1RROA

Refinement of recombinant oncomodulin at 1.30 angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAT ONCOMODULIN
publication title Refinement of recombinant oncomodulin at 1.30 A resolution.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1992-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rroA00
1YR5A 2BE4A 1DJIA 3KF9A 1GGZA 2JRFA 1DJZA 4XYNA 2K0JA 3NSOA 4N1GA 1UHIA 2JPTA 4MZJA 2L2EA 1CFPA 1AHRA 2LLSA 4QJ4B 1EJ3A 2MLEC 1KFUL 1YURA 3PM8A 2EC6C 1OMRA 2LMVA 1CFDA 3BYAA 1SR6C 5D69A 4PE4A 4I5JA 1KWOB 2HQ8A 3SG6A 4BY4A 1U5IB 3I5IB 1LA0A 1MQ1A 3VGOA 1CKKA 2JU0A 4HREE 2JXLA 1F8HA 2CXJA 2LUXA 4YBHB 1TOPA 4NDCA 4PE0A 4ETOA 4YRUA 1NX3A 3DVEA 1DMOA 1E8AA 3JTDC 4CLNA 5I2OA 2F3YA 4DCKA 3ICBA 4NQGA 3VROA 5HYDA 2NCPA 4YGAA 2MA2A 3EVRA 2BECA 1PSBA 1S6IA 2VRGA 3DF0A 3O6BA 4YGDB 1W7IB 1AUIB 1Q80A 2IS9A 2KSPA 5I2QA 3EKHA 2R2IA 3ZNIA 2KBMA 2KNEA 2V53A 2LP2A 1IQ3A 2ZFDA 3VRRA 2P6BB 4C0KA 1XFWO 4DRWA 3EVVA 2QACA 1J55A 1NSHA 4N1FA 2KHNA 2WCEA 3KPXA 1UHHA 1H8BA 1XFYO 2KGRA 2NZ0A 1KQMB 3CR5X 3FS7A 1QXPA 2BKIB 5HLOA 4AQJA 1DGUA 1U5IA 3SJSA 3IQOA 1RROA 5CSJA 2BCAA 3DD4A 1MUXA 2G9BA 5KSZA 3PALA 4YI8A 2LHLA 3EKJA 2KQ6A 1QX7A 1QIWA 2WC8A 2ZNEA 4NDBA 3OP0A 3SG3A 1L2OC 4OR9B 3RM1A 2FOTA 2FJUB 2JTTA 1CDNA 4HSZA 2DOQA 3TDIA 1B9AA 1HQVA 4QJ5B 1EL4A 4PHJA 2JNFA 2EC6B 3DVJA 1IQ5A 3OB2B 1OE9B 1SR6B 1ODBA 2BBNA 2LVKA 1WY9A 2MHHA 3I5IC 3O2PA 1NP8A 1YUTA 1QIVA 2I94A 1PALA 4MEWA 1NYAA 5CSNA 2K61A 3GK1A 1DJXA 2JNXA 2WCBA 1J7PA 1QATA 3JTDB 2K2FA 1A75B 4E68A 1HT9A 1KFUS 2F2PA 1NX0A 1ZMZA 1XYDA 1CTRA 2ZN9A 5G08A 5ER5A 2KAVA 1SCVA 1JF0A 1PRWA 1WDCB 4CPVA 2ZRTA 1BG1A 1AK8A 1S5GZ 1NCZA 1EG3A 1TCFA 3NSIA 2PALA 3WHTB 4JWQA 2Y1MA 4CIDA 4P5OE 1EH2A 3BUMB 3DVKA 1S3PA 4XJKB 2HF5A 2KYCA 2LCPA 1LKJA 4ORCB 2I7AA 4TNCA 3WNXB 1BLQA 4BY5A 3VRNA 4MSPA 1IJ5A 3TZ1A 2COLB 1OMDA 1SRAA 1ZOTB 1SL7A 1UHKA 3CR4X 2AAOA 2M0RA 1K93D 5ER4X 1XVJA 2M7LA 5CPVA 3A4UB 2LVJA 5I2LA 2MAZA 2G2BA 1TN4A 1GJYA 1Y1AA 1XFVO 3D0YB 1L7ZA 3IQQA 1L2OB 2LLTA 5HKZA 1A75A 2CBLA 4WQ3A 2QPTA 1OZSA 5B8IB 1B7TZ 1IKUA 2KYFA 1RK9A 2JTZA 1DJYA 2LE9B 2KOTA 4YGCB 1JWDA 3CGAA 2KBIA 2WCFA 2BCXA 2A4JA 2F33A 2LC5A 3CS1A 4GBAA 3BUWB 1UHJA 4DIRA 1C07A 5AANA 4M2PA 1JFJA 2M97A 4XJKA 1Y6WA 2LHIA 1XFUO 1MXEA 2SASA 4ICBA 1RECA 2BCBA 2KQYA 2L0PA 4WRIA 5J3XA 1XO5A 1F55A 1RJVA 4L9MA 1S26D 1SCMC 1CMFA 4FTGA 4MRYA 2NXQA 1MR8A 2JT0A 3D10A 5IBWA 1KQVA 2I18A 3AAKA 3KO0A 1SW8A 1M46A 2RGIA 1DF0B 3AKBA 1K90D 2JC2A 1TNPA 3D0YA 4I5LB 4MN0A 1WDCC 2JXCA 1JFKA 1YUSA 5D7FA 3PFVA 5AXIA 1TTXA 2H61A 1TNQA 1S36A 1GGWA 1CM1A 1QS7A 1YTZC 2KFHA 2Q4UA 3F45A 3O4YA 1CMGA 2LV7A 1LA3A 2M8UA 1BODA 1A4PA 2MBXA 3SG7A 1YRTB 2HETA 3TDUA 4PALA 1FBVA 2B1UA 1S6JA 1V1GA 2JQ6A 3K21A 3SIAA 1D1OA 1Y0VH 5JJGA 1NUBA 1CDMA 1C7WA 2L51A 3I5GC 3I5HC 1PK0D 1NCXA 3IF7A 1G8IA 1QTXA 3EK7A 3PSRA 1DT7B 1KK7Y 4ZCVA 1J1EA 1BOCA 5TNCA 1A2XA 5HLVA 3EK4A 1G33A 1YRUB 4YI9A 1F4QA 4FQOA 1NX1A 1B8CA 1KSMA 4QJ3B 1MXLC 2E6WA 2H61C 1JBAA 1DF0A 1BMOA 1S6CA 1QX5B 1A03A 1K2HA 1NPQA 2TN4A 1XK4A 4U8DA 4GGFC 1CLBA 1NCYA 1SK6D 1DTLA 1WLZA 2E30A 4OV2A 1SKTA 2LMUA 4JQ0D 1OMVA 2K7CA 3PN7C 5DKQA 3CR2A 3SIBA 1PVAA 1QLKA 1K95A 4CFRA 1K94A 1NWDA 1W7JB 2OTGC 3A8RA 4A4BA 4UPGA 1IG5A 3NSKA 4F0ZB 3LLEA 1SCMB 1JF2A 2F8PA 3EVUA 1VRKA 3BQ3A 1B47A 2K7BA 1F70A 1EXRA 1JSAA 2ZNDA 1QV0A 1TNWA 1K9UA 1FPWA 1X02A 1QV1A 4MZKA 5BPJA 1XK4C 1SMGA 1CLMA 3RLZA 3H4SE 1YVLA 1CB1A 1ALVA 5JOLA 2PVBA 1F71A 1YX7A 2KAXA 4JPZB 3CTNA 2L4IA 1BT6A 3BUNB 2GV5A 2LNKA 3NSLA 4OKHA 2Y5IA 2M49B 1J1DA 1JC2A 4GGNA 1MHOA 1OQPA 1QASA 1J7OA 1SPYA 2LMTA 2ZRSA 1YX8A 4WQ2A 4NDDA 1DJWA 3BUOB 5KU1A 1DVIA 3EK8A 1F4OA 1UP5A 1IJ6A 1IRJA 3I5GB 5K89A 3I5HB 3PATA 4DS7A 3SG4A 2KDHA 3CLNA 3ZWHA 3BOWB 4OVNF 4MBEA 3AKAA 1TNXA 1TRFA 2OS8C 1Y1UA 2I2RE 1LXFC 