2H61A

X-ray structure of human ca2+-loaded s100b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B, E, F, H
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61A00
2BE4A 3LK1A 2L4IA 1Y1XA 3TUYB 1C7WA 5JJGA 4DRWA 3F45A 1A4PA 1RFJA 2BCBA 3BOWB 3LCPC 2JULA 5DKQA 1W7JB 3A8RA 3SIAA 1F55A 4YRUA 2Y4QA 2M3WA 4PE1A 3KF9A 3DF0A 1C7VA 3PN7C 1WLMA 3JTDC 4HSZA 1CLLA 1WRLA 4PCWA 5F6TA 2OTGB 3KPXA 2L4HA 4NDBA 1TRFA 3FWBA 2LUCA 1K8UA 4R1EA 3CGAA 4MVFA 1WDCC 2KOTA 2BL0B 1WRKA 3NSOA 2BECA 2KAVA 1FW4A 4PDZA 2KGRA 1NWDA 1TNQA 1KK8C 3JVTB 1IH0A 4F0ZB 3AKAA 1SR6B 1BR4B 5HKZA 1PSBA 3PATA 2JQ6A 4I5JA 3JTDB 1KQMB 4GFTA 2CNPA 2KI4B 1QJTA 1KCYA 2Y5IA 1Y1AA 2LMVA 2V53A 5I8NA 1B47A 1AP4A 3I5GB 2ZKMX 1DJXA 1IWQA 4D1EA 4MBEA 1XVJA 2LV7A 3VGOA 1BJFA 2OPOA 3PALA 4GGFA 2L51A 1Y6WA 1AJ5A 1TCFA 2I94A 4CLNA 1BT6A 1A75B 2O60A 1K95A 2L2EA 1Y1UA 2WCEA 2BBMA 2PALA 1SK6D 2PSRA 1CFFA 4PALA 2O5GA 2EGDA 3I5IB 2ISDA 1M31A 2K7BA 3OHMB 1VRKA 1SW8A 3RLZA 2CTNA 1SL8A 3O4YA 2M0RA 1CMGA 1MHOA 2BCXA 2JTTA 4OKHA 2KGBC 4DCKA 1HT9A 2WORA 3AKBA 2OS8B 1DF0A 2LVKA 1B8LA 1CKKA 2P6BB 2AUCA 4MZKA 5D7FA 1SL7A 2KDHA 1KK7Z 2LLSA 3O78A 4YBHB 5HLOA 3SJSA 3BUMB 1YR5A 2E6WA 2PRUA 4I5LB 2HETA 3O6BA 4DUQA 1QV1A 1OZSA 3PLFB 3SG6A 1S5GZ 4MEWA 4ORBB 1K93D 3CS1A 2JPTA 1YURA 1TN4A 2MA2A 1XK4C 1J55A 2D8NA 2KHNA 3HX4A 1AJ4A 2F2OA 1NX3A 1TTXA 4AQIA 2LUXA 1CDLA 3KEVA 1PRWA 4MLWA 1X02A 1TIZA 1A2XA 1K94A 1N2DA 2R2IA 4GUKA 1JFJA 1FPWA 3OP0A 3VRNA 2L0PA 1A29A 1BF5A 4HRGA 1IQ3A 2WC8A 1QS7A 1KFUS 1DJGA 1E8AA 1KWOC 1SRAA 1QX7A 2DOQA 2JNXA 5IBWA 2CBLA 2GGZA 4YGBB 3TUYC 1CB1A 4YI8A 3VROA 1DJIA 1K96A 1LKJA 1SYMA 4I5KA 3RM1A 2H61C 1H8BA 3EVUA 4MRXA 2JTZA 4NQGA 1DJZA 3EKHA 3FIAA 2JT3A 2QPTA 4DS7A 1J1EA 3GK1A 2SASA 2ZNDA 5AEQA 3ZNIA 4PHNA 2JXLA 2M97A 4A4BA 3BUOB 1B8RA 1IJ6A 4WRIA 2EC6B 1OMVA 2M1UA 1SBJA 2MHHA 2ZRTA 5ER5A 5HLVA 1EL4A 4NDDA 1XFWO 1GJYA 3DVMA 1NPQA 4GPLB 2OTGC 1UHHA 1CNPA 2LVIA 3EVVA 2FJUB 3SG2A 2LMUA 2HF5A 2BL0C 2JXCA 3KHEA 1OOJA 4MN0A 1MUXA 3WHUB 3MSEB 4P2YB 4PHKA 3FWCA 3JVTC 2COLB 4XJKA 3AAJA 1SR6C 4CFRA 4QJ5B 3EK7A 4ETOA 1KQMC 1WLZA 4FTGA 2K7CA 2KI4C 1SY9A 1CMFA 4C0LA 1EG3A 4AOMA 3D0YA 4I5NB 1QVIZ 3CR4X 1TOPA 2FCEA 2I18A 4XJKB 1IRJA 1U5IA 3I5GC 3CLNA 1TCOB 1NCXA 4N1GA 2B1UA 4OVNF 3TZ1A 1IKUA 1QLKA 3DF0B 4HRHA 2BE6A 1XO5A 1L2OB 4YGDB 3BUWB 2AAOA 2KNEA 1GQMA 3C1VA 3D0YB 1A03A 1PSRA 3I5FB 1YX8A 1S36A 1QIWA 1KSOA 2I2RE 1B4CA 4BY5A 3I5IC 5PALA 1FBVA 1LXFC 4ICBA 3QRXA 4GGFC 2GV5A 2LVJA 1QX2A 2E30A 1CDPA 2KBIA 2KFFA 1RTP1 4WQ3A 2JNFA 2K2AA 3EK4A 2LC5A 3TDIA 1MF8B 1NYAA 1OQPA 1DGUA 1GGWA 2M29A 1EXRA 1PVBA 2OS8C 2Y1NA 2LAPA 3BUXB 4OV2A 4ZCVA 1JC2A 2JZIA 4QJ4B 3SG3A 1CTRA 1KK7Y 2CT9A 1XFYO 1TNPA 4C0JA 3NSIA 4YGCB 1YUUA 1YVHA 2WOSA 1DVIA 2K61A 4XYNA 4OCIA 4CPVA 4JQ0D 1F71A 2LHLA 1CM1A 4M2QA 1JBAA 1RK9A 3A4UB 4QJ3B 1C07A 1NX2A 2K7DA 4PE7A 1ZACA 2LP3A 5B8IB 1UHJA 5TNCA 4YI9A 2KBMA 2F3ZA 1CFDA 1JF2A 1F8HA 1V1FA 1EJ3A 2KYCA 1JFKA 2LHIA 2I7AA 3EVRA 4C0KA 1JSAA 1TNWA 2L98A 2M9GA 3PM8A 5AXIA 4N5XA 3I5HB 2JC2A 1YUTA 2K8MB 3LL8B 1BG1A 1IGVA 4JWQA 3EKJA 3LK0A 3O2PA 5AFPA 1DF0B 1KFUL 1ZFSA 2KI6C 4Q04A 1B1GA 5CSJA 5I2QA 1LA0A 4CFQA 2FOTA 4U8DA 1EG4A 2ZNEA 1CDNA 3CTNA 1NX1A 1AHRA 2NLNA 2NXQA 1J7QA 1SPYA 5D69A 2EC6C 1B8CA 4NDCA 5G08A 1J7RA 2H2KA 3CR2A 1QATA 1UHNA 2ZFDA 3BXKA 1QLSA 1J7PA 1F54A 2MAZA 1D1OA 3PSRA 3BYAA 2KSPA 1SCVA 2JT8A 2K2FA 2F3YA 1YRTB 4WQ2A 5CSIA 2Q4UA 1XK4A 2KAXA 1FI5A 1M39A 2NCOA 1BODA 2M1KB 1EH2A 1MXLC 2LM5A 2KFGA 2LNKA 1QASA 3OB2B 1JUOA 2BKHB 2G9BA 2PASA 2VRGA 1R2UA 5AERA 1HQVA 3TS5B 1KSMA 3GK2A 2BKIB 1QVIY 1L7ZA 1G33A 1NSHA 2Y1MA 3PFVA 1FF1A 1SL9A 1FI6A 1AUIB 1G8IA 4USLA 2M8UA 1KFXS 3DD4A 1PALA 3NSKA 1GGZA 1OZOA 3DVKA 3M0WA 1QX5B 1L2OC 1XFZO 3HCMA 2H61A 1QTXA 1MWNA 3AAKA 5FYXA 4GNKB 1TNXA 3TDUA 3ZWHA 1Y0VH 4GGNA 1B7TZ 1NP8A 3FS7A 1K2HA 2LMTA 2TN4A 3SG7A 1DJHA 3I5FC 1S6CA 2EHBA 2PVBA 2ZN9A 4ZCUA 3VRQA 1J7OA 4L9MA 2JT0A 3OB1B 2M49B 1QXPA 4ORCB 1N65A 4MSPA 1WRZA 2FCDA 2Q91A 5CSFA 1DMOA 1SCMB 4YGEB 1ALWA 2LE9B 1YTZC 3KO0A 1RJVA 1KQVA 2F8PA 2GGMA 3IF7A 3WNXB 5HKWA 3E3RA 3EK8A 1IG5A 1F70A 1PVAA 4FQOA 2ZRSA 1LVCD 1RECA 1UHIA 2M7LA 2QACA 3CWGA 3SIBA 1U5IB 2MLEC 3CR5X 2CXJA 1MQ1A 4IL1A 3H4SE 3TDZA 1SKTA 1CLBA 1BLQA 2LLTA 2BCAA 1WY9A 1MXEA 2MLFC 4M2PA 1UWOA 1DTLA 1NCZA 1OMDA 2A4JA 4MZJA 1QV0A 1ZOTB 1J1DA 1BOCA 3IQOA 1JF0A 3OX6A 5I2OA 2KAYA 1XA5A 2ZN8A 4PHMA 5J3XA 1BMOA 1DT7B 3PN7B 1K9KA 2MRDA 1R6PA 3CZTX 3GOFA 2WCFA 4AQJA 5GQQC 5DKNA 5HYDA 2RGIA 1BR1B 1IJ5A 2KI6D 1S5GY 1XYDA 3I5HC 1OE9B 1A75A 1WDCB 3DVEA 1DJYA 4E68A 1LINA 3VRRA 4JPZB 3D10A 1UP5A 2L50A 1YUSA 2JWWA 4PE0A 5BPJA 1H4BA 1KK8B 1YX7A 4GAOA 5CSNA 3IQQA 1N0YA 1ALVA 2LP2A 5HKYA 1ZMZA 3K21A 1CM4A 4TNCA 2BBNA 4OR9B 1IQ5A 2IS9A 1F4OA 1NIWA 1F4QA 1DGVA 1UURA 1XFUO 2M7NA 1K9UA 2SCPA 4HREE 5DKRA 5KSZA 1AK8A 2L5XB 1S6JA 1K9PA 4CIDA 2LVVA 4MZLA 3ICBA 5KTYA 1XFVO 3BQ3A 1M46A 2K0JA 1S1EA 3WHTB 1M45A 1RWYA 1JWDA 4N1FA 1MR8A 1BU3A 3NXAA 1B9AA 1ODBA 3GK4X 1NX0A 1W7IB 4ORAB 1CLMA 3SG4A 1XFXO 2LCPA 3LLEA 4BY4A 1S6IA 2NZ0A 1S26D 2AMIA 3TS5C 5KU1A 2MBXA 2HPSA 1NCYA 3SG5A 5JOLA 1AVSA 1LA3A 1CDMA 2KFHA 1Q80A 2F2PA 4M2OA 2WCBA 1CFCA 1M63B 3NSLA 1UHKA 1OMRA 2KQYA 4GBAA 1V1GA 2JRFA 5ER4X 1SMGA 4PHJA 3BUNB 5AANA 1KFXL 1G4YR 1B7TY 2JOJA 5K89A 3OX5A 1SNLA 3DVJA 4DIRA 2MJWB 1OSAA 2WNDA 1UUSA 2HQWA 1PULA 2KYFA 1PK0D 1YRUB 3WXAA 2JU0A 2CCMA 2NCPA 4MRYA 4A4CA 1NUBA 1DJWA 2PMYA 1K90D 1SCMC 1RROA 4PE4A 1QIVA 2LANA 3BOWA 4UPGA 2KQ6A 1CFPA 4P5OE 2F33A 2K7OA 5I2LA 1ZUZA 2G2BA 4YGAA 1S3PA 2HQ8A 5CPVA 3VRPA 1YVLA 2LLUA 1KWOB
