2H61A

X-ray structure of human ca2+-loaded s100b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural and functional insights into RAGE activation by multimeric S100B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein, signaling protein
total genus 33
structure length 91
sequence length 91
chains with identical sequence B, E, F, H
ec nomenclature
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2h61A00
1ALWA 1NP8A 1RJVA 2KGBC 1V1GA 4R1EA 1TN4A 1AUIB 1F4OA 1QLKA 1TNQA 4HREE 2JRFA 1QJTA 4CFRA 1QX7A 2K7OA 2WCBA 2L51A 2ZKMX 1WDCB 2L98A 1TRFA 3LL8B 4D1EA 1CLBA 2I94A 4MLWA 5DKNA 1XO5A 1JF0A 2K61A 1TCOB 4GBAA 2LAPA 3DVMA 1CDPA 5CSIA 4OR9B 2E6WA 1UP5A 2Q4UA 3PATA 1K93D 1KK8B 1NIWA 3O78A 2BL0C 1CM4A 1JWDA 1SL8A 1SRAA 5AERA 1J7OA 4PALA 1XA5A 2CBLA 2LVKA 3TDUA 5HKZA 1NUBA 3KEVA 2LLTA 2LMUA 3VRRA 4YGAA 4BY5A 3VROA 1CFDA 5B8IB 1CM1A 1IQ5A 3NSLA 1Y6WA 2PSRA 4YGDB 2SCPA 1S6IA 4WQ3A 1CLMA 2COLB 2JNFA 4C0JA 1U5IB 1EG3A 3FIAA 2LMVA 2F3YA 2GGMA 1IRJA 1B7TY 1S6JA 5I2QA 2HPSA 4ORCB 3JTDC 2ISDA 1SY9A 4YI9A 1BU3A 1AHRA 2ZN9A 2GGZA 2BECA 2MLFC 2LVVA 3D0YB 1J1EA 3FWCA 1OMDA 1GQMA 1SCMB 2O60A 3O4YA 4F0ZB 1UHIA 2BCAA 3H4SE 3E3RA 1EXRA 4CFQA 2F2OA 3DVKA 2KBMA 3EVRA 4PHKA 4PE1A 3WNXB 4ETOA 1F4QA 1J7RA 2F33A 2KI4B 4AOMA 1DF0A 1OZSA 2OS8C 1WRLA 3SJSA 1UHNA 2F8PA 2M9GA 2WC8A 3FWBA 2LVJA 2PRUA 5AXIA 1TTXA 1DJHA 1XVJA 4MN0A 1JSAA 1MQ1A 4OKHA 1SR6B 2HF5A 4XJKA 1SBJA 1VRKA 2WOSA 3VRQA 3AKAA 3I5GB 1DJWA 2M49B 4PE0A 1KFXS 1TNWA 2BCBA 4JQ0D 1RWYA 1IGVA 2JWWA 1PVAA 2MRDA 2ZNDA 1QX5B 1A29A 2AMIA 1DMOA 3ZNIA 2BE6A 5BPJA 5KTYA 1SCVA 2MJWB 1KQMB 2Y5IA 4GNKB 2LHLA 2KAYA 1KWOC 1DJYA 2WORA 3FS7A 4XYNA 5CSJA 2KNEA 1S3PA 1KK7Z 4NQGA 1BF5A 4N1GA 1F55A 1FPWA 3KPXA 1QLSA 4MZLA 3K21A 1CMGA 2FCEA 2KSPA 2JZIA 4WRIA 5HKYA 5I2LA 1OZOA 3PM8A 1G4YR 5G08A 1SMGA 2FJUB 1AJ4A 1WRKA 1CFCA 2KQ6A 2LV7A 4MRXA 4GAOA 1FF1A 1XFXO 2Y1MA 2Y1NA 2KDHA 2K7DA 3I5IB 4PCWA 5DKQA 3SG5A 1J1DA 1S5GZ 1YURA 4HRHA 2EC6C 1NSHA 3BQ3A 4YI8A 2KOTA 1SW8A 1MHOA 3BUWB 4YGCB 3NSKA 2M29A 3BYAA 4ORAB 1QVIZ 4DRWA 4ZCVA 1UHJA 1UHHA 1M31A 3JVTC 4UPGA 1IKUA 5HLVA 1L2OC 4QJ3B 1S26D 1A4PA 2K0JA 3HX4A 1G33A 1K95A 4L9MA 1K9KA 2FOTA 1NWDA 4U8DA 1C07A 1EG4A 1SKTA 2MA2A 3C1VA 1XK4C 1W7JB 3LK0A 3TUYC 3CTNA 2BL0B 2JXCA 1XK4A 1IH0A 1LXFC 1XFZO 4QJ5B 1N2DA 2HETA 4PDZA 1YRTB 2Y4QA 1X02A 1LA0A 3CR5X 1GGWA 5I8NA 1FBVA 1XYDA 3EVUA 4GPLB 1SPYA 5KSZA 1B9AA 1SL7A 4NDCA 1YUSA 2TN4A 3EK4A 3KF9A 1XFWO 1IJ6A 1HQVA 2H61A 2Q91A 1B4CA 1AVSA 3ZWHA 3PSRA 3A8RA 1C7WA 4DS7A 4PE4A 2GV5A 1K9UA 1ZFSA 2L0PA 3SG6A 1CTRA 1M63B 3VGOA 1WLMA 2M3WA 1PRWA 4USLA 1BJFA 1NCXA 2FCDA 2NLNA 1B47A 3DD4A 3GK2A 2BKIB 4PHNA 4A4CA 1FI6A 1QV1A 1V1FA 3GOFA 1NX1A 1Y1XA 2K8MB 3BUOB 3JTDB 2OTGC 3PN7C 3VRPA 2PASA 1LVCD 1QS7A 3EKJA 5AANA 2JPTA 3HCMA 1ZUZA 3KO0A 1TIZA 1W7IB 5F6TA 3CZTX 3D10A 1DJXA 1J55A 1NPQA 2OS8B 2ZRTA 3CWGA 2L4HA 2K7CA 4M2PA 4PE7A 1DJGA 2M1KB 3PLFB 3CS1A 4PHMA 1B8LA 1G8IA 1ZACA 2P6BB 4XJKB 4C0KA 1N65A 3EK7A 1AK8A 3TDIA 2D8NA 1BLQA 2QACA 2KFHA 1YUTA 1YRUB 2HQ8A 2NCPA 2M8UA 1OMVA 1J7PA 4GGNA 1K90D 1SL9A 1SYMA 4QJ4B 4IL1A 5JJGA 2B1UA 2KGRA 2LE9B 1JFKA 1CNPA 1MXLC 3GK4X 1R6PA 2JU0A 2V53A 2MBXA 4N5XA 4ZCUA 1XFYO 3I5HC 1EH2A 2CXJA 1KWOB 2BE4A 2LHIA 4OV2A 1ZOTB 1B7TZ 3SG4A 1AP4A 1OQPA 1YX7A 1EJ3A 1QATA 2LUXA 3LCPC 1E8AA 1JF2A 3AKBA 2QPTA 2KI6D 3WHUB 3IQOA 4DCKA 1BODA 5D69A 2EHBA 2L2EA 1CLLA 1MXEA 1YX8A 2L4IA 3EVVA 5IBWA 4TNCA 2SASA 1KCYA 4MSPA 3AAJA 4C0LA 4HSZA 3BUMB 1M45A 3GK1A 1S1EA 2IS9A 1Y1AA 1ODBA 3OHMB 3F45A 2JTTA 5HKWA 5J3XA 1DVIA 1CB1A 1D1OA 1K96A 3I5FC 4ORBB 1GGZA 1TCFA 1BT6A 3BOWA 2H2KA 3EK8A 2EC6B 2KYFA 2DOQA 1DGUA 4I5NB 1OOJA 4FQOA 3TDZA 3O6BA 1TOPA 3EKHA 3RLZA 4AQJA 3DF0A 4BY4A 1B1GA 2ZN8A 3JVTB 3MSEB 5KU1A 3IF7A 1MWNA 1L2OB 1IJ5A 3O2PA 2CTNA 1Y1UA 3SIAA 2KYCA 4CPVA 3BXKA 1YVHA 3CLNA 5I2OA 1LA3A 3CR4X 2CNPA 2LC5A 2LCPA 2AAOA 2M97A 2MHHA 1XFVO 2JXLA 1BG1A 1JBAA 1DJIA 1NX0A 3TS5C 2KFFA 1OMRA 2RGIA 5JOLA 4NDDA 5PALA 3TUYB 1F70A 1QTXA 1RK9A 4GUKA 1A75A 4M2OA 2E30A 2LP2A 1L7ZA 3QRXA 4I5LB 4ICBA 4HRGA 1DT7B 1BR1B 1MR8A 1MUXA 4MVFA 1PK0D 1RROA 2AUCA 3NSOA 1KFUL 1YUUA 1JC2A 4WQ2A 1QIVA 2KHNA 1UURA 2H61C 1CKKA 1PSRA 4I5JA 2PVBA 1WDCC 2CCMA 3OP0A 1WRZA 1NX2A 3M0WA 1NCYA 5CSFA 5HLOA 3OX6A 4JPZB 4I5KA 1FW4A 1SNLA 2KAVA 1WY9A 1PULA 1N0YA 2CT9A 1Q80A 2KI6C 3AAKA 5FYXA 1C7VA 3OB2B 2LUCA 3VRNA 5K89A 1CFFA 4AQIA 1KK8C 4MEWA 1UUSA 1MF8B 2OTGB 3PN7B 4MZJA 4YGEB 5DKRA 1B8CA 1NX3A 1TNPA 2MAZA 3LLEA 2EGDA 2R2IA 3LK1A 1QASA 2KBIA 4MRYA 2KFGA 2M7LA 4CIDA 1M39A 2G9BA 2LVIA 2ZRSA 2LNKA 2HQWA 2KAXA 2WCFA 4P2YB 1CMFA 1DGVA 1NCZA 1K9PA 1A2XA 2WCEA 2JOJA 2ZNEA 3RM1A 1UWOA 1DF0B 1K94A 2G2BA 2VRGA 3ICBA 1IWQA 1Y0VH 2F3ZA 5AFPA 1H8BA 1QV0A 2M0RA 2NCOA 1DTLA 2LLUA 5ER5A 1U5IA 1UHKA 1F8HA 2PALA 2M1UA 2LM5A 4CLNA 1R2UA 1OSAA 1ALVA 2K7BA 1BMOA 2PMYA 4NDBA 4PHJA 1KK7Y 1CDNA 2I2RE 1CFPA 1M46A 1RTP1 4FTGA 1GJYA 3OB1B 1CDMA 2K2AA 2NZ0A 2WNDA 3A4UB 2F2PA 4DIRA 5TNCA 1SCMC 1QIWA 1CDLA 3D0YA 1YTZC 4YGBB 2JNXA 3I5HB 4GGFC 2BKHB 2JC2A 2KI4C 3BUNB 1OE9B 1PSBA 2JT3A 4GGFA 4YBHB 4GFTA 1PALA 2ZFDA 1KSOA 2LLSA 4N1FA 3WXAA 1J7QA 1JFJA 4OCIA 3OX5A 2LP3A 1JUOA 2JULA 3CGAA 1A03A 1DJZA 2BBMA 1SR6C 1S5GY 1EL4A 2I7AA 2L5XB 2NXQA 4YRUA 1BR4B 3I5GC 4E68A 2MLEC 2BCXA 4A4BA 3TZ1A 1YVLA 2KQYA 1QVIY 2LANA 1S6CA 1K8UA 1B8RA 4P5OE 1H4BA 1RFJA 2JQ6A 4M2QA 2OPOA 5AEQA 2O5GA 5CPVA 3DVEA 1HT9A 3DVJA 1YR5A 3SG3A 1AJ5A 3BOWB 2JTZA 4MBEA 2K2FA 1KQMC 1TNXA 2A4JA 5CSNA 3I5FB 5D7FA 1QXPA 1LINA 5HYDA 1S36A 1IQ3A 1RECA 1XFUO 3DF0B 3PALA 1KFXL 3KHEA 1FI5A 1ZMZA 2L50A 4JWQA 1F71A 1PVBA 1SK6D 1KQVA 5GQQC 3PFVA 1F54A 1QX2A 1NYAA 3NSIA 2JT0A 3WHTB 2LMTA 1KSMA 4DUQA 2JT8A 1KFUS 3IQQA 4Q04A 1K2HA 1IG5A 4MZKA 1BOCA 1LKJA 3SIBA 4OVNF 2M7NA 3SG2A 3BUXB 3TS5B 5ER4X 3SG7A 3I5IC 1A75B 2I18A 3CR2A 3NXAA 2BBNA 1WLZA
