1OSAA 1C07A 4C0JA 5D7FA 1M63B 1ALWA 1QX2A 1TNQA 2KAXA 5IBWA 1SMGA 2G9BA 2ZFDA 3C1VA 2LUXA 4ORAB 3BQ3A 1TNXA 1MXLC 3SG2A 2K2FA 3MSEB 1KQMB 1KFXL 1Y1XA 4F0ZB 2H61C 4HRGA 1QLKA 5K89A 4Q04A 1NSHA 1F54A 4PHMA 1BODA 1TCOB 1YRTB 3CR5X 2MJWB 1KK8B 1H4BA 1PK0D 2MLFC 3WHUB 5CSNA 1J1EA 1B8CA 2JULA 2HPSA 2CBLA 2Y1MA 2MRDA 3IQOA 1DJXA 1K8UA 2LMTA 2HF5A 2KYFA 2MLEC 3BUMB 2O5GA 2MA2A 5KTYA 1PULA 1OMRA 1TCFA 1K93D 1HT9A 2OTGB 3GK1A 3BUOB 4I5KA 3SIAA 3OP0A 1PSBA 5DKQA 2CTNA 1DJYA 2D8NA 1F8HA 4N1GA 3BUWB 4ETOA 2KAVA 5JOLA 2EHBA 4PE7A 1W7JB 3I5HB 1LA0A 4HSZA 1ALVA 2KI6C 3SG5A 1CTRA 1BT6A 1CFDA 2LAPA 1FPWA 2LHIA 2F8PA 4PHJA 2LE9B 2AUCA 4WRIA 1LVCD 1YURA 2L4IA 1KSOA 3FWCA 3CTNA 1BR4B 3TUYB 4MEWA 1DJWA 3O6BA 2L5XB 2WCFA 1CMFA 2EGDA 1UP5A 4BY4A 1DTLA 3PSRA 4YRUA 1J7RA 4L9MA 1CLMA 1B4CA 2F2OA 1S26D 4I5JA 1SNLA 1WLZA 2L4HA 4HREE 2SCPA 2KHNA 2Q91A 1U5IB 3PN7B 4PHNA 1A75A 4MVFA 3NSOA 1GJYA 2L50A 2M49B 3TDIA 2KFHA 1M31A 1DGUA 5DKRA 1DF0B 2FCEA 1WRKA 2BL0C 4YGCB 1QIWA 4N5XA 1S3PA 3BYAA 1TIZA 2WC8A 1SL8A 2LVJA 2PSRA 1Y1AA 4PE0A 1CB1A 2ISDA 2KFFA 1F71A 3OX6A 1OMDA 2F2PA 1AK8A 2L2EA 3A8RA 1IJ5A 1Q80A 3LLEA 2LUCA 1QVIY 3OHMB 4A4CA 3VRRA 3ICBA 2FCDA 2PASA 2WCBA 1UHHA 2NCOA 4PDZA 4QJ5B 2EC6C 2LP3A 4AOMA 4NQGA 2M97A 4MN0A 4P5OE 4DRWA 1S6JA 2WORA 2KI4B 3AKBA 1CDNA 1KK7Y 1XVJA 2JRFA 2WCEA 1IRJA 5HLVA 2OS8C 1AJ5A 1TN4A 2Y4QA 1KCYA 2CT9A 2Q4UA 3NSKA 4MRYA 2JU0A 2SASA 5G08A 3RLZA 2BCXA 3O78A 4YGAA 2V53A 1B1GA 1NCZA 4GFTA 3FIAA 1JSAA 1PVAA 3IF7A 1OQPA 4UPGA 3CLNA 3VRQA 1A2XA 3JVTC 1GGZA 1RJVA 1N65A 5I2LA 4E68A 1DJHA 2LMUA 5KU1A 1IH0A 4ICBA 3DF0A 1C7VA 1A4PA 2PRUA 3I5GC 1JFKA 4DCKA 4GPLB 3JTDC 1K9KA 1GQMA 1IQ5A 1SL7A 1LA3A 1JC2A 1G4YR 1J55A 2JT0A 1MR8A 1SK6D 1UHNA 1W7IB 3TS5C 3CWGA 2CXJA 2KBIA 1XYDA 1M39A 1CLBA 1N2DA 1BG1A 1QV0A 4XJKB 5DKNA 1L2OC 2JZIA 2HQ8A 1IJ6A 2LP2A 3IQQA 2M8UA 1TNWA 1F4QA 3I5FB 4DUQA 1E8AA 2BKHB 4PHKA 1XO5A 2I7AA 3M0WA 5HKZA 2LVKA 1RECA 3NSLA 1G8IA 1H8BA 2GV5A 1AJ4A 1KWOC 2LHLA 1NX3A 1YUUA 1WDCB 2PMYA 1MUXA 1SBJA 1R6PA 1FI5A 3KPXA 2HETA 5FYXA 4PE4A 3OX5A 1AHRA 5HKWA 4QJ3B 1K9UA 2ZNDA 2LCPA 5HKYA 1MWNA 3VROA 3HX4A 4GGFC 1RFJA 1UHJA 1VRKA 4MRXA 4AQJA 1NX1A 2LLTA 2ZN8A 1QX5B 3DVJA 4MZJA 2I2RE 3K21A 3WHTB 5CSIA 2WNDA 2KI6D 4YI9A 1NYAA 1TOPA 2QACA 3D0YA 1J7PA 1KFUS 2L51A 2RGIA 1B8LA 1CDPA 4GGNA 1CNPA 2BE4A 1S6IA 2MBXA 1U5IA 2CNPA 3SIBA 4NDBA 2JOJA 3EVRA 1F55A 5J3XA 5CSFA 2JWWA 1JBAA 1QATA 1F70A 1DF0A 3BUXB 2JTZA 1NUBA 2JXCA 2Y5IA 1QJTA 3RM1A 1ZACA 4IL1A 1EJ3A 1XFWO 3NXAA 3FS7A 2OTGC 3DD4A 1JUOA 3VGOA 4YGDB 1SR6B 5ER5A 2K2AA 4OVNF 1NIWA 2BBMA 1BR1B 3I5HC 1A03A 1XFXO 3HCMA 3I5IC 1A29A 2GGMA 2DOQA 1NP8A 4WQ2A 1EH2A 1CM1A 3EK4A 2KGRA 3SG6A 3GOFA 4I5LB 1SRAA 1Y0VH 4C0LA 3SG3A 4YGEB 3VRPA 3EK7A 1ZMZA 3TUYC 1Y1UA 2KSPA 2M9GA 2K7DA 3SG4A 4FQOA 4ORBB 3H4SE 1YX8A 4DIRA 5AANA 1TNPA 1SY9A 3DVKA 1EG4A 1RROA 2LC5A 2VRGA 1B7TZ 1WLMA 3BUNB 4OKHA 3ZNIA 3VRNA 4BY5A 2LNKA 3TDZA 4CLNA 2K8MB 1L7ZA 2JT3A 3JVTB 3LL8B 1YX7A 2KNEA 1KFUL 2LLUA 1A75B 1FW4A 2M0RA 3KF9A 3OB1B 4CPVA 1B8RA 1DT7B 2PALA 4GUKA 1CDMA 2H2KA 4PCWA 1DMOA 5AEQA 1BLQA 2F3YA 2COLB 3I5GB 3QRXA 2I18A 1K90D 2I94A 2LV7A 4GGFA 4ORCB 1PRWA 5B8IB 3O2PA 5I2QA 1UWOA 4FTGA 3CS1A 3TS5B 1IKUA 1DJGA 2M3WA 2QPTA 3GK4X 1YTZC 2KGBC 3AAKA 1N0YA 1RTP1 4OCIA 1RWYA 1DGVA 3KEVA 4U8DA 5HYDA 1V1GA 1DVIA 4XJKA 3SG7A 2BCBA 1CFPA 1AVSA 4OR9B 1ZOTB 1CKKA 1C7WA 2E6WA 4JWQA 1BU3A 4WQ3A 2KAYA 4CIDA 4CFRA 1CFCA 1CM4A 1NCXA 4JPZB 2TN4A 5F6TA 1K9PA 3LCPC 2KDHA 2K7OA 4DS7A 1UHIA 2LMVA 3PLFB 2ZKMX 1S5GZ 1EG3A 3CZTX 4USLA 1D1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER4 X;  4AQI A;  3ZWH A;  2NLN A;  2LLS A;  