2LVIA 4N5XA 5GQQC 3PLFB 2M29A 1KCYA 3HCMA 1CFFA 4PE1A 2WORA 3SG2A 1FF1A 1CDLA 1M63B 1OSAA 1BR1B 4M2OA 3LL8B 2PRUA 4PCWA 5DKNA 4Q04A 2WNDA 1J7QA 2M1UA 4R1EA 4C0LA 2JT8A 3CWGA 2HQWA 3PN7B 2D8NA 3OB1B 1F54A 1SYMA 1Y1XA 3KEVA 1K96A 2AUCA 1KK8C 2OTGB 2HPSA 2K8MB 3BXKA 1DGVA 1UURA 2EHBA 1CDPA 1AJ5A 2GGZA 3VRPA 4A4CA 2LAPA 1SL8A 5FYXA 1B1GA 2KI6C 2CT9A 1CLLA 1NIWA 2BBMA 2ZN8A 2JWWA 2GGMA 2O60A 3MSEB 1BR4B 4IL1A 4PHNA 3BOWA 2Y1NA 1ALWA 2K7OA 2KAYA 2LANA 3JVTC 1QVIZ 1TCOB 4GAOA 1R2UA 1PVBA 3LK0A 1M31A 2L50A 2M3WA 1AVSA 2M1KB 4DUQA 2BL0C 1IWQA 3SG5A 1K9PA 2Y4QA 4ZCUA 1R6PA 1AJ4A 2CNPA 1JUOA 4GGFA 2WOSA 1KFXL 5CSIA 2OPOA 4ORBB 2BKHB 3AAJA 1K9KA 3M0WA 3FIAA 1SY9A 1FI6A 5HKWA 3QRXA 1NX2A 1QJTA 5AERA 2FCEA 2SCPA 2NCOA 4USLA 1WRZA 1M45A 3VRQA 2CCMA 1IH0A 2AMIA 5KTYA 2OS8B 3C1VA 4M2QA 3TDZA 1PSRA 1CFCA 1SNLA 3BUXB 1J7RA 1WLMA 4PHMA 1RFJA 2LM5A 2CTNA 2KGBC 5AEQA 3FWCA 1LINA 3HX4A 2F2OA 4GPLB 4I5KA 1S5GY 1BU3A 2JOJA 1GQMA 2O5GA 1YUUA 3LCPC 3OHMB 1A29A 1QX2A 2KI4C 3I5FC 2ISDA 1S1EA 2MLFC 3TS5C 2NLNA 4GUKA 1QLSA 4MLWA 1CNPA 1ZFSA 4ORAB 4OCIA 1ZUZA 2EGDA 4YGBB 1WRKA 5HKYA 1H4BA 3TUYC 1YVHA 1KK8B 1AP4A 2JT3A 4D1EA 4PDZA 1DJGA 2PMYA 1IGVA 2ZKMX 1MF8B 1LVCD 2LUCA 1KSOA 1SL9A 5I8NA 2MJWB 1DJHA 2L98A 3KHEA 2L5XB 1K8UA 1MWNA 2KI6D 3OX6A 2PASA 3JVTB 1ZACA 1C7VA 4GFTA 1CM4A 2LVVA 4I5NB 2LLUA 2MRDA 4MVFA 1B7TY 1KWOC 1N65A 4HRHA 3GOFA 5AFPA 2KFGA 3NXAA 3WXAA 2BL0B 3GK2A 1B4CA 1OOJA 2K2AA 3GK4X 2JULA 5F6TA 4C0JA 1XFZO 4AOMA 4PE7A 3LK1A 4MZLA 1KK7Z 2H2KA 4P2YB 1G4YR 1V1FA 2L4HA 1SBJA 1BJFA 4PHKA 1UHNA 1XA5A 4YGEB 4CFQA 3E3RA 2JZIA 2F3ZA 4MRXA 1UUSA 2M7NA 1WRLA 3FWBA 5PALA 2FCDA 2M9GA 4HRGA 2Q91A 1FW4A 1QVIY 1KFXS 1PULA 4AQIA 1N2DA 2BE6A 1RTP1 1XFXO 3O78A 3WHUB 1B8LA 1UWOA 5CSFA 2KFFA 5DKRA 3OX5A 2KI4B 3DVMA 3I5FB 1TIZA 1KQMC 3TS5B 1RWYA 3CZTX 2K7DA 1EG4A 2LP3A 1BF5A 1N0YA 1OZOA 4GNKB 3TUYB 2PSRA 3DF0B 1M39A 1B8RA 1FI5A