chains in the Genus database with same CATH superfamily
2BE4A 3LK1A 2L4IA 1Y1XA 3TUYB 1C7WA 5JJGA 4DRWA 3F45A 1A4PA 1RFJA 2BCBA 3BOWB 3LCPC 2JULA 5DKQA 3S0BA 2GTEA 1W7JB 3A8RA 3QMEA 3SIAA 1F55A 4YRUA 2Y4QA 2M3WA 4PE1A 3KF9A 3DF0A 1C7VA 3PN7C 1WLMA 3JTDC 4HSZA 1CLLA 1WRLA 4PCWA 5F6TA 2OTGB 3KPXA 2L4HA 4NDBA 3SS3A 1TRFA 3FWBA 2LUCA 1K8UA 4KYNA 4R1EA 3VROA 3CGAA 4MVFA 1WDCC 3L47A 2KOTA 2BL0B 1WRKA 3NSOA 3SS4A 2BECA 2KAVA 1FW4A 4F7FA 4PDZA 2KGRA 1NWDA 1TNQA 1KK8C 3JVTB 1P28A 1IH0A 4F0ZB 3AKAA 1SR6B 1BR4B 5HKZA 3R1OA 1PSBA 3PATA 2JQ6A 4I5JA 3JTDB 1KQMB 4GFTA 2CNPA 2KI4B 1OOGA 1QJTA 1KCYA 2Y5IA 1Y1AA 2LMVA 2V53A 5I8NA 1B47A 2JPOA 1AP4A 3I5GB 2ZKMX 1DJXA 1IWQA 4D1EA 4MBEA 1XVJA 3S0DA 2LV7A 3VGOA 1BJFA 2OPOA 3PALA 4GGFA 2L51A 2WCHA 1Y6WA 1AJ5A 1TCFA 2I94A 4CLNA 1BT6A 3D76A 1A75B 2O60A 1K95A 2L2EA 1Y1UA 5I94A 2WCEA 2BBMA 2PALA 1SK6D 2PSRA 1CFFA 4PALA 2O5GA 2EGDA 3I5IB 2ISDA 1M31A 2K7BA 3OHMB 1DEKA 1SW8A 1VRKA 3RLZA 2CTNA 1SL8A 3O4YA 2M0RA 1CMGA 1MHOA 2BCXA 2JTTA 4OKHA 2KGBC 3ZWHA 4DCKA 1HT9A 2WORA 3AKBA 2OS8B 1DF0A 2LVKA 1B8LA 1CKKA 2P6BB 2AUCA 4MZKA 5D7FA 1SL7A 3L4LA 2KDHA 1KK7Z 2LLSA 3O78A 4YBHB 5HLOA 3SJSA 3R72A 3BUMB 1YR5A 2E6WA 2PRUA 4I5LB 2HETA 3O6BA 4DUQA 1QV1A 1OZSA 3PLFB 3NHIA 3SG6A 3OBVA 1S5GZ 4MEWA 3DY9A 4ORBB 1K93D 3CS1A 2JPTA 1YURA 3CZ0A 2KLDA 1TN4A 2MA2A 1XK4C 1DQEA 1J55A 2D8NA 2KHNA 3HX4A 1AJ4A 2F2OA 1NX3A 1TTXA 2QEHA 4AQIA 2LUXA 1CDLA 3KEVA 1PRWA 3CYZA 1X02A 1TIZA 1A2XA 1K94A 1N2DA 2R2IA 4GUKA 1JFJA 1FPWA 3OP0A 4OZDA 3VRNA 2L0PA 1A29A 2BNXA 3R1PA 3BFHA 2WC8A 4HRGA 1BF5A 1IQ3A 1QS7A 1KFUS 1DJGA 1E8AA 1KWOC 1SRAA 1QX7A 2DOQA 2JNXA 5IBWA 2CBLA 2GGZA 4YGBB 3TUYC 1CB1A 3UO9A 4YI8A 2WCKA 1DJIA 1K96A 1LKJA 1SYMA 3D75A 4I5KA 2H61C 3RM1A 3EVUA 4MRXA 2JTZA 1H8BA 4NQGA 1DJZA 3EKHA 3FIAA 2JT3A 2QPTA 4DS7A 2WCJA 1J1EA 3GK1A 2SASA 2ZNDA 3N7HA 2ERBA 5AEQA 3ZNIA 4PHNA 2JXLA 2M97A 4A4BA 3EG5B 3BUOB 1B8RA 1IJ6A 4WRIA 2EC6B 1OMVA 2M1UA 1SBJA 2MHHA 2ZRTA 5ER5A 5HLVA 1EL4A 4NDDA 1XFWO 1GJYA 3DVMA 1NPQA 4GPLB 2OTGC 1UHHA 1CNPA 2LVIA 3EVVA 2FJUB 3SG2A 2LMUA 2HF5A 2BL0C 2JXCA 3KHEA 1OOJA 4MN0A 5FI6A 1MUXA 3WHUB 3MSEB 4P2YB 4PHKA 3FWCA 3JVTC 2COLB 4XJKA 3AAJA 1SR6C 4CFRA 4QJ5B 3EK7A 4ETOA 3VB1A 1KQMC 1WLZA 4FTGA 2K7CA 2KI4C 1SY9A 1CMFA 4C0LA 1EG3A 4AOMA 1DC1A 3D0YA 4I5NB 1QVIZ 3CR4X 1TOPA 2FCEA 2I18A 4XJKB 1IRJA 1U5IA 2FJYA 3CLNA 1TCOB 1NCXA 3I5GC 2B1UA 4N1GA 4OVNF 3TZ1A 1QLKA 3DF0B 4HRHA 4INXA 2BE6A 1IKUA 1XO5A 1L2OB 4YGDB 3BUWB 1DELA 2AAOA 2KNEA 1GQMA 3C1VA 3D0YB 1A03A 1PSRA 2WC6A 3I5FB 1Z2CB 3CDNA 5FI7A 1YX8A 1S36A 1QIWA 4JKTA 1KSOA 2I2RE 1B4CA 2K60A 4BY5A 3I5IC 5PALA 1FBVA 1LXFC 4ICBA 2WCLA 3QRXA 4GGFC 2WC5A 2GV5A 2LVJA 1QX2A 2E30A 1CDPA 2KBIA 2KFFA 1RTP1 4WQ3A 2JNFA 2K2AA 3EK4A 2LC5A 3TDIA 1MF8B 1NYAA 1OQPA 5D3OA 1DGUA 1GGWA 2M29A 1IIOA 3D77A 1EXRA 1PVBA 2OS8C 2Y1NA 1TUZA 2LAPA 3BUXB 4OV2A 4ZCVA 1JC2A 2JZIA 5EL2A 1W9ZA 3SG3A 1CTRA 4QJ4B 1KK7Y 1XFYO 2CT9A 1TNPA 4C0JA 3O4XA 3NSIA 4YGCB 1YUUA 1YVHA 2WOSA 1DVIA 4FQTA 2K61A 2L5YA 4OCIA 4XYNA 4JQ0D 4CPVA 2LHLA 1CM1A 4M2QA 1JBAA 1F71A 1RK9A 3A4UB 4QJ3B 1C07A 1NX2A 2K7DA 4PE7A 1ZACA 2LP3A 5B8IB 1UHJA 5TNCA 4YI9A 2KBMA 2F3ZA 1ORGA 2L2CA 1CFDA 1JF2A 1F8HA 1V1FA 1QWVA 5DICA 1EJ3A 2KYCA 1JFKA 2LHIA 2I7AA 3EVRA 4C0KA 4JD9A 1JSAA 1TNWA 2L98A 2WCMA 2M9GA 3PM8A 5AXIA 4N5XA 3I5HB 2JC2A 1YUTA 2K8MB 3LL8B 1BG1A 1IGVA 3Q8IA 4JWQA 3EKJA 3LK0A 3O2PA 5AFPA 1DF0B 1KFUL 1ZFSA 2KI6C 2QDIA 4Q04A 2QEOA 1B1GA 5CSJA 5I2QA 1LA0A 4CFQA 2FOTA 4U8DA 1EG4A 2ZNEA 1CDNA 3CTNA 1NX1A 1AHRA 3D73A 2NLNA 2NXQA 3S0GA 3NGVA 1J7QA 1SPYA 5D69A 2EC6C 3CZ2A 1B8CA 4NDCA 5G08A 1J7RA 2H2KA 3B7AA 3CR2A 1QATA 1UHNA 2ZFDA 3BXKA 1QLSA 3S0FA 1J7PA 2MAZA 1D1OA 3PSRA 1F54A 3BYAA 2KSPA 1SCVA 2JT8A 2K2FA 2F3YA 1YRTB 4WQ2A 2QEVA 5CSIA 3SS5A 3R1VA 2Q4UA 1XK4A 2KAXA 1FI5A 1M39A 2NCOA 1BODA 2M1KB 1EH2A 1MXLC 2LM5A 3D78A 2KFGA 2LNKA 1QASA 3OB2B 2BAPA 1JUOA 2BKHB 2G9BA 2PASA 2VRGA 1R2UA 5AERA 1HQVA 3TS5B 1KSMA 3GK2A 2BKIB 4INWA 1QVIY 1L7ZA 1G33A 1T14A 1NSHA 2Y1MA 3OGNA 3PFVA 1SL9A 3D74A 1FF1A 1FI6A 2P70A 1AUIB 1G8IA 4USLA 2M8UA 1KFXS 3DD4A 3V2LA 1PALA 3NSKA 1GGZA 1OZOA 3DVKA 1OOFA 3BFBA 3M0WA 3RZSA 1QX5B 1L2OC 1XFZO 3FE9A 2H61A 1QTXA 1MWNA 3AAKA 3HCMA 4GNKB 1TNXA 5FYXA 3TDUA 1Y0VH 4GGNA 1B7TZ 1NP8A 3FS7A 1K2HA 2LMTA 2TN4A 3SG7A 1DJHA 3I5FC 1S6CA 3S0EA 2EHBA 3B6XA 2PVBA 2ZN9A 4ZCUA 3VRQA 3DYEA 1J7OA 4L9MA 2JT0A 3B88A 3OB1B 2M49B 1QXPA 4ORCB 1N65A 4MSPA 1WRZA 2FCDA 2Q91A 5CSFA 1C3YA 1DMOA 3K1EA 1SCMB 4YGEB 1ALWA 2LE9B 1YTZC 3KO0A 1C3ZA 1RJVA 2P71A 2F8PA 2GGMA 2KLEA 3IF7A 3WNXB 5HKWA 1KQVA 3E3RA 3EK8A 1IG5A 2PYQA 1PVAA 4FQOA 1F70A 2ZRSA 1LVCD 2YGUA 1RECA 1UHIA 2M7LA 2QACA 3CWGA 3SIBA 1U5IB 2MLEC 3BFAA 3CR5X 2CXJA 1MQ1A 2QEBA 3H4SE 4IL1A 1XFRA 3TDZA 1SKTA 1CLBA 1BLQA 2LLTA 1OOIX 2BCAA 1WY9A 1MXEA 2MLFC 4M2PA 1UWOA 1DTLA 1NCZA 1OMDA 2A4JA 4MZJA 1QV0A 1ZOTB 1J1DA 1BOCA 3IQOA 1JF0A 3OX6A 5I2OA 2KAYA 1XA5A 2ZN8A 4PHMA 5J3XA 1BMOA 1DT7B 2PQLA 3PN7B 1K9KA 2MRDA 1R6PA 1TUJA 3CZTX 2WCFA 3GOFA 4AQJA 5GQQC 5DKNA 5HYDA 2RGIA 1BR1B 1IJ5A 2KI6D 5FI2A 4IJ7A 1S5GY 1XYDA 3I5HC 1OE9B 1A75A 1WDCB 3L4AA 3DVEA 1DJYA 4E68A 1LINA 3VRRA 2H8VA 3IVTA 4JPZB 3D10A 1UP5A 1OOHA 2L50A 1YUSA 