1RROA

Refinement of recombinant oncomodulin at 1.30 angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAT ONCOMODULIN
publication title Refinement of recombinant oncomodulin at 1.30 A resolution.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1992-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rroA00
5B8IB 4I5LB 1S36A 4I5JA 2GGZA 3I5IC 1SMGA 3WHUB 1IWQA 1Y1UA 4TNCA 2Y4QA 1NCYA 2KQ6A 1AJ4A 1N65A 1HT9A 3BUXB 1QX2A 3EVRA 1SY9A 2RGIA 1MHOA 1DMOA 1N2DA 2AUCA 1BU3A 4BY5A 4MBEA 3TS5C 1M46A 3H4SE 3A4UB 2L98A 1QXPA 2R2IA 3SG2A 1S3PA 2KQYA 1SKTA 2LMTA 1IGVA 2PALA 2BBNA 1F8HA 2O60A 1ZFSA 1CLLA 2K2FA 5HKZA 5J3XA 4MRYA 1QATA 3MSEB 1MXLC 1CFPA 1J55A 1JUOA 2Q91A 3RLZA 1N0YA 1XFUO 2P6BB 3VRRA 4JWQA 3PN7B 4MSPA 5F6TA 2JXLA 1SBJA 3JVTC 1FPWA 2KGBC 4GGNA 1JBAA 1LA3A 2KFGA 1DTLA 4HRGA 1TIZA 3O78A 2MA2A 3DD4A 1ODBA 1XK4C 1V1GA 1J7OA 3VRQA 1UWOA 1DVIA 1KWOB 2M49B 2LAPA 4N1GA 3OB1B 1TOPA 2K0JA 4XYNA 2M1KB 4GBAA 1F70A 4YBHB 2CCMA 1B1GA 1KK7Y 2HQ8A 2M0RA 2V53A 1BOCA 4WQ2A 2ZRSA 2BKHB 4AQJA 2MLFC 1TNXA 1YVHA 4N1FA 1MR8A 4M2PA 1FBVA 3DVJA 3BXKA 2SASA 3BQ3A 1L7ZA 2LLTA 4YGDB 5AERA 2ZNEA 2LNKA 3IQOA 2HF5A 3KO0A 1EH2A 1RWYA 4YGCB 1NX3A 3KHEA 3EK8A 1MF8B 4AOMA 1W7IB 2AMIA 2CT9A 1CMGA 4CPVA 3TDIA 4PHKA 2JT8A 2MAZA 2BECA 5CPVA 5D69A 5AFPA 1DJGA 2HETA 1QX7A 2WCBA 4XJKB 1XO5A 3WHTB 1JFJA 2H2KA 3EK7A 2JXCA 2F33A 3BOWA 3HX4A 1NUBA 1K94A 3PLFB 1YUTA 1IJ5A 2LMVA 2KFHA 1SW8A 2OS8C 2JT0A 1PSBA 3PN7C 1QIVA 2FJUB 2KYCA 2CNPA 4JQ0D 1SRAA 1FW4A 1S1EA 4JPZB 5HKYA 4GUKA 1XFVO 1IJ6A 2B1UA 4OKHA 2E30A 2LVJA 2OTGC 1CFFA 4C0JA 2MBXA 1NP8A 4C0LA 1KWOC 1SK6D 3PM8A 3PSRA 1UHHA 1OZSA 2LHIA 2LV7A 1SCMB 3I5HB 5BPJA 1PK0D 1SL7A 2BCAA 2PSRA 2KNEA 1GJYA 2PASA 1WY9A 3EKJA 1NPQA 1AUIB 2DOQA 2KHNA 1QTXA 3OHMB 3TUYC 5I2QA 1A75A 1KFXS 3CLNA 1G8IA 2E6WA 1FI6A 2G2BA 1QVIY 1B8RA 3BUNB 1BODA 1CMFA 4GNKB 2FOTA 4ETOA 2ZN9A 5G08A 4CFQA 4U8DA 3NSLA 2JWWA 1NIWA 4FQOA 1MQ1A 1S26D 1W7JB 2SCPA 1BR1B 3E3RA 2WNDA 3FS7A 4ICBA 1ZUZA 3D0YB 1H4BA 5DKQA 1QS7A 1F4OA 1DJHA 4GAOA 1BT6A 1DJIA 4GPLB 3GK4X 2KBIA 3DVEA 1RTP1 2BKIB 3LL8B 1NSHA 1TCOB 2L51A 3CR5X 4PE7A 1KQMC 4QJ4B 3DVMA 2K8MB 2Y5IA 2NXQA 4DUQA 4PE4A 1K9UA 2TN4A 1SCVA 3CR4X 4MEWA 3NSIA 3D10A 5JJGA 1RK9A 4MN0A 4R1EA 4WQ3A 1B47A 1PVBA 1XFZO 5KU1A 1WRZA 3I5GB 2LM5A 3IQQA 5FYXA 1FF1A 1M39A 2LP2A 4ORBB 1SR6C 1XVJA 1YRUB 2KI4C 2NZ0A 5CSNA 2A4JA 1PVAA 2BE4A 2NLNA 2JTTA 2CXJA 4PCWA 4HSZA 2F2OA 2MJWB 1XK4A 1UHNA 2JC2A 3PFVA 3AKAA 3OB2B 3TZ1A 3F45A 3I5HC 2JOJA 1SCMC 2KGRA 5PALA 1YTZC 1F71A 2BBMA 2F3YA 2COLB 3O4YA 3QRXA 1KQVA 1KSOA 1YVLA 1A4PA 1PULA 4USLA 1CB1A 1HQVA 3SIBA 2FCDA 1SL9A 2G9BA 2M1UA 2M29A 5JOLA 2I2RE 4YGEB 1KK8B 1LKJA 2F8PA 3OP0A 2EC6B 4MVFA 1CFDA 4CFRA 1B7TZ 4MZLA 3EVUA 1EG3A 1KFXL 2QPTA 5AEQA 2JPTA 2MRDA 2M8UA 1AP4A 1V1FA 2PRUA 1Y6WA 2BL0B 3KPXA 1DF0A 1E8AA 1R6PA 2L5XB 2WCEA 1TNWA 4PHJA 2LE9B 4PHNA 1F4QA 2WCFA 2LC5A 3BOWB 1K93D 1G33A 5AXIA 4QJ5B 1TTXA 2M9GA 1PRWA 2WOSA 1XA5A 2JT3A 3SIAA 2KI6D 1JF2A 3O2PA 3FIAA 5ER4X 2BE6A 1NX0A 3BUMB 3FWCA 2K61A 1B4CA 2H61A 1NYAA 2NCOA 4OCIA 5D7FA 1ZACA 2K7DA 1ZMZA 3OX6A 1QX5B 3I5GC 1YX8A 1XFXO 1Y0VH 1LXFC 2ZKMX 1WLMA 3DF0A 1QIWA 1UHJA 2PMYA 3FWBA 5AANA 5I8NA 2WC8A 3ZWHA 3I5FB 1BJFA 1TCFA 1TN4A 1UHIA 2AAOA 2F2PA 4ZCUA 3I5IB 3ICBA 1NX2A 1OMDA 1SYMA 3PATA 1OOJA 1A75B 1X02A 1H8BA 1QLKA 1JF0A 2LVVA 1CDLA 1ZOTB 2L4IA 3CWGA 1OQPA 3EKHA 2IS9A 3AAKA 2Y1NA 3HCMA 2ISDA 1LVCD 3SG7A 2KDHA 4A4BA 1KK8C 2M7NA 5KTYA 5DKRA 1XFWO 2EC6C 4QJ3B 1J7PA 1YUUA 2I18A 1EJ3A 1OMRA 4FTGA 3SJSA 1J1DA 2ZNDA 1A2XA 1XFYO 2LP3A 3TS5B 4C0KA 4PDZA 2BL0C 1PSRA 2KOTA 1BF5A 1BLQA 1NWDA 2JQ6A 4MRXA 1GGWA 4A4CA 4OR9B 3JTDB 1NX1A 4CLNA 1BMOA 5CSJA 2HPSA 1CLBA 4YI8A 1UHKA 3VRNA 1KCYA 1R2UA 3BUWB 4BY4A 3NXAA 5HKWA 2LVIA 4MLWA 1DGVA 1K2HA 1B7TY 2LHLA 1CDMA 1CTRA 4MZKA 4L9MA 2KAVA 4GGFC 1J7QA 4YRUA 2Y1MA 4PE0A 1U5IA 5DKNA 2ZRTA 2KI6C 3TDUA 4OVNF 1Y1AA 3I5FC 2LCPA 4I5NB 2K2AA 1ALVA 1K90D 4UPGA 1BR4B 2K7OA 1PALA 3BUOB 1A29A 1M31A 4F0ZB 2WORA 2JRFA 1FI5A 1YRTB 1IH0A 2JNXA 1C7WA 3LCPC 4YI9A 2JZIA 1SNLA 2HQWA 2KAXA 3CS1A 2JNFA 1M63B 1RROA 4NQGA 4DIRA 1WLZA 1S6CA 5CSIA 3RM1A 1DF0B 3SG3A 1ALWA 5HLVA 1TNQA 1F55A 1UURA 1YURA 4PHMA 4P5OE 1QV0A 1IG5A 1OZOA 4HRHA 1SPYA 1JSAA 2LMUA 4CIDA 1J1EA 1AHRA 1IKUA 1S6IA 1UUSA 1VRKA 2EGDA 2F3ZA 5TNCA 2EHBA 1TRFA 1JFKA 4GFTA 3JTDC 3D0YA 3IF7A 1GQMA 4DS7A 1CNPA 2KYFA 1WDCB 3SG6A 1CKKA 2CBLA 1K8UA 1L2OB 2OS8B 5KSZA 5CSFA 3NSKA 1EG4A 1S5GZ 3M0WA 3NSOA 3ZNIA 2GGMA 5HLOA 1RECA 4IL1A 3CR2A 1EXRA 3DF0B 4Q04A 2K7CA 1SL8A 1QVIZ 1Y1XA 3VGOA 2OTGB 1QASA 5K89A 1KFUL 1EL4A 4NDBA 3LK1A 1Q80A 1WRKA 2ZN8A 1K96A 3CTNA 1KSMA 3LLEA 4PALA 5GQQC 3GK1A 3OX5A 1K95A 2I94A 3AAJA 4AQIA 4M2QA 5IBWA 1CFCA 1OMVA 5I2OA 3TUYB 2NCPA 1AJ5A 5ER5A 3VROA 1J7RA 1IRJA 3KF9A 2L0PA 4ORAB 4NDCA 3VRPA 3SG5A 3WXAA 1DJYA 4PE1A 2M7LA 3KEVA 1MUXA 1M45A 4D1EA 1OSAA 1IQ5A 2M97A 1QLSA 1B9AA 2LLSA 1JWDA 2VRGA 1RJVA 2LANA 2M3WA 1YX7A 1B8LA 4P2YB 4ZCVA 2JU0A 3AKBA 1MXEA 1JC2A 2MLEC 1K9PA 1MWNA 2QACA 3LK0A 1DGUA 2I7AA 2LUXA 2L50A 4I5KA 1CLMA 1CM1A 3DVKA 4MZJA 4WRIA 2H61C 5HYDA 1KQMB 1BG1A 1UP5A 3A8RA 1F54A 4N5XA 4OV2A 2OPOA 4YGAA 2GV5A 1WDCC 1L2OC 4YGBB 2L2EA 1DJXA 1D1OA 2PVBA 1CDPA 4E68A 2BCBA 2O5GA 3CGAA 1CM4A 2JTZA 2LLUA 1XYDA 1U5IB 1YUSA 1G4YR 2Q4UA 2FCEA 4DRWA 1SR6B 2KI4B 4M2OA 3SG4A 2KBMA 3CZTX 1YR5A 1K9KA 1KK7Z 2BCXA 1S6JA 2K7BA 3K21A 2D8NA 1DJWA 4GGFA 1C07A 1QV1A 4XJKA 3BYAA 1LINA 1LA0A 4DCKA 1TNPA 2L4HA 3PALA 3GK2A 1WRLA 3WNXB 2KSPA 3EVVA 1AVSA 3JVTB 1IQ3A 1RFJA 2KFFA 1QJTA 2MHHA 4HREE 4ORCB 5I2LA 1KFUS 3TDZA 2ZFDA 1NCZA 1C7VA 1A03A 1OE9B 2LVKA 1AK8A 3C1VA 3O6BA 3EK4A 1S5GY 1B8CA 1GGZA 2JULA 1CDNA 2KAYA 4NDDA 1DJZA 2CTNA 1NCXA 1DT7B 3GOFA 2LUCA