chains in the Genus database with same CATH superfamily
1YR5A 3D76A 2BE4A 1DJIA 3KF9A 1GGZA 2JRFA 3D75A 1DJZA 4XYNA 2K0JA 3NSOA 3R1VA 4N1GA 1UHIA 2JPTA 3QMEA 4MZJA 2L2EA 3SS4A 1CFPA 1AHRA 2LLSA 4QJ4B 1EJ3A 2MLEC 1KFUL 1YURA 4F7FA 3PM8A 2EC6C 1OMRA 2LMVA 1CFDA 3BYAA 1SR6C 1ORGA 5D69A 4PE4A 4I5JA 1KWOB 2HQ8A 3SG6A 4BY4A 1U5IB 3CZ1A 3I5IB 1LA0A 1MQ1A 3VGOA 1CKKA 2JU0A 4HREE 2JXLA 3PJIA 1F8HA 2CXJA 2LUXA 3NHIA 4YBHB 1TOPA 4NDCA 4PE0A 2PQLA 4ETOA 2KPHA 4YRUA 1NX3A 3DVEA 1DMOA 1E8AA 3JTDC 4CLNA 5I2OA 2F3YA 4DCKA 3ICBA 4NQGA 3VROA 5HYDA 2NCPA 4YGAA 2MA2A 3EVRA 2BECA 1PSBA 1S6IA 2VRGA 3DF0A 3O6BA 4YGDB 4JKTA 1W7IB 1AUIB 1Q80A 2IS9A 2KSPA 5I2QA 3EKHA 2WCKA 2R2IA 3B6XA 3ZNIA 2KBMA 1SSEB 2KNEA 2LP2A 2V53A 2L2CA 3RZSA 1IQ3A 2ZFDA 3VRRA 2P6BB 4C0KA 1XFWO 4DRWA 3EVVA 1TUJA 2QACA 1J55A 1NSHA 2K60A 4N1FA 2KHNA 2WCEA 3KPXA 1UHHA 1H8BA 1XFYO 1P28A 2KGRA 3R1OA 2NZ0A 1KQMB 3CR5X 3FS7A 1QXPA 2BKIB 5HLOA 4AQJA 1DGUA 1U5IA 3SJSA 3IQOA 1RROA 5CSJA 2BCAA 2WC5A 1MUXA 3DD4A 2G9BA 5KSZA 3D78A 3PALA 4YI8A 1IIOA 2LHLA 2KLDA 3EKJA 3D77A 2KQ6A 1QX7A 1QIWA 2WC8A 2ZNEA 4NDBA 3OP0A 3SG3A 3FE8A 1L2OC 4OR9B 3RM1A 2FOTA 2FJUB 2JTTA 1CDNA 4HSZA 1OOFA 2DOQA 3TDIA 1B9AA 1HQVA 4QJ5B 1EL4A 4PHJA 2JNFA 2EC6B 3DVJA 1IQ5A 3OB2B 1OE9B 1SR6B 1ODBA 2BBNA 2LVKA 1WY9A 2PYQA 2MHHA 3I5IC 3O2PA 3FE6A 1NP8A 1YUTA 1QIVA 4INXA 2I94A 1PALA 4MEWA 1NYAA 5CSNA 2K61A 3GK1A 5D3OA 1DJXA 5I94A 2JNXA 2WCBA 1J7PA 1QATA 3JTDB 2K2FA 1A75B 4E68A 1HT9A 1KFUS 2F2PA 3NGVA 4FQTA 3UO9A 1NX0A 1ZMZA 1XYDA 1CTRA 2KLEA 2ZN9A 5G08A 5ER5A 2KAVA 1SCVA 1JF0A 3FE9A 1PRWA 1WDCB 4CPVA 2ZRTA 1BG1A 1AK8A 1S5GZ 1NCZA 1EG3A 1TCFA 3O4XA 3NSIA 2PALA 5DICA 4JWQA 2Y1MA 3WHTB 1OW4A 4CIDA 4P5OE 1EH2A 3BUMB 3DVKA 1S3PA 4XJKB 2HF5A 2KYCA 2LCPA 2QEBA 1LKJA 4ORCB 2I7AA 4TNCA 3WNXB 1BLQA 4BY5A 3VRNA 4MSPA 1IJ5A 3TZ1A 2COLB 1OMDA 1SRAA 1ZOTB 1SL7A 1UHKA 