1XFY O;  3E3R A;  4CFQ A;  1MXE A;  1OZS A;  1CDL A;  1BJF A;  1XA5 A;  2ZRT A;  3DVE A;  1PVB A;  3BOW B;  3KHE A;  1NWD A;  1TTX A;  2KOT A;  5BPJ A;  4NDD A;  4YI8 A;  1OE9 B;  4I5N B;  1JF0 A;  1OMV A;  2ZNE A;  4MLW A;  1SCM C;  1SL9 A;  1S6C A;  2GGZ A;  2M1K B;  1YUS A;  3DF0 B;  2JTT A;  3CGA A;  2KBM A;  3DVM A;  2ZN9 A;  1DJI A;  2LM5 A;  1WRL A;  1X02 A;  3KO0 A;  3AAJ A;  1ZFS A;  1K2H A;  4NDC A;  4QJ4 B;  1J7O A;  1KQM C;  2OPO A;  4M2P A;  2O60 A;  2G2B A;  5I2O A;  2KQY A;  1JWD A;  4C0K A;  1B9A A;  1XFV O;  2B1U A;  2M7L A;  4HRH A;  4PE1 A;  3NSI A;  1M46 A;  3EK8 A;  5AXI A;  2KFG A;  5KSZ A;  1SKT A;  1BF5 A;  2PVB A;  1G33 A;  4GAO A;  1KSM A;  2BKI B;  2JNX A;  2MAZ A;  1K95 A;  2JXL A;  1WY9 A;  1KK8 C;  2M29 A;  4YBH B;  2F3Z A;  3I5F C;  1M45 A;  3BXK A;  1ZUZ A;  2F33 A;  1KQV A;  1IWQ A;  1S1E A;  2BL0 B;  3I5I B;  1UUR A;  4N1F A;  5JJG A;  4R1E A;  2K7C A;  4GNK B;  1PAL A;  1FBV A;  3F45 A;  4P2Y B;  1ODB A;  3FWB A;  1LKJ A;  1QTX A;  1WDC C;  2NZ0 A;  3EVV A;  2A4J A;  5PAL A;  3EVU A;  1YUT A;  1XFZ O;  3CR2 A;  1NPQ A;  1S36 A;  1CLL A;  3EKJ A;  1EXR A;  3PAL A;  3OB2 B;  1OZO A;  1V1F A;  1QV1 A;  3A4U B;  2LVV A;  1LIN A;  1K94 A;  2M7N A;  2CCM A;  2EC6 B;  3LK0 A;  1IQ3 A;  1YVL A;  1BOC A;  1R2U A;  2KQ6 A;  1TRF A;  5D69 A;  1B7T Y;  1CFF A;  5HLO A;  1NCY A;  2P6B B;  1J1D A;  1XK4 A;  3D0Y B;  1SPY A;  1PSR A;  1HQV A;  2OS8 B;  1YRU B;  1MHO A;  2JNF A;  1QXP A;  1SCV A;  1UHK A;  2R2I A;  5GQQ C;  4A4B A;  1AP4 A;  3O4Y A;  1LXF C;  2Y1N A;  1XFU O;  1QAS A;  3CR4 X;  2BCA A;  2K61 A;  2JT8 A;  2ZRS A;  4MSP A;  5AFP A;  3TDU A;  3EKH A;  1JFJ A;  4JQ0 D;  5CPV A;  1GGW A;  2E30 A;  3PFV A;  2IS9 A;  4ZCU A;  1AUI B;  3SJS A;  2K0J A;  1KFX S;  1FI6 A;  1RK9 A;  1YVH A;  1IGV A;  2BBN A;  2H61 A;  3PAT A;  2AMI A;  2L0P A;  4GBA A;  5CSJ A;  1EL4 A;  1F4O A;  3AKA A;  1K96 A;  1NX2 A;  3PN7 C;  4XYN A;  5I8N A;  2K7B A;  2MHH A;  1SR6 C;  2JC2 A;  3GK2 A;  1DJZ A;  5TNC A;  4MBE A;  2NCP A;  3JTD B;  1QIV A;  2FOT A;  4MZK A;  3TZ1 A;  4YGB B;  1IG5 A;  1JF2 A;  1Y6W A;  2BE6 A;  4MZL A;  1QS7 A;  1B47 A;  1BMO A;  2FJU B;  2JPT A;  4TNC A;  2M1U A;  2HQW A;  1FF1 A;  1SW8 A;  1UUS A;  1QLS A;  2JQ6 A;  2L98 A;  1J7Q A;  2LVI A;  1SYM A;  1QVI Z;  1L2O B;  2AAO A;  3D10 A;  3PM8 A;  1YR5 A;  4OV2 A;  1S5G Y;  5AER A;  1MQ1 A;  1NX0 A;  4ZCV A;  2WOS A;  2KYC A;  4D1E A;  2BEC A;  2NXQ A;  3WXA A;  4PAL A;  2LAN A;  3WNX B;  3LK1 A;  1CMG A;  1MF8 B;  1KWO B;  1QX7 A;  1XK4 C;  3BOW A;  4M2O A;  1KK7 Z;  4M2Q A;  1SCM B;  1WRZ A;  2KI4 C;  1OOJ A;  1OSA A;  1C07 A;  4C0J A;  5D7F A;  1M63 B;  1ALW A;  1QX2 A;  1TNQ A;  2KAX A;  5IBW A;  1SMG A;  2G9B A;  2ZFD A;  3C1V A;  2LUX A;  4ORA B;  3BQ3 A;  1TNX A;  1MXL C;  3SG2 A;  2K2F A;  3MSE B;  1KQM B;  1KFX L;  1Y1X A;  4F0Z B;  2H61 C;  4HRG A;  1QLK A;  5K89 A;  4Q04 A;  1NSH A;  1F54 A;  4PHM A;  1BOD A;  1TCO B;  1YRT B;  3CR5 X;  2MJW B;  1KK8 B;  1H4B A;  1PK0 D;  2MLF C;  3WHU B;  5CSN A;  1J1E A;  1B8C A;  2JUL A;  2HPS A;  2CBL A;  2Y1M A;  2MRD A;  3IQO A;  1DJX A;  1K8U A;  2LMT A;  2HF5 A;  2KYF A;  2MLE C;  3BUM B;  2O5G A;  2MA2 A;  5KTY A;  1PUL A;  1OMR A;  1TCF A;  1K93 D;  1HT9 A;  2OTG B;  3GK1 A;  3BUO B;  4I5K A;  3SIA A;  3OP0 A;  1PSB A;  5DKQ A;  2CTN A;  1DJY A;  2D8N A;  1F8H A;  4N1G A;  3BUW B;  4ETO A;  2KAV A;  5JOL A;  2EHB A;  4PE7 A;  1W7J B;  3I5H B;  1LA0 A;  4HSZ A;  1ALV A;  2KI6 C;  3SG5 A;  1CTR A;  1BT6 A;  1CFD A;  2LAP A;  1FPW A;  2LHI A;  2F8P A;  4PHJ A;  2LE9 B;  2AUC