chains in the Genus database with same CATH superfamily
5B8IB 4I5LB 1S36A 4I5JA 2GGZA 1T14A 3I5IC 1SMGA 3WHUB 1IWQA 1Y1UA 4TNCA 2Y4QA 1NCYA 2KQ6A 1AJ4A 1N65A 1HT9A 3BUXB 1QX2A 3EVRA 3BFAA 1SY9A 1OW4A 2RGIA 1MHOA 1DMOA 1N2DA 2AUCA 1BU3A 4BY5A 4MBEA 4INXA 5EL2A 3TS5C 1M46A 3H4SE 3A4UB 2L98A 1QXPA 2R2IA 3SG2A 1S3PA 2KQYA 1SKTA 2LMTA 1IGVA 2PALA 2BBNA 3VB1A 1F8HA 2O60A 1ZFSA 1CLLA 2K2FA 5HKZA 5J3XA 4MRYA 1QATA 3MSEB 3B7AA 1MXLC 1CFPA 1J55A 1JUOA 2Q91A 3RLZA 1N0YA 1XFUO 2P6BB 3VRRA 4JWQA 3NHTA 3PN7B 4MSPA 5F6TA 2JXLA 1SBJA 3JVTC 1FPWA 1TUJA 2KGBC 4GGNA 4JD9A 1JBAA 1LA3A 2KFGA 1DTLA 4HRGA 1TIZA 3NHIA 3O78A 2MA2A 3DD4A 1ODBA 1XK4C 1V1GA 3CABA 3VRQA 1J7OA 1UWOA 1DVIA 1KWOB 2M49B 2LAPA 4N1GA 3OB1B 3BJHA 1TOPA 2K0JA 4XYNA 2M1KB 4GBAA 1F70A 4YBHB 2CCMA 1B1GA 2WCHA 1KK7Y 2HQ8A 2M0RA 2V53A 1BOCA 4WQ2A 2ZRSA 3QMEA 1DEKA 2BKHB 2MLFC 3BFHA 4AQJA 5HL1A 1IIOA 1TNXA 1OOGA 1YVHA 4N1FA 1MR8A 3FE8A 3DZTA 4M2PA 1FBVA 3DVJA 3BXKA 2SASA 3BQ3A 1L7ZA 2LLTA 4YGDB 5AERA 2ZNEA 3N7HA 2LNKA 3IQOA 2HF5A 3KO0A 1EH2A 1RWYA 4INWA 4YGCB 1NX3A 1SSEB 3KHEA 3EK8A 1MF8B 4AOMA 1W7IB 2AMIA 2CT9A 3D73A 1CMGA 4CPVA 3TDIA 4PHKA 2JT8A 3K1EA 2MAZA 2BECA 5CPVA 5D69A 5AFPA 1DJGA 2HETA 1QX7A 2WCBA 4XJKB 1XO5A 3WHTB 1JFJA 2H2KA 3EK7A 2JXCA 2F33A 3BOWA 3HX4A 1NUBA 1K94A 3PLFB 1YUTA 1IJ5A 2LMVA 2KFHA 1SW8A 2OS8C 1DQEA 2JT0A 1PSBA 3PN7C 1QIVA 2FJUB 2KYCA 2CNPA 3D75A 4JQ0D 1SRAA 1FW4A 1S1EA 3R72A 4JPZB 3PJIA 4GUKA 1XFVO 5HKYA 1IJ6A 2B1UA 4OKHA 2E30A 2LVJA 2OTGC 1CFFA 2QEHA 2MBXA 4C0JA 2QEOA 1NP8A 3BFBA 4C0LA 1KWOC 1SK6D 3PM8A 3PSRA 1UHHA 1OZSA 2LHIA 2LV7A 1SCMB 3I5HB 5BPJA 1PK0D 1SL7A 2BCAA 2PSRA 2KNEA 1GJYA 1TUZA 2PASA 1WY9A 3EKJA 1NPQA 3SS4A 1AUIB 2DOQA 2KHNA 1QTXA 3OHMB 3TUYC 5I2QA 1A75A 1KFXS 3CLNA 1G8IA 4PT1A 2E6WA 1FI6A 2G2BA 2WCMA 1QVIY 1B8RA 3BUNB 1BODA 1CMFA 4GNKB 2FOTA 3D76A 4ETOA 2ZN9A 5G08A 4CFQA 4U8DA 3NSLA 2JWWA 1NIWA 4FQOA 1MQ1A 1S26D 1W7JB 2SCPA 1BR1B 3E3RA 2WNDA 3FS7A 3Q8IA 4ICBA 1ZUZA 3D0YB 1H4BA 5DKQA 1QS7A 1F4OA 1DJHA 4GAOA 1BT6A 1DJIA 4GPLB 3GK4X 2KBIA 3DVEA 1RTP1 2BKIB 3LL8B 1NSHA 1TCOB 2L51A 3CR5X 4PE7A 2PYQA 2P71A 1KQMC 4QJ4B 3DVMA 2K8MB 2KPHA 3S0BA 2Y5IA 2NXQA 4DUQA 4PE4A 1K9UA 2TN4A 1SCVA 3CR4X 4MEWA 3NSIA 3D10A 5JJGA 1RK9A 4JKTA 4MN0A 4R1EA 2L5YA 4WQ3A 1B47A 1PVBA 1XFZO 5KU1A 1WRZA 3I5GB 2LM5A 1P28A 3IQQA 5FYXA 1FF1A 1M39A 2LP2A 4ORBB 2K60A 1SR6C 1XVJA 1YRUB 2KI4C 2NZ0A 5CSNA 2A4JA 1PVAA 2BE4A 2NLNA 3V2LA 2JTTA 2CXJA 5I94A 4PCWA 4HSZA 2F2OA 2MJWB 1XK4A 1UHNA 2JC2A 3PFVA 3AKAA 3OB2B 3TZ1A 3F45A 3I5HC 2JOJA 1SCMC 2KGRA 5PALA 1YTZC 1C3YA 3B6XA 2BBMA 1F71A 2F3YA 2COLB 3O4YA 3QRXA 1KQVA 3O4XA 1KSOA 1YVLA 1A4PA 1PULA 4USLA 1CB1A 3RZSA 1HQVA 2WCKA 3SIBA 2FCDA 1SL9A 2G9BA 2M1UA 2M29A 1ORGA 2I2RE 5JOLA 4YGEB 1KK8B 1LKJA 2F8PA 3OP0A 2EC6B 4MVFA 1CFDA 4CFRA 1B7TZ 4MZLA 3EVUA 1EG3A 1KFXL 2QPTA 5AEQA 2JPTA 2MRDA 2M8UA 1AP4A 1V1FA 2PRUA 1Y6WA 2BL0B 3KPXA 1DF0A 1XFRA 1E8AA 1R6PA 2L5XB 2WCEA 3D78A 3UNWA 1TNWA 4PHJA 2LE9B 4PHNA 1F4QA 2WCFA 2LC5A 3BOWB 1K93D 1G33A 5AXIA 4QJ5B 1TTXA 2M9GA 1PRWA 3DXLA 2WOSA 1XA5A 5FI6A 3CZ0A 2JT3A 3SIAA 2KI6D 1JF2A 3O2PA 3FIAA 5ER4X 2BE6A 1NX0A 3BUMB 3FWCA 2K61A 1B4CA 2H61A 1NYAA 2NCOA 4OCIA 1TWOA 5D7FA 1ZACA 2K7DA 1ZMZA 3OX6A 1QX5B 3I5GC 1YX8A 1XFXO 1Y0VH 1LXFC 2ZKMX 3S0DA 1WLMA 3DF0A 3OBVA 1QIWA 3R1PA 1UHJA 2PMYA 3FWBA 5AANA 5I8NA 2WC8A 3ZWHA 3I5FB 1BJFA 1TCFA 1TN4A 1UHIA 2AAOA 2F2PA 4ZCUA 3L4LA 3I5IB 3ICBA 3S0AA 1NX2A 1OMDA 1SYMA 3CZ1A 3PATA 1OOJA 1A75B 1QWVA 1X02A 3D74A 1H8BA 1QLKA 1JF0A 2LVVA 1CDLA 1ZOTB 2L4IA 3CWGA 1OQPA 3EKHA 3SS3A 2IS9A 3AAKA 1W9ZA 2BAPA 2Y1NA 1LVCD 3HCMA 2KDHA 2ISDA 3SG7A 4A4BA 1KK8C 2M7NA 3CDNA 3R1OA 1XFWO 2EC6C 3DYEA 4QJ3B 3OGNA 5DKRA 5KTYA 1J7PA 1YUUA 2I18A 3SS5A 1EJ3A 1OMRA 4FTGA 3SJSA 1J1DA 2ZNDA 1A2XA 1XFYO 2LP3A 3TS5B 4C0KA 4PDZA 2BL0C 1PSRA 2KOTA 3PM2A 1BF5A 1BLQA 1NWDA 2JQ6A 3IVTA 2QEVA 4MRXA 1GGWA 4A4CA 4OR9B 3JTDB 1NX1A 4CLNA 1BMOA 3DY9A 5CSJA 2HPSA 1OOHA 5FI7A 1CLBA 4YI8A 1UHKA 3VRNA 1KCYA 1R2UA 3BUWB 4BY4A 3NXAA 5HKWA 2LVIA 4MLWA 1DGVA 3CZ2A 1K2HA 1B7TY 2LHLA 1CDMA 1CTRA 3FE9A 4MZKA 3NGVA 3B87A 2KAVA 4GGFC 4L9MA 3FE6A 4YRUA 1J7QA 2Y1MA 5DICA 4PE0A 3S0FA 1U5IA 1Z4HA 5DKNA 2KLDA 2ZRTA 2YGUA 2KI6C 3TDUA 4OVNF 3L47A 1Y1AA 3I5FC 2LCPA 4I5NB 2K2AA 1ALVA 1K90D 4UPGA 1BR4B 2K7OA 1PALA 3BUOB 1A29A 1C3ZA 1DC1A 1M31A 4F0ZB 2WORA 2JRFA 1FI5A 2QEBA 1YRTB 1IH0A 2JNXA 1C7WA 3D77A 3LCPC 2JZIA 4YI9A 2WCJA 1SNLA 2HQWA 2KAXA 3CS1A 2JNFA 1M63B 1RROA 4NQGA 4DIRA 1WLZA 1S6CA 5CSIA 2WC6A 1DF0B 3RM1A 1ALWA 5HLVA 1TNQA 3SG3A 3UO9A 1UURA 1F55A 1OOIX 1YURA 4FQTA 3R1VA 4PHMA 4P5OE 1QV0A 1IG5A 1OZOA 4HRHA 1SPYA 1JSAA 2LMUA 4CIDA 1J1EA 1AHRA 1IKUA 1S6IA 1UUSA 1VRKA 2EGDA 2F3ZA 5TNCA 2EHBA 1TRFA 1JFKA 4GFTA 3JTDC 3D0YA 3IF7A 1GQMA 4DS7A 1CNPA 2KYFA 3S0EA 1WDCB 3SG6A 1CKKA 2CBLA 1K8UA 1L2OB 2OS8B 4F7FA 5KSZA 5CSFA 2FJYA 3NSKA 1EG4A 1S5GZ 3M0WA 3NSOA 2BNXA 2GGMA 5HLOA 1RECA 3ZNIA 4IL1A 3CR2A 1EXRA 2GTEA 3DF0B 4Q04A 2K7CA 1SL8A 1QVIZ 1Y1XA 3VGOA 2PQLA 2OTGB 1QASA 5K89A 1KFUL 1EL4A 4NDBA 3LK1A 1Q80A 1WRKA 2ZN8A 1K96A 2JPOA 3CTNA 