3CR4X 2AAOA 2M0RA 5HL1A 1K93D 3CABA 1XVJA 5ER4X 2M7LA 5CPVA 3A4UB 2LVJA 5I2LA 2MAZA 4PT1A 2G2BA 1TN4A 1GJYA 1Y1AA 1XFVO 3D0YB 1L7ZA 3IQQA 1L2OB 2LLTA 3BFHA 5HKZA 1A75A 3S0BA 2CBLA 4WQ3A 2QPTA 1OZSA 5B8IB 3B86A 1B7TZ 1IKUA 2KYFA 2QDIA 1RK9A 2JTZA 1DJYA 2LE9B 2KOTA 3B88A 4YGCB 1JWDA 3CGAA 4JD9A 2KBIA 2WCFA 2BCXA 2A4JA 2F33A 2BNXA 1DQEA 2LC5A 3CS1A 4GBAA 3BUWB 1UHJA 4DIRA 1C07A 5EL2A 5AANA 4M2PA 1JFJA 2M97A 4XJKA 1DEKA 1Y6WA 2LHIA 1XFUO 1MXEA 2SASA 4ICBA 1RECA 2BCBA 2KQYA 2L0PA 4WRIA 5FI2A 1XO5A 5J3XA 3S0EA 1F55A 1RJVA 4L9MA 1S26D 1SCMC 1CMFA 4FTGA 4MRYA 2NXQA 1MR8A 2JT0A 3D10A 5IBWA 1KQVA 2I18A 3AAKA 3KO0A 3DZTA 1SW8A 1M46A 2RGIA 1DF0B 2WC6A 3AKBA 1K90D 2JC2A 1OOIX 1TNPA 3D0YA 4I5LB 1T14A 1WDCC 4MN0A 2JXCA 1JFKA 1YUSA 5D7FA 3PFVA 5AXIA 1TTXA 2H61A 1TNQA 3S0AA 1S36A 1GGWA 1CM1A 1QS7A 1YTZC 2KFHA 2Q4UA 3F45A 3O4YA 1CMGA 2LV7A 1LA3A 1QWVA 2M8UA 1BODA 1A4PA 2MBXA 3SG7A 1YRTB 2HETA 3TDUA 4PALA 2JPOA 1FBVA 2B1UA 1S6JA 1V1GA 2JQ6A 3D73A 3K21A 2WCLA 3SIAA 1D1OA 1Y0VH 1DELA 5JJGA 1NUBA 1CDMA 1C7WA 2L51A 3I5GC 3I5HC 1PK0D 1NCXA 3IF7A 1G8IA 1QTXA 3EK7A 3PSRA 3BFAA 1DT7B 1KK7Y 2QEHA 4ZCVA 1J1EA 1BOCA 5TNCA 1A2XA 5HLVA 3EK4A 1G33A 1YRUB 4YI9A 1F4QA 4FQOA 1NX1A 1B8CA 1KSMA 4QJ3B 1MXLC 2E6WA 2H61C 1JBAA 1DF0A 1BMOA 1S6CA 1QX5B 1A03A 3DXLA 1K2HA 1NPQA 2TN4A 1XK4A 4U8DA 4GGFC 1CLBA 1NCYA 2FJYA 1SK6D 1DTLA 4OZDA 1WLZA 3DY9A 2E30A 4OV2A 1SKTA 2LMUA 4JQ0D 1OMVA 2K7CA 3PN7C 5FI6A 5DKQA 3CR2A 3SIBA 1PVAA 1QLKA 1K95A 3NHTA 4CFRA 1K94A 1NWDA 1W7JB 2OTGC 3A8RA 4A4BA 4UPGA 3VB1A 1IG5A 3NSKA 4F0ZB 3LLEA 1SCMB 1JF2A 2F8PA 3EVUA 1VRKA 3BQ3A 1B47A 2K7BA 1F70A 1EXRA 1JSAA 2ZNDA 1QV0A 1TNWA 1K9UA 1FPWA 1X02A 1QV1A 4MZKA 5BPJA 1XK4C 1SMGA 1CLMA 3RLZA 3B7AA 3H4SE 1YVLA 3IVTA 1ALVA 3K1EA 5JOLA 1CB1A 2PVBA 1OOGA 3R72A 1F71A 1YX7A 2KAXA 4JPZB 3CTNA 2L4IA 1BT6A 3BUNB 2GV5A 2LNKA 3NSLA 4OKHA 2Y5IA 2M49B 