A;  4WRI A;  1LVC D;  1YUR A;  2L4I A;  1KSO A;  3FWC A;  3CTN A;  1BR4 B;  3TUY B;  4MEW A;  1DJW A;  3O6B A;  2L5X B;  2WCF A;  1CMF A;  2EGD A;  1UP5 A;  4BY4 A;  1DTL A;  3PSR A;  4YRU A;  1J7R A;  4L9M A;  1CLM A;  1B4C A;  2F2O A;  1S26 D;  4I5J A;  1SNL A;  1WLZ A;  2L4H A;  4HRE E;  2SCP A;  2KHN A;  2Q91 A;  1U5I B;  3PN7 B;  4PHN A;  1A75 A;  4MVF A;  3NSO A;  1GJY A;  2L50 A;  2M49 B;  3TDI A;  2KFH A;  1M31 A;  1DGU A;  5DKR A;  1DF0 B;  2FCE A;  1WRK A;  2BL0 C;  4YGC B;  1QIW A;  4N5X A;  1S3P A;  3BYA A;  1TIZ A;  2WC8 A;  1SL8 A;  2LVJ A;  2PSR A;  1Y1A A;  4PE0 A;  1CB1 A;  2ISD A;  2KFF A;  1F71 A;  3OX6 A;  1OMD A;  2F2P A;  1AK8 A;  2L2E A;  3A8R A;  1IJ5 A;  1Q80 A;  3LLE A;  2LUC A;  1QVI Y;  3OHM B;  4A4C A;  3VRR A;  3ICB A;  2FCD A;  2PAS A;  2WCB A;  1UHH A;  2NCO A;  4PDZ A;  4QJ5 B;  2EC6 C;  2LP3 A;  4AOM A;  4NQG A;  2M97 A;  4MN0 A;  4P5O E;  4DRW A;  1S6J A;  2WOR A;  2KI4 B;  3AKB A;  1CDN A;  1KK7 Y;  1XVJ A;  2JRF A;  2WCE A;  1IRJ A;  5HLV A;  2OS8 C;  1AJ5 A;  1TN4 A;  2Y4Q A;  1KCY A;  2CT9 A;  2Q4U A;  3NSK A;  4MRY A;  2JU0 A;  2SAS A;  5G08 A;  3RLZ A;  2BCX A;  3O78 A;  4YGA A;  2V53 A;  1B1G A;  1NCZ A;  4GFT A;  3FIA A;  1JSA A;  1PVA A;  3IF7 A;  1OQP A;  4UPG A;  3CLN A;  3VRQ A;  1A2X A;  3JVT C;  1GGZ A;  1RJV A;  1N65 A;  5I2L A;  4E68 A;  1DJH A;  2LMU A;  5KU1 A;  1IH0 A;  4ICB A;  3DF0 A;  1C7V A;  1A4P A;  2PRU A;  3I5G C;  1JFK A;  4DCK A;  4GPL B;  3JTD C;  1K9K A;  1GQM A;  1IQ5 A;  1SL7 A;  1LA3 A;  1JC2 A;  1G4Y R;  1J55 A;  2JT0 A;  1MR8 A;  1SK6 D;  1UHN A;  1W7I B;  3TS5 C;  3CWG A;  2CXJ A;  2KBI A;  1XYD A;  1M39 A;  1CLB A;  1N2D A;  1BG1 A;  1QV0 A;  4XJK B;  5DKN A;  1L2O C;  2JZI A;  2HQ8 A;  1IJ6 A;  2LP2 A;  3IQQ A;  2M8U A;  1TNW A;  1F4Q A;  3I5F B;  4DUQ A;  1E8A A;  2BKH B;  4PHK A;  1XO5 A;  2I7A A;  3M0W A;  5HKZ A;  2LVK A;  1REC A;  3NSL A;  1G8I A;  1H8B A;  2GV5 A;  1AJ4 A;  1KWO C;  2LHL A;  1NX3 A;  1YUU A;  1WDC B;  2PMY A;  1MUX A;  1SBJ A;  1R6P A;  1FI5 A;  3KPX A;  2HET A;  5FYX A;  4PE4 A;  3OX5 A;  1AHR A;  5HKW A;  4QJ3 B;  1K9U A;  2ZND A;  2LCP A;  5HKY A;  1MWN A;  3VRO A;  3HX4 A;  4GGF C;  1RFJ A;  1UHJ A;  1VRK A;  4MRX A;  4AQJ A;  1NX1 A;  2LLT A;  2ZN8 A;  1QX5 B;  3DVJ A;  4MZJ A;  2I2R E;  3K21 A;  3WHT B;  5CSI A;  2WND A;  2KI6 D;  4YI9 A;  1NYA A;  1TOP A;  2QAC A;  3D0Y A;  1J7P A;  1KFU S;  2L51 A;  2RGI A;  1B8L A;  1CDP A;  4GGN A;  1CNP A;  2BE4 A;  1S6I A;  2MBX A;  1U5I A;  2CNP A;  3SIB A;  4NDB A;  2JOJ A;  3EVR A;  1F55 A;  5J3X A;  5CSF A;  2JWW A;  1JBA A;  1QAT A;  1F70 A;  1DF0 A;  3BUX B;  2JTZ A;  1NUB A;  2JXC A;  2Y5I A;  1QJT A;  3RM1 A;  1ZAC A;  4IL1 A;  1EJ3 A;  1XFW O;  3NXA A;  3FS7 A;  2OTG C;  3DD4 A;  1JUO A;  3VGO A;  4YGD B;  1SR6 B;  5ER5 A;  2K2A A;  4OVN F;  1NIW A;  2BBM A;  1BR1 B;  3I5H C;  1A03 A;  1XFX O;  3HCM A;  3I5I C;  1A29 A;  2GGM A;  2DOQ A;  1NP8 A;  4WQ2 A;  1EH2 A;  1CM1 A;  3EK4 A;  2KGR A;  3SG6 A;  3GOF A;  4I5L B;  1SRA A;  1Y0V H;  4C0L A;  3SG3 A;  4YGE B;  3VRP A;  3EK7 A;  1ZMZ A;  3TUY C;  1Y1U A;  2KSP A;  2M9G A;  2K7D A;  3SG4 A;  4FQO A;  4ORB B;  3H4S E;  1YX8 A;  4DIR A;  5AAN A;  1TNP A;  1SY9 A;  3DVK A;  1EG4 A;  1RRO A;  2LC5 A;  2VRG A;  1B7T Z;  1WLM A;  3BUN B;  4OKH A;  3ZNI A;  3VRN A;  4BY5 A;  2LNK A;  3TDZ A;  4CLN A;  2K8M B;  1L7Z A;  2JT3 A;  3JVT B;  3LL8 B;  1YX7 A;  2KNE A;  1KFU L;  2LLU A;  1A75 B;  1FW4 A;  2M0R A;  3KF9 A;  3OB1 B;  4CPV A;  1B8R A;  1DT7 B;  2PAL A;  4GUK A;  1CDM A;  2H2K A;  4PCW A;  1DMO A;  5AEQ A;  1BLQ A;  2F3Y A;  2COL B;  3I5G B;  3QRX A;  2I18 A;  1K90 D;  2I94 A;  2LV7 A;  4GGF A;  4ORC B;  1PRW A;  5B8I B;  3O2P A;  5I2Q A;  1UWO A;  4FTG A;  3CS1 A;  3TS5 B;  1IKU A;  1DJG A;  2M3W A;  2QPT A;  3GK4 X;  1YTZ C;  2KGB C;  3AAK A;  1N0Y A;  1RTP 1;  4OCI A;  1RWY A;  1DGV A;  3KEV A;  4U8D A;  5HYD A;  1V1G A;  1DVI A;  4XJK A;  3SG7 A;  2BCB A;  1CFP A;  1AVS A;  4OR9 B;  1ZOT B;  1CKK A;  1C7W A;  2E6W A;  4JWQ A;  1BU3 A;  4WQ3 A;  2KAY A;  4CID A;  4CFR A;  1CFC A;  1CM4 A;  1NCX A;  4JPZ B;  2TN4 A;  5F6T A;  1K9P A;  3LCP C;  2KDH A;  2K7O A;  4DS7 A;  1UHI A;  2LMV A;  3PLF B;  2ZKM X;  1S5G Z;  1EG3 A;  3CZT X;  4USL A;  1D1O A; 
#chains in the Genus database with same CATH topology
 5ER4 X;  3PJI A;  4AQI A;  3ZWH A;  2NLN A;  2LLS A;  1XFY O;  3E3R A;  4CFQ A;  1MXE A;  1OZS A;  1CDL A;  1BJF A;  1XA5 A;  2ZRT A;  3DVE A;  1PVB A;  2L2C A;  3BOW B;  1NWD A;  3KHE A;  1TTX A;  2KOT A;  5BPJ A;  4NDD A;  4YI8 A;  1OE9 B;  4I5N B;  1JF0 A;  1OMV A;  2ZNE A;  4MLW A;  1SCM C;  4F7F A;  1SL9 A;  1S6C A;  2GGZ A;  2M1K B;  1YUS A;  3DF0 B;  2JTT A;  3CGA A;  2KBM A;  3DVM A;  2ZN9 A;  1DJI A;  2LM5 A;  1WRL A;  1X02 A;  2WC6 A;  3KO0 A;  3AAJ A;  1ZFS A;  1K2H A;  4FQT A;  4NDC A;  4QJ4 B;  1J7O A;  1KQM C;  2OPO A;  4JD9 A;  4M2P A;  2O60 A;  2G2B A;  5I2O A;  2KQY A;  1JWD A;  4C0K A;  1B9A A;  1XFV O;  2B1U A;  2M7L A;  1W9Z A;  4HRH A;  4PE1 A;  3NSI A;  1M46 A;  3EK8 A;  5AXI A;  2KFG A;  5KSZ A;  1SKT A;  1BF5 A;  2PVB A;  1G33 A;  4GAO A;  1KSM A;  2BKI B;  2JNX A;  2MAZ A;  1K95 A;  2JXL A;  1WY9 A;  1KK8 C;  2M29 A;  4YBH B;  2F3Z A;  1OW4 A;  3I5F C;  1M45 A;  3BXK A;  1ZUZ A;  2F33 A;  1KQV A;  1IWQ A;  1S1E A;  2BL0 B;  3I5I B;  1UUR A;  4N1F A;  5JJG A;  3BFH A;  4R1E A;  2K7C A;  3R72 A;  4GNK B;  1PAL A;  1IIO A;  1FBV A;  3F45 A;  4P2Y B;  1ODB A;  1SSE B;  3FWB A;  1LKJ A;  1QTX A;  1WDC C;  2KLD A;  2NZ0 A;  2A4J A;  3EVV A;  5PAL A;  3EVU A;  1YUT A;  3B7A A;  1XFZ O;  3CR2 A;  1NPQ A;  1S36 A;  1CLL A;  1OOH A;  3EKJ A;  1EXR A;  3PAL A;  3OB2 B;  1OZO A;  1V1F A;  1QV1 A;  3B86 A;  3A4U B;  2LVV A;  1LIN A;  3DZT A;  1K94 A;  2M7N A;  2CCM A;  2EC6 B;  3NHT A;  3LK0 A;  1IQ3 A;  1YVL A;  3CAB A;  1BOC A;  3NHI A;  1R2U A;  2KQ6 A;  1TRF A;  5D69 A;  1B7T Y;  1CFF A;  5HLO A;  1NCY A;  2P6B B;  1J1D A;  1XK4 A;  3D0Y B;  1SPY A;  1PSR A;  1HQV A;  2OS8 B;  1YRU B;  1MHO A;  2JNF A;  1QXP A;  1SCV A;  1UHK A;  2R2I A;  5GQQ C;  4A4B A;  1AP4 A;  3O4Y A;  1LXF C;  2Y1N A;  1XFU O;  1QAS A;  3L4L A;  3CR4 X;  2BCA A;  2K61 A;  1XFR A;  2JT8 A;  2ZRS A;  3BFB A;  4MSP A;  5AFP A;  3TDU A;  3FE9 A;  3EKH A;  1JFJ A;  4JQ0 D;  5CPV A;  1GGW A;  2E30 A;  3PFV A;  2IS9 A;  4ZCU A;  1AUI B;  3SJS A;  2K0J A;  1KFX S;  2QEV A;  1FI6 A;  1RK9 A;  1YVH A;  1IGV A;  2BBN A;  2H61 A;  3D75 A;  3PAT A;  2AMI A;  2L0P A;  4GBA A;  5CSJ A;  1EL4 A;  1F4O A;  3AKA A;  1K96 A;  1NX2 A;  3PN7 C;  3S0G A;  5FI7 A;  4XYN A;  5I8N A;  2K7B A;  2MHH A;  1SR6 C;  2JC2 A;  2WCH A;  1DJZ A;  3GK2 A;  4MBE A;  2NCP A;  3JTD B;  1QIV A;  2FOT A;  4MZK A;  5TNC A;  3TZ1 A;  4YGB B;  3CYZ A;  1IG5 A;  5I94 A;  2BNX A;  1JF2 A;  3CZ1 A;  1Y6W A;  2BE6 A;  4MZL A;  1QS7 A;  1B47 A;  1BMO A;  2FJU B;  4KYN A;  2JPT A;  4TNC A;  5DIC A;  2M1U A;  2HQW A;  3BJH A;  1FF1 A;  1SW8 A;  1UUS A;  1QLS A;  2JQ6 A;  2L98 A;  1C3Y A;  1J7Q A;  2LVI A;  1SYM A;  1QVI Z;  1L2O B;  2AAO A;  3D10 A;  3PM8 A;  1YR5 A;  4OV2 A;  1S5G Y;  5AER A;  1MQ1 A;  1NX0 A;  4ZCV A;  2WOS A;  2KYC A;  4D1E A;  2BEC A;  2ERB