1KSMA 3LLEA 4PALA 5GQQC 3GK1A 3EG5B 3OX5A 1K95A 2WC5A 2I94A 2WCLA 3AAJA 4AQIA 5FI2A 3B86A 4M2QA 5IBWA 3L4AA 1CFCA 1OMVA 3CYZA 5I2OA 3TUYB 2NCPA 1AJ5A 5ER5A 3VROA 1J7RA 3S0GA 1IRJA 3KF9A 2L0PA 4ORAB 4NDCA 3VRPA 3SG5A 3WXAA 1DJYA 4PE1A 2M7LA 3KEVA 1MUXA 1M45A 4D1EA 1LS8A 1IQ5A 1OSAA 2M97A 1QLSA 2H8VA 1B9AA 2L2CA 2LLSA 2VRGA 1JWDA 1RJVA 2LANA 2M3WA 4IJ7A 1YX7A 1B8LA 4P2YB 4ZCVA 2JU0A 3AKBA 1MXEA 1JC2A 2MLEC 1K9PA 1MWNA 2QACA 3LK0A 1DGUA 2I7AA 2LUXA 2L50A 3B88A 4I5KA 1CLMA 1CM1A 3DVKA 4MZJA 4WRIA 1DELA 2H61C 5HYDA 1KQMB 1BG1A 1UP5A 3A8RA 1F54A 4N5XA 4OV2A 2OPOA 4YGAA 2GV5A 1WDCC 1L2OC 4YGBB 2L2EA 1DJXA 1D1OA 2PVBA 1CDPA 4E68A 2BCBA 2O5GA 3CGAA 1CM4A 2JTZA 2LLUA 1XYDA 1U5IB 1YUSA 1G4YR 5D3OA 2Q4UA 2FCEA 4DRWA 1SR6B 2KI4B 4M2OA 3SG4A 2KBMA 3CZTX 1YR5A 1K9KA 1KK7Z 2BCXA 1S6JA 4KYNA 2K7BA 3K21A 2D8NA 1DJWA 4GGFA 1C07A 1QV1A 4XJKA 3BYAA 1LINA 1GM0A 1LA0A 2P70A 4DCKA 1TNPA 2L4HA 2QDIA 3GK2A 1WRLA 3PALA 2KSPA 3EVVA 1AVSA 3JVTB 3WNXB 1IQ3A 1RFJA 2KFFA 1QJTA 2MHHA 2ERBA 4HREE 4ORCB 5I2LA 1KFUS 3TDZA 2ZFDA 1NCZA 1C7VA 1Z2CB 1A03A 1OE9B 2LVKA 1AK8A 3C1VA 3O6BA 3EK4A 1S5GY 1B8CA 1GGZA 1OOFA 2JULA 4OZDA 2KLEA 1CDNA 2KAYA 4NDDA 1DJZA 2CTNA 1NCXA 1DT7B 3GOFA 2LUCA
chains in the Genus database with same CATH topology
5B8IB 4I5LB 1S36A 4I5JA 2GGZA 3I5IC 1SMGA 3WHUB 1IWQA 1Y1UA 4TNCA 2Y4QA 1NCYA 2KQ6A 1AJ4A 1N65A 1HT9A 3BUXB 1QX2A 3EVRA 1SY9A 2RGIA 1MHOA 1DMOA 1N2DA 2AUCA 1BU3A 4BY5A 4MBEA 3TS5C 1M46A 3H4SE 3A4UB 2L98A 1QXPA 2R2IA 3SG2A 1S3PA 2KQYA 1SKTA 2LMTA 1IGVA 2PALA 2BBNA 1F8HA 2O60A 1ZFSA 1CLLA 2K2FA 5HKZA 5J3XA 4MRYA 1QATA 3MSEB 1MXLC 1CFPA 1J55A 1JUOA 2Q91A 3RLZA 1N0YA 1XFUO 2P6BB 3VRRA 4JWQA 3PN7B 4MSPA 5F6TA 2JXLA 1SBJA 3JVTC 1FPWA 2KGBC 4GGNA 1JBAA 1LA3A 2KFGA 1DTLA 4HRGA 1TIZA 3O78A 2MA2A 3DD4A 1ODBA 1XK4C 1V1GA 1J7OA 3VRQA 1UWOA 1DVIA 1KWOB 2M49B 2LAPA 4N1GA 3OB1B 1TOPA 2K0JA 4XYNA 2M1KB 4GBAA 1F70A 4YBHB 2CCMA 1B1GA 1KK7Y 2HQ8A 2M0RA 2V53A 1BOCA 4WQ2A 2ZRSA 2BKHB 4AQJA 2MLFC 1TNXA 1YVHA 4N1FA 1MR8A 4M2PA 1FBVA 3DVJA 3BXKA 2SASA 3BQ3A 1L7ZA 2LLTA 4YGDB 5AERA 2ZNEA 2LNKA 3IQOA 2HF5A 3KO0A 1EH2A 1RWYA 4YGCB 1NX3A 3KHEA 3EK8A 1MF8B 4AOMA 1W7IB 2AMIA 2CT9A 1CMGA 4CPVA 3TDIA 4PHKA 2JT8A 2MAZA 2BECA 5CPVA 5D69A 5AFPA 1DJGA 2HETA 1QX7A 2WCBA 4XJKB 1XO5A 3WHTB 1JFJA 2H2KA 3EK7A 2JXCA 2F33A 3BOWA 3HX4A 1NUBA 1K94A 3PLFB 1YUTA 1IJ5A 2LMVA 2KFHA 1SW8A 2OS8C 2JT0A 1PSBA 3PN7C 1QIVA 2FJUB 2KYCA 2CNPA 4JQ0D 1SRAA 1FW4A 1S1EA 4JPZB 5HKYA 4GUKA 1XFVO 1IJ6A 2B1UA 4OKHA 2E30A 2LVJA 2OTGC 1CFFA 4C0JA 2MBXA 1NP8A 4C0LA 1KWOC 1SK6D 3PM8A 3PSRA 1UHHA 1OZSA 2LHIA 2LV7A 1SCMB 3I5HB 5BPJA 1PK0D 1SL7A 2BCAA 2PSRA 2KNEA 1GJYA 2PASA 1WY9A 3EKJA 1NPQA 1AUIB 2DOQA 2KHNA 1QTXA 3OHMB 3TUYC 5I2QA 1A75A 1KFXS 3CLNA 1G8IA 2E6WA 1FI6A 2G2BA 1QVIY 1B8RA 3BUNB 1BODA 1CMFA 4GNKB 2FOTA 4ETOA 2ZN9A 5G08A 4CFQA 4U8DA 3NSLA 2JWWA 1NIWA 4FQOA 1MQ1A 1S26D 1W7JB 2SCPA 1BR1B 3E3RA 2WNDA 3FS7A 4ICBA 1ZUZA 3D0YB 1H4BA 5DKQA 1QS7A 1F4OA 1DJHA 4GAOA 1BT6A 1DJIA 4GPLB 3GK4X 2KBIA 3DVEA 1RTP1 2BKIB 3LL8B 1NSHA 1TCOB 2L51A 3CR5X 4PE7A 1KQMC 4QJ4B 3DVMA 2K8MB 2Y5IA 2NXQA 4DUQA 4PE4A 1K9UA 2TN4A 1SCVA 3CR4X 4MEWA 3NSIA 3D10A 5JJGA 1RK9A 4MN0A 4R1EA 4WQ3A 1B47A 1PVBA 1XFZO 5KU1A 1WRZA 3I5GB 2LM5A 3IQQA 5FYXA 1FF1A 1M39A 2LP2A 4ORBB 1SR6C 1XVJA 1YRUB 2KI4C 2NZ0A 5CSNA 2A4JA 1PVAA 2BE4A 2NLNA 2JTTA 2CXJA 4PCWA 4HSZA 2F2OA 2MJWB 1XK4A 1UHNA 2JC2A 3PFVA 3AKAA 3OB2B 3TZ1A 3F45A 3I5HC 2JOJA 1SCMC 2KGRA 5PALA 1YTZC 1F71A 2BBMA 2F3YA 2COLB 3O4YA 3QRXA 1KQVA 1KSOA 1YVLA 1A4PA 1PULA 4USLA 1CB1A 1HQVA 3SIBA 2FCDA 1SL9A 2G9BA 2M1UA 2M29A 5JOLA 2I2RE 4YGEB 1KK8B 1LKJA 2F8PA 3OP0A 2EC6B 4MVFA 1CFDA 4CFRA 1B7TZ 4MZLA 3EVUA 1EG3A 1KFXL 2QPTA 5AEQA 2JPTA 2MRDA 2M8UA 1AP4A 1V1FA 2PRUA 1Y6WA 2BL0B 3KPXA 1DF0A 1E8AA 1R6PA 2L5XB 2WCEA 1TNWA 4PHJA 2LE9B 4PHNA 1F4QA 2WCFA 2LC5A 3BOWB 1K93D 1G33A 5AXIA 4QJ5B 1TTXA 2M9GA 1PRWA 2WOSA 1XA5A 2JT3A 3SIAA 2KI6D 1JF2A 3O2PA 3FIAA 5ER4X 2BE6A 1NX0A 3BUMB 3FWCA 2K61A 1B4CA 2H61A 1NYAA 2NCOA 4OCIA 5D7FA 1ZACA 2K7DA 1ZMZA 3OX6A 1QX5B 3I5GC 1YX8A 1XFXO 1Y0VH 1LXFC 2ZKMX 1WLMA 3DF0A 1QIWA 1UHJA 2PMYA 3FWBA 5AANA 5I8NA 2WC8A 3ZWHA 3I5FB 1BJFA 1TCFA 1TN4A 1UHIA 2AAOA 2F2PA 4ZCUA 3I5IB 3ICBA 1NX2A 1OMDA 1SYMA 3PATA 1OOJA 1A75B 1X02A 1H8BA 1QLKA 1JF0A 2LVVA 1CDLA 1ZOTB 2L4IA 3CWGA 1OQPA 3EKHA 2IS9A 3AAKA 2Y1NA 3HCMA 2ISDA 1LVCD 3SG7A 2KDHA 4A4BA 1KK8C 2M7NA 5KTYA 5DKRA 1XFWO 2EC6C 4QJ3B 1J7PA 1YUUA 2I18A 1EJ3A 1OMRA 4FTGA 3SJSA 1J1DA 2ZNDA 1A2XA 1XFYO 2LP3A 3TS5B 4C0KA 4PDZA 2BL0C 1PSRA 2KOTA 1BF5A 1BLQA 1NWDA 2JQ6A 4MRXA 1GGWA 4A4CA 4OR9B 3JTDB 1NX1A 4CLNA 1BMOA 5CSJA 2HPSA 1CLBA 4YI8A 1UHKA 3VRNA 1KCYA 1R2UA 3BUWB 4BY4A 3NXAA 5HKWA 2LVIA 4MLWA 1DGVA 1K2HA 1B7TY 2LHLA 1CDMA 1CTRA 4MZKA 4L9MA 2KAVA 4GGFC 1J7QA 4YRUA 2Y1MA 4PE0A 1U5IA 5DKNA 2ZRTA 2KI6C 3TDUA 4OVNF 1Y1AA 3I5FC 2LCPA 4I5NB 2K2AA 1ALVA 1K90D 4UPGA 1BR4B 2K7OA 1PALA 3BUOB 1A29A 1M31A 4F0ZB 2WORA 2JRFA 1FI5A 1YRTB 1IH0A 2JNXA 1C7WA 3LCPC 4YI9A 2JZIA 1SNLA 2HQWA 2KAXA 3CS1A 2JNFA 1M63B 1RROA 4NQGA 4DIRA 1WLZA 1S6CA 5CSIA 3RM1A 1DF0B 3SG3A 1ALWA 5HLVA 1TNQA 1F55A 1UURA 1YURA 4PHMA 4P5OE 1QV0A 1IG5A 1OZOA 4HRHA 1SPYA 1JSAA 2LMUA 4CIDA 1J1EA 1AHRA 1IKUA 1S6IA 1UUSA 1VRKA 2EGDA 2F3ZA 5TNCA 2EHBA 1TRFA 1JFKA 4GFTA 3JTDC 3D0YA 3IF7A 1GQMA 4DS7A 1CNPA 2KYFA 1WDCB 3SG6A 1CKKA 2CBLA 1K8UA 1L2OB 2OS8B 5KSZA 5CSFA 3NSKA 1EG4A 