2JWWA 4PE0A 5BPJA 1H4BA 3DZTA 1KK8B 1YX7A 4GAOA 5CSNA 3IQQA 1N0YA 1ALVA 2LP2A 3B87A 5HKYA 4PT1A 1TWOA 1ZMZA 3K21A 1CM4A 4TNCA 2BBNA 4OR9B 1IQ5A 2IS9A 1F4OA 1Z4HA 1NIWA 1F4QA 5HL1A 1DGVA 1UURA 1XFUO 2M7NA 1K9UA 2SCPA 1LS8A 4HREE 5DKRA 5KSZA 1AK8A 2L5XB 3PJIA 1S6JA 1K9PA 3CZ1A 4CIDA 2LVVA 4MZLA 3ICBA 3CABA 5KTYA 1XFVO 3NHTA 3UNWA 3BQ3A 1M46A 2K0JA 1S1EA 3WHTB 1M45A 1OW4A 1RWYA 3S0AA 3DXLA 1JWDA 4N1FA 1MR8A 1BU3A 3NXAA 1B9AA 1ODBA 3GK4X 1NX0A 1W7IB 1SSEB 1CLMA 4ORAB 3SG4A 1XFXO 2LCPA 3FE8A 3LLEA 4BY4A 1S6IA 2NZ0A 1S26D 2AMIA 3TS5C 2KPHA 3BJHA 2MBXA 2HPSA 5KU1A 1NCYA 3SG5A 3FE6A 5JOLA 1AVSA 1LA3A 1CDMA 4MLWA 2KFHA 1Q80A 2F2PA 4M2OA 2WCBA 1CFCA 1M63B 3NSLA 1UHKA 1OMRA 2KQYA 3B86A 3PM2A 4GBAA 1V1GA 2JRFA 5ER4X 1SMGA 4PHJA 3BUNB 5AANA 1KFXL 1G4YR 1B7TY 2JOJA 5K89A 3OX5A 1SNLA 3DVJA 4DIRA 2MJWB 1OSAA 2WNDA 1UUSA 2HQWA 1GM0A 1PULA 2KYFA 1PK0D 1YRUB 3WXAA 2JU0A 2CCMA 2NCPA 4MRYA 4A4CA 1NUBA 1DJWA 2PMYA 1K90D 1SCMC 1RROA 4PE4A 1QIVA 2LANA 3BOWA 4UPGA 2KQ6A 1CFPA 4P5OE 2F33A 2K7OA 5I2LA 1ZUZA 2G2BA 4YGAA 1S3PA 2HQ8A 5CPVA 3VRPA 1YVLA 2LLUA 1KWOB
chains in the Genus database with same CATH topology
2BE4A 3LK1A 2L4IA 1Y1XA 3TUYB 1C7WA 5JJGA 4DRWA 3F45A 1A4PA 1RFJA 2BCBA 3BOWB 3LCPC 2JULA 5DKQA 1W7JB 3A8RA 3SIAA 1F55A 4YRUA 2Y4QA 2M3WA 4PE1A 3KF9A 3DF0A 1C7VA 3PN7C 1WLMA 3JTDC 4HSZA 1CLLA 1WRLA 4PCWA 5F6TA 2OTGB 3KPXA 2L4HA 4NDBA 1TRFA 3FWBA 2LUCA 1K8UA 4R1EA 3CGAA 4MVFA 1WDCC 2KOTA 2BL0B 1WRKA 3NSOA 2BECA 2KAVA 1FW4A 4PDZA 2KGRA 1NWDA 1TNQA 1KK8C 3JVTB 1IH0A 4F0ZB 3AKAA 1SR6B 1BR4B 5HKZA 1PSBA 3PATA 2JQ6A 4I5JA 3JTDB 1KQMB 4GFTA 2CNPA 2KI4B 1QJTA 1KCYA 2Y5IA 1Y1AA 2LMVA 2V53A 5I8NA 1B47A 1AP4A 3I5GB 2ZKMX 1DJXA 1IWQA 4D1EA 4MBEA 1XVJA 2LV7A 3VGOA 1BJFA 2OPOA 3PALA 4GGFA 2L51A 1Y6WA 1AJ5A 1TCFA 2I94A 4CLNA 1BT6A 1A75B 2O60A 1K95A 2L2EA 1Y1UA 2WCEA 2BBMA 2PALA 1SK6D 2PSRA 1CFFA 4PALA 2O5GA 2EGDA 3I5IB 2ISDA 1M31A 2K7BA 3OHMB 1VRKA 1SW8A 3RLZA 2CTNA 1SL8A 3O4YA 2M0RA 1CMGA 1MHOA 2BCXA 2JTTA 4OKHA 2KGBC 4DCKA 1HT9A 2WORA 3AKBA 2OS8B 1DF0A 2LVKA 1B8LA 1CKKA 2P6BB 2AUCA 4MZKA 5D7FA 1SL7A 2KDHA 1KK7Z 2LLSA 3O78A 4YBHB 5HLOA 3SJSA 3BUMB 1YR5A 2E6WA 2PRUA 4I5LB 2HETA 3O6BA 4DUQA 1QV1A 1OZSA 3PLFB 3SG6A 1S5GZ 4MEWA 4ORBB 1K93D 3CS1A 2JPTA 1YURA 1TN4A 2MA2A 1XK4C 1J55A 2D8NA 2KHNA 3HX4A 1AJ4A 2F2OA 1NX3A 1TTXA 4AQIA 2LUXA 1CDLA 3KEVA 1PRWA 4MLWA 1X02A 1TIZA 1A2XA 1K94A 1N2DA 2R2IA 4GUKA 1JFJA 1FPWA 3OP0A 3VRNA 2L0PA 1A29A 1BF5A 4HRGA 1IQ3A 2WC8A 1QS7A 1KFUS 1DJGA 1E8AA 1KWOC 1SRAA 1QX7A 2DOQA 2JNXA 5IBWA 2CBLA 2GGZA 4YGBB 3TUYC 1CB1A 4YI8A 3VROA 1DJIA 1K96A 1LKJA 1SYMA 4I5KA 3RM1A 2H61C 1H8BA 3EVUA 4MRXA 2JTZA 4NQGA 1DJZA 3EKHA 3FIAA 2JT3A 2QPTA 4DS7A 1J1EA 3GK1A 2SASA 2ZNDA 5AEQA 3ZNIA 4PHNA 2JXLA 2M97A 4A4BA 3BUOB 1B8RA 1IJ6A 4WRIA 2EC6B 1OMVA 2M1UA 1SBJA 2MHHA 2ZRTA 5ER5A 5HLVA 1EL4A 4NDDA 1XFWO 1GJYA 3DVMA 1NPQA 4GPLB 2OTGC 1UHHA 1CNPA 2LVIA 3EVVA 2FJUB 3SG2A 2LMUA 2HF5A 2BL0C 2JXCA 3KHEA 1OOJA 4MN0A 1MUXA 3WHUB 3MSEB 4P2YB 4PHKA 3FWCA 3JVTC 2COLB 4XJKA 3AAJA 1SR6C 4CFRA 4QJ5B 3EK7A 4ETOA 1KQMC 1WLZA 4FTGA 2K7CA 2KI4C 1SY9A 1CMFA 4C0LA 1EG3A 4AOMA 3D0YA 4I5NB 1QVIZ 3CR4X 1TOPA 2FCEA 2I18A 4XJKB 1IRJA 1U5IA 3I5GC 3CLNA 1TCOB 1NCXA 4N1GA 2B1UA 4OVNF 3TZ1A 1IKUA 1QLKA 3DF0B 4HRHA 2BE6A 1XO5A 1L2OB 4YGDB 3BUWB 2AAOA 2KNEA 1GQMA 3C1VA 3D0YB 1A03A 1PSRA 3I5FB 1YX8A 1S36A 1QIWA 1KSOA 2I2RE 1B4CA 4BY5A 3I5IC 5PALA 1FBVA 1LXFC 4ICBA 3QRXA 4GGFC 2GV5A 2LVJA 1QX2A 2E30A 1CDPA 2KBIA 2KFFA 1RTP1 4WQ3A 2JNFA 2K2AA 3EK4A 2LC5A 3TDIA 1MF8B 1NYAA 1OQPA 1DGUA 1GGWA 2M29A 1EXRA 1PVBA 2OS8C 2Y1NA 2LAPA 3BUXB 4OV2A 4ZCVA 1JC2A 2JZIA 4QJ4B 3SG3A 1CTRA 1KK7Y 2CT9A 1XFYO 1TNPA 4C0JA 3NSIA 4YGCB 1YUUA 1YVHA 2WOSA 1DVIA 2K61A 4XYNA 4OCIA 4CPVA 4JQ0D 1F71A 2LHLA 1CM1A 4M2QA 1JBAA 1RK9A 3A4UB 4QJ3B 1C07A 1NX2A 2K7DA 4PE7A 1ZACA 2LP3A 5B8IB 1UHJA 5TNCA 4YI9A 2KBMA 2F3ZA 1CFDA 1JF2A 1F8HA 1V1FA 1EJ3A 2KYCA 1JFKA 2LHIA 2I7AA 3EVRA 4C0KA 1JSAA 1TNWA 2L98A 2M9GA 3PM8A 5AXIA 4N5XA 3I5HB 2JC2A 1YUTA 2K8MB 3LL8B 1BG1A 1IGVA 4JWQA 3EKJA 3LK0A 3O2PA 5AFPA 1DF0B 1KFUL 1ZFSA 2KI6C 4Q04A 1B1GA 5CSJA 5I2QA 1LA0A 4CFQA 2FOTA 4U8DA 1EG4A 2ZNEA 1CDNA 3CTNA 1NX1A 1AHRA 2NLNA 2NXQA 1J7QA 1SPYA 5D69A 2EC6C 1B8CA 4NDCA 5G08A 1J7RA 2H2KA 3CR2A 1QATA 1UHNA 2ZFDA 3BXKA 1QLSA 1J7PA 1F54A 2MAZA 1D1OA 3PSRA 3BYAA 2KSPA 1SCVA 2JT8A 2K2FA 2F3YA 1YRTB 4WQ2A 5CSIA 2Q4UA 1XK4A 2KAXA 1FI5A 1M39A 2NCOA 1BODA 2M1KB 1EH2A 1MXLC 2LM5A 2KFGA 2LNKA 1QASA 3OB2B 1JUOA 2BKHB 2G9BA 2PASA 2VRGA 1R2UA 5AERA 1HQVA 3TS5B 1KSMA 3GK2A 2BKIB 1QVIY 1L7ZA 1G33A 1NSHA 2Y1MA 3PFVA 1FF1A 1SL9A 1FI6A 1AUIB 1G8IA 4USLA 2M8UA 1KFXS 3DD4A 1PALA 3NSKA 1GGZA 1OZOA 3DVKA 3M0WA 1QX5B 1L2OC 1XFZO 3HCMA 2H61A 1QTXA 1MWNA 3AAKA 5FYXA 4GNKB 1TNXA 3TDUA 3ZWHA 1Y0VH 4GGNA 1B7TZ 1NP8A 3FS7A 1K2HA 2LMTA 2TN4A 3SG7A 1DJHA 3I5FC 1S6CA 2EHBA 2PVBA 2ZN9A 4ZCUA 3VRQA 1J7OA 4L9MA 2JT0A 3OB1B 2M49B 1QXPA 4ORCB 1N65A 4MSPA 1WRZA 2FCDA 2Q91A 5CSFA 1DMOA 1SCMB 4YGEB 1ALWA 2LE9B 1YTZC 3KO0A 1RJVA 1KQVA 2F8PA 2GGMA 3IF7A 3WNXB 5HKWA 3E3RA 3EK8A 1IG5A 1F70A 1PVAA 4FQOA 2ZRSA 1LVCD 1RECA 1UHIA 2M7LA 2QACA 3CWGA 3SIBA 1U5IB 2MLEC 3CR5X 2CXJA 1MQ1A 4IL1A 3H4SE 3TDZA 1SKTA 1CLBA 1BLQA 2LLTA 2BCAA 1WY9A 1MXEA 2MLFC 4M2PA 1UWOA 1DTLA 1NCZA 1OMDA 2A4JA 4MZJA 1QV0A 1ZOTB 1J1DA 1BOCA 3IQOA 1JF0A 3OX6A 5I2OA 2KAYA 1XA5A 2ZN8A 4PHMA 5J3XA 