chains in the Genus database with same CATH superfamily
1ALWA 1NP8A 1RJVA 2KGBC 1V1GA 4R1EA 1TN4A 1AUIB 1F4OA 3CDNA 1QLKA 3CZ1A 1TNQA 4HREE 3BFBA 2JRFA 1QJTA 4CFRA 1QX7A 2K7OA 2WCBA 2L51A 2ZKMX 1WDCB 2L98A 1TRFA 3BFHA 3LL8B 4D1EA 1CLBA 2I94A 4MLWA 5DKNA 1XO5A 1JF0A 2K61A 1TCOB 4GBAA 2LAPA 3DVMA 1CDPA 5CSIA 3R1VA 1OOGA 4OR9B 2E6WA 1UP5A 2Q4UA 3PATA 1K93D 1KK8B 1NIWA 3O78A 2BL0C 1CM4A 1JWDA 1SL8A 1SRAA 5AERA 1J7OA 4PALA 1XA5A 2CBLA 2LVKA 3TDUA 5HKZA 1NUBA 3KEVA 2LLTA 2LMUA 3VRRA 5D3OA 3BFAA 4YGAA 4BY5A 3VROA 1CFDA 5B8IB 1CM1A 1IQ5A 1QWVA 4PT1A 3S0FA 3NSLA 2QEBA 1Y6WA 2PSRA 4YGDB 2SCPA 1S6IA 2WCLA 1CLMA 3BJHA 4WQ3A 2COLB 3FE6A 2JNFA 4C0JA 1U5IB 1EG3A 3FIAA 4JD9A 2H8VA 2LMVA 2F3YA 2GGMA 1IRJA 1B7TY 3B86A 1S6JA 5I2QA 2HPSA 2L2CA 4ORCB 3JTDC 2ISDA 1SY9A 4YI9A 1BU3A 1AHRA 2ZN9A 2GGZA 2BECA 2MLFC 3B88A 2LVVA 3D0YB 1J1EA 3FWCA 1OMDA 1GQMA 1SCMB 2O60A 3O4YA 5DICA 4F0ZB 1UHIA 2BCAA 3H4SE 3E3RA 1EXRA 4CFQA 2F2OA 3DVKA 2KBMA 3EVRA 4PHKA 4PE1A 3WNXB 4ETOA 1F4QA 1J7RA 2F33A 2KI4B 4AOMA 1DF0A 1OZSA 2OS8C 1WRLA 3SJSA 3IVTA 1UHNA 2F8PA 2M9GA 2WC8A 3FWBA 2LVJA 2PRUA 5AXIA 1TTXA 1DJHA 1XVJA 3R1OA 4MN0A 1JSAA 1MQ1A 4OKHA 1SR6B 2HF5A 4XJKA 1SBJA 1VRKA 2WOSA 3VRQA 3AKAA 3I5GB 1DJWA 2M49B 3CABA 4PE0A 1KFXS 1TNWA 2BCBA 4JQ0D 1RWYA 1IGVA 2JWWA 3O4XA 1PVAA 2MRDA 2ZNDA 1QX5B 1A29A 2AMIA 1DMOA 3ZNIA 1TWOA 3PM2A 2BE6A 5BPJA 5KTYA 1SCVA 2K60A 2MJWB 1KQMB 2Y5IA 4GNKB 3SS5A 2LHLA 3NHTA 2KAYA 3QMEA 3OBVA 1KWOC 1DJYA 2WORA 3FS7A 4XYNA 5CSJA 2KNEA 1S3PA 1KK7Z 5FI2A 4NQGA 1BF5A 4N1GA 3S0AA 1F55A 1FPWA 3KPXA 1QLSA 4MZLA 3K21A 1CMGA 2FCEA 2KSPA 1XFRA 2JZIA 4WRIA 5HKYA 3B6XA 5I2LA 1OZOA 3PM8A 1G4YR 5G08A 1SMGA 2FJUB 1AJ4A 1WRKA 1CFCA 2KQ6A 2LV7A 4MRXA 3D77A 2QEOA 4GAOA 1FF1A 1XFXO 2Y1MA 2Y1NA 2KDHA 2K7DA 3I5IB 4PCWA 5DKQA 3SG5A 3R1PA 1J1DA 1S5GZ 1YURA 1TUZA 2WC5A 1TUJA 1NSHA 2EC6C 2WCHA 3BQ3A 4HRHA 4INXA 4YI8A 2KOTA 1SW8A 1MHOA 2BAPA 3BUWB 4YGCB 3NSKA 2M29A 1Z2CB 3S0BA 3BYAA 1DC1A 4ORAB 1QVIZ 4DRWA 4ZCVA 1UHJA 1UHHA 1M31A 2QEHA 3JVTC 1T14A 3FE9A 4UPGA 1IKUA 5HLVA 1L2OC 4QJ3B 1S26D 1A4PA 2K0JA 3HX4A 1G33A 2FJYA 1K95A 3S0GA 4L9MA 1K9KA 2FOTA 1NWDA 4U8DA 1C07A 3L4LA 1SSEB 1EG4A 1SKTA 2MA2A 3C1VA 1XK4C 1W7JB 3LK0A 3TUYC 2L5YA 2BL0B 3CTNA 3DYEA 1OW4A 2JXCA 1XK4A 2KLDA 1LXFC 1XFZO 4QJ5B 1N2DA 2HETA 4PDZA 1IH0A 1YRTB 2Y4QA 1X02A 1LA0A 3CR5X 3V2LA 1GGWA 5I8NA 1FBVA 1XYDA 3EVUA 4GPLB 1SPYA 5KSZA 1B9AA 1SL7A 4NDCA 1YUSA 2TN4A 3EK4A 3KF9A 1IIOA 1XFWO 1IJ6A 1HQVA 2H61A 2Q91A 1B4CA 1AVSA 3ZWHA 2YGUA 3PSRA 3A8RA 1C7WA 4DS7A 4PE4A 2GV5A 1OOIX 1K9UA 1ZFSA 2L0PA 2WCMA 3SG6A 1CTRA 1M63B 3VGOA 1WLMA 2M3WA 1PRWA 4USLA 1BJFA 1NCXA 2FCDA 2NLNA 1B47A 3DD4A 3GK2A 3L4AA 2BKIB 4PHNA 4A4CA 1FI6A 1QV1A 1V1FA 3GOFA 1NX1A 1Y1XA 2K8MB 3BUOB 3JTDB 2OTGC 3PN7C 3VRPA 2PASA 1LVCD 1QS7A 3RZSA 3D78A 3EKJA 5AANA 2JPTA 3HCMA 1ZUZA 3KO0A 1TIZA 1W7IB 3SS4A 5F6TA 3CZTX 4C0KA 3D10A 1DJXA 1J55A 1NPQA 2OS8B 2ZRTA 3CWGA 2L4HA 2K7CA 4M2PA 4PE7A 1LS8A 4F7FA 1DJGA 2M1KB 3PLFB 3CS1A 4PHMA 1B8LA 1G8IA 1OOHA 1C3ZA 1ZACA 2P6BB 4XJKB 3K1EA 3UNWA 1N65A 3EK7A 1C3YA 1AK8A 3TDIA 2D8NA 1BLQA 2QACA 2KFHA 5HL1A 1YUTA 1YRUB 2HQ8A 2NCPA 2M8UA 1OMVA 1J7PA 4GGNA 1K90D 2QEVA 1SL9A 1SYMA 4QJ4B 4IL1A 5JJGA 2B1UA 2KGRA 2LE9B 1JFKA 1CNPA 1MXLC 3GK4X 1R6PA 2JU0A 3B7AA 3D76A 2V53A 2MBXA 4N5XA 2JPOA 4ZCUA 1XFYO 3I5HC 3DXLA 1EH2A 2CXJA 1KWOB 2BE4A 2LHIA 4OV2A 1ZOTB 1B7TZ 3SG4A 1AP4A 1OQPA 1YX7A 3D75A 1EJ3A 1QATA 2LUXA 3LCPC 3VB1A 1E8AA 1JF2A 3AKBA 3CYZA 2QPTA 2KI6D 3D73A 3WHUB 3IQOA 4DCKA 2WCKA 5I94A 1BODA 5D69A 2EHBA 2L2EA 2QDIA 1CLLA 1MXEA 1YX8A 2L4IA 3EVVA 5IBWA 4TNCA 2SASA 1KCYA 4MSPA 4JKTA 3AAJA 4C0LA 4HSZA 3BUMB 1M45A 3GK1A 1S1EA 2IS9A 1Y1AA 1ODBA 3CZ0A 3OHMB 3F45A 2JTTA 5HKWA 5J3XA 1DVIA 1CB1A 2P71A 1D1OA 1K96A 3I5FC 4ORBB 1GGZA 1TCFA 1BT6A 3BOWA 2H2KA 3EK8A 2EC6B 4KYNA 2KYFA 2DOQA 1DGUA 4I5NB 3UO9A 1DQEA 1OOJA 4FQOA 3TDZA 3O6BA 1TOPA 3EKHA 3RLZA 4AQJA 3DF0A 1Z4HA 4BY4A 1B1GA 2ZN8A 3S0EA 3JVTB 3MSEB 5KU1A 3IF7A 1MWNA 1L2OB 1IJ5A 3B87A 2CTNA 3O2PA 1Y1UA 3SIAA 2KYCA 4CPVA 5FI7A 4INWA 3BXKA 1YVHA 3CLNA 1DELA 1LA3A 2KLEA 5I2OA 3CR4X 2CNPA 2LC5A 2LCPA 2AAOA 2M97A 2MHHA 1XFVO 2JXLA 1BG1A 1JBAA 1DJIA 1NX0A 3TS5C 2KFFA 1OMRA 2BNXA 2RGIA 4NDDA 4OZDA 5JOLA 5PALA 3TUYB 1F70A 1ORGA 1QTXA 1RK9A 4GUKA 1A75A 4M2OA 2E30A 2LP2A 1L7ZA 3PJIA 3QRXA 4I5LB 4HRGA 4ICBA 3SS3A 1DT7B 1BR1B 1MR8A 1MUXA 4MVFA 1PK0D 1RROA 2AUCA 3NSOA 1KFUL 1YUUA 1JC2A 4WQ2A 1QIVA 2KHNA 1UURA 2H61C 1CKKA 1PSRA 4I5JA 2PVBA 5FI6A 1WDCC 2WCJA 2CCMA 3OP0A 1WRZA 1NX2A 1DEKA 1NCYA 3M0WA 5CSFA 5HLOA 2P70A 3OX6A 4JPZB 4I5KA 1FW4A 1SNLA 2KAVA 2WC6A 1GM0A 1WY9A 1PULA 1N0YA 2CT9A 1Q80A 2KI6C 3AAKA 5FYXA 1C7VA 3OB2B 2LUCA 3VRNA 5K89A 1CFFA 4AQIA 1KK8C 2ERBA 1UUSA 1MF8B 4MEWA 2OTGB 3PN7B 4MZJA 4YGEB 5DKRA 1B8CA 1NX3A 3NHIA 1TNPA 2MAZA 3LLEA 2KPHA 2EGDA 2R2IA 3LK1A 1QASA 2KBIA 4MRYA 2KFGA 2M7LA 4CIDA 1M39A 2G9BA 2LVIA 2ZRSA 2LNKA 2HQWA 2KAXA 2WCFA 4P2YB 3DZTA 1CMFA 1DGVA 3D74A 1NCZA 3N7HA 1K9PA 1A2XA 2WCEA 2JOJA 