1S5GZ 3M0WA 3NSOA 3ZNIA 2GGMA 5HLOA 1RECA 4IL1A 3CR2A 1EXRA 3DF0B 4Q04A 2K7CA 1SL8A 1QVIZ 1Y1XA 3VGOA 2OTGB 1QASA 5K89A 1KFUL 1EL4A 4NDBA 3LK1A 1Q80A 1WRKA 2ZN8A 1K96A 3CTNA 1KSMA 3LLEA 4PALA 5GQQC 3GK1A 3OX5A 1K95A 2I94A 3AAJA 4AQIA 4M2QA 5IBWA 1CFCA 1OMVA 5I2OA 3TUYB 2NCPA 1AJ5A 5ER5A 3VROA 1J7RA 1IRJA 3KF9A 2L0PA 4ORAB 4NDCA 3VRPA 3SG5A 3WXAA 1DJYA 4PE1A 2M7LA 3KEVA 1MUXA 1M45A 4D1EA 1OSAA 1IQ5A 2M97A 1QLSA 1B9AA 2LLSA 1JWDA 2VRGA 1RJVA 2LANA 2M3WA 1YX7A 1B8LA 4P2YB 4ZCVA 2JU0A 3AKBA 1MXEA 1JC2A 2MLEC 1K9PA 1MWNA 2QACA 3LK0A 1DGUA 2I7AA 2LUXA 2L50A 4I5KA 1CLMA 1CM1A 3DVKA 4MZJA 4WRIA 2H61C 5HYDA 1KQMB 1BG1A 1UP5A 3A8RA 1F54A 4N5XA 4OV2A 2OPOA 4YGAA 2GV5A 1WDCC 1L2OC 4YGBB 2L2EA 1DJXA 1D1OA 2PVBA 1CDPA 4E68A 2BCBA 2O5GA 3CGAA 1CM4A 2JTZA 2LLUA 1XYDA 1U5IB 1YUSA 1G4YR 2Q4UA 2FCEA 4DRWA 1SR6B 2KI4B 4M2OA 3SG4A 2KBMA 3CZTX 1YR5A 1K9KA 1KK7Z 2BCXA 1S6JA 2K7BA 3K21A 2D8NA 1DJWA 4GGFA 1C07A 1QV1A 4XJKA 3BYAA 1LINA 1LA0A 4DCKA 1TNPA 2L4HA 3PALA 3GK2A 1WRLA 3WNXB 2KSPA 3EVVA 1AVSA 3JVTB 1IQ3A 1RFJA 2KFFA 1QJTA 2MHHA 4HREE 4ORCB 5I2LA 1KFUS 3TDZA 2ZFDA 1NCZA 1C7VA 1A03A 1OE9B 2LVKA 1AK8A 3C1VA 3O6BA 3EK4A 1S5GY 1B8CA 1GGZA 2JULA 1CDNA 2KAYA 4NDDA 1DJZA 2CTNA 1NCXA 1DT7B 3GOFA 2LUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8I B;  4I5L B;  1S36 A;  4I5J A;  2GGZ A;  3I5I C;  1SMG A;  3WHU B;  1IWQ A;  1Y1U A;  4TNC A;  2Y4Q A;  1NCY A;  2KQ6 A;  1AJ4 A;  1N65 A;  1HT9 A;  3BUX B;  1QX2 A;  3EVR A;  1SY9 A;  2RGI A;  1MHO A;  1DMO A;  1N2D A;  2AUC A;  1BU3 A;  4BY5 A;  4MBE A;  3TS5 C;  1M46 A;  3H4S E;  3A4U B;  2L98 A;  1QXP A;  2R2I A;  3SG2 A;  1S3P A;  2KQY A;  1SKT A;  2LMT A;  1IGV A;  2PAL A;  2BBN A;  1F8H A;  2O60 A;  1ZFS A;  1CLL A;  2K2F A;  5HKZ A;  5J3X A;  4MRY A;  1QAT A;  3MSE B;  1MXL C;  1CFP A;  1J55 A;  1JUO A;  2Q91 A;  3RLZ A;  1N0Y A;  1XFU O;  2P6B B;  3VRR A;  4JWQ A;  3PN7 B;  4MSP A;  5F6T A;  2JXL A;  1SBJ A;  3JVT C;  1FPW A;  2KGB C;  4GGN A;  1JBA A;  1LA3 A;  2KFG A;  1DTL A;  4HRG A;  1TIZ A;  3O78 A;  2MA2 A;  3DD4 A;  1ODB A;  1XK4 C;  1V1G A;  1J7O A;  3VRQ A;  1UWO A;  1DVI A;  1KWO B;  2M49 B;  2LAP A;  4N1G A;  3OB1 B;  1TOP A;  2K0J A;  4XYN A;  2M1K B;  4GBA A;  1F70 A;  4YBH B;  2CCM A;  1B1G A;  1KK7 Y;  2HQ8 A;  2M0R A;  2V53 A;  1BOC A;  4WQ2 A;  2ZRS A;  2BKH B;  4AQJ A;  2MLF C;  1TNX A;  1YVH A;  4N1F A;  1MR8 A;  4M2P A;  1FBV A;  3DVJ A;  3BXK A;  2SAS A;  3BQ3 A;  1L7Z A;  2LLT A;  4YGD B;  5AER A;  2ZNE A;  2LNK A;  3IQO A;  2HF5 A;  3KO0 A;  1EH2 A;  1RWY A;  4YGC B;  1NX3 A;  3KHE A;  3EK8 A;  1MF8 B;  4AOM A;  1W7I B;  2AMI A;  2CT9 A;  1CMG A;  4CPV A;  3TDI A;  4PHK A;  2JT8 A;  2MAZ A;  2BEC A;  5CPV A;  5D69 A;  5AFP A;  1DJG A;  2HET A;  1QX7 A;  2WCB A;  4XJK B;  1XO5 A;  3WHT B;  1JFJ A;  2H2K A;  3EK7 A;  2JXC A;  2F33 A;  3BOW A;  3HX4 A;  1NUB A;  1K94 A;  3PLF B;  1YUT A;  1IJ5 A;  2LMV A;  2KFH A;  1SW8 A;  2OS8 C;  2JT0 A;  1PSB A;  3PN7 C;  1QIV A;  2FJU B;  2KYC A;  2CNP A;  4JQ0 D;  1SRA A;  1FW4 A;  1S1E A;  4JPZ B;  5HKY A;  4GUK A;  1XFV O;  1IJ6 A;  2B1U A;  4OKH A;  2E30 A;  2LVJ A;  2OTG C;  1CFF A;  4C0J A;  2MBX A;  1NP8 A;  4C0L A;  1KWO C;  1SK6 D;  3PM8 A;  3PSR A;  1UHH A;  1OZS A;  2LHI A;  2LV7 A;  1SCM B;  3I5H B;  5BPJ A;  1PK0 D;  1SL7 A;  2BCA A;  2PSR A;  2KNE A;  1GJY A;  2PAS A;  1WY9 A;  3EKJ A;  1NPQ A;  1AUI B;  2DOQ A;  2KHN A;  1QTX A;  3OHM B;  3TUY C;  5I2Q A;  1A75 A;  1KFX S;  3CLN A;  1G8I A;  2E6W A;  1FI6 A;  2G2B A;  1QVI Y;  1B8R A;  3BUN B;  1BOD A;  1CMF A;  4GNK B;  2FOT A;  4ETO A;  2ZN9 A;  5G08 A;  4CFQ A;  4U8D A;  3NSL A;  2JWW A;  1NIW A;  4FQO A;  1MQ1 A;  1S26 D;  1W7J B;  2SCP A;  1BR1 B;  3E3R A;  2WND A;  3FS7 A;  4ICB A;  1ZUZ A;  3D0Y B;  1H4B A;  5DKQ A;  1QS7 A;  1F4O A;  1DJH A;  4GAO A;  1BT6 A;  1DJI A;  4GPL B;  3GK4 X;  2KBI A;  3DVE A;  1RTP 1;  2BKI B;  3LL8 B;  1NSH A;  1TCO B;  2L51 A;  3CR5 X;  4PE7 A;  1KQM C;  4QJ4 B;  3DVM A;  2K8M B;  2Y5I A;  2NXQ A;  4DUQ A;  4PE4 A;  1K9U A;  2TN4 A;  1SCV A;  3CR4 X;  4MEW A;  3NSI A;  3D10 A;  5JJG A;  1RK9 A;  4MN0 A;  4R1E A;  4WQ3 A;  1B47 A;  1PVB A;  1XFZ O;  5KU1 A;  1WRZ A;  3I5G B;  2LM5 A;  3IQQ A;  5FYX A;  1FF1 A;  1M39 A;  2LP2 A;  4ORB B;  1SR6 C;  1XVJ A;  1YRU B;  2KI4 C;  2NZ0 A;  5CSN A;  2A4J A;  1PVA A;  2BE4 A;  2NLN A;  2JTT A;  2CXJ A;  4PCW A;  4HSZ A;  2F2O A;  2MJW B;  1XK4 A;  1UHN A;  2JC2 A;  3PFV A;  3AKA A;  3OB2 B;  3TZ1 A;  3F45 A;  3I5H C;  2JOJ A;  1SCM C;  2KGR A;  5PAL A;  1YTZ C;  1F71 A;  2BBM A;  2F3Y A;  2COL B;  3O4Y A;  3QRX A;  1KQV A;  1KSO A;  1YVL A;  1A4P A;  1PUL A;  4USL A;  1CB1 A;  1HQV A;  3SIB A;  2FCD A;  1SL9 A;  2G9B A;  2M1U A;  2M29 A;  5JOL A;  2I2R E;  4YGE B;  1KK8 B;  1LKJ A;  2F8P A;  3OP0 A;  2EC6 B;  4MVF A;  1CFD A;  4CFR A;  1B7T Z;  4MZL A;  3EVU A;  1EG3 A;  1KFX L;  2QPT A;  5AEQ A;  2JPT A;  2MRD A;  2M8U A;  1AP4 A;  1V1F A;  2PRU A;  1Y6W A;  2BL0 B;  3KPX A;  1DF0 A;  1E8A A;  1R6P A;  2L5X B;  2WCE A;  1TNW A;  4PHJ A;  2LE9 B;  4PHN A;  1F4Q A;  2WCF A;  2LC5 A;  3BOW B;  1K93 D;  1G33 A;  5AXI A;  4QJ5 B;  1TTX A;  2M9G A;  1PRW A;  2WOS A;  1XA5 A;  2JT3 A;  3SIA A;  2KI6 D;  1JF2 A;  3O2P A;  3FIA A;  5ER4 X;  2BE6 A;  1NX0 A;  3BUM B;  3FWC A;  2K61 A;  1B4C