1BMOA 1DT7B 3PN7B 1K9KA 2MRDA 1R6PA 3CZTX 3GOFA 2WCFA 4AQJA 5GQQC 5DKNA 5HYDA 2RGIA 1BR1B 1IJ5A 2KI6D 1S5GY 1XYDA 3I5HC 1OE9B 1A75A 1WDCB 3DVEA 1DJYA 4E68A 1LINA 3VRRA 4JPZB 3D10A 1UP5A 2L50A 1YUSA 2JWWA 4PE0A 5BPJA 1H4BA 1KK8B 1YX7A 4GAOA 5CSNA 3IQQA 1N0YA 1ALVA 2LP2A 5HKYA 1ZMZA 3K21A 1CM4A 4TNCA 2BBNA 4OR9B 1IQ5A 2IS9A 1F4OA 1NIWA 1F4QA 1DGVA 1UURA 1XFUO 2M7NA 1K9UA 2SCPA 4HREE 5DKRA 5KSZA 1AK8A 2L5XB 1S6JA 1K9PA 4CIDA 2LVVA 4MZLA 3ICBA 5KTYA 1XFVO 3BQ3A 1M46A 2K0JA 1S1EA 3WHTB 1M45A 1RWYA 1JWDA 4N1FA 1MR8A 1BU3A 3NXAA 1B9AA 1ODBA 3GK4X 1NX0A 1W7IB 4ORAB 1CLMA 3SG4A 1XFXO 2LCPA 3LLEA 4BY4A 1S6IA 2NZ0A 1S26D 2AMIA 3TS5C 5KU1A 2MBXA 2HPSA 1NCYA 3SG5A 5JOLA 1AVSA 1LA3A 1CDMA 2KFHA 1Q80A 2F2PA 4M2OA 2WCBA 1CFCA 1M63B 3NSLA 1UHKA 1OMRA 2KQYA 4GBAA 1V1GA 2JRFA 5ER4X 1SMGA 4PHJA 3BUNB 5AANA 1KFXL 1G4YR 1B7TY 2JOJA 5K89A 3OX5A 1SNLA 3DVJA 4DIRA 2MJWB 1OSAA 2WNDA 1UUSA 2HQWA 1PULA 2KYFA 1PK0D 1YRUB 3WXAA 2JU0A 2CCMA 2NCPA 4MRYA 4A4CA 1NUBA 1DJWA 2PMYA 1K90D 1SCMC 1RROA 4PE4A 1QIVA 2LANA 3BOWA 4UPGA 2KQ6A 1CFPA 4P5OE 2F33A 2K7OA 5I2LA 1ZUZA 2G2BA 4YGAA 1S3PA 2HQ8A 5CPVA 3VRPA 1YVLA 2LLUA 1KWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE4 A;  3LK1 A;  2L4I A;  1Y1X A;  3TUY B;  1C7W A;  5JJG A;  4DRW A;  3F45 A;  1A4P A;  1RFJ A;  2BCB A;  3BOW B;  3LCP C;  2JUL A;  5DKQ A;  1W7J B;  3A8R A;  3SIA A;  1F55 A;  4YRU A;  2Y4Q A;  2M3W A;  4PE1 A;  3KF9 A;  3DF0 A;  1C7V A;  3PN7 C;  1WLM A;  3JTD C;  4HSZ A;  1CLL A;  1WRL A;  4PCW A;  5F6T A;  2OTG B;  3KPX A;  2L4H A;  4NDB A;  1TRF A;  3FWB A;  2LUC A;  1K8U A;  4R1E A;  3CGA A;  4MVF A;  1WDC C;  2KOT A;  2BL0 B;  1WRK A;  3NSO A;  2BEC A;  2KAV A;  1FW4 A;  4PDZ A;  2KGR A;  1NWD A;  1TNQ A;  1KK8 C;  3JVT B;  1IH0 A;  4F0Z B;  3AKA A;  1SR6 B;  1BR4 B;  5HKZ A;  1PSB A;  3PAT A;  2JQ6 A;  4I5J A;  3JTD B;  1KQM B;  4GFT A;  2CNP A;  2KI4 B;  1QJT A;  1KCY A;  2Y5I A;  1Y1A A;  2LMV A;  2V53 A;  5I8N A;  1B47 A;  1AP4 A;  3I5G B;  2ZKM X;  1DJX A;  1IWQ A;  4D1E A;  4MBE A;  1XVJ A;  2LV7 A;  3VGO A;  1BJF A;  2OPO A;  3PAL A;  4GGF A;  2L51 A;  1Y6W A;  1AJ5 A;  1TCF A;  2I94 A;  4CLN A;  1BT6 A;  1A75 B;  2O60 A;  1K95 A;  2L2E A;  1Y1U A;  2WCE A;  2BBM A;  2PAL A;  1SK6 D;  2PSR A;  1CFF A;  4PAL A;  2O5G A;  2EGD A;  3I5I B;  2ISD A;  1M31 A;  2K7B A;  3OHM B;  1VRK A;  1SW8 A;  3RLZ A;  2CTN A;  1SL8 A;  3O4Y A;  2M0R A;  1CMG A;  1MHO A;  2BCX A;  2JTT A;  4OKH A;  2KGB C;  4DCK A;  1HT9 A;  2WOR A;  3AKB A;  2OS8 B;  1DF0 A;  2LVK A;  1B8L A;  1CKK A;  2P6B B;  2AUC A;  4MZK A;  5D7F A;  1SL7 A;  2KDH A;  1KK7 Z;  2LLS A;  3O78 A;  4YBH B;  5HLO A;  3SJS A;  3BUM B;  1YR5 A;  2E6W A;  2PRU A;  4I5L B;  2HET A;  3O6B A;  4DUQ A;  1QV1 A;  1OZS A;  3PLF B;  3SG6 A;  1S5G Z;  4MEW A;  4ORB B;  1K93 D;  3CS1 A;  2JPT A;  1YUR A;  1TN4 A;  2MA2 A;  1XK4 C;  1J55 A;  2D8N A;  2KHN A;  3HX4 A;  1AJ4 A;  2F2O A;  1NX3 A;  1TTX A;  4AQI A;  2LUX A;  1CDL A;  3KEV A;  1PRW A;  4MLW A;  1X02 A;  1TIZ A;  1A2X A;  1K94 A;  1N2D A;  2R2I A;  4GUK A;  1JFJ A;  1FPW A;  3OP0 A;  3VRN A;  2L0P A;  1A29 A;  1BF5 A;  4HRG A;  1IQ3 A;  2WC8 A;  1QS7 A;  1KFU S;  1DJG A;  1E8A A;  1KWO C;  1SRA A;  1QX7 A;  2DOQ A;  2JNX A;  5IBW A;  2CBL A;  2GGZ A;  4YGB B;  3TUY C;  1CB1 A;  4YI8 A;  3VRO A;  1DJI A;  1K96 A;  1LKJ A;  1SYM A;  4I5K A;  3RM1 A;  2H61 C;  1H8B A;  3EVU A;  4MRX A;  2JTZ A;  4NQG A;  1DJZ A;  3EKH A;  3FIA A;  2JT3 A;  2QPT A;  4DS7 A;  1J1E A;  3GK1 A;  2SAS A;  2ZND A;  5AEQ A;  3ZNI A;  4PHN A;  2JXL A;  2M97 A;  4A4B A;  3BUO B;  1B8R A;  1IJ6 A;  4WRI A;  2EC6 B;  1OMV A;  2M1U A;  1SBJ A;  2MHH A;  2ZRT A;  5ER5 A;  5HLV A;  1EL4 A;  4NDD A;  1XFW O;  1GJY A;  3DVM A;  1NPQ A;  4GPL B;  2OTG C;  1UHH A;  1CNP A;  2LVI A;  3EVV A;  2FJU B;  3SG2 A;  2LMU A;  2HF5 A;  2BL0 C;  2JXC A;  3KHE A;  1OOJ A;  4MN0 A;  1MUX A;  3WHU B;  3MSE B;  4P2Y B;  4PHK A;  3FWC A;  3JVT C;  2COL B;  4XJK A;  3AAJ A;  1SR6 C;  4CFR A;  4QJ5 B;  3EK7 A;  4ETO A;  1KQM C;  1WLZ A;  4FTG A;  2K7C A;  2KI4 C;  1SY9 A;  1CMF A;  4C0L A;  1EG3 A;  4AOM A;  3D0Y A;  4I5N B;  1QVI Z;  3CR4 X;  1TOP A;  2FCE A;  2I18 A;  4XJK B;  1IRJ A;  1U5I A;  3I5G C;  3CLN A;  1TCO B;  1NCX A;  4N1G A;  2B1U A;  4OVN F;  3TZ1 A;  1IKU A;  1QLK A;  3DF0 B;  4HRH A;  2BE6 A;  1XO5 A;  1L2O B;  4YGD B;  3BUW B;  2AAO A;  2KNE A;  1GQM A;  3C1V A;  3D0Y B;  1A03 A;  1PSR A;  3I5F B;  1YX8 A;  1S36 A;  1QIW A;  1KSO A;  2I2R E;  1B4C A;  4BY5 A;  3I5I C;  5PAL A;  1FBV A;  1LXF C;  4ICB A;  3QRX A;  4GGF C;  2GV5 A;  2LVJ A;  1QX2 A;  2E30 A;  1CDP A;  2KBI A;  2KFF A;  1RTP 1;  4WQ3 A;  2JNF A;  2K2A A;  3EK4 A;  2LC5 A;  3TDI A;  1MF8 B;  1NYA A;  1OQP A;  1DGU A;  1GGW A;  2M29 A;  1EXR A;  1PVB A;  2OS8 C;  2Y1N A;  2LAP A;  3BUX B;  4OV2 A;  4ZCV A;  1JC2 A;  2JZI A;  4QJ4 B;  3SG3 A;  1CTR A;  1KK7 Y;  2CT9 A;  1XFY O;  1TNP A;  4C0J A;  3NSI A;  4YGC B;  1YUU A;  1YVH A;  2WOS A;  1DVI A;  2K61 A;  4XYN A;  4OCI A;  4CPV A;  4JQ0 D;  1F71 A;  2LHL A;  1CM1 A;  4M2Q A;  1JBA A;  1RK9 A;  3A4U B;  4QJ3 B;  1C07 A;  1NX2 A;  2K7D A;  4PE7 A;  1ZAC A;  2LP3 A;  5B8I B;  1UHJ A;  5TNC A;  4YI9 A;  2KBM A;  2F3Z A;  1CFD A;  1JF2 A;  1F8H A;  1V1F A;  1EJ3 A;  2KYC A;  1JFK A;  