2ZNEA 3RM1A 1UWOA 1DF0B 1K94A 2G2BA 2VRGA 3NGVA 3ICBA 1IWQA 5EL2A 1Y0VH 2F3ZA 5AFPA 1H8BA 1QV0A 2M0RA 2NCOA 1DTLA 1P28A 2LLUA 5ER5A 1U5IA 1UHKA 1F8HA 4FQTA 2PALA 2M1UA 2LM5A 4CLNA 1R2UA 1OSAA 1ALVA 2K7BA 1BMOA 2PMYA 4NDBA 4PHJA 1KK7Y 1CDNA 2I2RE 1CFPA 1M46A 1RTP1 4FTGA 1GJYA 3OB1B 1CDMA 2K2AA 2NZ0A 2WNDA 3A4UB 3FE8A 2F2PA 4DIRA 5TNCA 1SCMC 1QIWA 1CDLA 3D0YA 1YTZC 4YGBB 2JNXA 3I5HB 4GGFC 2GTEA 2BKHB 2JC2A 2KI4C 3BUNB 1OE9B 1PSBA 2JT3A 3OGNA 4GGFA 4GFTA 4YBHB 1PALA 2ZFDA 1KSOA 2LLSA 4N1FA 3WXAA 1J7QA 1JFJA 4OCIA 3OX5A 2LP3A 1JUOA 2JULA 3CGAA 3EG5B 1A03A 1DJZA 2BBMA 1SR6C 1S5GY 1EL4A 2I7AA 2L5XB 2NXQA 4YRUA 1BR4B 3I5GC 4E68A 2MLEC 2BCXA 3CZ2A 4A4BA 3TZ1A 1YVLA 2KQYA 3Q8IA 1QVIY 2LANA 1S6CA 1K8UA 1B8RA 4P5OE 2PQLA 1H4BA 1RFJA 2JQ6A 3R72A 4M2QA 2OPOA 5AEQA 2O5GA 5CPVA 3DVEA 1HT9A 3DVJA 1YR5A 3SG3A 1AJ5A 3BOWB 2JTZA 4MBEA 2K2FA 1KQMC 1TNXA 2A4JA 5CSNA 3I5FB 5D7FA 1QXPA 1LINA 5HYDA 1S36A 1IQ3A 1RECA 1XFUO 3DF0B 3PALA 1KFXL 3DY9A 2PYQA 3KHEA 1FI5A 1ZMZA 2L50A 4JWQA 1F71A 1PVBA 1SK6D 1KQVA 5GQQC 3S0DA 3PFVA 1F54A 1QX2A 1NYAA 3L47A 2JT0A 3NSIA 3WHTB 2LMTA 1KSMA 4DUQA 2JT8A 1KFUS 3IQQA 4Q04A 1K2HA 1IG5A 4MZKA 1OOFA 1BOCA 1LKJA 3SIBA 4OVNF 2M7NA 4IJ7A 3BUXB 3SG2A 3TS5B 5ER4X 3SG7A 3I5IC 1A75B 2I18A 3CR2A 1W9ZA 3NXAA 2BBNA 1WLZA
chains in the Genus database with same CATH topology
1ALWA 1NP8A 1RJVA 2KGBC 1V1GA 4R1EA 1TN4A 1AUIB 1F4OA 1QLKA 1TNQA 4HREE 2JRFA 1QJTA 4CFRA 1QX7A 2K7OA 2WCBA 2L51A 2ZKMX 1WDCB 2L98A 1TRFA 3LL8B 4D1EA 1CLBA 2I94A 4MLWA 5DKNA 1XO5A 1JF0A 2K61A 1TCOB 4GBAA 2LAPA 3DVMA 1CDPA 5CSIA 4OR9B 2E6WA 1UP5A 2Q4UA 3PATA 1K93D 1KK8B 1NIWA 3O78A 2BL0C 1CM4A 1JWDA 1SL8A 1SRAA 5AERA 1J7OA 4PALA 1XA5A 2CBLA 2LVKA 3TDUA 5HKZA 1NUBA 3KEVA 2LLTA 2LMUA 3VRRA 4YGAA 4BY5A 3VROA 1CFDA 5B8IB 1CM1A 1IQ5A 3NSLA 1Y6WA 2PSRA 4YGDB 2SCPA 1S6IA 4WQ3A 1CLMA 2COLB 2JNFA 4C0JA 1U5IB 1EG3A 3FIAA 2LMVA 2F3YA 2GGMA 1IRJA 1B7TY 1S6JA 5I2QA 2HPSA 4ORCB 3JTDC 2ISDA 1SY9A 4YI9A 1BU3A 1AHRA 2ZN9A 2GGZA 2BECA 2MLFC 2LVVA 3D0YB 1J1EA 3FWCA 1OMDA 1GQMA 1SCMB 2O60A 3O4YA 4F0ZB 1UHIA 2BCAA 3H4SE 3E3RA 1EXRA 4CFQA 2F2OA 3DVKA 2KBMA 3EVRA 4PHKA 4PE1A 3WNXB 4ETOA 1F4QA 1J7RA 2F33A 2KI4B 4AOMA 1DF0A 1OZSA 2OS8C 1WRLA 3SJSA 1UHNA 2F8PA 2M9GA 2WC8A 3FWBA 2LVJA 2PRUA 5AXIA 1TTXA 1DJHA 1XVJA 4MN0A 1JSAA 1MQ1A 4OKHA 1SR6B 2HF5A 4XJKA 1SBJA 1VRKA 2WOSA 3VRQA 3AKAA 3I5GB 1DJWA 2M49B 4PE0A 1KFXS 1TNWA 2BCBA 4JQ0D 1RWYA 1IGVA 2JWWA 1PVAA 2MRDA 2ZNDA 1QX5B 1A29A 2AMIA 1DMOA 3ZNIA 2BE6A 5BPJA 5KTYA 1SCVA 2MJWB 1KQMB 2Y5IA 4GNKB 2LHLA 2KAYA 1KWOC 1DJYA 2WORA 3FS7A 4XYNA 5CSJA 2KNEA 1S3PA 1KK7Z 4NQGA 1BF5A 4N1GA 1F55A 1FPWA 3KPXA 1QLSA 4MZLA 3K21A 1CMGA 2FCEA 2KSPA 2JZIA 4WRIA 5HKYA 5I2LA 1OZOA 3PM8A 1G4YR 5G08A 1SMGA 2FJUB 1AJ4A 1WRKA 1CFCA 2KQ6A 2LV7A 4MRXA 4GAOA 1FF1A 1XFXO 2Y1MA 2Y1NA 2KDHA 2K7DA 3I5IB 4PCWA 5DKQA 3SG5A 1J1DA 1S5GZ 1YURA 4HRHA 2EC6C 1NSHA 3BQ3A 4YI8A 2KOTA 1SW8A 1MHOA 3BUWB 4YGCB 3NSKA 2M29A 3BYAA 4ORAB 1QVIZ 4DRWA 4ZCVA 1UHJA 1UHHA 1M31A 3JVTC 4UPGA 1IKUA 5HLVA 1L2OC 4QJ3B 1S26D 1A4PA 2K0JA 3HX4A 1G33A 1K95A 4L9MA 1K9KA 2FOTA 1NWDA 4U8DA 1C07A 1EG4A 1SKTA 2MA2A 3C1VA 1XK4C 1W7JB 3LK0A 3TUYC 3CTNA 2BL0B 2JXCA 1XK4A 1IH0A 1LXFC 1XFZO 4QJ5B 1N2DA 2HETA 4PDZA 1YRTB 2Y4QA 1X02A 1LA0A 3CR5X 1GGWA 5I8NA 1FBVA 1XYDA 3EVUA 4GPLB 1SPYA 5KSZA 1B9AA 1SL7A 4NDCA 1YUSA 2TN4A 3EK4A 3KF9A 1XFWO 1IJ6A 1HQVA 2H61A 2Q91A 1B4CA 1AVSA 3ZWHA 3PSRA 3A8RA 1C7WA 4DS7A 4PE4A 2GV5A 1K9UA 1ZFSA 2L0PA 3SG6A 1CTRA 1M63B 3VGOA 1WLMA 2M3WA 1PRWA 4USLA 1BJFA 1NCXA 2FCDA 2NLNA 1B47A 3DD4A 3GK2A 2BKIB 4PHNA 4A4CA 1FI6A 1QV1A 1V1FA 3GOFA 1NX1A 1Y1XA 2K8MB 3BUOB 3JTDB 2OTGC 3PN7C 3VRPA 2PASA 1LVCD 1QS7A 3EKJA 5AANA 2JPTA 3HCMA 1ZUZA 3KO0A 1TIZA 1W7IB 5F6TA 3CZTX 3D10A 1DJXA 1J55A 1NPQA 2OS8B 2ZRTA 3CWGA 2L4HA 2K7CA 4M2PA 4PE7A 1DJGA 2M1KB 3PLFB 3CS1A 4PHMA 1B8LA 1G8IA 1ZACA 2P6BB 4XJKB 4C0KA 1N65A 3EK7A 1AK8A 3TDIA 2D8NA 1BLQA 2QACA 2KFHA 1YUTA 1YRUB 2HQ8A 2NCPA 2M8UA 1OMVA 1J7PA 4GGNA 1K90D 1SL9A 1SYMA 4QJ4B 4IL1A 5JJGA 2B1UA 2KGRA 2LE9B 1JFKA 1CNPA 1MXLC 3GK4X 1R6PA 2JU0A 2V53A 2MBXA 4N5XA 4ZCUA 1XFYO 3I5HC 1EH2A 2CXJA 1KWOB 2BE4A 2LHIA 4OV2A 1ZOTB 1B7TZ 3SG4A 1AP4A 1OQPA 1YX7A 1EJ3A 1QATA 2LUXA 3LCPC 1E8AA 1JF2A 3AKBA 2QPTA 2KI6D 3WHUB 3IQOA 4DCKA 1BODA 5D69A 2EHBA 2L2EA 1CLLA 1MXEA 1YX8A 2L4IA 3EVVA 5IBWA 4TNCA 2SASA 1KCYA 4MSPA 3AAJA 4C0LA 4HSZA 3BUMB 1M45A 3GK1A 1S1EA 2IS9A 1Y1AA 1ODBA 3OHMB 3F45A 2JTTA 5HKWA 5J3XA 1DVIA 1CB1A 1D1OA 1K96A 3I5FC 4ORBB 1GGZA 1TCFA 1BT6A 3BOWA 2H2KA 3EK8A 2EC6B 2KYFA 2DOQA 1DGUA 4I5NB 1OOJA 4FQOA 3TDZA 3O6BA 1TOPA 3EKHA 3RLZA 4AQJA 3DF0A 4BY4A 1B1GA 2ZN8A 3JVTB 3MSEB 5KU1A 3IF7A 1MWNA 1L2OB 1IJ5A 3O2PA 2CTNA 1Y1UA 3SIAA 2KYCA 4CPVA 3BXKA 1YVHA 3CLNA 5I2OA 1LA3A 3CR4X 2CNPA 2LC5A 2LCPA 2AAOA 2M97A 2MHHA 1XFVO 2JXLA 1BG1A 1JBAA 1DJIA 1NX0A 3TS5C 2KFFA 1OMRA 2RGIA 5JOLA 4NDDA 5PALA 3TUYB 1F70A 1QTXA 1RK9A 4GUKA 1A75A 4M2OA 2E30A 2LP2A 1L7ZA 3QRXA 4I5LB 4ICBA 4HRGA 1DT7B 1BR1B 1MR8A 1MUXA 4MVFA 1PK0D 1RROA 2AUCA 3NSOA 1KFUL 1YUUA 1JC2A 4WQ2A 1QIVA 2KHNA 1UURA 2H61C 1CKKA 1PSRA 4I5JA 2PVBA 1WDCC 2CCMA 3OP0A 1WRZA 1NX2A 3M0WA 1NCYA 5CSFA 5HLOA 3OX6A 4JPZB 4I5KA 1FW4A 1SNLA 2KAVA 1WY9A 1PULA 1N0YA 2CT9A 1Q80A 2KI6C 3AAKA 5FYXA 1C7VA 3OB2B 2LUCA 3VRNA 5K89A 1CFFA 4AQIA 1KK8C 4MEWA 1UUSA 1MF8B 2OTGB 3PN7B 4MZJA 4YGEB 5DKRA 1B8CA 1NX3A 1TNPA 2MAZA 3LLEA 2EGDA 2R2IA 3LK1A 1QASA 2KBIA 4MRYA 2KFGA 2M7LA 4CIDA 1M39A 2G9BA 2LVIA 2ZRSA 2LNKA 2HQWA 2KAXA 2WCFA 4P2YB 1CMFA 1DGVA 1NCZA 1K9PA 1A2XA 2WCEA 2JOJA 2ZNEA 3RM1A 1UWOA 1DF0B 1K94A 2G2BA 2VRGA 3ICBA 1IWQA 1Y0VH 2F3ZA 5AFPA 1H8BA 1QV0A 2M0RA 2NCOA 1DTLA 2LLUA 5ER5A 1U5IA 1UHKA 1F8HA 2PALA 2M1UA 2LM5A 4CLNA 1R2UA 1OSAA 1ALVA 2K7BA 1BMOA 2PMYA 4NDBA 4PHJA 1KK7Y 1CDNA 2I2RE 1CFPA 1M46A 1RTP1 4FTGA 1GJYA 3OB1B 1CDMA 2K2AA 2NZ0A 2WNDA 3A4UB 2F2PA 4DIRA 5TNCA 1SCMC 1QIWA 1CDLA 3D0YA 1YTZC 4YGBB 2JNXA 3I5HB 4GGFC 2BKHB 2JC2A 2KI4C 3BUNB 1OE9B 1PSBA 2JT3A 4GGFA 4YBHB 4GFTA 1PALA 2ZFDA 1KSOA 2LLSA 4N1FA 3WXAA 1J7QA 1JFJA 4OCIA 3OX5A 2LP3A 1JUOA 2JULA 3CGAA 1A03A 1DJZA 2BBMA 1SR6C 1S5GY 1EL4A 2I7AA 2L5XB 2NXQA 4YRUA 1BR4B 3I5GC 4E68A 2MLEC 2BCXA 4A4BA 3TZ1A 1YVLA 2KQYA 1QVIY 2LANA 1S6CA 1K8UA 1B8RA 4P5OE 1H4BA 1RFJA 2JQ6A 4M2QA 2OPOA 5AEQA 2O5GA 5CPVA 3DVEA 1HT9A 3DVJA 1YR5A 3SG3A 1AJ5A 3BOWB 2JTZA 4MBEA 2K2FA 1KQMC 1TNXA 2A4JA 5CSNA 3I5FB 5D7FA 1QXPA 1LINA 5HYDA 1S36A 1IQ3A 1RECA 1XFUO 3DF0B 3PALA 1KFXL 3KHEA 1FI5A 1ZMZA 2L50A 4JWQA 1F71A 1PVBA 1SK6D 1KQVA 5GQQC 3PFVA 1F54A 1QX2A 1NYAA 3NSIA 2JT0A 3WHTB 2LMTA 1KSMA 4DUQA 2JT8A 1KFUS 3IQQA 4Q04A 1K2HA 1IG5A 4MZKA 1BOCA 1LKJA 3SIBA 4OVNF 2M7NA 3SG2A 3BUXB 3TS5B 5ER4X 3SG7A 3I5IC 1A75B 2I18A 3CR2A 3NXAA 2BBNA 1WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALW A;  1NP8 A;  1RJV A;  2KGB C;  1V1G A;  4R1E A;  1TN4 A;  1AUI B;  1F4O A;  1QLK A;  1TNQ A;  4HRE E;  2JRF A;  1QJT A;  4CFR A;  1QX7 A;  2K7O A;  2WCB A;  2L51 A;  2ZKM X;  1WDC B;  2L98 A;  1TRF A;  3LL8 B;  4D1E A;  1CLB A;  2I94 A;  4MLW A;  5DKN A;  1XO5 A;  1JF0 A;  2K61 A;  1TCO B;  4GBA A;  2LAP A;  3DVM A;  1CDP A;  5CSI A;  4OR9 B;  2E6W A;  1UP5 A;  2Q4U A;  3PAT A;  1K93 D;  1KK8 B;  1NIW A;  3O78 A;  2BL0 C;  1CM4 A;  1JWD A;  1SL8 A;  1SRA A;  5AER A;  1J7O A;  4PAL A;  1XA5 A;  2CBL A;  2LVK A;  3TDU A;  5HKZ A;  1NUB A;  3KEV A;  2LLT A;  2LMU A;  3VRR A;  4YGA A;  4BY5 A;  3VRO A;  1CFD A;  5B8I B;  1CM1 A;  1IQ5 A;  3NSL A;  1Y6W A;  2PSR A;  4YGD B;  2SCP A;  1S6I A;  4WQ3 A;  1CLM A;  2COL B;  2JNF A;  4C0J A;  1U5I B;  1EG3 A;  3FIA A;  2LMV A;  2F3Y A;  2GGM A;  1IRJ A;  1B7T Y;  1S6J A;  5I2Q A;  2HPS A;  4ORC B;  3JTD C;  2ISD A;  1SY9 A;  4YI9 A;  1BU3 A;  1AHR A;  2ZN9 A;  2GGZ A;  2BEC A;  2MLF C;  2LVV A;  3D0Y B;  1J1E A;  3FWC A;  1OMD A;  1GQM A;  1SCM B;  2O60 A;  3O4Y A;  4F0Z B;  1UHI A;  2BCA A;  3H4S E;  3E3R A;  1EXR A;  4CFQ A;  2F2O A;  3DVK A;  2KBM A;  3EVR A;  4PHK A;  4PE1 A;  3WNX B;  4ETO A;  1F4Q A;  1J7R A;  2F33 A;  2KI4 B;  4AOM A;  1DF0 A;  1OZS A;  2OS8 C;  1WRL A;  3SJS A;  1UHN A;  2F8P A;  2M9G A;  2WC8 A;  3FWB A;  2LVJ A;  2PRU A;  5AXI A;  1TTX A;  1DJH A;  1XVJ A;  4MN0 A;  1JSA A;  1MQ1 A;  4OKH A;  1SR6 B;  2HF5 A;  4XJK A;  1SBJ A;  1VRK A;  2WOS A;  3VRQ A;  3AKA A;  3I5G B;  1DJW A;  2M49 B;  4PE0 A;  1KFX S;  1TNW A;  2BCB A;  4JQ0 D;  1RWY A;  1IGV A;  2JWW A;  1PVA A;  2MRD A;  2ZND A;  1QX5 B;  1A29 A;  2AMI A;  1DMO A;  3ZNI A;  2BE6 A;  5BPJ A;  5KTY A;  1SCV A;  2MJW B;  1KQM B;  2Y5I A;  4GNK B;  2LHL A;  2KAY A;  1KWO C;  1DJY A;  2WOR A;  3FS7 A;  4XYN A;  5CSJ A;  2KNE A;  1S3P A;  1KK7 Z;  4NQG A;  1BF5 A;  4N1G A;  1F55 A;  1FPW A;  3KPX A;  1QLS A;  4MZL A;  3K21 A;  1CMG A;  2FCE A;  2KSP A;  2JZI A;  4WRI A;  5HKY A;  5I2L A;  1OZO A;  3PM8 A;  1G4Y R;  5G08 A;  1SMG A;  2FJU B;  1AJ4 A;  1WRK A;  1CFC A;  2KQ6 A;  2LV7 A;  4MRX A;  4GAO A;  1FF1 A;  1XFX O;  2Y1M A;  2Y1N A;  2KDH A;  2K7D A;  3I5I B;  4PCW A;  5DKQ A;  3SG5 A;  1J1D A;  1S5G Z;  1YUR A;  4HRH A;  2EC6 C;  1NSH A;  3BQ3 A;  4YI8 A;  2KOT A;  1SW8 A;  1MHO A;  3BUW B;  4YGC B;  3NSK A;  2M29 A;  3BYA A;  4ORA B;  1QVI Z;  4DRW A;  4ZCV A;  1UHJ A;  1UHH A;  1M31 A;  3JVT C;  4UPG A;  1IKU A;  5HLV A;  1L2O C;  4QJ3 B;  1S26 D;  1A4P A;  2K0J A;  3HX4 A;  1G33 A;  1K95 A;  4L9M A;  1K9K A;  2FOT A;  1NWD A;  4U8D A;  1C07 A;  1EG4 A;  1SKT A;  2MA2 A;  3C1V A;  1XK4 C;  1W7J B;  3LK0 A;  3TUY C;  3CTN A;  2BL0 B;  2JXC A;  1XK4 A;  1IH0 A;  1LXF C;  1XFZ O;  4QJ5 B;  1N2D A;  2HET A;  4PDZ A;  1YRT B;  2Y4Q A;  1X02 A;  1LA0 A;  3CR5 X;  1GGW A;  5I8N A;  1FBV A;  1XYD A;  3EVU A;  4GPL B;  1SPY A;  5KSZ A;  1B9A A;  1SL7 A;  4NDC A;  1YUS A;  2TN4 A;  3EK4 A;  3KF9 A;  1XFW O;  1IJ6 A;  1HQV A;  2H61 A;  2Q91 A;  1B4C A;  1AVS A;  3ZWH A;  3PSR A;  3A8R A;  1C7W A;  4DS7 A;  4PE4 A;  2GV5 A;  1K9U A;  1ZFS A;  2L0P A;  3SG6 A;  1CTR A;  1M63 B;  3VGO A;  1WLM A;  2M3W A;  1PRW A;  4USL A;  1BJF A;  1NCX A;  2FCD A;  2NLN A;  1B47 A;  3DD4 A;  3GK2 A;  2BKI B;  4PHN A;  4A4C A;  1FI6 A;  1QV1 A;  1V1F A;  3GOF A;  1NX1 A;  1Y1X A;  2K8M B;  3BUO B;  3JTD B;  2OTG C;  3PN7 C;  3VRP A;  2PAS A;  1LVC D;  1QS7 A;  3EKJ A;  5AAN A;  2JPT A;  3HCM A;  1ZUZ A;  3KO0 A;  1TIZ A;  1W7I B;  5F6T A;  3CZT X;  3D10 A;  1DJX A;  1J55 A;  1NPQ A;  2OS8 B;  2ZRT A;  3CWG A;  2L4H A;  2K7C A;  4M2P A;  4PE7 A;  1DJG A;  2M1K B;  3PLF B;  3CS1 A;  4PHM A;  1B8L A;  1G8I A;  1ZAC A;  2P6B B;  4XJK B;  4C0K A;  1N65 A;  3EK7 A;  1AK8 A;  3TDI A;  2D8N A;  1BLQ A;  2QAC A;  2KFH A;  1YUT A;  1YRU B;  2HQ8 A;  2NCP A;  2M8U A;  1OMV A;  1J7P A;  4GGN A;  1K90 D;  1SL9 A;  1SYM A;  4QJ4 B;  4IL1 A;  5JJG A;  2B1U A;  