A;  2H61 A;  1NYA A;  2NCO A;  4OCI A;  5D7F A;  1ZAC A;  2K7D A;  1ZMZ A;  3OX6 A;  1QX5 B;  3I5G C;  1YX8 A;  1XFX O;  1Y0V H;  1LXF C;  2ZKM X;  1WLM A;  3DF0 A;  1QIW A;  1UHJ A;  2PMY A;  3FWB A;  5AAN A;  5I8N A;  2WC8 A;  3ZWH A;  3I5F B;  1BJF A;  1TCF A;  1TN4 A;  1UHI A;  2AAO A;  2F2P A;  4ZCU A;  3I5I B;  3ICB A;  1NX2 A;  1OMD A;  1SYM A;  3PAT A;  1OOJ A;  1A75 B;  1X02 A;  1H8B A;  1QLK A;  1JF0 A;  2LVV A;  1CDL A;  1ZOT B;  2L4I A;  3CWG A;  1OQP A;  3EKH A;  2IS9 A;  3AAK A;  2Y1N A;  3HCM A;  2ISD A;  1LVC D;  3SG7 A;  2KDH A;  4A4B A;  1KK8 C;  2M7N A;  5KTY A;  5DKR A;  1XFW O;  2EC6 C;  4QJ3 B;  1J7P A;  1YUU A;  2I18 A;  1EJ3 A;  1OMR A;  4FTG A;  3SJS A;  1J1D A;  2ZND A;  1A2X A;  1XFY O;  2LP3 A;  3TS5 B;  4C0K A;  4PDZ A;  2BL0 C;  1PSR A;  2KOT A;  1BF5 A;  1BLQ A;  1NWD A;  2JQ6 A;  4MRX A;  1GGW A;  4A4C A;  4OR9 B;  3JTD B;  1NX1 A;  4CLN A;  1BMO A;  5CSJ A;  2HPS A;  1CLB A;  4YI8 A;  1UHK A;  3VRN A;  1KCY A;  1R2U A;  3BUW B;  4BY4 A;  3NXA A;  5HKW A;  2LVI A;  4MLW A;  1DGV A;  1K2H A;  1B7T Y;  2LHL A;  1CDM A;  1CTR A;  4MZK A;  4L9M A;  2KAV A;  4GGF C;  1J7Q A;  4YRU A;  2Y1M A;  4PE0 A;  1U5I A;  5DKN A;  2ZRT A;  2KI6 C;  3TDU A;  4OVN F;  1Y1A A;  3I5F C;  2LCP A;  4I5N B;  2K2A A;  1ALV A;  1K90 D;  4UPG A;  1BR4 B;  2K7O A;  1PAL A;  3BUO B;  1A29 A;  1M31 A;  4F0Z B;  2WOR A;  2JRF A;  1FI5 A;  1YRT B;  1IH0 A;  2JNX A;  1C7W A;  3LCP C;  4YI9 A;  2JZI A;  1SNL A;  2HQW A;  2KAX A;  3CS1 A;  2JNF A;  1M63 B;  1RRO A;  4NQG A;  4DIR A;  1WLZ A;  1S6C A;  5CSI A;  3RM1 A;  1DF0 B;  3SG3 A;  1ALW A;  5HLV A;  1TNQ A;  1F55 A;  1UUR A;  1YUR A;  4PHM A;  4P5O E;  1QV0 A;  1IG5 A;  1OZO A;  4HRH A;  1SPY A;  1JSA A;  2LMU A;  4CID A;  1J1E A;  1AHR A;  1IKU A;  1S6I A;  1UUS A;  1VRK A;  2EGD A;  2F3Z A;  5TNC A;  2EHB A;  1TRF A;  1JFK A;  4GFT A;  3JTD C;  3D0Y A;  3IF7 A;  1GQM A;  4DS7 A;  1CNP A;  2KYF A;  1WDC B;  3SG6 A;  1CKK A;  2CBL A;  1K8U A;  1L2O B;  2OS8 B;  5KSZ A;  5CSF A;  3NSK A;  1EG4 A;  1S5G Z;  3M0W A;  3NSO A;  3ZNI A;  2GGM A;  5HLO A;  1REC A;  4IL1 A;  3CR2 A;  1EXR A;  3DF0 B;  4Q04 A;  2K7C A;  1SL8 A;  1QVI Z;  1Y1X A;  3VGO A;  2OTG B;  1QAS A;  5K89 A;  1KFU L;  1EL4 A;  4NDB A;  3LK1 A;  1Q80 A;  1WRK A;  2ZN8 A;  1K96 A;  3CTN A;  1KSM A;  3LLE A;  4PAL A;  5GQQ C;  3GK1 A;  3OX5 A;  1K95 A;  2I94 A;  3AAJ A;  4AQI A;  4M2Q A;  5IBW A;  1CFC A;  1OMV A;  5I2O A;  3TUY B;  2NCP A;  1AJ5 A;  5ER5 A;  3VRO A;  1J7R A;  1IRJ A;  3KF9 A;  2L0P A;  4ORA B;  4NDC A;  3VRP A;  3SG5 A;  3WXA A;  1DJY A;  4PE1 A;  2M7L A;  3KEV A;  1MUX A;  1M45 A;  4D1E A;  1OSA A;  1IQ5 A;  2M97 A;  1QLS A;  1B9A A;  2LLS A;  1JWD A;  2VRG A;  1RJV A;  2LAN A;  2M3W A;  1YX7 A;  1B8L A;  4P2Y B;  4ZCV A;  2JU0 A;  3AKB A;  1MXE A;  1JC2 A;  2MLE C;  1K9P A;  1MWN A;  2QAC A;  3LK0 A;  1DGU A;  2I7A A;  2LUX A;  2L50 A;  4I5K A;  1CLM A;  1CM1 A;  3DVK A;  4MZJ A;  4WRI A;  2H61 C;  5HYD A;  1KQM B;  1BG1 A;  1UP5 A;  3A8R A;  1F54 A;  4N5X A;  4OV2 A;  2OPO A;  4YGA A;  2GV5 A;  1WDC C;  1L2O C;  4YGB B;  2L2E A;  1DJX A;  1D1O A;  2PVB A;  1CDP A;  4E68 A;  2BCB A;  2O5G A;  3CGA A;  1CM4 A;  2JTZ A;  2LLU A;  1XYD A;  1U5I B;  1YUS A;  1G4Y R;  2Q4U A;  2FCE A;  4DRW A;  1SR6 B;  2KI4 B;  4M2O A;  3SG4 A;  2KBM A;  3CZT X;  1YR5 A;  1K9K A;  1KK7 Z;  2BCX A;  1S6J A;  2K7B A;  3K21 A;  2D8N A;  1DJW A;  4GGF A;  1C07 A;  1QV1 A;  4XJK A;  3BYA A;  1LIN A;  1LA0 A;  4DCK A;  1TNP A;  2L4H A;  3PAL A;  3GK2 A;  1WRL A;  3WNX B;  2KSP A;  3EVV A;  1AVS A;  3JVT B;  1IQ3 A;  1RFJ A;  2KFF A;  1QJT A;  2MHH A;  4HRE E;  4ORC B;  5I2L A;  1KFU S;  3TDZ A;  2ZFD A;  1NCZ A;  1C7V A;  1A03 A;  1OE9 B;  2LVK A;  1AK8 A;  3C1V A;  3O6B A;  3EK4 A;  1S5G Y;  1B8C A;  1GGZ A;  2JUL A;  1CDN A;  2KAY A;  4NDD A;  1DJZ A;  2CTN A;  1NCX A;  1DT7 B;  3GOF A;  2LUC A; 
#chains in the Genus database with same CATH topology
 5B8I B;  4I5L B;  1S36 A;  4I5J A;  2GGZ A;  1T14 A;  3I5I C;  1SMG A;  3WHU B;  1IWQ A;  1Y1U A;  4TNC A;  2Y4Q A;  1NCY A;  2KQ6 A;  1AJ4 A;  1N65 A;  1HT9 A;  3BUX B;  1QX2 A;  3EVR A;  3BFA A;  1SY9 A;  1OW4 A;  2RGI A;  1MHO A;  1DMO A;  1N2D A;  2AUC A;  1BU3 A;  4BY5 A;  4MBE A;  4INX A;  5EL2 A;  3TS5 C;  1M46 A;  3H4S E;  3A4U B;  2L98 A;  1QXP A;  2R2I A;  3SG2 A;  1S3P A;  2KQY A;  1SKT A;  2LMT A;  1IGV A;  2PAL A;  2BBN A;  3VB1 A;  1F8H A;  2O60 A;  1ZFS A;  1CLL A;  2K2F A;  5HKZ A;  5J3X A;  4MRY A;  1QAT A;  3MSE B;  3B7A A;  1MXL C;  1CFP A;  1J55 A;  1JUO A;  2Q91 A;  3RLZ A;  1N0Y A;  1XFU O;  2P6B B;  3VRR A;  4JWQ A;  3NHT A;  3PN7 B;  4MSP A;  5F6T A;  2JXL A;  1SBJ A;  3JVT C;  1FPW A;  1TUJ A;  2KGB C;  4GGN A;  4JD9 A;  1JBA A;  1LA3 A;  2KFG A;  1DTL A;  4HRG A;  1TIZ A;  3NHI A;  3O78 A;  2MA2 A;  3DD4 A;  1ODB A;  1XK4 C;  1V1G A;  3CAB A;  3VRQ A;  1J7O A;  1UWO A;  1DVI A;  1KWO B;  2M49 B;  2LAP A;  4N1G A;  3OB1 B;  3BJH A;  1TOP A;  2K0J A;  4XYN A;  2M1K B;  4GBA A;  1F70 A;  4YBH B;  2CCM A;  1B1G A;  2WCH A;  1KK7 Y;  2HQ8 A;  2M0R A;  2V53 A;  1BOC A;  4WQ2 A;  2ZRS A;  3QME A;  1DEK A;  2BKH B;  2MLF C;  3BFH A;  4AQJ A;  5HL1 A;  1IIO A;  1TNX A;  1OOG A;  1YVH A;  4N1F A;  1MR8 A;  3FE8 A;  3DZT A;  4M2P A;  1FBV A;  3DVJ A;  3BXK A;  2SAS A;  3BQ3 A;  1L7Z A;  2LLT A;  4YGD B;  5AER A;  2ZNE A;  3N7H A;  2LNK A;  3IQO A;  2HF5 A;  3KO0 A;  1EH2 A;  1RWY A;  4INW A;  4YGC B;  1NX3 A;  1SSE B;  3KHE A;  3EK8 A;  1MF8 B;  4AOM A;  1W7I B;  2AMI A;  2CT9 A;  3D73 A;  1CMG A;  4CPV A;  3TDI A;  4PHK A;  2JT8 A;  3K1E A;  2MAZ A;  2BEC A;  5CPV A;  5D69 A;  5AFP A;  1DJG A;  2HET A;  1QX7 A;  2WCB A;  4XJK B;  1XO5 A;  3WHT B;  1JFJ A;  2H2K A;  3EK7 A;  2JXC A;  2F33 A;  3BOW A;  3HX4 A;  1NUB A;  1K94 A;  3PLF B;  1YUT A;  1IJ5 A;  2LMV A;  2KFH A;  1SW8 A;  2OS8 C;  1DQE A;  2JT0 A;  1PSB A;  3PN7 C;  1QIV A;  2FJU B;  2KYC A;  2CNP A;  3D75 A;  4JQ0 D;  1SRA A;  1FW4 A;  1S1E A;  3R72 A;  4JPZ B;  3PJI A;  4GUK A;  1XFV O;  5HKY A;  1IJ6 A;  2B1U A;  4OKH A;  2E30 A;  2LVJ A;  2OTG C;  1CFF A;  2QEH A;  2MBX A;  4C0J A;  2QEO A;  1NP8 A;  3BFB A;  4C0L A;  1KWO C;  1SK6 D;  3PM8 A;  3PSR A;  1UHH A;  1OZS A;  2LHI A;  2LV7 A;  1SCM B;  3I5H B;  5BPJ A;  1PK0 D;  1SL7 A;  2BCA A;  2PSR A;  2KNE A;  1GJY A;  1TUZ A;  2PAS A;  1WY9 A;  3EKJ A;  1NPQ A;  3SS4 A;  1AUI B;  2DOQ A;  2KHN A;  1QTX A;  3OHM B;  3TUY C;  5I2Q A;  1A75 A;  1KFX S;  3CLN A;  1G8I A;  4PT1 A;  2E6W A;  1FI6 A;  2G2B A;  2WCM A;  1QVI Y;  1B8R A;  3BUN B;  1BOD A;  1CMF A;  4GNK B;  2FOT A;  3D76 A;  4ETO A;  2ZN9 A;  5G08 A;  4CFQ A;  4U8D A;  3NSL A;  2JWW A;  1NIW A;  4FQO A;  1MQ1 A;  1S26 D;  1W7J B;  2SCP A;  1BR1 B;  3E3R A;  2WND A;  3FS7 A;  3Q8I A;  4ICB A;  1ZUZ A;  3D0Y B;  1H4B A;  5DKQ A;  1QS7 A;  1F4O A;  1DJH A;  4GAO A;  1BT6 A;  1DJI A;  4GPL B;  3GK4 X;  2KBI A;  3DVE A;  1RTP 1;  2BKI B;  3LL8 B;  1NSH A;  1TCO B;  2L51 A;  3CR5 X;  4PE7 A;  2PYQ A;  2P71 A;  1KQM C;  4QJ4 B;  3DVM A;  2K8M B;  2KPH A;  3S0B A;  2Y5I A;  2NXQ A;  4DUQ A;  4PE4 A;  1K9U A;  2TN4 A;  1SCV A;  3CR4 X;  4MEW A;  3NSI A;  3D10 A;  5JJG A;  1RK9 A;  4JKT A;  4MN0 A;  4R1E A;  2L5Y A;  4WQ3 A;  1B47 A;  1PVB A;  1XFZ O;  5KU1 A;  1WRZ A;  3I5G B;  2LM5 A;  1P28 A;  3IQQ A;  5FYX A;  1FF1 A;  1M39 A;  2LP2 A;  4ORB B;  2K60 A;  1SR6 C;  1XVJ A;  1YRU B;  2KI4 C;  2NZ0 A;  5CSN A;  2A4J A;  1PVA A;  2BE4 A;  2NLN A;  3V2L A;  2JTT A;  2CXJ A;  5I94 A;  4PCW A;  4HSZ A;  2F2O A;  2MJW B;  1XK4 A;  1UHN A;  2JC2 A;  3PFV A;  3AKA A;  3OB2 B;  3TZ1 A;  3F45 A;  3I5H C;  2JOJ A;  1SCM C;  2KGR A;  5PAL A;  1YTZ C;  1C3Y A;  3B6X A;  2BBM A;  1F71 A;  2F3Y A;  2COL B;  3O4Y A;  3QRX A;  1KQV A;  3O4X A;  1KSO A;  1YVL A;  1A4P A;  1PUL A;  4USL A;  1CB1 A;  3RZS A;  1HQV A;  2WCK A;  3SIB A;  2FCD A;  1SL9 A;  2G9B A;  2M1U A;  2M29 A;  1ORG A;  2I2R E;  5JOL A;  4YGE B;  1KK8 B;  1LKJ A;  2F8P A;  3OP0 A;  2EC6 B;  4MVF A;  1CFD A;  4CFR A;  1B7T Z;  4MZL A;  3EVU A;  1EG3 A;  1KFX L;  2QPT A;  5AEQ A;  2JPT A;  2MRD A;  2M8U A;  1AP4 A;  1V1F A;  2PRU A;  1Y6W A;  2BL0 B;  3KPX A;  1DF0 A;  1XFR A;  1E8A A;  1R6P A;  2L5X B;  2WCE A;  3D78 A;  3UNW A;  1TNW A;  4PHJ A;  2LE9 B;  4PHN A;  1F4Q A;  2WCF A;  2LC5 A;  3BOW B;  1K93 D;  1G33 A;  5AXI A;  4QJ5 B;  1TTX A;  2M9G A;  1PRW A;  3DXL A;  2WOS A;  1XA5 A;  5FI6 A;  3CZ0 A;  2JT3 A;  3SIA A;  2KI6 D;  1JF2 A;  3O2P A;  3FIA A;  5ER4 X;  2BE6 A;  1NX0 A;  3BUM B;  3FWC A;  2K61 A;  1B4C A;  2H61 A;  1NYA A;  2NCO A;  4OCI A;  1TWO A;  5D7F A;  1ZAC A;  2K7D A;  1ZMZ A;  3OX6 A;  1QX5 B;  3I5G C;  1YX8 A;  1XFX O;  1Y0V H;  1LXF C;  2ZKM X;  3S0D A;  1WLM A;  3DF0 A;  3OBV A;  1QIW A;  3R1P A;  1UHJ A;  2PMY A;  3FWB A;  5AAN A;  5I8N A;  2WC8 A;  3ZWH A;  3I5F B;  1BJF A;  1TCF A;  1TN4 A;  1UHI A;  2AAO A;  2F2P A;  4ZCU A;  3L4L A;  3I5I B;  3ICB A;  3S0A A;  1NX2 A;  1OMD A;  1SYM A;  3CZ1 A;  3PAT A;  1OOJ A;  1A75 B;  1QWV A;  1X02 A;  3D74 A;  1H8B A;  1QLK A;  1JF0 A;  2LVV A;  1CDL A;  1ZOT B;  2L4I A;  3CWG A;  1OQP A;  3EKH A;  3SS3 A;  2IS9 A;  3AAK A;  1W9Z A;  2BAP A;  2Y1N A;  1LVC D;  3HCM A;  2KDH A;  2ISD A;  3SG7 A;  4A4B A;  1KK8 C;  2M7N A;  3CDN A;  3R1O A;  1XFW O;  2EC6 C;  3DYE A;  4QJ3 B;  3OGN A;  5DKR A;  5KTY A;  1J7P A;  1YUU A;  2I18 A;  3SS5 A;  1EJ3 A;  1OMR A;  4FTG A;  3SJS A;  1J1D A;  2ZND A;  1A2X A;  1XFY O;  2LP3 A;  3TS5 B;  4C0K A;  4PDZ A;  2BL0 C;  1PSR A;  2KOT A;  3PM2 A;  1BF5 A;  1BLQ A;  1NWD A;  2JQ6 A;  3IVT A;  2QEV A;  4MRX A;  1GGW A;  4A4C A;  4OR9 B;  3JTD B;  1NX1 A;  4CLN A;  1BMO A;  3DY9 A;  5CSJ A;  2HPS A;  1OOH A;  5FI7 A;  1CLB A;  4YI8 A;  1UHK A;  3VRN A;  1KCY A;  1R2U A;  3BUW B;  4BY4 A;  3NXA A;  5HKW A;  2LVI A;  4MLW A;  1DGV A;  3CZ2 A;  1K2H A;  1B7T Y;  2LHL A;  1CDM A;  1CTR A;  3FE9 A;  4MZK A;  3NGV A;  3B87 A;  2KAV A;  4GGF C;  4L9M A;  3FE6 A;  4YRU A;  1J7Q A;  2Y1M A;  5DIC A;  4PE0 A;  3S0F A;  1U5I A;  1Z4H A;  5DKN A;  2KLD A;  2ZRT A;  2YGU A;  2KI6 C;  3TDU A;  4OVN F;  3L47 A;  1Y1A A;  3I5F C;  2LCP A;  4I5N B;  2K2A A;  1ALV A;  1K90 D;  4UPG A;  1BR4 B;  2K7O A;  1PAL A;  3BUO B;  1A29 A;  1C3Z A;  1DC1 A;  1M31 A;  4F0Z B;  2WOR A;  2JRF A;  1FI5 A;  2QEB A;  1YRT B;  1IH0 A;  2JNX A;  1C7W A;  3D77 A;  3LCP C;  2JZI A;  4YI9 A;  2WCJ A;  1SNL A;  2HQW A;  2KAX A;  3CS1 A;  2JNF A;  1M63 B;  1RRO A;  4NQG A;  4DIR A;  1WLZ A;  1S6C A;  5CSI A;  2WC6 A;  1DF0 B;  3RM1 A;  1ALW A;  5HLV A;  1TNQ A;  3SG3 A;  3UO9 A;  1UUR A;  1F55 