2LHI A;  2I7A A;  3EVR A;  4C0K A;  1JSA A;  1TNW A;  2L98 A;  2M9G A;  3PM8 A;  5AXI A;  4N5X A;  3I5H B;  2JC2 A;  1YUT A;  2K8M B;  3LL8 B;  1BG1 A;  1IGV A;  4JWQ A;  3EKJ A;  3LK0 A;  3O2P A;  5AFP A;  1DF0 B;  1KFU L;  1ZFS A;  2KI6 C;  4Q04 A;  1B1G A;  5CSJ A;  5I2Q A;  1LA0 A;  4CFQ A;  2FOT A;  4U8D A;  1EG4 A;  2ZNE A;  1CDN A;  3CTN A;  1NX1 A;  1AHR A;  2NLN A;  2NXQ A;  1J7Q A;  1SPY A;  5D69 A;  2EC6 C;  1B8C A;  4NDC A;  5G08 A;  1J7R A;  2H2K A;  3CR2 A;  1QAT A;  1UHN A;  2ZFD A;  3BXK A;  1QLS A;  1J7P A;  1F54 A;  2MAZ A;  1D1O A;  3PSR A;  3BYA A;  2KSP A;  1SCV A;  2JT8 A;  2K2F A;  2F3Y A;  1YRT B;  4WQ2 A;  5CSI A;  2Q4U A;  1XK4 A;  2KAX A;  1FI5 A;  1M39 A;  2NCO A;  1BOD A;  2M1K B;  1EH2 A;  1MXL C;  2LM5 A;  2KFG A;  2LNK A;  1QAS A;  3OB2 B;  1JUO A;  2BKH B;  2G9B A;  2PAS A;  2VRG A;  1R2U A;  5AER A;  1HQV A;  3TS5 B;  1KSM A;  3GK2 A;  2BKI B;  1QVI Y;  1L7Z A;  1G33 A;  1NSH A;  2Y1M A;  3PFV A;  1FF1 A;  1SL9 A;  1FI6 A;  1AUI B;  1G8I A;  4USL A;  2M8U A;  1KFX S;  3DD4 A;  1PAL A;  3NSK A;  1GGZ A;  1OZO A;  3DVK A;  3M0W A;  1QX5 B;  1L2O C;  1XFZ O;  3HCM A;  2H61 A;  1QTX A;  1MWN A;  3AAK A;  5FYX A;  4GNK B;  1TNX A;  3TDU A;  3ZWH A;  1Y0V H;  4GGN A;  1B7T Z;  1NP8 A;  3FS7 A;  1K2H A;  2LMT A;  2TN4 A;  3SG7 A;  1DJH A;  3I5F C;  1S6C A;  2EHB A;  2PVB A;  2ZN9 A;  4ZCU A;  3VRQ A;  1J7O A;  4L9M A;  2JT0 A;  3OB1 B;  2M49 B;  1QXP A;  4ORC B;  1N65 A;  4MSP A;  1WRZ A;  2FCD A;  2Q91 A;  5CSF A;  1DMO A;  1SCM B;  4YGE B;  1ALW A;  2LE9 B;  1YTZ C;  3KO0 A;  1RJV A;  1KQV A;  2F8P A;  2GGM A;  3IF7 A;  3WNX B;  5HKW A;  3E3R A;  3EK8 A;  1IG5 A;  1F70 A;  1PVA A;  4FQO A;  2ZRS A;  1LVC D;  1REC A;  1UHI A;  2M7L A;  2QAC A;  3CWG A;  3SIB A;  1U5I B;  2MLE C;  3CR5 X;  2CXJ A;  1MQ1 A;  4IL1 A;  3H4S E;  3TDZ A;  1SKT A;  1CLB A;  1BLQ A;  2LLT A;  2BCA A;  1WY9 A;  1MXE A;  2MLF C;  4M2P A;  1UWO A;  1DTL A;  1NCZ A;  1OMD A;  2A4J A;  4MZJ A;  1QV0 A;  1ZOT B;  1J1D A;  1BOC A;  3IQO A;  1JF0 A;  3OX6 A;  5I2O A;  2KAY A;  1XA5 A;  2ZN8 A;  4PHM A;  5J3X A;  1BMO A;  1DT7 B;  3PN7 B;  1K9K A;  2MRD A;  1R6P A;  3CZT X;  3GOF A;  2WCF A;  4AQJ A;  5GQQ C;  5DKN A;  5HYD A;  2RGI A;  1BR1 B;  1IJ5 A;  2KI6 D;  1S5G Y;  1XYD A;  3I5H C;  1OE9 B;  1A75 A;  1WDC B;  3DVE A;  1DJY A;  4E68 A;  1LIN A;  3VRR A;  4JPZ B;  3D10 A;  1UP5 A;  2L50 A;  1YUS A;  2JWW A;  4PE0 A;  5BPJ A;  1H4B A;  1KK8 B;  1YX7 A;  4GAO A;  5CSN A;  3IQQ A;  1N0Y A;  1ALV A;  2LP2 A;  5HKY A;  1ZMZ A;  3K21 A;  1CM4 A;  4TNC A;  2BBN A;  4OR9 B;  1IQ5 A;  2IS9 A;  1F4O A;  1NIW A;  1F4Q A;  1DGV A;  1UUR A;  1XFU O;  2M7N A;  1K9U A;  2SCP A;  4HRE E;  5DKR A;  5KSZ A;  1AK8 A;  2L5X B;  1S6J A;  1K9P A;  4CID A;  2LVV A;  4MZL A;  3ICB A;  5KTY A;  1XFV O;  3BQ3 A;  1M46 A;  2K0J A;  1S1E A;  3WHT B;  1M45 A;  1RWY A;  1JWD A;  4N1F A;  1MR8 A;  1BU3 A;  3NXA A;  1B9A A;  1ODB A;  3GK4 X;  1NX0 A;  1W7I B;  4ORA B;  1CLM A;  3SG4 A;  1XFX O;  2LCP A;  3LLE A;  4BY4 A;  1S6I A;  2NZ0 A;  1S26 D;  2AMI A;  3TS5 C;  5KU1 A;  2MBX A;  2HPS A;  1NCY A;  3SG5 A;  5JOL A;  1AVS A;  1LA3 A;  1CDM A;  2KFH A;  1Q80 A;  2F2P A;  4M2O A;  2WCB A;  1CFC A;  1M63 B;  3NSL A;  1UHK A;  1OMR A;  2KQY A;  4GBA A;  1V1G A;  2JRF A;  5ER4 X;  1SMG A;  4PHJ A;  3BUN B;  5AAN A;  1KFX L;  1G4Y R;  1B7T Y;  2JOJ A;  5K89 A;  3OX5 A;  1SNL A;  3DVJ A;  4DIR A;  2MJW B;  1OSA A;  2WND A;  1UUS A;  2HQW A;  1PUL A;  2KYF A;  1PK0 D;  1YRU B;  3WXA A;  2JU0 A;  2CCM A;  2NCP A;  4MRY A;  4A4C A;  1NUB A;  1DJW A;  2PMY A;  1K90 D;  1SCM C;  1RRO A;  4PE4 A;  1QIV A;  2LAN A;  3BOW A;  4UPG A;  2KQ6 A;  1CFP A;  4P5O E;  2F33 A;  2K7O A;  5I2L A;  1ZUZ A;  2G2B A;  4YGA A;  1S3P A;  2HQ8 A;  5CPV A;  3VRP A;  1YVL A;  2LLU A;  1KWO B; 
#chains in the Genus database with same CATH topology
 2BE4 A;  3LK1 A;  2L4I A;  1Y1X A;  3TUY B;  1C7W A;  5JJG A;  4DRW A;  3F45 A;  1A4P A;  1RFJ A;  2BCB A;  3BOW B;  3LCP C;  2JUL A;  5DKQ A;  3S0B A;  2GTE A;  1W7J B;  3A8R A;  3QME A;  3SIA A;  1F55 A;  4YRU A;  2Y4Q A;  2M3W A;  4PE1 A;  3KF9 A;  3DF0 A;  1C7V A;  3PN7 C;  1WLM A;  3JTD C;  4HSZ A;  1CLL A;  1WRL A;  4PCW A;  5F6T A;  2OTG B;  3KPX A;  2L4H A;  4NDB A;  3SS3 A;  1TRF A;  3FWB A;  2LUC A;  1K8U A;  4KYN A;  4R1E A;  3VRO A;  3CGA A;  4MVF A;  1WDC C;  3L47 A;  2KOT A;  2BL0 B;  1WRK A;  3NSO A;  3SS4 A;  2BEC A;  2KAV A;  1FW4 A;  4F7F A;  4PDZ A;  2KGR A;  1NWD A;  1TNQ A;  1KK8 C;  3JVT B;  1P28 A;  1IH0 A;  4F0Z B;  3AKA A;  1SR6 B;  1BR4 B;  5HKZ A;  3R1O A;  1PSB A;  3PAT A;  2JQ6 A;  4I5J A;  3JTD B;  1KQM B;  4GFT A;  2CNP A;  2KI4 B;  1OOG A;  1QJT A;  1KCY A;  2Y5I A;  1Y1A A;  2LMV A;  2V53 A;  5I8N A;  1B47 A;  2JPO A;  1AP4 A;  3I5G B;  2ZKM X;  1DJX A;  1IWQ A;  4D1E A;  4MBE A;  1XVJ A;  3S0D A;  2LV7 A;  3VGO A;  1BJF A;  2OPO A;  3PAL A;  4GGF A;  2L51 A;  2WCH A;  1Y6W A;  1AJ5 A;  1TCF A;  2I94 A;  4CLN A;  1BT6 A;  3D76 A;  1A75 B;  2O60 A;  1K95 A;  2L2E A;  1Y1U A;  5I94 A;  2WCE A;  2BBM A;  2PAL A;  1SK6 D;  2PSR A;  1CFF A;  4PAL A;  2O5G A;  2EGD A;  3I5I B;  2ISD A;  1M31 A;  2K7B A;  3OHM B;  1DEK A;  1SW8 A;  1VRK A;  3RLZ A;  2CTN A;  1SL8 A;  3O4Y A;  2M0R A;  1CMG A;  