A;  2NXQ A;  3WXA A;  4PAL A;  2LAN A;  3WNX B;  3LK1 A;  3S0F A;  1CMG A;  1MF8 B;  1KWO B;  3FE8 A;  1QX7 A;  1XK4 C;  3BOW A;  4M2O A;  1KK7 Z;  1Z2C B;  1SCM B;  1WRZ A;  2KI4 C;  4M2Q A;  1OOJ A;  1OSA A;  1C07 A;  4C0J A;  3BFA A;  5D7F A;  1M63 B;  1ALW A;  1QX2 A;  1TNQ A;  2KAX A;  5IBW A;  1SMG A;  2G9B A;  2ZFD A;  3C1V A;  2LUX A;  4ORA B;  3BQ3 A;  1TNX A;  1MXL C;  3SG2 A;  2K2F A;  3MSE B;  3D73 A;  1KQM B;  1KFX L;  1Y1X A;  4F0Z B;  2H61 C;  4HRG A;  1QLK A;  5K89 A;  4Q04 A;  1NSH A;  1F54 A;  3DXL A;  4PHM A;  3D74 A;  2PYQ A;  1BOD A;  1TCO B;  1YRT B;  3CR5 X;  3SS4 A;  2P71 A;  1DQE A;  1KK8 B;  2MJW B;  1H4B A;  1PK0 D;  2MLF C;  3WHU B;  3PM2 A;  5CSN A;  1J1E A;  1B8C A;  2JUL A;  2HPS A;  2CBL A;  2Y1M A;  1TUJ A;  2MRD A;  3CZ0 A;  3IQO A;  1DJX A;  1K8U A;  2H8V A;  2WCK A;  2LMT A;  2HF5 A;  2KYF A;  1ORG A;  2MLE C;  3BUM B;  2O5G A;  2MA2 A;  4INX A;  1PUL A;  5KTY A;  1OMR A;  1TCF A;  1K93 D;  1HT9 A;  2OTG B;  3GK1 A;  3BUO B;  4I5K A;  3SIA A;  3OP0 A;  1PSB A;  5DKQ A;  2CTN A;  1DJY A;  2D8N A;  1F8H A;  4N1G A;  3BUW B;  4ETO A;  2KAV A;  5JOL A;  2EHB A;  2QDI A;  4PE7 A;  1W7J B;  3I5H B;  1LA0 A;  4HSZ A;  1ALV A;  1C3Z A;  2KI6 C;  3SG5 A;  1CTR A;  1BT6 A;  2WC5 A;  1CFD A;  2LAP A;  1FPW A;  3SS3 A;  4JKT A;  2LHI A;  2F8P A;  4PHJ A;  2LE9 B;  2AUC A;  4WRI A;  1LVC D;  1YUR A;  2L4I A;  1KSO A;  3FWC A;  4OZD A;  3CTN A;  1BR4 B;  3TUY B;  4MEW A;  1DJW A;  3O6B A;  2L5X B;  2WCF A;  3UNW A;  3B87 A;  4PT1 A;  1CMF A;  2EGD A;  1UP5 A;  3CZ2 A;  4BY4 A;  1DTL A;  3PSR A;  4YRU A;  1J7R A;  4L9M A;  1CLM A;  1B4C A;  2F2O A;  1S26 D;  4I5J A;  1SNL A;  1T14 A;  1WLZ A;  2L4H A;  4HRE E;  2SCP A;  2KHN A;  2Q91 A;  1U5I B;  3PN7 B;  3R1O A;  4PHN A;  1A75 A;  4MVF A;  3NSO A;  1GJY A;  2L50 A;  2M49 B;  3TDI A;  2KFH A;  1M31 A;  3UO9 A;  3FE6 A;  1DGU A;  5DKR A;  1DF0 B;  2FCE A;  1WRK A;  2BL0 C;  4YGC B;  3QME A;  1QIW A;  4N5X A;  1S3P A;  3BYA A;  1TIZ A;  2WC8 A;  1SL8 A;  2KPH A;  2LVJ A;  1Y1A A;  2PSR A;  4PE0 A;  1CB1 A;  2YGU A;  2ISD A;  2KFF A;  1F71 A;  3OX6 A;  1OMD A;  2F2P A;  3V2L A;  1AK8 A;  2L2E A;  3A8R A;  1IJ5 A;  1Q80 A;  3DYE A;  3LLE A;  2LUC A;  3SS5 A;  1QVI Y;  3OHM B;  4A4C A;  3VRR A;  1TUZ A;  3ICB A;  2FCD A;  2PAS A;  1DEK A;  2WCB A;  1UHH A;  2NCO A;  4PDZ A;  4QJ5 B;  2EC6 C;  2LP3 A;  4AOM A;  4NQG A;  2M97 A;  2WCJ A;  4MN0 A;  4P5O E;  1S6J A;  2WOR A;  2KI4 B;  3AKB A;  4DRW A;  1CDN A;  1KK7 Y;  1XVJ A;  2JRF A;  2WCE A;  1IRJ A;  5HLV A;  2OS8 C;  1AJ5 A;  1TN4 A;  2Y4Q A;  1KCY A;  2CT9 A;  2Q4U A;  3NSK A;  4MRY A;  2JU0 A;  2SAS A;  5G08 A;  3RLZ A;  2BCX A;  3O78 A;  4YGA A;  2V53 A;  1B1G A;  1NCZ A;  2JPO A;  3Q8I A;  4GFT A;  3FIA A;  3IVT A;  3DY9 A;  1QWV A;  1JSA A;  1PVA A;  3IF7 A;  1OQP A;  4UPG A;  3CLN A;  3VRQ A;  1A2X A;  3JVT C;  3B6X A;  1GGZ A;  1RJV A;  1N65 A;  5I2L A;  4E68 A;  1DJH A;  2LMU A;  5KU1 A;  1IH0 A;  4ICB A;  3DF0 A;  1C7V A;  1OOF A;  4IJ7 A;  1A4P A;  2PRU A;  3I5G C;  1JFK A;  4DCK A;  4GPL B;  3JTD C;  1K9K A;  1GQM A;  1IQ5 A;  1SL7 A;  1LA3 A;  1JC2 A;  1G4Y R;  1J55 A;  2JT0 A;  1MR8 A;  1SK6 D;  1UHN A;  1W7I B;  2L5Y A;  3CWG A;  2CXJ A;  3TS5 C;  2KBI A;  1XYD A;  2PQL A;  3L47 A;  1M39 A;  1CLB A;  3CDN A;  1N2D A;  1BG1 A;  1OOG A;  1QV0 A;  4XJK B;  5DKN A;  1L2O C;  2JZI A;  2K60 A;  3S0A A;  2HQ8 A;  1IJ6 A;  2LP2 A;  3IQQ A;  2M8U A;  1TNW A;  1F4Q A;  3I5F B;  4DUQ A;  1E8A A;  2BKH B;  4PHK A;  1XO5 A;  2I7A A;  3M0W A;  3VB1 A;  1DEL A;  5HKZ A;  2LVK A;  1REC A;  