A;  1OOI X;  1YUR A;  4FQT A;  3R1V A;  4PHM A;  4P5O E;  1QV0 A;  1IG5 A;  1OZO A;  4HRH A;  1SPY A;  1JSA A;  2LMU A;  4CID A;  1J1E A;  1AHR A;  1IKU A;  1S6I A;  1UUS A;  1VRK A;  2EGD A;  2F3Z A;  5TNC A;  2EHB A;  1TRF A;  1JFK A;  4GFT A;  3JTD C;  3D0Y A;  3IF7 A;  1GQM A;  4DS7 A;  1CNP A;  2KYF A;  3S0E A;  1WDC B;  3SG6 A;  1CKK A;  2CBL A;  1K8U A;  1L2O B;  2OS8 B;  4F7F A;  5KSZ A;  5CSF A;  2FJY A;  3NSK A;  1EG4 A;  1S5G Z;  3M0W A;  3NSO A;  2BNX A;  2GGM A;  5HLO A;  1REC A;  3ZNI A;  4IL1 A;  3CR2 A;  1EXR A;  2GTE A;  3DF0 B;  4Q04 A;  2K7C A;  1SL8 A;  1QVI Z;  1Y1X A;  3VGO A;  2PQL A;  2OTG B;  1QAS A;  5K89 A;  1KFU L;  1EL4 A;  4NDB A;  3LK1 A;  1Q80 A;  1WRK A;  2ZN8 A;  1K96 A;  2JPO A;  3CTN A;  1KSM A;  3LLE A;  4PAL A;  5GQQ C;  3GK1 A;  3EG5 B;  3OX5 A;  1K95 A;  2WC5 A;  2I94 A;  2WCL A;  3AAJ A;  4AQI A;  5FI2 A;  3B86 A;  4M2Q A;  5IBW A;  3L4A A;  1CFC A;  1OMV A;  3CYZ A;  5I2O A;  3TUY B;  2NCP A;  1AJ5 A;  5ER5 A;  3VRO A;  1J7R A;  3S0G A;  1IRJ A;  3KF9 A;  2L0P A;  4ORA B;  4NDC A;  3VRP A;  3SG5 A;  3WXA A;  1DJY A;  4PE1 A;  2M7L A;  3KEV A;  1MUX A;  1M45 A;  4D1E A;  1LS8 A;  1IQ5 A;  1OSA A;  2M97 A;  1QLS A;  2H8V A;  1B9A A;  2L2C A;  2LLS A;  2VRG A;  1JWD A;  1RJV A;  2LAN A;  2M3W A;  4IJ7 A;  1YX7 A;  1B8L A;  4P2Y B;  4ZCV A;  2JU0 A;  3AKB A;  1MXE A;  1JC2 A;  2MLE C;  1K9P A;  1MWN A;  2QAC A;  3LK0 A;  1DGU A;  2I7A A;  2LUX A;  2L50 A;  3B88 A;  4I5K A;  1CLM A;  1CM1 A;  3DVK A;  4MZJ A;  4WRI A;  1DEL A;  2H61 C;  5HYD A;  1KQM B;  1BG1 A;  1UP5 A;  3A8R A;  1F54 A;  4N5X A;  4OV2 A;  2OPO A;  4YGA A;  2GV5 A;  1WDC C;  1L2O C;  4YGB B;  2L2E A;  1DJX A;  1D1O A;  2PVB A;  1CDP A;  4E68 A;  2BCB A;  2O5G A;  3CGA A;  1CM4 A;  2JTZ A;  2LLU A;  1XYD A;  1U5I B;  1YUS A;  1G4Y R;  5D3O A;  2Q4U A;  2FCE A;  4DRW A;  1SR6 B;  2KI4 B;  4M2O A;  3SG4 A;  2KBM A;  3CZT X;  1YR5 A;  1K9K A;  1KK7 Z;  2BCX A;  1S6J A;  4KYN A;  2K7B A;  3K21 A;  2D8N A;  1DJW A;  4GGF A;  1C07 A;  1QV1 A;  4XJK A;  3BYA A;  1LIN A;  1GM0 A;  1LA0 A;  2P70 A;  4DCK A;  1TNP A;  2L4H A;  2QDI A;  3GK2 A;  1WRL A;  3PAL A;  2KSP A;  3EVV A;  1AVS A;  3JVT B;  3WNX B;  1IQ3 A;  1RFJ A;  2KFF A;  1QJT A;  2MHH A;  2ERB A;  4HRE E;  4ORC B;  5I2L A;  1KFU S;  3TDZ A;  2ZFD A;  1NCZ A;  1C7V A;  1Z2C B;  1A03 A;  1OE9 B;  2LVK A;  1AK8 A;  3C1V A;  3O6B A;  3EK4 A;  1S5G Y;  1B8C A;  1GGZ A;  1OOF A;  2JUL A;  4OZD A;  2KLE A;  1CDN A;  2KAY A;  4NDD A;  1DJZ A;  2CTN A;  1NCX A;  1DT7 B;  3GOF A;  2LUC A; 
#chains in the Genus database with same CATH homology
 5B8I B;  4I5L B;  1S36 A;  4I5J A;  2GGZ A;  3I5I C;  1SMG A;  3WHU B;  1IWQ A;  1Y1U A;  4TNC A;  2Y4Q A;  1NCY A;  2KQ6 A;  1AJ4 A;  1N65 A;  1HT9 A;  3BUX B;  1QX2 A;  3EVR A;  1SY9 A;  2RGI A;  1MHO A;  1DMO A;  1N2D A;  2AUC A;  1BU3 A;  4BY5 A;  4MBE A;  3TS5 C;  1M46 A;  3H4S E;  3A4U B;  2L98 A;  1QXP A;  2R2I A;  3SG2 A;  1S3P A;  2KQY A;  1SKT A;  2LMT A;  1IGV A;  2PAL A;  2BBN A;  1F8H A;  2O60 A;  1ZFS A;  1CLL A;  2K2F A;  5HKZ A;  5J3X A;  4MRY A;  1QAT A;  3MSE B;  1MXL C;  1CFP A;  1J55 A;  1JUO A;  2Q91 A;  3RLZ A;  1N0Y A;  1XFU O;  2P6B B;  3VRR A;  4JWQ A;  3PN7 B;  4MSP A;  5F6T A;  2JXL A;  1SBJ A;  3JVT C;  1FPW A;  2KGB C;  4GGN A;  1JBA A;  1LA3 A;  2KFG A;  1DTL A;  4HRG A;  1TIZ A;  3O78 A;  2MA2 A;  3DD4 A;  1ODB A;  1XK4 C;  1V1G A;  1J7O A;  3VRQ A;  1UWO A;  1DVI A;  1KWO B;  2M49 B;  2LAP A;  4N1G A;  3OB1 B;  1TOP A;  2K0J A;  4XYN A;  2M1K B;  4GBA A;  1F70 A;  4YBH B;  2CCM A;  1B1G A;  1KK7 Y;  2HQ8 A;  2M0R A;  2V53 A;  1BOC A;  4WQ2 A;  2ZRS A;  2BKH B;  4AQJ A;  2MLF C;  1TNX A;  1YVH A;  4N1F A;  1MR8 A;  4M2P A;  1FBV A;  3DVJ A;  3BXK A;  2SAS A;  3BQ3 A;  1L7Z A;  2LLT A;  4YGD B;  5AER A;  2ZNE A;  2LNK A;  3IQO A;  2HF5 A;  3KO0 A;  1EH2 A;  1RWY A;  4YGC B;  1NX3 A;  3KHE A;  3EK8 A;  1MF8 B;  4AOM A;  1W7I B;  2AMI A;  2CT9 A;  1CMG A;  4CPV A;  3TDI A;  4PHK A;  2JT8 A;  2MAZ A;  2BEC A;  5CPV A;  5D69 A;  5AFP A;  1DJG A;  2HET A;  1QX7 A;  2WCB A;  4XJK B;  1XO5 A;  3WHT B;  1JFJ A;  2H2K A;  3EK7 A;  2JXC A;  2F33 A;  3BOW A;  3HX4 A;  1NUB A;  1K94 A;  3PLF B;  1YUT A;  1IJ5 A;  2LMV A;  2KFH A;  1SW8 A;  2OS8 C;  2JT0 A;  1PSB A;  3PN7 C;  1QIV A;  2FJU B;  2KYC A;  2CNP A;  4JQ0 D;  1SRA A;  1FW4 A;  1S1E A;  4JPZ B;  5HKY A;  4GUK A;  1XFV O;  1IJ6 A;  2B1U A;  4OKH A;  2E30 A;  2LVJ A;  2OTG C;  1CFF A;  4C0J A;  2MBX A;  1NP8 A;  4C0L A;  1KWO C;  1SK6 D;  3PM8 A;  3PSR A;  1UHH A;  1OZS A;  2LHI A;  2LV7 A;  1SCM B;  3I5H B;  5BPJ A;  1PK0 D;  1SL7 A;  2BCA A;  2PSR A;  2KNE A;  1GJY A;  2PAS A;  1WY9 A;  3EKJ A;  1NPQ A;  1AUI B;  2DOQ A;  2KHN A;  1QTX A;  3OHM B;  3TUY C;  5I2Q A;  1A75 A;  1KFX S;  3CLN A;  1G8I A;  2E6W A;  1FI6 A;  2G2B A;  1QVI Y;  1B8R A;  3BUN B;  1BOD A;  1CMF A;  4GNK B;  2FOT A;  4ETO A;  2ZN9 A;  5G08 A;  4CFQ A;  4U8D A;  3NSL A;  2JWW A;  1NIW A;  4FQO A;  1MQ1 A;  1S26 D;  1W7J B;  2SCP A;  1BR1 B;  3E3R A;  2WND A;  3FS7 A;  4ICB A;  1ZUZ A;  3D0Y B;  1H4B A;  5DKQ A;  1QS7 A;  1F4O A;  1DJH A;  4GAO A;  1BT6 A;  1DJI A;  4GPL B;  3GK4 X;  2KBI A;  3DVE A;  1RTP 1;  2BKI B;  3LL8 B;  1NSH A;  1TCO B;  2L51 A;  3CR5 X;  4PE7 A;  1KQM C;  4QJ4 