1MHO A;  2BCX A;  2JTT A;  4OKH A;  2KGB C;  3ZWH A;  4DCK A;  1HT9 A;  2WOR A;  3AKB A;  2OS8 B;  1DF0 A;  2LVK A;  1B8L A;  1CKK A;  2P6B B;  2AUC A;  4MZK A;  5D7F A;  1SL7 A;  3L4L A;  2KDH A;  1KK7 Z;  2LLS A;  3O78 A;  4YBH B;  5HLO A;  3SJS A;  3R72 A;  3BUM B;  1YR5 A;  2E6W A;  2PRU A;  4I5L B;  2HET A;  3O6B A;  4DUQ A;  1QV1 A;  1OZS A;  3PLF B;  3NHI A;  3SG6 A;  3OBV A;  1S5G Z;  4MEW A;  3DY9 A;  4ORB B;  1K93 D;  3CS1 A;  2JPT A;  1YUR A;  3CZ0 A;  2KLD A;  1TN4 A;  2MA2 A;  1XK4 C;  1DQE A;  1J55 A;  2D8N A;  2KHN A;  3HX4 A;  1AJ4 A;  2F2O A;  1NX3 A;  1TTX A;  2QEH A;  4AQI A;  2LUX A;  1CDL A;  3KEV A;  1PRW A;  3CYZ A;  1X02 A;  1TIZ A;  1A2X A;  1K94 A;  1N2D A;  2R2I A;  4GUK A;  1JFJ A;  1FPW A;  3OP0 A;  4OZD A;  3VRN A;  2L0P A;  1A29 A;  2BNX A;  3R1P A;  3BFH A;  2WC8 A;  4HRG A;  1BF5 A;  1IQ3 A;  1QS7 A;  1KFU S;  1DJG A;  1E8A A;  1KWO C;  1SRA A;  1QX7 A;  2DOQ A;  2JNX A;  5IBW A;  2CBL A;  2GGZ A;  4YGB B;  3TUY C;  1CB1 A;  3UO9 A;  4YI8 A;  2WCK A;  1DJI A;  1K96 A;  1LKJ A;  1SYM A;  3D75 A;  4I5K A;  2H61 C;  3RM1 A;  3EVU A;  4MRX A;  2JTZ A;  1H8B A;  4NQG A;  1DJZ A;  3EKH A;  3FIA A;  2JT3 A;  2QPT A;  4DS7 A;  2WCJ A;  1J1E A;  3GK1 A;  2SAS A;  2ZND A;  3N7H A;  2ERB A;  5AEQ A;  3ZNI A;  4PHN A;  2JXL A;  2M97 A;  4A4B A;  3EG5 B;  3BUO B;  1B8R A;  1IJ6 A;  4WRI A;  2EC6 B;  1OMV A;  2M1U A;  1SBJ A;  2MHH A;  2ZRT A;  5ER5 A;  5HLV A;  1EL4 A;  4NDD A;  1XFW O;  1GJY A;  3DVM A;  1NPQ A;  4GPL B;  2OTG C;  1UHH A;  1CNP A;  2LVI A;  3EVV A;  2FJU B;  3SG2 A;  2LMU A;  2HF5 A;  2BL0 C;  2JXC A;  3KHE A;  1OOJ A;  4MN0 A;  5FI6 A;  1MUX A;  3WHU B;  3MSE B;  4P2Y B;  4PHK A;  3FWC A;  3JVT C;  2COL B;  4XJK A;  3AAJ A;  1SR6 C;  4CFR A;  4QJ5 B;  3EK7 A;  4ETO A;  3VB1 A;  1KQM C;  1WLZ A;  4FTG A;  2K7C A;  2KI4 C;  1SY9 A;  1CMF A;  4C0L A;  1EG3 A;  4AOM A;  1DC1 A;  3D0Y A;  4I5N B;  1QVI Z;  3CR4 X;  1TOP A;  2FCE A;  2I18 A;  4XJK B;  1IRJ A;  1U5I A;  2FJY A;  3CLN A;  1TCO B;  1NCX A;  3I5G C;  2B1U A;  4N1G A;  4OVN F;  3TZ1 A;  1QLK A;  3DF0 B;  4HRH A;  4INX A;  2BE6 A;  1IKU A;  1XO5 A;  1L2O B;  4YGD B;  3BUW B;  1DEL A;  2AAO A;  2KNE A;  1GQM A;  3C1V A;  3D0Y B;  1A03 A;  1PSR A;  2WC6 A;  3I5F B;  1Z2C B;  3CDN A;  5FI7 A;  1YX8 A;  1S36 A;  1QIW A;  4JKT A;  1KSO A;  2I2R E;  1B4C A;  2K60 A;  4BY5 A;  3I5I C;  5PAL A;  1FBV A;  1LXF C;  4ICB A;  2WCL A;  3QRX A;  4GGF C;  2WC5 A;  2GV5 A;  2LVJ A;  1QX2 A;  2E30 A;  1CDP A;  2KBI A;  2KFF A;  1RTP 1;  4WQ3 A;  2JNF A;  2K2A A;  3EK4 A;  2LC5 A;  3TDI A;  1MF8 B;  1NYA A;  1OQP A;  5D3O A;  1DGU A;  1GGW A;  2M29 A;  1IIO A;  3D77 A;  1EXR A;  1PVB A;  2OS8 C;  2Y1N A;  1TUZ A;  2LAP A;  3BUX B;  4OV2 A;  4ZCV A;  1JC2 A;  2JZI A;  5EL2 A;  1W9Z A;  3SG3 A;  1CTR A;  4QJ4 B;  1KK7 Y;  1XFY O;  2CT9 A;  1TNP A;  4C0J A;  3O4X A;  3NSI A;  4YGC B;  1YUU A;  1YVH A;  2WOS A;  1DVI A;  4FQT A;  2K61 A;  2L5Y A;  4OCI A;  4XYN A;  4JQ0 D;  4CPV A;  2LHL A;  1CM1 A;  4M2Q A;  1JBA A;  1F71 A;  1RK9 A;  3A4U B;  4QJ3 B;  1C07 A;  1NX2 A;  2K7D A;  4PE7 A;  1ZAC A;  2LP3 A;  5B8I B;  1UHJ A;  5TNC A;  4YI9 A;  2KBM A;  2F3Z A;  1ORG A;  2L2C A;  1CFD A;  1JF2 A;  1F8H A;  1V1F A;  1QWV A;  5DIC A;  1EJ3 A;  2KYC A;  1JFK A;  2LHI A;  2I7A A;  3EVR A;  4C0K A;  4JD9 A;  1JSA A;  1TNW A;  2L98 A;  2WCM A;  2M9G A;  3PM8 A;  5AXI A;  4N5X A;  3I5H B;  2JC2 A;  1YUT A;  2K8M B;  3LL8 B;  1BG1 A;  1IGV A;  3Q8I A;  4JWQ A;  3EKJ A;  3LK0 A;  3O2P A;  5AFP A;  1DF0 B;  1KFU L;  1ZFS A;  2KI6 C;  2QDI A;  4Q04 A;  2QEO A;  1B1G A;  5CSJ A;  5I2Q A;  1LA0 A;  4CFQ A;  2FOT A;  4U8D A;  1EG4 A;  2ZNE A;  1CDN A;  3CTN A;  1NX1 A;  1AHR A;  3D73 A;  2NLN A;  2NXQ A;  3S0G A;  3NGV A;  1J7Q A;  1SPY A;  5D69 A;  2EC6 C;  3CZ2 A;  1B8C A;  4NDC A;  5G08 A;  1J7R A;  2H2K A;  3B7A A;  3CR2 A;  1QAT A;  1UHN A;  2ZFD A;  3BXK A;  1QLS A;  3S0F A;  1J7P A;  2MAZ A;  1D1O A;  3PSR A;  1F54 A;  3BYA A;  2KSP A;  1SCV A;  2JT8 A;  2K2F A;  2F3Y A;  1YRT B;  4WQ2 A;  2QEV A;  5CSI A;  3SS5 A;  3R1V A;  2Q4U A;  1XK4 A;  2KAX A;  1FI5 A;  1M39 A;  2NCO A;  1BOD A;  2M1K B;  1EH2 A;  1MXL C;  2LM5 A;  3D78 A;  2KFG A;  2LNK A;  1QAS A;  3OB2 B;  2BAP A;  1JUO A;  2BKH B;  2G9B A;  2PAS A;  2VRG A;  1R2U A;  5AER A;  1HQV A;  3TS5 B;  1KSM A;  3GK2 A;  2BKI B;  4INW A;  1QVI Y;  1L7Z A;  1G33 A;  1T14 A;  1NSH A;  2Y1M A;  3OGN A;  3PFV A;  1SL9 A;  3D74 A;  1FF1 A;  1FI6 A;  2P70 A;  1AUI B;  1G8I A;  4USL A;  2M8U A;  1KFX S;  3DD4 A;  3V2L A;  1PAL A;  3NSK A;  1GGZ A;  1OZO A;  3DVK A;  1OOF A;  3BFB A;  3M0W A;  3RZS A;  1QX5 B;  1L2O C;  1XFZ O;  3FE9 A;  2H61 A;  1QTX A;  1MWN A;  3AAK A;  3HCM A;  4GNK B;  1TNX A;  5FYX A;  3TDU A;  1Y0V H;  4GGN A;  1B7T Z;  1NP8 A;  3FS7 A;  1K2H A;  2LMT A;  2TN4 A;  3SG7 A;  1DJH A;  3I5F C;  1S6C A;  3S0E A;  2EHB A;  3B6X A;  2PVB A;  2ZN9 A;  4ZCU A;  3VRQ A;  3DYE A;  1J7O A;  4L9M A;  2JT0 A;  3B88 A;  3OB1 B;  2M49 B;  1QXP A;  4ORC B;  1N65 A;  4MSP A;  1WRZ A;  2FCD A;  2Q91 A;  5CSF A;  1C3Y A;  1DMO A;  3K1E A;  1SCM B;  4YGE B;  1ALW A;  2LE9 B;  1YTZ C;  3KO0 A;  1C3Z A;  1RJV A;  2P71 A;  2F8P A;  2GGM A;  2KLE A;  3IF7 A;  3WNX B;  5HKW A;  1KQV A;  3E3R