3NSL A;  1G8I A;  2QEB A;  1H8B A;  2GV5 A;  1AJ4 A;  5EL2 A;  1KWO C;  1LS8 A;  2LHL A;  1NX3 A;  1YUU A;  1WDC B;  2PMY A;  1MUX A;  1SBJ A;  3R1P A;  3D78 A;  1R6P A;  1TWO A;  3KPX A;  2HET A;  4INW A;  4PE4 A;  3OX5 A;  5FYX A;  1FI5 A;  1AHR A;  5HKW A;  4QJ3 B;  1K9U A;  2ZND A;  2LCP A;  5HKY A;  1MWN A;  3OBV A;  3VRO A;  3HX4 A;  4GGF C;  1RFJ A;  1UHJ A;  1VRK A;  4MRX A;  3NGV A;  4AQJ A;  1NX1 A;  2KLE A;  2LLT A;  2ZN8 A;  1QX5 B;  2WCL A;  3DVJ A;  4MZJ A;  1OOI X;  2I2R E;  3K21 A;  3WHT B;  5HL1 A;  5CSI A;  3N7H A;  2WND A;  2KI6 D;  4YI9 A;  5D3O A;  1NYA A;  1TOP A;  2QAC A;  3D0Y A;  1J7P A;  1KFU S;  2L51 A;  2RGI A;  1B8L A;  1CDP A;  3OGN A;  4GGN A;  2BE4 A;  1S6I A;  2MBX A;  1CNP A;  1U5I A;  2CNP A;  3RZS A;  3SIB A;  4NDB A;  2JOJ A;  3EVR A;  1F55 A;  5J3X A;  5CSF A;  2JWW A;  1JBA A;  1QAT A;  1F70 A;  1DF0 A;  3BUX B;  2JTZ A;  1NUB A;  2JXC A;  2Y5I A;  1QJT A;  3RM1 A;  1ZAC A;  4IL1 A;  3EG5 B;  1EJ3 A;  1XFW O;  3NXA A;  3FS7 A;  2OTG C;  3DD4 A;  1JUO A;  3VGO A;  4YGD B;  1SR6 B;  5ER5 A;  2K2A A;  4OVN F;  1NIW A;  2BBM A;  1BR1 B;  3I5H C;  1A03 A;  1XFX O;  3HCM A;  2FJY A;  3I5I C;  5FI2 A;  1A29 A;  2GGM A;  2DOQ A;  1NP8 A;  4WQ2 A;  1EH2 A;  1CM1 A;  3EK4 A;  2BAP A;  2QEH A;  2KGR A;  3SG6 A;  3L4A A;  3GOF A;  4I5L B;  1SRA A;  1Y0V H;  4C0L A;  2WCM A;  3SG3 A;  4YGE B;  3B88 A;  3VRP A;  3EK7 A;  1ZMZ A;  3TUY C;  1Y1U A;  2KSP A;  2M9G A;  2K7D A;  3SG4 A;  4FQO A;  4ORB B;  1P28 A;  3H4S E;  1YX8 A;  4DIR A;  5AAN A;  1TNP A;  1SY9 A;  1Z4H A;  1EG4 A;  3DVK A;  1RRO A;  2LC5 A;  2VRG A;  1B7T Z;  1WLM A;  3BUN B;  4OKH A;  3ZNI A;  3VRN A;  4BY5 A;  2LNK A;  3TDZ A;  4CLN A;  2K8M B;  1L7Z A;  2JT3 A;  3JVT B;  3LL8 B;  1YX7 A;  2KNE A;  1KFU L;  2LLU A;  1A75 B;  1FW4 A;  2M0R A;  3KF9 A;  3OB1 B;  3S0B A;  4CPV A;  1B8R A;  1DT7 B;  2PAL A;  4GUK A;  1CDM A;  2H2K A;  4PCW A;  1DMO A;  5AEQ A;  3R1V A;  2F3Y A;  2COL B;  3I5G B;  3QRX A;  3S0E A;  5FI6 A;  1BLQ A;  2I18 A;  1K90 D;  2I94 A;  2LV7 A;  4GGF A;  4ORC B;  1PRW A;  5B8I B;  3O2P A;  5I2Q A;  3O4X A;  1UWO A;  4FTG A;  2P70 A;  3CS1 A;  3TS5 B;  1IKU A;  1DJG A;  2M3W A;  1DC1 A;  2QPT A;  3GK4 X;  3D77 A;  1YTZ C;  2KGB C;  3AAK A;  1N0Y A;  1RTP 1;  2GTE A;  4OCI A;  1RWY A;  1DGV A;  2QEO A;  3KEV A;  4U8D A;  3S0D A;  1V1G A;  5HYD A;  1GM0 A;  1DVI A;  4XJK A;  3SG7 A;  2BCB A;  1CFP A;  1AVS A;  4OR9 B;  1ZOT B;  1CKK A;  1C7W A;  2E6W A;  4JWQ A;  1BU3 A;  4WQ3 A;  2KAY A;  4CID A;  4CFR A;  1CFC A;  1CM4 A;  1NCX A;  4JPZ B;  2TN4 A;  3K1E A;  5F6T A;  1K9P A;  3D76 A;  3LCP C;  2KDH A;  2K7O A;  4DS7 A;  1UHI A;  2LMV A;  3PLF B;  2ZKM X;  1S5G Z;  1EG3 A;  3CZT X;  4USL A;  1D1O A; 
#chains in the Genus database with same CATH homology
 5ER4 X;  4AQI A;  3ZWH A;  2NLN A;  2LLS A;  1XFY O;  3E3R A;  4CFQ A;  1MXE A;  1OZS A;  1CDL A;  1BJF A;  1XA5 A;  2ZRT A;  3DVE A;  1PVB A;  3BOW B;  3KHE A;  1NWD A;  1TTX A;  2KOT A;  5BPJ A;  4NDD A;  4YI8 A;  1OE9 B;  4I5N B;  1JF0 A;  1OMV A;  2ZNE A;  4MLW A;  1SCM C;  1SL9 A;  1S6C A;  2GGZ A;  2M1K B;  1YUS A;  3DF0 B;  2JTT A;  3CGA A;  2KBM A;  3DVM A;  2ZN9 A;  1DJI A;  2LM5 A;  1WRL A;  1X02 A;  3KO0 A;  3AAJ A;  1ZFS A;  1K2H A;  4NDC A;  4QJ4 B;  1J7O A;  1KQM C;  2OPO A;  4M2P A;  2O60 A;  2G2B A;  5I2O A;  2KQY A;  1JWD A;  4C0K A;  1B9A A;  1XFV O;  2B1U A;  2M7L A;  4HRH A;  4PE1 A;  3NSI A;  1M46 A;  3EK8 A;  5AXI A;  2KFG A;  5KSZ A;  1SKT A;  1BF5 A;  2PVB A;  1G33 A;  4GAO A;  1KSM A;  2BKI B;  2JNX A;  2MAZ A;  1K95 A;  