1J1DA 2P71A 1JC2A 4GGNA 1MHOA 1OQPA 1QASA 1J7OA 1SPYA 2LMTA 2ZRSA 1YX8A 4WQ2A 4NDDA 1DJWA 3BUOB 5KU1A 4INWA 1DVIA 3EK8A 1F4OA 1UP5A 1IJ6A 1W9ZA 1IRJA 3I5GB 5K89A 3I5HB 3PATA 4DS7A 3SG4A 2KDHA 3CLNA 3ZWHA 3BOWB 4OVNF 4MBEA 3AKAA 3L4LA 3L47A 1TNXA 1TRFA 2OS8C 1Y1UA 2I2RE 1LXFC 3S0FA 2LVIA 4N5XA 5GQQC 3PLFB 3CDNA 2M29A 1KCYA 3HCMA 1CFFA 4PE1A 2WORA 3SG2A 1FF1A 1CDLA 1M63B 1OSAA 1BR1B 4M2OA 3LL8B 2PRUA 2H8VA 4PCWA 5DKNA 4Q04A 2WNDA 1J7QA 1C3YA 2M1UA 4R1EA 4C0LA 2YGUA 2JT8A 3CWGA 2HQWA 3PN7B 2D8NA 4IJ7A 3OB1B 1F54A 1SYMA 1Y1XA 3KEVA 1K96A 2AUCA 3BFBA 1KK8C 2OTGB 2HPSA 2K8MB 3BXKA 1DGVA 1UURA 2EHBA 1CDPA 1AJ5A 2GGZA 2WCMA 3BJHA 3VRPA 4A4CA 2LAPA 1SL8A 5FYXA 1B1GA 2KI6C 2CT9A 1CLLA 1NIWA 2BBMA 2ZN8A 2JWWA 2GGMA 2O60A 2WCJA 1BR4B 3MSEB 3OGNA 4IL1A 4PHNA 3BOWA 2Y1NA 1ALWA 2K7OA 2KAYA 2LANA 3S0GA 3JVTC 1QVIZ 1TCOB 2P70A 3N7HA 4GAOA 1R2UA 1PVBA 3LK0A 1M31A 2L50A 2M3WA 1LS8A 1AVSA 1Z2CB 2M1KB 4DUQA 2BL0C 1IWQA 3SG5A 3D74A 1K9PA 2Y4QA 4ZCUA 1R6PA 1AJ4A 1JUOA 2CNPA 4GGFA 2WOSA 1KFXL 5CSIA 2OPOA 4ORBB 1Z4HA 2BKHB 3AAJA 1K9KA 3M0WA 3FIAA 1SY9A 1FI6A 5HKWA 3QRXA 1NX2A 1QJTA 5AERA 2FCEA 2SCPA 2NCOA 1TWOA 4USLA 1WRZA 1M45A 3V2LA 3VRQA 2CCMA 1IH0A 2AMIA 5KTYA 2OS8B 3C1VA 4M2QA 3TDZA 1PSRA 1CFCA 1SNLA 3BUXB 3SS5A 1J7RA 1WLMA 4PHMA 1RFJA 2LM5A 2QEOA 2CTNA 2KGBC 5AEQA 3FWCA 1LINA 3HX4A 2F2OA 4GPLB 4I5KA 1S5GY 3SS3A 1BU3A 2JOJA 1GQMA 2O5GA 1YUUA 3LCPC 3OHMB 1A29A 1QX2A 2KI4C 3I5FC 2ISDA 1S1EA 2MLFC 3TS5C 2NLNA 4GUKA 1QLSA 4MLWA 1CNPA 1ZFSA 4ORAB 4OCIA 1ZUZA 2EGDA 3CZ0A 4YGBB 1WRKA 1XFRA 5HKYA 1H4BA 3TUYC 1YVHA 1KK8B 1AP4A 2JT3A 4D1EA 4PDZA 1DJGA 2PMYA 1IGVA 2WCHA 2ZKMX 1MF8B 3B87A 2ERBA 1LVCD 2LUCA 1KSOA 1SL9A 5I8NA 1OOHA 2MJWB 1DJHA 2L98A 3KHEA 1GM0A 2L5XB 1K8UA 1MWNA 2KI6D 3OX6A 2PASA 3JVTB 1C3ZA 1ZACA 1C7VA 2QEVA 4GFTA 1CM4A 2LVVA 4I5NB 2LLUA 2MRDA 4MVFA 1B7TY 1KWOC 1N65A 3CZ2A 4HRHA 3GOFA 