A;  3EK8 A;  1IG5 A;  2PYQ A;  1PVA A;  4FQO A;  1F70 A;  2ZRS A;  1LVC D;  2YGU A;  1REC A;  1UHI A;  2M7L A;  2QAC A;  3CWG A;  3SIB A;  1U5I B;  2MLE C;  3BFA A;  3CR5 X;  2CXJ A;  1MQ1 A;  2QEB A;  3H4S E;  4IL1 A;  1XFR A;  3TDZ A;  1SKT A;  1CLB A;  1BLQ A;  2LLT A;  1OOI X;  2BCA A;  1WY9 A;  1MXE A;  2MLF C;  4M2P A;  1UWO A;  1DTL A;  1NCZ A;  1OMD A;  2A4J A;  4MZJ A;  1QV0 A;  1ZOT B;  1J1D A;  1BOC A;  3IQO A;  1JF0 A;  3OX6 A;  5I2O A;  2KAY A;  1XA5 A;  2ZN8 A;  4PHM A;  5J3X A;  1BMO A;  1DT7 B;  2PQL A;  3PN7 B;  1K9K A;  2MRD A;  1R6P A;  1TUJ A;  3CZT X;  2WCF A;  3GOF A;  4AQJ A;  5GQQ C;  5DKN A;  5HYD A;  2RGI A;  1BR1 B;  1IJ5 A;  2KI6 D;  5FI2 A;  4IJ7 A;  1S5G Y;  1XYD A;  3I5H C;  1OE9 B;  1A75 A;  1WDC B;  3L4A A;  3DVE A;  1DJY A;  4E68 A;  1LIN A;  3VRR A;  2H8V A;  3IVT A;  4JPZ B;  3D10 A;  1UP5 A;  1OOH A;  2L50 A;  1YUS A;  2JWW A;  4PE0 A;  5BPJ A;  1H4B A;  3DZT A;  1KK8 B;  1YX7 A;  4GAO A;  5CSN A;  3IQQ A;  1N0Y A;  1ALV A;  2LP2 A;  3B87 A;  5HKY A;  4PT1 A;  1TWO A;  1ZMZ A;  3K21 A;  1CM4 A;  4TNC A;  2BBN A;  4OR9 B;  1IQ5 A;  2IS9 A;  1F4O A;  1Z4H A;  1NIW A;  1F4Q A;  5HL1 A;  1DGV A;  1UUR A;  1XFU O;  2M7N A;  1K9U A;  2SCP A;  1LS8 A;  4HRE E;  5DKR A;  5KSZ A;  1AK8 A;  2L5X B;  3PJI A;  1S6J A;  1K9P A;  3CZ1 A;  4CID A;  2LVV A;  4MZL A;  3ICB A;  3CAB A;  5KTY A;  1XFV O;  3NHT A;  3UNW A;  3BQ3 A;  1M46 A;  2K0J A;  1S1E A;  3WHT B;  1M45 A;  1OW4 A;  1RWY A;  3S0A A;  3DXL A;  1JWD A;  4N1F A;  1MR8 A;  1BU3 A;  3NXA A;  1B9A A;  1ODB A;  3GK4 X;  1NX0 A;  1W7I B;  1SSE B;  1CLM A;  4ORA B;  3SG4 A;  1XFX O;  2LCP A;  3FE8 A;  3LLE A;  4BY4 A;  1S6I A;  2NZ0 A;  1S26 D;  2AMI A;  3TS5 C;  2KPH A;  3BJH A;  2MBX A;  2HPS A;  5KU1 A;  1NCY A;  3SG5 A;  3FE6 A;  5JOL A;  1AVS A;  1LA3 A;  1CDM A;  4MLW A;  2KFH A;  1Q80 A;  2F2P A;  4M2O A;  2WCB A;  1CFC A;  1M63 B;  3NSL A;  1UHK A;  1OMR A;  2KQY A;  3B86 A;  3PM2 A;  4GBA A;  1V1G A;  2JRF A;  5ER4 X;  1SMG A;  4PHJ A;  3BUN B;  5AAN A;  1KFX L;  1G4Y R;  1B7T Y;  2JOJ A;  5K89 A;  3OX5 A;  1SNL A;  3DVJ A;  4DIR A;  2MJW B;  1OSA A;  2WND A;  1UUS A;  2HQW A;  1GM0 A;  1PUL A;  2KYF A;  1PK0 D;  1YRU B;  3WXA A;  2JU0 A;  2CCM A;  2NCP A;  4MRY A;  4A4C A;  1NUB A;  1DJW A;  2PMY A;  1K90 D;  1SCM C;  1RRO A;  4PE4 A;  1QIV A;  2LAN A;  3BOW A;  4UPG A;  2KQ6 A;  1CFP A;  4P5O E;  2F33 A;  2K7O A;  5I2L A;  1ZUZ A;  2G2B A;  4YGA A;  1S3P A;  2HQ8 A;  5CPV A;  3VRP A;  1YVL A;  2LLU A;  1KWO B; 
#chains in the Genus database with same CATH homology
 2BE4 A;  3LK1 A;  2L4I A;  1Y1X A;  3TUY B;  1C7W A;  5JJG A;  4DRW A;  3F45 A;  1A4P A;  1RFJ A;  2BCB A;  3BOW B;  3LCP C;  2JUL A;  5DKQ A;  1W7J B;  3A8R A;  3SIA A;  1F55 A;  4YRU A;  2Y4Q A;  2M3W A;  4PE1 A;  3KF9 A;  3DF0 A;  1C7V A;  3PN7 C;  1WLM A;  3JTD C;  4HSZ A;  1CLL A;  1WRL A;  4PCW A;  5F6T A;  2OTG B;  3KPX A;  2L4H A;  4NDB A;  1TRF A;  3FWB A;  2LUC A;  1K8U A;  4R1E A;  3CGA A;  4MVF A;  1WDC C;  2KOT A;  2BL0 B;  1WRK A;  3NSO A;  2BEC A;  2KAV A;  1FW4 A;  4PDZ A;  2KGR A;  1NWD A;  1TNQ A;  1KK8 C;  3JVT B;  1IH0 A;  4F0Z B;  3AKA A;  1SR6 B;  1BR4 B;  5HKZ A;  1PSB A;  3PAT A;  2JQ6 A;  4I5J A;  3JTD B;  1KQM B;  4GFT A;  2CNP A;  2KI4 B;  1QJT A;  1KCY A;  2Y5I A;  1Y1A A;  2LMV A;  2V53 A;  5I8N A;  1B47 A;  1AP4 A;  3I5G B;  2ZKM X;  1DJX A;  1IWQ A;  4D1E A;  4MBE A;  1XVJ A;  2LV7 A;  3VGO A;  1BJF A;  2OPO A;  3PAL A;  4GGF A;  2L51 A;  1Y6W A;  1AJ5 A;  1TCF A;  2I94 A;  4CLN A;  1BT6 A;  1A75 B;  2O60 A;  1K95 A;  2L2E A;  1Y1U A;  2WCE A;  2BBM A;  2PAL A;  1SK6 D;  2PSR A;  1CFF A;  4PAL A;  2O5G A;  2EGD A;  3I5I B;  2ISD A;  1M31 A;  2K7B A;  3OHM B;  1VRK A;  1SW8 A;  3RLZ A;  2CTN A;  1SL8 A;  3O4Y A;  2M0R A;  1CMG A;  1MHO A;  2BCX A;  2JTT A;  4OKH A;  2KGB C;  4DCK A;  1HT9 A;  2WOR A;  3AKB A;  2OS8 B;  1DF0 A;  2LVK A;  1B8L A;  1CKK A;  2P6B B;  2AUC A;  4MZK A;  5D7F A;  1SL7 A;  2KDH A;  1KK7 Z;  2LLS A;  3O78 A;  4YBH B;  5HLO A;  3SJS A;  3BUM B;  1YR5 A;  2E6W A;  2PRU A;  4I5L B;  2HET A;  3O6B A;  4DUQ A;  1QV1 A;  1OZS A;  3PLF B;  3SG6 A;  1S5G Z;  4MEW A;  4ORB B;  1K93 D;  3CS1 A;  2JPT A;  1YUR A;  1TN4 A;  2MA2 A;  1XK4 C;  1J55 A;  2D8N A;  2KHN A;  3HX4 A;  1AJ4 A;  2F2O A;  1NX3 A;  1TTX A;  4AQI A;  2LUX A;  1CDL A;  3KEV A;  1PRW A;  4MLW A;  1X02 A;  1TIZ A;  1A2X A;  1K94 A;  1N2D A;  2R2I A;  4GUK A;  1JFJ A;  1FPW A;  3OP0 A;  3VRN A;  2L0P A;  1A29 A;  1BF5 A;  4HRG A;  1IQ3 A;  2WC8 A;  1QS7 A;  1KFU S;  1DJG A;  1E8A A;  1KWO C;  1SRA A;  1QX7 A;  2DOQ A;  2JNX A;  5IBW A;  2CBL A;  2GGZ A;  4YGB B;  3TUY C;  1CB1 A;  4YI8 A;  3VRO A;  1DJI A;  1K96 A;  1LKJ A;  1SYM A;  4I5K A;  3RM1 A;  2H61 C;  1H8B A;  3EVU A;  4MRX A;  2JTZ A;  4NQG A;  1DJZ A;  3EKH A;  3FIA A;  2JT3 A;  2QPT A;  4DS7 A;  1J1E A;  3GK1 A;  2SAS A;  2ZND A;  5AEQ A;  3ZNI A;  4PHN A;  2JXL A;  2M97 A;  4A4B A;  3BUO B;  1B8R A;  1IJ6 A;  4WRI A;  2EC6 B;  1OMV A;  2M1U A;  1SBJ A;  2MHH A;  2ZRT A;  5ER5 A;  5HLV A;  1EL4 A;  4NDD A;  1XFW O;  1GJY A;  3DVM A;  1NPQ A;  4GPL B;  2OTG C;  1UHH A;  1CNP A;  2LVI A;  3EVV A;  2FJU B;  3SG2 A;  2LMU A;  2HF5 A;  2BL0 C;  2JXC A;  3KHE A;  1OOJ A;  4MN0 A;  1MUX