2JXL A;  1WY9 A;  1KK8 C;  2M29 A;  4YBH B;  2F3Z A;  3I5F C;  1M45 A;  3BXK A;  1ZUZ A;  2F33 A;  1KQV A;  1IWQ A;  1S1E A;  2BL0 B;  3I5I B;  1UUR A;  4N1F A;  5JJG A;  4R1E A;  2K7C A;  4GNK B;  1PAL A;  1FBV A;  3F45 A;  4P2Y B;  1ODB A;  3FWB A;  1LKJ A;  1QTX A;  1WDC C;  2NZ0 A;  3EVV A;  2A4J A;  5PAL A;  3EVU A;  1YUT A;  1XFZ O;  3CR2 A;  1NPQ A;  1S36 A;  1CLL A;  3EKJ A;  1EXR A;  3PAL A;  3OB2 B;  1OZO A;  1V1F A;  1QV1 A;  3A4U B;  2LVV A;  1LIN A;  1K94 A;  2M7N A;  2CCM A;  2EC6 B;  3LK0 A;  1IQ3 A;  1YVL A;  1BOC A;  1R2U A;  2KQ6 A;  1TRF A;  5D69 A;  1B7T Y;  1CFF A;  5HLO A;  1NCY A;  2P6B B;  1J1D A;  1XK4 A;  3D0Y B;  1SPY A;  1PSR A;  1HQV A;  2OS8 B;  1YRU B;  1MHO A;  2JNF A;  1QXP A;  1SCV A;  1UHK A;  2R2I A;  5GQQ C;  4A4B A;  1AP4 A;  3O4Y A;  1LXF C;  2Y1N A;  1XFU O;  1QAS A;  3CR4 X;  2BCA A;  2K61 A;  2JT8 A;  2ZRS A;  4MSP A;  5AFP A;  3TDU A;  3EKH A;  1JFJ A;  4JQ0 D;  5CPV A;  1GGW A;  2E30 A;  3PFV A;  2IS9 A;  4ZCU A;  1AUI B;  3SJS A;  2K0J A;  1KFX S;  1FI6 A;  1RK9 A;  1YVH A;  1IGV A;  2BBN A;  2H61 A;  3PAT A;  2AMI A;  2L0P A;  4GBA A;  5CSJ A;  1EL4 A;  1F4O A;  3AKA A;  1K96 A;  1NX2 A;  3PN7 C;  4XYN A;  5I8N A;  2K7B A;  2MHH A;  1SR6 C;  2JC2 A;  3GK2 A;  1DJZ A;  5TNC A;  4MBE A;  2NCP A;  3JTD B;  1QIV A;  2FOT A;  4MZK A;  3TZ1 A;  4YGB B;  1IG5 A;  1JF2 A;  1Y6W A;  2BE6 A;  4MZL A;  1QS7 A;  1B47 A;  1BMO A;  2FJU B;  2JPT A;  4TNC A;  2M1U A;  2HQW A;  1FF1 A;  1SW8 A;  1UUS A;  1QLS A;  2JQ6 A;  2L98 A;  1J7Q A;  2LVI A;  1SYM A;  1QVI Z;  1L2O B;  2AAO A;  3D10 A;  3PM8 A;  1YR5 A;  4OV2 A;  1S5G Y;  5AER A;  1MQ1 A;  1NX0 A;  4ZCV A;  2WOS A;  2KYC A;  4D1E A;  2BEC A;  2NXQ A;  3WXA A;  4PAL A;  2LAN A;  3WNX B;  3LK1 A;  1CMG A;  1MF8 B;  1KWO B;  1QX7 A;  1XK4 C;  3BOW A;  4M2O A;  1KK7 Z;  4M2Q A;  1SCM B;  1WRZ A;  2KI4 C;  1OOJ A;  1OSA A;  1C07 A;  4C0J A;  5D7F A;  1M63 B;  1ALW A;  1QX2 A;  1TNQ A;  2KAX A;  5IBW A;  1SMG A;  2G9B A;  2ZFD A;  3C1V A;  2LUX A;  4ORA B;  3BQ3 A;  1TNX A;  1MXL C;  3SG2 A;  2K2F A;  3MSE B;  1KQM B;  1KFX L;  1Y1X A;  4F0Z B;  2H61 C;  4HRG A;  1QLK A;  5K89 A;  4Q04 A;  1NSH A;  1F54 A;  4PHM A;  1BOD A;  1TCO B;  1YRT B;  3CR5 X;  2MJW B;  1KK8 B;  1H4B A;  1PK0 D;  2MLF C;  3WHU B;  5CSN A;  1J1E A;  1B8C A;  2JUL A;  2HPS A;  2CBL A;  2Y1M A;  2MRD A;  3IQO A;  1DJX A;  1K8U A;  2LMT A;  2HF5 A;  2KYF A;  2MLE C;  3BUM B;  2O5G A;  2MA2 A;  5KTY A;  1PUL A;  1OMR A;  1TCF A;  1K93 D;  1HT9 A;  2OTG B;  3GK1 A;  3BUO B;  4I5K A;  3SIA A;  3OP0 A;  1PSB A;  5DKQ A;  2CTN A;  1DJY A;  2D8N A;  1F8H A;  4N1G A;  3BUW B;  4ETO A;  2KAV A;  5JOL A;  2EHB A;  4PE7 A;  1W7J B;  3I5H B;  1LA0 A;  4HSZ A;  1ALV A;  2KI6 C;  3SG5 A;  1CTR A;  1BT6 A;  1CFD A;  2LAP A;  1FPW A;  2LHI A;  2F8P A;  4PHJ A;  2LE9 B;  2AUC A;  4WRI A;  1LVC D;  1YUR A;  2L4I A;  1KSO A;  3FWC A;  3CTN A;  1BR4 B;  3TUY B;  4MEW A;  1DJW A;  3O6B A;  2L5X B;  2WCF A;  1CMF A;  2EGD A;  1UP5 A;  4BY4 A;  1DTL A;  3PSR A;  4YRU A;  1J7R A;  4L9M A;  1CLM A;  1B4C A;  2F2O A;  1S26 D;  4I5J A;  1SNL A;  1WLZ A;  2L4H A;  4HRE E;  2SCP A;  2KHN A;  2Q91 A;  1U5I B;  3PN7 B;  4PHN A;  1A75 A;  4MVF A;  3NSO A;  1GJY A;  2L50 A;  2M49 B;  3TDI A;  2KFH A;  1M31 A;  1DGU A;  5DKR A;  1DF0 B;  2FCE A;  1WRK A;  2BL0 C;  4YGC B;  1QIW A;  4N5X A;  1S3P A;  3BYA A;  1TIZ A;  2WC8 A;  1SL8 A;  2LVJ A;  2PSR A;  1Y1A A;  4PE0 A;  1CB1 A;  2ISD A;  2KFF A;  1F71 A;  3OX6 A;  1OMD A;  2F2P A;  1AK8 A;  2L2E A;  3A8R A;  1IJ5 A;  1Q80 A;  3LLE A;  2LUC