B;  3DVM A;  2K8M B;  2Y5I A;  2NXQ A;  4DUQ A;  4PE4 A;  1K9U A;  2TN4 A;  1SCV A;  3CR4 X;  4MEW A;  3NSI A;  3D10 A;  5JJG A;  1RK9 A;  4MN0 A;  4R1E A;  4WQ3 A;  1B47 A;  1PVB A;  1XFZ O;  5KU1 A;  1WRZ A;  3I5G B;  2LM5 A;  3IQQ A;  5FYX A;  1FF1 A;  1M39 A;  2LP2 A;  4ORB B;  1SR6 C;  1XVJ A;  1YRU B;  2KI4 C;  2NZ0 A;  5CSN A;  2A4J A;  1PVA A;  2BE4 A;  2NLN A;  2JTT A;  2CXJ A;  4PCW A;  4HSZ A;  2F2O A;  2MJW B;  1XK4 A;  1UHN A;  2JC2 A;  3PFV A;  3AKA A;  3OB2 B;  3TZ1 A;  3F45 A;  3I5H C;  2JOJ A;  1SCM C;  2KGR A;  5PAL A;  1YTZ C;  1F71 A;  2BBM A;  2F3Y A;  2COL B;  3O4Y A;  3QRX A;  1KQV A;  1KSO A;  1YVL A;  1A4P A;  1PUL A;  4USL A;  1CB1 A;  1HQV A;  3SIB A;  2FCD A;  1SL9 A;  2G9B A;  2M1U A;  2M29 A;  5JOL A;  2I2R E;  4YGE B;  1KK8 B;  1LKJ A;  2F8P A;  3OP0 A;  2EC6 B;  4MVF A;  1CFD A;  4CFR A;  1B7T Z;  4MZL A;  3EVU A;  1EG3 A;  1KFX L;  2QPT A;  5AEQ A;  2JPT A;  2MRD A;  2M8U A;  1AP4 A;  1V1F A;  2PRU A;  1Y6W A;  2BL0 B;  3KPX A;  1DF0 A;  1E8A A;  1R6P A;  2L5X B;  2WCE A;  1TNW A;  4PHJ A;  2LE9 B;  4PHN A;  1F4Q A;  2WCF A;  2LC5 A;  3BOW B;  1K93 D;  1G33 A;  5AXI A;  4QJ5 B;  1TTX A;  2M9G A;  1PRW A;  2WOS A;  1XA5 A;  2JT3 A;  3SIA A;  2KI6 D;  1JF2 A;  3O2P A;  3FIA A;  5ER4 X;  2BE6 A;  1NX0 A;  3BUM B;  3FWC A;  2K61 A;  1B4C A;  2H61 A;  1NYA A;  2NCO A;  4OCI A;  5D7F A;  1ZAC A;  2K7D A;  1ZMZ A;  3OX6 A;  1QX5 B;  3I5G C;  1YX8 A;  1XFX O;  1Y0V H;  1LXF C;  2ZKM X;  1WLM A;  3DF0 A;  1QIW A;  1UHJ A;  2PMY A;  3FWB A;  5AAN A;  5I8N A;  2WC8 A;  3ZWH A;  3I5F B;  1BJF A;  1TCF A;  1TN4 A;  1UHI A;  2AAO A;  2F2P A;  4ZCU A;  3I5I B;  3ICB A;  1NX2 A;  1OMD A;  1SYM A;  3PAT A;  1OOJ A;  1A75 B;  1X02 A;  1H8B A;  1QLK A;  1JF0 A;  2LVV A;  1CDL A;  1ZOT B;  2L4I A;  3CWG A;  1OQP A;  3EKH A;  2IS9 A;  3AAK A;  2Y1N A;  3HCM A;  2ISD A;  1LVC D;  3SG7 A;  2KDH A;  4A4B A;  1KK8 C;  2M7N A;  5KTY A;  5DKR A;  1XFW O;  2EC6 C;  4QJ3 B;  1J7P A;  1YUU A;  2I18 A;  1EJ3 A;  1OMR A;  4FTG A;  3SJS A;  1J1D A;  2ZND A;  1A2X A;  1XFY O;  2LP3 A;  3TS5 B;  4C0K A;  4PDZ A;  2BL0 C;  1PSR A;  2KOT A;  1BF5 A;  1BLQ A;  1NWD A;  2JQ6 A;  4MRX A;  1GGW A;  4A4C A;  4OR9 B;  3JTD B;  1NX1 A;  4CLN A;  1BMO A;  5CSJ A;  2HPS A;  1CLB A;  4YI8 A;  1UHK A;  3VRN A;  1KCY A;  1R2U A;  3BUW B;  4BY4 A;  3NXA A;  5HKW A;  2LVI A;  4MLW A;  1DGV A;  1K2H A;  1B7T Y;  2LHL A;  1CDM A;  1CTR A;  4MZK A;  4L9M A;  2KAV A;  4GGF C;  1J7Q A;  4YRU A;  2Y1M A;  4PE0 A;  1U5I A;  5DKN A;  2ZRT A;  2KI6 C;  3TDU A;  4OVN F;  1Y1A A;  3I5F C;  2LCP A;  4I5N B;  2K2A A;  1ALV A;  1K90 D;  4UPG A;  1BR4 B;  2K7O A;  1PAL A;  3BUO B;  1A29 A;  1M31 A;  4F0Z B;  2WOR A;  2JRF A;  1FI5 A;  1YRT B;  1IH0 A;  2JNX A;  1C7W A;  3LCP C;  4YI9 A;  2JZI A;  1SNL A;  2HQW A;  2KAX A;  3CS1 A;  2JNF A;  1M63 B;  1RRO A;  4NQG A;  4DIR A;  1WLZ A;  1S6C A;  5CSI A;  3RM1 A;  1DF0 B;  3SG3 A;  1ALW A;  5HLV A;  1TNQ A;  1F55 A;  1UUR A;  1YUR A;  4PHM A;  4P5O E;  1QV0 A;  1IG5 A;  1OZO A;  4HRH A;  1SPY A;  1JSA A;  2LMU A;  4CID A;  1J1E A;  1AHR A;  1IKU A;  1S6I A;  1UUS A;  1VRK A;  2EGD A;  2F3Z A;  5TNC A;  2EHB A;  1TRF A;  1JFK A;  4GFT A;  3JTD C;  3D0Y A;  3IF7 A;  1GQM A;  4DS7 A;  1CNP A;  2KYF A;  1WDC B;  3SG6 A;  1CKK A;  2CBL A;  1K8U A;  1L2O B;  2OS8 B;  5KSZ A;  5CSF A;  3NSK A;  1EG4 A;  1S5G Z;  3M0W A;  3NSO A;  3ZNI A;  2GGM A;  5HLO A;  1REC A;  4IL1 A;  3CR2 A;  1EXR A;  3DF0 B;  4Q04 A;  2K7C A;  1SL8 A;  1QVI Z;  1Y1X A;  3VGO A;  2OTG B;  1QAS A;  5K89 A;  1KFU L;  1EL4 A;  4NDB A;  3LK1 A;  1Q80 A;  1WRK A;  2ZN8 A;  1K96 A;  3CTN A;  1KSM A;  3LLE A;  4PAL A;  5GQQ C;  3GK1 A;  3OX5 A;  1K95 A;  2I94 A;  3AAJ A;  4AQI A;  4M2Q A;  5IBW A;  1CFC A;  1OMV A;  5I2O A;  3TUY B;  2NCP A;  1AJ5 A;  5ER5 A;  3VRO A;  1J7R A;  1IRJ A;  3KF9 A;  2L0P A;  4ORA B;  4NDC A;  3VRP A;  3SG5 A;  3WXA A;  1DJY A;  4PE1 A;  2M7L A;  3KEV A;  1MUX A;  1M45 A;  4D1E A;  1OSA A;  1IQ5 A;  2M97 A;  1QLS A;  1B9A A;  2LLS A;  1JWD A;  2VRG A;  1RJV A;  2LAN A;  2M3W A;  1YX7 A;  1B8L A;  4P2Y B;  4ZCV A;  2JU0 A;  3AKB A;  1MXE A;  1JC2 A;  2MLE C;  1K9P A;  1MWN A;  2QAC A;  3LK0 A;  1DGU A;  2I7A A;  2LUX A;  2L50 A;  4I5K A;  1CLM A;  1CM1 A;  3DVK A;  4MZJ A;  4WRI A;  2H61 C;  5HYD A;  1KQM B;  1BG1 A;  1UP5 A;  3A8R A;  1F54 A;  4N5X A;  4OV2 A;  2OPO A;  4YGA A;  2GV5 A;  1WDC C;  1L2O C;  4YGB B;  2L2E A;  1DJX A;  1D1O A;  2PVB A;  1CDP A;  4E68 A;  2BCB A;  2O5G A;  3CGA A;  1CM4 A;  2JTZ A;  2LLU A;  1XYD A;  1U5I B;  1YUS A;  1G4Y R;  2Q4U A;  2FCE A;  4DRW A;  1SR6 B;  2KI4 B;  4M2O A;  3SG4 A;  2KBM A;  3CZT X;  1YR5 A;  1K9K A;  1KK7 Z;  2BCX A;  1S6J A;  2K7B A;  3K21 A;  2D8N A;  1DJW A;  4GGF A;  1C07 A;  1QV1 A;  4XJK A;  3BYA A;  1LIN A;  1LA0 A;  4DCK A;  1TNP A;  2L4H A;  3PAL A;  3GK2 A;  1WRL A;  3WNX B;  2KSP A;  3EVV A;  1AVS A;  3JVT B;  1IQ3 A;  1RFJ A;  2KFF A;  1QJT A;  2MHH A;  4HRE E;  4ORC B;  5I2L A;  1KFU S;  3TDZ A;  2ZFD A;  1NCZ A;  1C7V A;  1A03 A;  1OE9 B;  2LVK A;  1AK8 A;  3C1V A;  3O6B A;  3EK4 A;  1S5G Y;  1B8C A;  1GGZ A;  2JUL A;  1CDN A;  2KAY A;  4NDD A;  1DJZ A;  2CTN A;  1NCX A;  1DT7 B;  3GOF A;  2LUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...