2KGR A;  2LE9 B;  1JFK A;  1CNP A;  1MXL C;  3GK4 X;  1R6P A;  2JU0 A;  2V53 A;  2MBX A;  4N5X A;  4ZCU A;  1XFY O;  3I5H C;  1EH2 A;  2CXJ A;  1KWO B;  2BE4 A;  2LHI A;  4OV2 A;  1ZOT B;  1B7T Z;  3SG4 A;  1AP4 A;  1OQP A;  1YX7 A;  1EJ3 A;  1QAT A;  2LUX A;  3LCP C;  1E8A A;  1JF2 A;  3AKB A;  2QPT A;  2KI6 D;  3WHU B;  3IQO A;  4DCK A;  1BOD A;  5D69 A;  2EHB A;  2L2E A;  1CLL A;  1MXE A;  1YX8 A;  2L4I A;  3EVV A;  5IBW A;  4TNC A;  2SAS A;  1KCY A;  4MSP A;  3AAJ A;  4C0L A;  4HSZ A;  3BUM B;  1M45 A;  3GK1 A;  1S1E A;  2IS9 A;  1Y1A A;  1ODB A;  3OHM B;  3F45 A;  2JTT A;  5HKW A;  5J3X A;  1DVI A;  1CB1 A;  1D1O A;  1K96 A;  3I5F C;  4ORB B;  1GGZ A;  1TCF A;  1BT6 A;  3BOW A;  2H2K A;  3EK8 A;  2EC6 B;  2KYF A;  2DOQ A;  1DGU A;  4I5N B;  1OOJ A;  4FQO A;  3TDZ A;  3O6B A;  1TOP A;  3EKH A;  3RLZ A;  4AQJ A;  3DF0 A;  4BY4 A;  1B1G A;  2ZN8 A;  3JVT B;  3MSE B;  5KU1 A;  3IF7 A;  1MWN A;  1L2O B;  1IJ5 A;  3O2P A;  2CTN A;  1Y1U A;  3SIA A;  2KYC A;  4CPV A;  3BXK A;  1YVH A;  3CLN A;  5I2O A;  1LA3 A;  3CR4 X;  2CNP A;  2LC5 A;  2LCP A;  2AAO A;  2M97 A;  2MHH A;  1XFV O;  2JXL A;  1BG1 A;  1JBA A;  1DJI A;  1NX0 A;  3TS5 C;  2KFF A;  1OMR A;  2RGI A;  5JOL A;  4NDD A;  5PAL A;  3TUY B;  1F70 A;  1QTX A;  1RK9 A;  4GUK A;  1A75 A;  4M2O A;  2E30 A;  2LP2 A;  1L7Z A;  3QRX A;  4I5L B;  4ICB A;  4HRG A;  1DT7 B;  1BR1 B;  1MR8 A;  1MUX A;  4MVF A;  1PK0 D;  1RRO A;  2AUC A;  3NSO A;  1KFU L;  1YUU A;  1JC2 A;  4WQ2 A;  1QIV A;  2KHN A;  1UUR A;  2H61 C;  1CKK A;  1PSR A;  4I5J A;  2PVB A;  1WDC C;  2CCM A;  3OP0 A;  1WRZ A;  1NX2 A;  3M0W A;  1NCY A;  5CSF A;  5HLO A;  3OX6 A;  4JPZ B;  4I5K A;  1FW4 A;  1SNL A;  2KAV A;  1WY9 A;  1PUL A;  1N0Y A;  2CT9 A;  1Q80 A;  2KI6 C;  3AAK A;  5FYX A;  1C7V A;  3OB2 B;  2LUC A;  3VRN A;  5K89 A;  1CFF A;  4AQI A;  1KK8 C;  4MEW A;  1UUS A;  1MF8 B;  2OTG B;  3PN7 B;  4MZJ A;  4YGE B;  5DKR A;  1B8C A;  1NX3 A;  1TNP A;  2MAZ A;  3LLE A;  2EGD A;  2R2I A;  3LK1 A;  1QAS A;  2KBI A;  4MRY A;  2KFG A;  2M7L A;  4CID A;  1M39 A;  2G9B A;  2LVI A;  2ZRS A;  2LNK A;  2HQW A;  2KAX A;  2WCF A;  4P2Y B;  1CMF A;  1DGV A;  1NCZ A;  1K9P A;  1A2X A;  2WCE A;  2JOJ A;  2ZNE A;  3RM1 A;  1UWO A;  1DF0 B;  1K94 A;  2G2B A;  2VRG A;  3ICB A;  1IWQ A;  1Y0V H;  2F3Z A;  5AFP A;  1H8B A;  1QV0 A;  2M0R A;  2NCO A;  1DTL A;  2LLU A;  5ER5 A;  1U5I A;  1UHK A;  1F8H A;  2PAL A;  2M1U A;  2LM5 A;  4CLN A;  1R2U A;  1OSA A;  1ALV A;  2K7B A;  1BMO A;  2PMY A;  4NDB A;  4PHJ A;  1KK7 Y;  1CDN A;  2I2R E;  1CFP A;  1M46 A;  1RTP 1;  4FTG A;  1GJY A;  3OB1 B;  1CDM A;  2K2A A;  2NZ0 A;  2WND A;  3A4U B;  2F2P A;  4DIR A;  5TNC A;  1SCM C;  1QIW A;  1CDL A;  3D0Y A;  1YTZ C;  4YGB B;  2JNX A;  3I5H B;  4GGF C;  2BKH B;  2JC2 A;  2KI4 C;  3BUN B;  1OE9 B;  1PSB A;  2JT3 A;  4GGF A;  4YBH B;  4GFT A;  1PAL A;  2ZFD A;  1KSO A;  2LLS A;  4N1F A;  3WXA A;  1J7Q A;  1JFJ A;  4OCI A;  3OX5 A;  2LP3 A;  1JUO A;  2JUL A;  3CGA A;  1A03 A;  1DJZ A;  2BBM A;  1SR6 C;  1S5G Y;  1EL4 A;  2I7A A;  2L5X B;  2NXQ A;  4YRU A;  1BR4 B;  3I5G C;  4E68 A;  2MLE C;  2BCX A;  4A4B A;  3TZ1 A;  1YVL A;  2KQY A;  1QVI Y;  2LAN A;  1S6C A;  1K8U A;  1B8R A;  4P5O E;  1H4B A;  1RFJ A;  2JQ6 A;  4M2Q A;  2OPO A;  5AEQ A;  2O5G A;  5CPV A;  3DVE A;  1HT9 A;  3DVJ A;  1YR5 A;  3SG3 A;  1AJ5 A;  3BOW B;  2JTZ A;  4MBE A;  2K2F A;  1KQM C;  1TNX A;  2A4J A;  5CSN A;  3I5F B;  5D7F A;  1QXP A;  1LIN A;  5HYD A;  1S36 A;  1IQ3 A;  1REC A;  1XFU O;  3DF0 B;  3PAL A;  1KFX L;  3KHE A;  1FI5 A;  1ZMZ A;  2L50 A;  4JWQ A;  1F71 A;  1PVB A;  1SK6 D;  1KQV A;  5GQQ C;  3PFV A;  1F54 A;  1QX2 A;  1NYA A;  3NSI A;  2JT0 A;  3WHT B;  2LMT A;  1KSM A;  4DUQ A;  2JT8 A;  1KFU S;  3IQQ A;  4Q04 A;  1K2H A;  1IG5 A;  4MZK A;  1BOC A;  1LKJ A;  3SIB A;  4OVN F;  2M7N A;  3SG2 A;  3BUX B;  3TS5 B;  5ER4 X;  3SG7 A;  3I5I C;  1A75 B;  2I18 A;  3CR2 A;  3NXA A;  2BBN A;  1WLZ A; 
#chains in the Genus database with same CATH topology
 1ALW A;  1NP8 A;  1RJV A;  2KGB C;  1V1G A;  4R1E A;  1TN4 A;  1AUI B;  1F4O A;  3CDN A;  1QLK A;  3CZ1 A;  1TNQ A;  4HRE E;  3BFB A;  2JRF A;  1QJT A;  4CFR A;  1QX7 A;  2K7O A;  2WCB A;  2L51 A;  2ZKM X;  1WDC B;  2L98 A;  1TRF A;  3BFH A;  3LL8 B;  4D1E A;  1CLB A;  2I94 A;  4MLW A;  5DKN A;  1XO5 A;  1JF0 A;  2K61 A;  1TCO B;  4GBA A;  2LAP A;  3DVM A;  1CDP A;  5CSI A;  3R1V A;  1OOG A;  4OR9 B;  2E6W A;  1UP5 A;  2Q4U A;  3PAT A;  1K93 D;  1KK8 B;  1NIW A;  3O78 A;  2BL0 C;  1CM4 A;  1JWD A;  1SL8 A;  1SRA A;  5AER A;  1J7O A;  4PAL A;  1XA5 A;  2CBL A;  2LVK A;  3TDU A;  5HKZ A;  1NUB A;  3KEV A;  2LLT A;  2LMU A;  3VRR A;  5D3O A;  3BFA A;  4YGA A;  4BY5 A;  3VRO A;  1CFD A;  5B8I B;  1CM1 A;  1IQ5 A;  1QWV A;  4PT1 A;  3S0F A;  3NSL A;  2QEB A;  1Y6W A;  2PSR A;  4YGD B;  2SCP A;  1S6I A;  2WCL A;  1CLM A;  3BJH A;  4WQ3 A;  2COL B;  3FE6 A;  2JNF A;  4C0J A;  1U5I B;  1EG3 A;  3FIA A;  4JD9 A;  2H8V A;  2LMV A;  2F3Y A;  2GGM A;  1IRJ A;  1B7T Y;  3B86 A;  1S6J A;  5I2Q A;  2HPS A;  2L2C A;  4ORC B;  3JTD C;  2ISD A;  1SY9 A;  4YI9 A;  1BU3 A;  1AHR A;  2ZN9 A;  2GGZ A;  2BEC A;  2MLF C;  3B88 A;  2LVV A;  3D0Y B;  1J1E A;  3FWC A;  1OMD A;  1GQM A;  1SCM B;  2O60 A;  3O4Y A;  5DIC A;  4F0Z B;  1UHI A;  2BCA A;  3H4S