5AFPA 2KFGA 3NXAA 4KYNA 3WXAA 3PM2A 2BL0B 3GK2A 1DC1A 1B4CA 1OOJA 1TUZA 2K2AA 3GK4X 2JULA 5F6TA 4C0JA 1XFZO 4AOMA 4PE7A 3LK1A 4MZLA 1KK7Z 2H2KA 4P2YB 2GTEA 1G4YR 1V1FA 2L4HA 1SBJA 5FI7A 1BJFA 3R1PA 4PHKA 1UHNA 1XA5A 4YGEB 3DYEA 3Q8IA 4CFQA 3UNWA 3E3RA 2JZIA 2F3ZA 4MRXA 1UUSA 2M7NA 1WRLA 3FWBA 5PALA 2FCDA 2M9GA 3EG5B 4HRGA 3S0DA 3OBVA 2Q91A 1FW4A 1QVIY 1KFXS 1PULA 4AQIA 1N2DA 2BE6A 1RTP1 1XFXO 3O78A 3WHUB 1B8LA 1UWOA 5CSFA 2KFFA 5DKRA 2BAPA 3OX5A 2KI4B 3DVMA 3I5FB 1TIZA 1KQMC 3TS5B 1RWYA 3CZTX 2K7DA 2L5YA 3CYZA 1EG4A 2LP3A 3L4AA 1N0YA 1OZOA 4GNKB 1BF5A 3TUYB 2PSRA 3DF0B 1M39A 1B8RA 1FI5A
chains in the Genus database with same CATH topology
1YR5A 2BE4A 1DJIA 3KF9A 1GGZA 2JRFA 1DJZA 4XYNA 2K0JA 3NSOA 4N1GA 1UHIA 2JPTA 4MZJA 2L2EA 1CFPA 1AHRA 2LLSA 4QJ4B 1EJ3A 2MLEC 1KFUL 1YURA 3PM8A 2EC6C 1OMRA 2LMVA 1CFDA 3BYAA 1SR6C 5D69A 4PE4A 4I5JA 1KWOB 2HQ8A 3SG6A 4BY4A 1U5IB 3I5IB 1LA0A 1MQ1A 3VGOA 1CKKA 2JU0A 4HREE 2JXLA 1F8HA 2CXJA 2LUXA 4YBHB 1TOPA 4NDCA 4PE0A 4ETOA 4YRUA 1NX3A 3DVEA 1DMOA 1E8AA 3JTDC 4CLNA 5I2OA 2F3YA 4DCKA 3ICBA 4NQGA 3VROA 5HYDA 2NCPA 4YGAA 2MA2A 3EVRA 2BECA 1PSBA 1S6IA 2VRGA 3DF0A 3O6BA 4YGDB 1W7IB 1AUIB 1Q80A 2IS9A 2KSPA 5I2QA 3EKHA 2R2IA 3ZNIA 2KBMA 2KNEA 2V53A 2LP2A 1IQ3A 2ZFDA 3VRRA 2P6BB 4C0KA 1XFWO 4DRWA 3EVVA 2QACA 1J55A 1NSHA 4N1FA 2KHNA 2WCEA 3KPXA 1UHHA 1H8BA 1XFYO 2KGRA 2NZ0A 1KQMB 3CR5X 3FS7A 1QXPA 2BKIB 5HLOA 4AQJA 1DGUA 1U5IA 3SJSA 3IQOA 1RROA 5CSJA 2BCAA 3DD4A 1MUXA 2G9BA 5KSZA 3PALA 4YI8A 2LHLA 3EKJA 2KQ6A 1QX7A 1QIWA 2WC8A 2ZNEA 4NDBA 3OP0A 3SG3A 1L2OC 4OR9B 3RM1A 2FOTA 2FJUB 2JTTA 1CDNA 4HSZA 2DOQA 3TDIA 1B9AA 1HQVA 4QJ5B 1EL4A 4PHJA 2JNFA 2EC6B 3DVJA 1IQ5A 3OB2B 1OE9B 1SR6B 1ODBA 2BBNA 2LVKA 1WY9A 2MHHA 3I5IC 3O2PA 1NP8A 1YUTA 1QIVA 2I94A 1PALA 4MEWA 1NYAA 5CSNA 2K61A 3GK1A 1DJXA 2JNXA 2WCBA 1J7PA 1QATA 3JTDB 2K2FA 1A75B 4E68A 1HT9A 1KFUS 