A;  3WHU B;  3MSE B;  4P2Y B;  4PHK A;  3FWC A;  3JVT C;  2COL B;  4XJK A;  3AAJ A;  1SR6 C;  4CFR A;  4QJ5 B;  3EK7 A;  4ETO A;  1KQM C;  1WLZ A;  4FTG A;  2K7C A;  2KI4 C;  1SY9 A;  1CMF A;  4C0L A;  1EG3 A;  4AOM A;  3D0Y A;  4I5N B;  1QVI Z;  3CR4 X;  1TOP A;  2FCE A;  2I18 A;  4XJK B;  1IRJ A;  1U5I A;  3I5G C;  3CLN A;  1TCO B;  1NCX A;  4N1G A;  2B1U A;  4OVN F;  3TZ1 A;  1IKU A;  1QLK A;  3DF0 B;  4HRH A;  2BE6 A;  1XO5 A;  1L2O B;  4YGD B;  3BUW B;  2AAO A;  2KNE A;  1GQM A;  3C1V A;  3D0Y B;  1A03 A;  1PSR A;  3I5F B;  1YX8 A;  1S36 A;  1QIW A;  1KSO A;  2I2R E;  1B4C A;  4BY5 A;  3I5I C;  5PAL A;  1FBV A;  1LXF C;  4ICB A;  3QRX A;  4GGF C;  2GV5 A;  2LVJ A;  1QX2 A;  2E30 A;  1CDP A;  2KBI A;  2KFF A;  1RTP 1;  4WQ3 A;  2JNF A;  2K2A A;  3EK4 A;  2LC5 A;  3TDI A;  1MF8 B;  1NYA A;  1OQP A;  1DGU A;  1GGW A;  2M29 A;  1EXR A;  1PVB A;  2OS8 C;  2Y1N A;  2LAP A;  3BUX B;  4OV2 A;  4ZCV A;  1JC2 A;  2JZI A;  4QJ4 B;  3SG3 A;  1CTR A;  1KK7 Y;  2CT9 A;  1XFY O;  1TNP A;  4C0J A;  3NSI A;  4YGC B;  1YUU A;  1YVH A;  2WOS A;  1DVI A;  2K61 A;  4XYN A;  4OCI A;  4CPV A;  4JQ0 D;  1F71 A;  2LHL A;  1CM1 A;  4M2Q A;  1JBA A;  1RK9 A;  3A4U B;  4QJ3 B;  1C07 A;  1NX2 A;  2K7D A;  4PE7 A;  1ZAC A;  2LP3 A;  5B8I B;  1UHJ A;  5TNC A;  4YI9 A;  2KBM A;  2F3Z A;  1CFD A;  1JF2 A;  1F8H A;  1V1F A;  1EJ3 A;  2KYC A;  1JFK A;  2LHI A;  2I7A A;  3EVR A;  4C0K A;  1JSA A;  1TNW A;  2L98 A;  2M9G A;  3PM8 A;  5AXI A;  4N5X A;  3I5H B;  2JC2 A;  1YUT A;  2K8M B;  3LL8 B;  1BG1 A;  1IGV A;  4JWQ A;  3EKJ A;  3LK0 A;  3O2P A;  5AFP A;  1DF0 B;  1KFU L;  1ZFS A;  2KI6 C;  4Q04 A;  1B1G A;  5CSJ A;  5I2Q A;  1LA0 A;  4CFQ A;  2FOT A;  4U8D A;  1EG4 A;  2ZNE A;  1CDN A;  3CTN A;  1NX1 A;  1AHR A;  2NLN A;  2NXQ A;  1J7Q A;  1SPY A;  5D69 A;  2EC6 C;  1B8C A;  4NDC A;  5G08 A;  1J7R A;  2H2K A;  3CR2 A;  1QAT A;  1UHN A;  2ZFD A;  3BXK A;  1QLS A;  1J7P A;  1F54 A;  2MAZ A;  1D1O A;  3PSR A;  3BYA A;  2KSP A;  1SCV A;  2JT8 A;  2K2F A;  2F3Y A;  1YRT B;  4WQ2 A;  5CSI A;  2Q4U A;  1XK4 A;  2KAX A;  1FI5 A;  1M39 A;  2NCO A;  1BOD A;  2M1K B;  1EH2 A;  1MXL C;  2LM5 A;  2KFG A;  2LNK A;  1QAS A;  3OB2 B;  1JUO A;  2BKH B;  2G9B A;  2PAS A;  2VRG A;  1R2U A;  5AER A;  1HQV A;  3TS5 B;  1KSM A;  3GK2 A;  2BKI B;  1QVI Y;  1L7Z A;  1G33 A;  1NSH A;  2Y1M A;  3PFV A;  1FF1 A;  1SL9 A;  1FI6 A;  1AUI B;  1G8I A;  4USL A;  2M8U A;  1KFX S;  3DD4 A;  1PAL A;  3NSK A;  1GGZ A;  1OZO A;  3DVK A;  3M0W A;  1QX5 B;  1L2O C;  1XFZ O;  3HCM A;  2H61 A;  1QTX A;  1MWN A;  3AAK A;  5FYX A;  4GNK B;  1TNX A;  3TDU A;  3ZWH A;  1Y0V H;  4GGN A;  1B7T Z;  1NP8 A;  3FS7 A;  1K2H A;  2LMT A;  2TN4 A;  3SG7 A;  1DJH A;  3I5F C;  1S6C A;  2EHB A;  2PVB A;  2ZN9 A;  4ZCU A;  3VRQ A;  1J7O A;  4L9M A;  2JT0 A;  3OB1 B;  2M49 B;  1QXP A;  4ORC B;  1N65 A;  4MSP A;  1WRZ A;  2FCD A;  2Q91 A;  5CSF A;  1DMO A;  1SCM B;  4YGE B;  1ALW A;  2LE9 B;  1YTZ C;  3KO0 A;  1RJV A;  1KQV A;  2F8P A;  2GGM A;  3IF7 A;  3WNX B;  5HKW A;  3E3R A;  3EK8 A;  1IG5 A;  1F70 A;  1PVA A;  4FQO A;  2ZRS A;  1LVC D;  1REC A;  1UHI A;  2M7L A;  2QAC A;  3CWG A;  3SIB A;  1U5I B;  2MLE C;  3CR5 X;  2CXJ A;  1MQ1 A;  4IL1 A;  3H4S E;  3TDZ A;  1SKT A;  1CLB A;  1BLQ A;  2LLT A;  2BCA A;  1WY9 A;  1MXE A;  2MLF C;  4M2P A;  1UWO A;  1DTL A;  1NCZ A;  1OMD A;  2A4J A;  4MZJ A;  1QV0 A;  1ZOT B;  1J1D A;  1BOC A;  3IQO A;  1JF0 A;  3OX6 A;  5I2O A;  2KAY A;  1XA5 A;  2ZN8 A;  4PHM A;  5J3X A;  1BMO A;  1DT7 B;  3PN7 B;  1K9K A;  2MRD A;  1R6P A;  3CZT X;  3GOF A;  2WCF A;  4AQJ A;  5GQQ C;  5DKN A;  5HYD A;  2RGI A;  1BR1 B;  1IJ5 A;  2KI6 D;  1S5G Y;  1XYD A;  3I5H C;  1OE9 B;  1A75 A;  1WDC B;  3DVE A;  1DJY A;  4E68 A;  1LIN A;  3VRR A;  4JPZ B;  3D10 A;  1UP5 A;  2L50 A;  1YUS A;  2JWW A;  4PE0 A;  5BPJ A;  1H4B A;  1KK8 B;  1YX7 A;  4GAO A;  5CSN A;  3IQQ A;  1N0Y A;  1ALV A;  2LP2 A;  5HKY A;  1ZMZ A;  3K21 A;  1CM4 A;  4TNC A;  2BBN A;  4OR9 B;  1IQ5 A;  2IS9 A;  1F4O A;  1NIW A;  1F4Q A;  1DGV A;  1UUR A;  1XFU O;  2M7N A;  1K9U A;  2SCP A;  4HRE E;  5DKR A;  5KSZ A;  1AK8 A;  2L5X B;  1S6J A;  1K9P A;  4CID A;  2LVV A;  4MZL A;  3ICB A;  5KTY A;  1XFV O;  3BQ3 A;  1M46 A;  2K0J A;  1S1E A;  3WHT B;  1M45 A;  1RWY A;  1JWD A;  4N1F A;  1MR8 A;  1BU3 A;  3NXA A;  1B9A A;  1ODB A;  3GK4 X;  1NX0 A;  1W7I B;  4ORA B;  1CLM A;  3SG4 A;  1XFX O;  2LCP A;  3LLE A;  4BY4 A;  1S6I A;  2NZ0 A;  1S26 D;  2AMI A;  3TS5 C;  5KU1 A;  2MBX A;  2HPS A;  1NCY A;  3SG5 A;  5JOL A;  1AVS A;  1LA3 A;  1CDM A;  2KFH A;  1Q80 A;  2F2P A;  4M2O A;  2WCB A;  1CFC A;  1M63 B;  3NSL A;  1UHK A;  1OMR A;  2KQY A;  4GBA A;  1V1G A;  2JRF A;  5ER4 X;  1SMG A;  4PHJ A;  3BUN B;  5AAN A;  1KFX L;  1G4Y R;  1B7T Y;  2JOJ A;  5K89 A;  3OX5 A;  1SNL A;  3DVJ A;  4DIR A;  2MJW B;  1OSA A;  2WND A;  1UUS A;  2HQW A;  1PUL A;  2KYF A;  1PK0 D;  1YRU B;  3WXA A;  2JU0 A;  2CCM A;  2NCP A;  4MRY A;  4A4C A;  1NUB A;  1DJW A;  2PMY A;  1K90 D;  1SCM C;  1RRO A;  4PE4 A;  1QIV A;  2LAN A;  3BOW A;  4UPG A;  2KQ6 A;  1CFP A;  4P5O E;  2F33 A;  2K7O A;  5I2L A;  1ZUZ A;  2G2B A;  4YGA A;  1S3P A;  2HQ8 A;  5CPV A;  3VRP A;  1YVL A;  2LLU A;  1KWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...