E;  3E3R A;  1EXR A;  4CFQ A;  2F2O A;  3DVK A;  2KBM A;  3EVR A;  4PHK A;  4PE1 A;  3WNX B;  4ETO A;  1F4Q A;  1J7R A;  2F33 A;  2KI4 B;  4AOM A;  1DF0 A;  1OZS A;  2OS8 C;  1WRL A;  3SJS A;  3IVT A;  1UHN A;  2F8P A;  2M9G A;  2WC8 A;  3FWB A;  2LVJ A;  2PRU A;  5AXI A;  1TTX A;  1DJH A;  1XVJ A;  3R1O A;  4MN0 A;  1JSA A;  1MQ1 A;  4OKH A;  1SR6 B;  2HF5 A;  4XJK A;  1SBJ A;  1VRK A;  2WOS A;  3VRQ A;  3AKA A;  3I5G B;  1DJW A;  2M49 B;  3CAB A;  4PE0 A;  1KFX S;  1TNW A;  2BCB A;  4JQ0 D;  1RWY A;  1IGV A;  2JWW A;  3O4X A;  1PVA A;  2MRD A;  2ZND A;  1QX5 B;  1A29 A;  2AMI A;  1DMO A;  3ZNI A;  1TWO A;  3PM2 A;  2BE6 A;  5BPJ A;  5KTY A;  1SCV A;  2K60 A;  2MJW B;  1KQM B;  2Y5I A;  4GNK B;  3SS5 A;  2LHL A;  3NHT A;  2KAY A;  3QME A;  3OBV A;  1KWO C;  1DJY A;  2WOR A;  3FS7 A;  4XYN A;  5CSJ A;  2KNE A;  1S3P A;  1KK7 Z;  5FI2 A;  4NQG A;  1BF5 A;  4N1G A;  3S0A A;  1F55 A;  1FPW A;  3KPX A;  1QLS A;  4MZL A;  3K21 A;  1CMG A;  2FCE A;  2KSP A;  1XFR A;  2JZI A;  4WRI A;  5HKY A;  3B6X A;  5I2L A;  1OZO A;  3PM8 A;  1G4Y R;  5G08 A;  1SMG A;  2FJU B;  1AJ4 A;  1WRK A;  1CFC A;  2KQ6 A;  2LV7 A;  4MRX A;  3D77 A;  2QEO A;  4GAO A;  1FF1 A;  1XFX O;  2Y1M A;  2Y1N A;  2KDH A;  2K7D A;  3I5I B;  4PCW A;  5DKQ A;  3SG5 A;  3R1P A;  1J1D A;  1S5G Z;  1YUR A;  1TUZ A;  2WC5 A;  1TUJ A;  1NSH A;  2EC6 C;  2WCH A;  3BQ3 A;  4HRH A;  4INX A;  4YI8 A;  2KOT A;  1SW8 A;  1MHO A;  2BAP A;  3BUW B;  4YGC B;  3NSK A;  2M29 A;  1Z2C B;  3S0B A;  3BYA A;  1DC1 A;  4ORA B;  1QVI Z;  4DRW A;  4ZCV A;  1UHJ A;  1UHH A;  1M31 A;  2QEH A;  3JVT C;  1T14 A;  3FE9 A;  4UPG A;  1IKU A;  5HLV A;  1L2O C;  4QJ3 B;  1S26 D;  1A4P A;  2K0J A;  3HX4 A;  1G33 A;  2FJY A;  1K95 A;  3S0G A;  4L9M A;  1K9K A;  2FOT A;  1NWD A;  4U8D A;  1C07 A;  3L4L A;  1SSE B;  1EG4 A;  1SKT A;  2MA2 A;  3C1V A;  1XK4 C;  1W7J B;  3LK0 A;  3TUY C;  2L5Y A;  2BL0 B;  3CTN A;  3DYE A;  1OW4 A;  2JXC A;  1XK4 A;  2KLD A;  1LXF C;  1XFZ O;  4QJ5 B;  1N2D A;  2HET A;  4PDZ A;  1IH0 A;  1YRT B;  2Y4Q A;  1X02 A;  1LA0 A;  3CR5 X;  3V2L A;  1GGW A;  5I8N A;  1FBV A;  1XYD A;  3EVU A;  4GPL B;  1SPY A;  5KSZ A;  1B9A A;  1SL7 A;  4NDC A;  1YUS A;  2TN4 A;  3EK4 A;  3KF9 A;  1IIO A;  1XFW O;  1IJ6 A;  1HQV A;  2H61 A;  2Q91 A;  1B4C A;  1AVS A;  3ZWH A;  2YGU A;  3PSR A;  3A8R A;  1C7W A;  4DS7 A;  4PE4 A;  2GV5 A;  1OOI X;  1K9U A;  1ZFS A;  2L0P A;  2WCM A;  3SG6 A;  1CTR A;  1M63 B;  3VGO A;  1WLM A;  2M3W A;  1PRW A;  4USL A;  1BJF A;  1NCX A;  2FCD A;  2NLN A;  1B47 A;  3DD4 A;  3GK2 A;  3L4A A;  2BKI B;  4PHN A;  4A4C A;  1FI6 A;  1QV1 A;  1V1F A;  3GOF A;  1NX1 A;  1Y1X A;  2K8M B;  3BUO B;  3JTD B;  2OTG C;  3PN7 C;  3VRP A;  2PAS A;  1LVC D;  1QS7 A;  3RZS A;  3D78 A;  3EKJ A;  5AAN A;  2JPT A;  3HCM A;  1ZUZ A;  3KO0 A;  1TIZ A;  1W7I B;  3SS4 A;  5F6T A;  3CZT X;  4C0K A;  3D10 A;  1DJX A;  1J55 A;  1NPQ A;  2OS8 B;  2ZRT A;  3CWG A;  2L4H A;  2K7C A;  4M2P A;  4PE7 A;  1LS8 A;  4F7F A;  1DJG A;  2M1K B;  3PLF B;  3CS1 A;  4PHM A;  1B8L A;  1G8I A;  1OOH A;  1C3Z A;  1ZAC A;  2P6B B;  4XJK B;  3K1E A;  3UNW A;  1N65 A;  3EK7 A;  1C3Y A;  1AK8 A;  3TDI A;  2D8N A;  1BLQ A;  2QAC A;  2KFH A;  5HL1 A;  1YUT A;  1YRU B;  2HQ8 A;  2NCP A;  2M8U A;  1OMV A;  1J7P A;  4GGN A;  1K90 D;  2QEV A;  1SL9 A;  1SYM A;  4QJ4 B;  4IL1 A;  5JJG A;  2B1U A;  2KGR A;  2LE9 B;  1JFK A;  1CNP A;  1MXL C;  3GK4 X;  1R6P A;  2JU0 A;  3B7A A;  3D76 A;  2V53 A;  2MBX A;  4N5X A;  2JPO A;  4ZCU A;  1XFY O;  3I5H C;  3DXL A;  1EH2 A;  2CXJ A;  1KWO B;  2BE4 A;  2LHI A;  4OV2 A;  1ZOT B;  1B7T Z;  3SG4 A;  1AP4 A;  1OQP A;  1YX7 A;  3D75 A;  1EJ3 A;  1QAT A;  2LUX A;  3LCP C;  3VB1 A;  1E8A A;  1JF2 A;  3AKB A;  3CYZ A;  2QPT A;  2KI6 D;  3D73 A;  3WHU B;  3IQO A;  4DCK A;  2WCK A;  5I94 A;  1BOD A;  5D69 A;  2EHB A;  2L2E A;  2QDI A;  1CLL A;  1MXE A;  1YX8 A;  2L4I A;  3EVV A;  5IBW A;  4TNC A;  2SAS A;  1KCY A;  4MSP A;  4JKT A;  3AAJ A;  4C0L A;  4HSZ A;  3BUM B;  1M45 A;  3GK1 A;  1S1E A;  2IS9 A;  1Y1A A;  1ODB A;  3CZ0 A;  3OHM B;  3F45 A;  2JTT A;  5HKW A;  5J3X A;  1DVI A;  1CB1 A;  2P71 A;  1D1O A;  1K96 A;  3I5F C;  4ORB B;  1GGZ A;  1TCF A;  1BT6 A;  3BOW A;  2H2K A;  3EK8 A;  2EC6 B;  4KYN A;  2KYF A;  2DOQ A;  1DGU A;  4I5N B;  3UO9 A;  1DQE A;  1OOJ A;  4FQO A;  3TDZ A;  3O6B A;  1TOP A;  3EKH A;  3RLZ A;  4AQJ A;  3DF0 A;  1Z4H A;  4BY4 A;  1B1G A;  2ZN8 A;  3S0E A;  3JVT B;  3MSE B;  5KU1 A;  3IF7 A;  1MWN A;  1L2O B;  1IJ5 A;  3B87 A;  2CTN A;  3O2P A;  1Y1U A;  3SIA A;  2KYC A;  4CPV A;  5FI7 A;  4INW A;  3BXK A;  1YVH A;  3CLN A;  1DEL A;  1LA3 A;  2KLE A;  5I2O A;  3CR4 X;  2CNP A;  2LC5 A;  2LCP A;  2AAO A;  2M97 A;  2MHH A;  1XFV O;  2JXL A;  1BG1 A;  1JBA A;  1DJI A;  1NX0 A;  3TS5 C;  2KFF A;  1OMR A;  2BNX A;  2RGI A;  4NDD A;  4OZD A;  5JOL A;  5PAL A;  3TUY B;  1F70 A;  1ORG A;  1QTX A;  1RK9 A;  4GUK A;  1A75 A;  4M2O A;  2E30 A;  2LP2 A;  1L7Z A;  3PJI A;  3QRX A;  4I5L B;  4HRG A;  4ICB A;  3SS3 A;  1DT7 B;  1BR1 B;  1MR8 A;  1MUX A;  4MVF A;  1PK0 D;  1RRO A;  2AUC A;  3NSO A;  1KFU L;  1YUU A;  1JC2 A;  4WQ2 A;  1QIV A;  2KHN A;  1UUR A;  2H61 C;  1CKK A;  1PSR A;  4I5J A;  2PVB A;  5FI6 A;  1WDC C;  2WCJ A;  2CCM A;  3OP0 A;  1WRZ A;  1NX2 A;  1DEK A;  1NCY