A;  1QVI Y;  3OHM B;  4A4C A;  3VRR A;  3ICB A;  2FCD A;  2PAS A;  2WCB A;  1UHH A;  2NCO A;  4PDZ A;  4QJ5 B;  2EC6 C;  2LP3 A;  4AOM A;  4NQG A;  2M97 A;  4MN0 A;  4P5O E;  4DRW A;  1S6J A;  2WOR A;  2KI4 B;  3AKB A;  1CDN A;  1KK7 Y;  1XVJ A;  2JRF A;  2WCE A;  1IRJ A;  5HLV A;  2OS8 C;  1AJ5 A;  1TN4 A;  2Y4Q A;  1KCY A;  2CT9 A;  2Q4U A;  3NSK A;  4MRY A;  2JU0 A;  2SAS A;  5G08 A;  3RLZ A;  2BCX A;  3O78 A;  4YGA A;  2V53 A;  1B1G A;  1NCZ A;  4GFT A;  3FIA A;  1JSA A;  1PVA A;  3IF7 A;  1OQP A;  4UPG A;  3CLN A;  3VRQ A;  1A2X A;  3JVT C;  1GGZ A;  1RJV A;  1N65 A;  5I2L A;  4E68 A;  1DJH A;  2LMU A;  5KU1 A;  1IH0 A;  4ICB A;  3DF0 A;  1C7V A;  1A4P A;  2PRU A;  3I5G C;  1JFK A;  4DCK A;  4GPL B;  3JTD C;  1K9K A;  1GQM A;  1IQ5 A;  1SL7 A;  1LA3 A;  1JC2 A;  1G4Y R;  1J55 A;  2JT0 A;  1MR8 A;  1SK6 D;  1UHN A;  1W7I B;  3TS5 C;  3CWG A;  2CXJ A;  2KBI A;  1XYD A;  1M39 A;  1CLB A;  1N2D A;  1BG1 A;  1QV0 A;  4XJK B;  5DKN A;  1L2O C;  2JZI A;  2HQ8 A;  1IJ6 A;  2LP2 A;  3IQQ A;  2M8U A;  1TNW A;  1F4Q A;  3I5F B;  4DUQ A;  1E8A A;  2BKH B;  4PHK A;  1XO5 A;  2I7A A;  3M0W A;  5HKZ A;  2LVK A;  1REC A;  3NSL A;  1G8I A;  1H8B A;  2GV5 A;  1AJ4 A;  1KWO C;  2LHL A;  1NX3 A;  1YUU A;  1WDC B;  2PMY A;  1MUX A;  1SBJ A;  1R6P A;  1FI5 A;  3KPX A;  2HET A;  5FYX A;  4PE4 A;  3OX5 A;  1AHR A;  5HKW A;  4QJ3 B;  1K9U A;  2ZND A;  2LCP A;  5HKY A;  1MWN A;  3VRO A;  3HX4 A;  4GGF C;  1RFJ A;  1UHJ A;  1VRK A;  4MRX A;  4AQJ A;  1NX1 A;  2LLT A;  2ZN8 A;  1QX5 B;  3DVJ A;  4MZJ A;  2I2R E;  3K21 A;  3WHT B;  5CSI A;  2WND A;  2KI6 D;  4YI9 A;  1NYA A;  1TOP A;  2QAC A;  3D0Y A;  1J7P A;  1KFU S;  2L51 A;  2RGI A;  1B8L A;  1CDP A;  4GGN A;  1CNP A;  2BE4 A;  1S6I A;  2MBX A;  1U5I A;  2CNP A;  3SIB A;  4NDB A;  2JOJ A;  3EVR A;  1F55 A;  5J3X A;  5CSF A;  2JWW A;  1JBA A;  1QAT A;  1F70 A;  1DF0 A;  3BUX B;  2JTZ A;  1NUB A;  2JXC A;  2Y5I A;  1QJT A;  3RM1 A;  1ZAC A;  4IL1 A;  1EJ3 A;  1XFW O;  3NXA A;  3FS7 A;  2OTG C;  3DD4 A;  1JUO A;  3VGO A;  4YGD B;  1SR6 B;  5ER5 A;  2K2A A;  4OVN F;  1NIW A;  2BBM A;  1BR1 B;  3I5H C;  1A03 A;  1XFX O;  3HCM A;  3I5I C;  1A29 A;  2GGM A;  2DOQ A;  1NP8 A;  4WQ2 A;  1EH2 A;  1CM1 A;  3EK4 A;  2KGR A;  3SG6 A;  3GOF A;  4I5L B;  1SRA A;  1Y0V H;  4C0L A;  3SG3 A;  4YGE B;  3VRP A;  3EK7 A;  1ZMZ A;  3TUY C;  1Y1U A;  2KSP A;  2M9G A;  2K7D A;  3SG4 A;  4FQO A;  4ORB B;  3H4S E;  1YX8 A;  4DIR A;  5AAN A;  1TNP A;  1SY9 A;  3DVK A;  1EG4 A;  1RRO A;  2LC5 A;  2VRG A;  1B7T Z;  1WLM A;  3BUN B;  4OKH A;  3ZNI A;  3VRN A;  4BY5 A;  2LNK A;  3TDZ A;  4CLN A;  2K8M B;  1L7Z A;  2JT3 A;  3JVT B;  3LL8 B;  1YX7 A;  2KNE A;  1KFU L;  2LLU A;  1A75 B;  1FW4 A;  2M0R A;  3KF9 A;  3OB1 B;  4CPV A;  1B8R A;  1DT7 B;  2PAL A;  4GUK A;  1CDM A;  2H2K A;  4PCW A;  1DMO A;  5AEQ A;  1BLQ A;  2F3Y A;  2COL B;  3I5G B;  3QRX A;  2I18 A;  1K90 D;  2I94 A;  2LV7 A;  4GGF A;  4ORC B;  1PRW A;  5B8I B;  3O2P A;  5I2Q A;  1UWO A;  4FTG A;  3CS1 A;  3TS5 B;  1IKU A;  1DJG A;  2M3W A;  2QPT A;  3GK4 X;  1YTZ C;  2KGB C;  3AAK A;  1N0Y A;  1RTP 1;  4OCI A;  1RWY A;  1DGV A;  3KEV A;  4U8D A;  5HYD A;  1V1G A;  1DVI A;  4XJK A;  3SG7 A;  2BCB A;  1CFP A;  1AVS A;  4OR9 B;  1ZOT B;  1CKK A;  1C7W A;  2E6W A;  4JWQ A;  1BU3 A;  4WQ3 A;  2KAY A;  4CID A;  4CFR A;  1CFC A;  1CM4 A;  1NCX A;  4JPZ B;  2TN4 A;  5F6T A;  1K9P A;  3LCP C;  2KDH A;  2K7O A;  4DS7 A;  1UHI A;  2LMV A;  3PLF B;  2ZKM X;  1S5G Z;  1EG3 A;  3CZT X;  4USL A;  1D1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...