A;  3M0W A;  5CSF A;  5HLO A;  2P70 A;  3OX6 A;  4JPZ B;  4I5K A;  1FW4 A;  1SNL A;  2KAV A;  2WC6 A;  1GM0 A;  1WY9 A;  1PUL A;  1N0Y A;  2CT9 A;  1Q80 A;  2KI6 C;  3AAK A;  5FYX A;  1C7V A;  3OB2 B;  2LUC A;  3VRN A;  5K89 A;  1CFF A;  4AQI A;  1KK8 C;  2ERB A;  1UUS A;  1MF8 B;  4MEW A;  2OTG B;  3PN7 B;  4MZJ A;  4YGE B;  5DKR A;  1B8C A;  1NX3 A;  3NHI A;  1TNP A;  2MAZ A;  3LLE A;  2KPH A;  2EGD A;  2R2I A;  3LK1 A;  1QAS A;  2KBI A;  4MRY A;  2KFG A;  2M7L A;  4CID A;  1M39 A;  2G9B A;  2LVI A;  2ZRS A;  2LNK A;  2HQW A;  2KAX A;  2WCF A;  4P2Y B;  3DZT A;  1CMF A;  1DGV A;  3D74 A;  1NCZ A;  3N7H A;  1K9P A;  1A2X A;  2WCE A;  2JOJ A;  2ZNE A;  3RM1 A;  1UWO A;  1DF0 B;  1K94 A;  2G2B A;  2VRG A;  3NGV A;  3ICB A;  1IWQ A;  5EL2 A;  1Y0V H;  2F3Z A;  5AFP A;  1H8B A;  1QV0 A;  2M0R A;  2NCO A;  1DTL A;  1P28 A;  2LLU A;  5ER5 A;  1U5I A;  1UHK A;  1F8H A;  4FQT A;  2PAL A;  2M1U A;  2LM5 A;  4CLN A;  1R2U A;  1OSA A;  1ALV A;  2K7B A;  1BMO A;  2PMY A;  4NDB A;  4PHJ A;  1KK7 Y;  1CDN A;  2I2R E;  1CFP A;  1M46 A;  1RTP 1;  4FTG A;  1GJY A;  3OB1 B;  1CDM A;  2K2A A;  2NZ0 A;  2WND A;  3A4U B;  3FE8 A;  2F2P A;  4DIR A;  5TNC A;  1SCM C;  1QIW A;  1CDL A;  3D0Y A;  1YTZ C;  4YGB B;  2JNX A;  3I5H B;  4GGF C;  2GTE A;  2BKH B;  2JC2 A;  2KI4 C;  3BUN B;  1OE9 B;  1PSB A;  2JT3 A;  3OGN A;  4GGF A;  4GFT A;  4YBH B;  1PAL A;  2ZFD A;  1KSO A;  2LLS A;  4N1F A;  3WXA A;  1J7Q A;  1JFJ A;  4OCI A;  3OX5 A;  2LP3 A;  1JUO A;  2JUL A;  3CGA A;  3EG5 B;  1A03 A;  1DJZ A;  2BBM A;  1SR6 C;  1S5G Y;  1EL4 A;  2I7A A;  2L5X B;  2NXQ A;  4YRU A;  1BR4 B;  3I5G C;  4E68 A;  2MLE C;  2BCX A;  3CZ2 A;  4A4B A;  3TZ1 A;  1YVL A;  2KQY A;  3Q8I A;  1QVI Y;  2LAN A;  1S6C A;  1K8U A;  1B8R A;  4P5O E;  2PQL A;  1H4B A;  1RFJ A;  2JQ6 A;  3R72 A;  4M2Q A;  2OPO A;  5AEQ A;  2O5G A;  5CPV A;  3DVE A;  1HT9 A;  3DVJ A;  1YR5 A;  3SG3 A;  1AJ5 A;  3BOW B;  2JTZ A;  4MBE A;  2K2F A;  1KQM C;  1TNX A;  2A4J A;  5CSN A;  3I5F B;  5D7F A;  1QXP A;  1LIN A;  5HYD A;  1S36 A;  1IQ3 A;  1REC A;  1XFU O;  3DF0 B;  3PAL A;  1KFX L;  3DY9 A;  2PYQ A;  3KHE A;  1FI5 A;  1ZMZ A;  2L50 A;  4JWQ A;  1F71 A;  1PVB A;  1SK6 D;  1KQV A;  5GQQ C;  3S0D A;  3PFV A;  1F54 A;  1QX2 A;  1NYA A;  3L47 A;  2JT0 A;  3NSI A;  3WHT B;  2LMT A;  1KSM A;  4DUQ A;  2JT8 A;  1KFU S;  3IQQ A;  4Q04 A;  1K2H A;  1IG5 A;  4MZK A;  1OOF A;  1BOC A;  1LKJ A;  3SIB A;  4OVN F;  2M7N A;  4IJ7 A;  3BUX B;  3SG2 A;  3TS5 B;  5ER4 X;  3SG7 A;  3I5I C;  1A75 B;  2I18 A;  3CR2 A;  1W9Z A;  3NXA A;  2BBN A;  1WLZ A; 
#chains in the Genus database with same CATH homology
 1ALW A;  1NP8 A;  1RJV A;  2KGB C;  1V1G A;  4R1E A;  1TN4 A;  1AUI B;  1F4O A;  1QLK A;  1TNQ A;  4HRE E;  2JRF A;  1QJT A;  4CFR A;  1QX7 A;  2K7O A;  2WCB A;  2L51 A;  2ZKM X;  1WDC B;  2L98 A;  1TRF A;  3LL8 B;  4D1E A;  1CLB A;  2I94 A;  4MLW A;  5DKN A;  1XO5 A;  1JF0 A;  2K61 A;  1TCO B;  4GBA A;  2LAP A;  3DVM A;  1CDP A;  5CSI A;  4OR9 B;  2E6W A;  1UP5 A;  2Q4U A;  3PAT A;  1K93 D;  1KK8 B;  1NIW A;  3O78 A;  2BL0 C;  1CM4 A;  1JWD A;  1SL8 A;  1SRA A;  5AER A;  1J7O A;  4PAL A;  1XA5 A;  2CBL A;  2LVK A;  3TDU A;  5HKZ A;  1NUB A;  3KEV A;  2LLT A;  2LMU A;  3VRR A;  4YGA A;  4BY5 A;  3VRO A;  1CFD A;  5B8I B;  1CM1 A;  1IQ5 A;  3NSL A;  1Y6W A;  2PSR A;  4YGD B;  2SCP A;  1S6I A;  4WQ3 A;  1CLM A;  2COL B;  2JNF A;  4C0J A;  1U5I B;  1EG3 A;  3FIA A;  2LMV A;  2F3Y A;  2GGM A;  1IRJ A;  1B7T Y;  1S6J A;  5I2Q A;  2HPS A;  4ORC B;  3JTD C;  2ISD A;  1SY9 A;  4YI9 A;  1BU3 A;  1AHR A;  2ZN9 A;  2GGZ A;  2BEC A;  2MLF C;  2LVV A;  3D0Y B;  1J1E A;  3FWC A;  1OMD A;  1GQM A;  1SCM B;  2O60 A;  3O4Y A;  4F0Z B;  1UHI A;  2BCA A;  3H4S E;  3E3R A;  1EXR A;  4CFQ A;  2F2O A;  3DVK A;  2KBM A;  3EVR A;  4PHK A;  4PE1 A;  3WNX B;  4ETO A;  1F4Q A;  1J7R A;  2F33 A;  2KI4 B;  4AOM A;  1DF0 A;  1OZS A;  2OS8 C;  1WRL A;  3SJS A;  1UHN A;  2F8P A;  2M9G A;  2WC8 A;  3FWB A;  2LVJ A;  2PRU A;  5AXI A;  1TTX A;  1DJH A;  1XVJ A;  4MN0 A;  1JSA A;  1MQ1 A;  4OKH A;  1SR6 B;  2HF5 A;  4XJK A;  1SBJ A;  1VRK A;  2WOS A;  3VRQ A;  3AKA A;  3I5G B;  1DJW A;  2M49 B;  4PE0 A;  1KFX S;  1TNW A;  2BCB A;  4JQ0 D;  1RWY A;  1IGV A;  2JWW A;  1PVA A;  2MRD A;  2ZND A;  1QX5 B;  1A29 A;  2AMI A;  1DMO A;  3ZNI A;  2BE6 A;  5BPJ A;  5KTY A;  1SCV A;  2MJW B;  1KQM B;  2Y5I A;  4GNK B;  2LHL A;  2KAY A;  1KWO C;  1DJY A;  2WOR A;  3FS7 A;  4XYN A;  5CSJ A;  2KNE A;  1S3P A;  1KK7 Z;  4NQG A;  1BF5 A;  4N1G A;  1F55 A;  1FPW A;  3KPX A;  1QLS A;  4MZL A;  3K21 A;  1CMG A;  2FCE A;  2KSP A;  2JZI A;  4WRI A;  5HKY A;  5I2L A;  1OZO A;  3PM8 A;  1G4Y R;  5G08 A;  1SMG A;  2FJU B;  1AJ4 A;  1WRK A;  1CFC A;  2KQ6 A;  2LV7 A;  4MRX A;  4GAO A;  1FF1 A;  1XFX O;  2Y1M A;  2Y1N A;  2KDH A;  2K7D A;  3I5I B;  4PCW A;  5DKQ A;  3SG5 A;  1J1D A;  1S5G Z;  1YUR A;  4HRH A;  2EC6 C;  1NSH A;  3BQ3 A;  4YI8 A;  2KOT A;  1SW8 A;  1MHO A;  3BUW B;  4YGC B;  3NSK A;  2M29 A;  3BYA A;  4ORA B;  1QVI Z;  4DRW A;  4ZCV A;  1UHJ A;  1UHH A;  1M31 A;  3JVT C;  4UPG A;  1IKU A;  5HLV A;  1L2O C;  4QJ3 B;  1S26 D;  1A4P A;  2K0J A;  3HX4 A;  1G33 A;  1K95 A;  4L9M A;  1K9K A;  2FOT A;  1NWD A;  4U8D A;  1C07 A;  1EG4 A;  1SKT A;  2MA2 A;  3C1V A;  1XK4 C;  1W7J B;  3LK0 A;  3TUY C;  3CTN A;  2BL0 B;  2JXC A;  1XK4 A;  1IH0 A;  1LXF C;  1XFZ O;  4QJ5 B;  1N2D A;  2HET A;  4PDZ A;  1YRT B;  2Y4Q A;  1X02 A;  1LA0 A;  3CR5 X;  1GGW A;  5I8N A;  1FBV A;  1XYD A;  3EVU A;  4GPL B;  1SPY A;  5KSZ A;  1B9A A;  1SL7 A;  4NDC A;  1YUS A;  2TN4 A;  3EK4 A;  3KF9 A;  1XFW O;  1IJ6 A;  1HQV A;  2H61 A;  2Q91 A;  1B4C A;  1AVS A;  3ZWH A;  3PSR A;  3A8R A;  1C7W A;  4DS7 A;  4PE4 A;  2GV5 A;  1K9U A;  1ZFS A;  2L0P A;  3SG6 A;  1CTR A;  1M63 B;  3VGO A;  1WLM A;  2M3W A;  1PRW A;  4USL A;  1BJF A;  1NCX A;  2FCD A;  2NLN A;  1B47 A;  3DD4 A;  3GK2 A;  2BKI B;  4PHN A;  4A4C A;  1FI6 A;  1QV1 A;  1V1F A;  3GOF A;  1NX1 A;  1Y1X A;  2K8M B;  3BUO B;  3JTD B;  2OTG C;  3PN7 C;  3VRP A;  2PAS A;  1LVC D;  1QS7 A;  3EKJ A;  5AAN A;  2JPT A;  3HCM A;  1ZUZ A;  3KO0 A;  1TIZ A;  1W7I B;  5F6T A;  3CZT X;  3D10 A;  1DJX A;  1J55 A;  1NPQ A;  2OS8 B;  2ZRT A;  3CWG A;  2L4H A;  2K7C A;  4M2P A;  4PE7 A;  1DJG A;  2M1K B;  3PLF B;  3CS1 A;  4PHM A;  1B8L A;  1G8I A;  1ZAC A;  2P6B B;  4XJK B;  4C0K A;  1N65 A;  3EK7 A;  1AK8 A;  3TDI A;  2D8N A;  1BLQ A;  2QAC A;  2KFH A;  1YUT A;  1YRU B;  2HQ8 A;  2NCP A;  2M8U A;  1OMV A;  1J7P A;  4GGN A;  1K90 D;  1SL9 A;  1SYM A;  4QJ4 B;  4IL1 A;  5JJG A;  2B1U A;  2KGR A;  2LE9 B;  1JFK A;  1CNP A;  1MXL C;  3GK4 X;  1R6P A;  2JU0 A;  2V53 A;  2MBX A;  4N5X A;  4ZCU A;  1XFY O;  3I5H C;  1EH2 A;  2CXJ A;  1KWO B;  2BE4 A;  2LHI A;  4OV2 A;  1ZOT B;  1B7T Z;  3SG4 A;  1AP4 A;  1OQP A;  1YX7 A;  1EJ3 A;  1QAT A;  2LUX A;  3LCP C;  1E8A A;  1JF2 A;  3AKB A;  2QPT A;  2KI6 D;  3WHU B;  3IQO A;  4DCK A;  1BOD A;  5D69 A;  2EHB A;  2L2E A;  1CLL A;  1MXE A;  1YX8 A;  2L4I A;  3EVV A;  5IBW A;  4TNC A;  2SAS A;  1KCY A;  4MSP A;  3AAJ A;  4C0L A;  4HSZ A;  3BUM B;  1M45 A;  3GK1 A;  1S1E A;  2IS9 A;  1Y1A A;  1ODB A;  3OHM B;  3F45 A;  2JTT A;  5HKW A;  5J3X A;  1DVI A;  1CB1 A;  1D1O A;  1K96 A;  3I5F C;  4ORB B;  1GGZ A;  1TCF A;  1BT6 A;  3BOW A;  2H2K A;  3EK8 A;  2EC6 B;  2KYF A;  2DOQ A;  1DGU A;  4I5N B;  1OOJ A;  4FQO A;  3TDZ A;  3O6B A;  1TOP A;  3EKH A;  3RLZ A;  4AQJ A;  3DF0 A;  4BY4 A;  1B1G A;  2ZN8 A;  3JVT B;  3MSE B;  5KU1 A;  3IF7 A;  1MWN A;  1L2O B;  1IJ5 A;  3O2P A;  2CTN A;  1Y1U A;  3SIA A;  2KYC A;  4CPV A;  3BXK A;  1YVH A;  3CLN A;  5I2O A;  1LA3 A;  3CR4 X;  2CNP A;  2LC5 A;  2LCP A;  2AAO A;  2M97 A;  2MHH A;  1XFV O;  2JXL A;  1BG1 A;  1JBA A;  1DJI A;  1NX0 A;  3TS5 C;  2KFF A;  1OMR A;  2RGI A;  5JOL A;  4NDD A;  5PAL A;  3TUY B;  1F70 A;  1QTX A;  1RK9 A;  4GUK A;  1A75 A;  4M2O A;  2E30 A;  2LP2 A;  1L7Z A;  3QRX A;  4I5L B;  4ICB A;  4HRG A;  1DT7 B;  1BR1 B;  1MR8 A;  1MUX A;  4MVF A;  1PK0 D;  1RRO A;  2AUC A;  3NSO A;  1KFU L;  1YUU A;  1JC2 A;  4WQ2 A;  1QIV A;  2KHN A;  1UUR A;  2H61 C;  1CKK A;  1PSR A;  4I5J A;  2PVB A;  1WDC C;  2CCM A;  3OP0 A;  1WRZ A;  1NX2 A;  3M0W A;  1NCY A;  5CSF A;  5HLO A;  3OX6 A;  4JPZ B;  4I5K A;  1FW4 A;  1SNL A;  2KAV A;  1WY9 A;  1PUL A;  1N0Y A;  2CT9 A;  1Q80 A;  2KI6 C;  3AAK A;  5FYX A;  1C7V A;  3OB2 B;  2LUC A;  3VRN A;  5K89 A;  1CFF A;  4AQI A;  1KK8 C;  4MEW A;  1UUS A;  1MF8 B;  2OTG B;  3PN7 B;  4MZJ A;  4YGE B;  5DKR A;  1B8C A;  1NX3 A;  1TNP A;  2MAZ A;  3LLE A;  2EGD A;  2R2I A;  3LK1 A;  1QAS A;  2KBI A;  4MRY A;  2KFG A;  2M7L A;  4CID A;  1M39 A;  2G9B A;  2LVI A;  2ZRS A;  2LNK A;  2HQW A;  2KAX A;  2WCF A;  4P2Y B;  1CMF A;  1DGV A;  1NCZ A;  1K9P A;  1A2X A;  2WCE A;  2JOJ A;  2ZNE A;  3RM1 A;  1UWO A;  1DF0 B;  1K94 A;  2G2B A;  2VRG A;  3ICB A;  1IWQ A;  1Y0V H;  2F3Z A;  5AFP A;  1H8B A;  1QV0 A;  2M0R A;  2NCO A;  1DTL A;  2LLU A;  5ER5 A;  1U5I A;  1UHK A;  1F8H A;  2PAL A;  2M1U A;  2LM5 A;  4CLN A;  1R2U A;  1OSA A;  1ALV A;  2K7B A;  1BMO A;  2PMY A;  4NDB A;  4PHJ A;  1KK7 Y;  1CDN A;  2I2R E;  1CFP A;  1M46 A;  1RTP 1;  4FTG A;  1GJY A;  3OB1 B;  1CDM A;  2K2A A;  2NZ0 A;  2WND A;  3A4U B;  2F2P A;  4DIR A;  5TNC A;  1SCM C;  1QIW A;  1CDL A;  3D0Y A;  1YTZ C;  4YGB B;  2JNX A;  3I5H B;  4GGF C;  2BKH B;  2JC2 A;  2KI4 C;  3BUN B;  1OE9 B;  1PSB A;  2JT3 A;  4GGF A;  4YBH B;  4GFT A;  1PAL A;  2ZFD A;  1KSO A;  2LLS A;  4N1F A;  3WXA A;  1J7Q A;  1JFJ A;  4OCI A;  3OX5 A;  2LP3 A;  1JUO A;  2JUL A;  3CGA A;  1A03 A;  1DJZ A;  2BBM A;  1SR6 C;  1S5G Y;  1EL4 A;  2I7A A;  2L5X B;  2NXQ A;  4YRU A;  1BR4 B;  3I5G C;  4E68 A;  2MLE C;  2BCX A;  4A4B A;  3TZ1 A;  1YVL A;  2KQY A;  1QVI Y;  2LAN A;  1S6C A;  1K8U A;  1B8R A;  4P5O E;  1H4B A;  1RFJ A;  2JQ6 A;  4M2Q A;  2OPO A;  5AEQ A;  2O5G A;  5CPV A;  3DVE A;  1HT9 A;  3DVJ A;  1YR5 A;  3SG3 A;  1AJ5 A;  3BOW B;  2JTZ A;  4MBE A;  2K2F A;  1KQM C;  1TNX A;  2A4J A;  5CSN A;  3I5F B;  5D7F A;  1QXP A;  1LIN A;  5HYD A;  1S36 A;  1IQ3 A;  1REC A;  1XFU O;  3DF0 B;  3PAL A;  1KFX L;  3KHE A;  1FI5 A;  1ZMZ A;  2L50 A;  4JWQ A;  1F71 A;  1PVB A;  1SK6 D;  1KQV A;  5GQQ C;  3PFV A;  1F54 A;  1QX2 A;  1NYA A;  3NSI A;  2JT0 A;  3WHT B;  2LMT A;  1KSM A;  4DUQ A;  2JT8 A;  1KFU S;  3IQQ A;  4Q04 A;  1K2H A;  1IG5 A;  4MZK A;  1BOC A;  1LKJ A;  3SIB A;  4OVN F;  2M7N A;  3SG2 A;  3BUX B;  3TS5 B;  5ER4 X;  3SG7 A;  3I5I C;  1A75 B;  2I18 A;  3CR2 A;  3NXA A;  2BBN A;  1WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...