2F2PA 1NX0A 1ZMZA 1XYDA 1CTRA 2ZN9A 5G08A 5ER5A 2KAVA 1SCVA 1JF0A 1PRWA 1WDCB 4CPVA 2ZRTA 1BG1A 1AK8A 1S5GZ 1NCZA 1EG3A 1TCFA 3NSIA 2PALA 3WHTB 4JWQA 2Y1MA 4CIDA 4P5OE 1EH2A 3BUMB 3DVKA 1S3PA 4XJKB 2HF5A 2KYCA 2LCPA 1LKJA 4ORCB 2I7AA 4TNCA 3WNXB 1BLQA 4BY5A 3VRNA 4MSPA 1IJ5A 3TZ1A 2COLB 1OMDA 1SRAA 1ZOTB 1SL7A 1UHKA 3CR4X 2AAOA 2M0RA 1K93D 5ER4X 1XVJA 2M7LA 5CPVA 3A4UB 2LVJA 5I2LA 2MAZA 2G2BA 1TN4A 1GJYA 1Y1AA 1XFVO 3D0YB 1L7ZA 3IQQA 1L2OB 2LLTA 5HKZA 1A75A 2CBLA 4WQ3A 2QPTA 1OZSA 5B8IB 1B7TZ 1IKUA 2KYFA 1RK9A 2JTZA 1DJYA 2LE9B 2KOTA 4YGCB 1JWDA 3CGAA 2KBIA 2WCFA 2BCXA 2A4JA 2F33A 2LC5A 3CS1A 4GBAA 3BUWB 1UHJA 4DIRA 1C07A 5AANA 4M2PA 1JFJA 2M97A 4XJKA 1Y6WA 2LHIA 1XFUO 1MXEA 2SASA 4ICBA 1RECA 2BCBA 2KQYA 2L0PA 4WRIA 5J3XA 1XO5A 1F55A 1RJVA 4L9MA 1S26D 1SCMC 1CMFA 4FTGA 4MRYA 2NXQA 1MR8A 2JT0A 3D10A 5IBWA 1KQVA 2I18A 3AAKA 3KO0A 1SW8A 1M46A 2RGIA 1DF0B 3AKBA 1K90D 2JC2A 1TNPA 3D0YA 4I5LB 4MN0A 1WDCC 2JXCA 1JFKA 1YUSA 5D7FA 3PFVA 5AXIA 1TTXA 2H61A 1TNQA 1S36A 1GGWA 1CM1A 1QS7A 1YTZC 2KFHA 2Q4UA 3F45A 3O4YA 1CMGA 2LV7A 1LA3A 2M8UA 1BODA 1A4PA 2MBXA 3SG7A 1YRTB 2HETA 3TDUA 4PALA 1FBVA 2B1UA 1S6JA 1V1GA 2JQ6A 3K21A 3SIAA 1D1OA 1Y0VH 5JJGA 1NUBA 1CDMA 1C7WA 2L51A 3I5GC 3I5HC 1PK0D 1NCXA 3IF7A 1G8IA 1QTXA 3EK7A 3PSRA 1DT7B 1KK7Y 4ZCVA 1J1EA 1BOCA 5TNCA 1A2XA 5HLVA 3EK4A 1G33A 1YRUB 4YI9A 1F4QA 4FQOA 1NX1A 1B8CA 1KSMA 4QJ3B 1MXLC 2E6WA 2H61C 1JBAA 1DF0A 1BMOA 1S6CA 1QX5B 1A03A 1K2HA 1NPQA 2TN4A 1XK4A 4U8DA 4GGFC 1CLBA 1NCYA 1SK6D 1DTLA 1WLZA 2E30A 4OV2A 1SKTA 2LMUA 4JQ0D 1OMVA 2K7CA 3PN7C 5DKQA 3CR2A 3SIBA 1PVAA 1QLKA 1K95A 4CFRA 1K94A 1NWDA 1W7JB 2OTGC 3A8RA 4A4BA 4UPGA 1IG5A 3NSKA 4F0ZB 3LLEA 1SCMB 1JF2A 2F8PA 3EVUA 1VRKA 3BQ3A 1B47A 2K7BA 1F70A 1EXRA 1JSAA 2ZNDA 1QV0A 1TNWA 1K9UA 1FPWA 1X02A 1QV1A 4MZKA 5BPJA 1XK4C 1SMGA 1CLMA 3RLZA 3H4SE 1YVLA 1CB1A 1ALVA 5JOLA 2PVBA 1F71A 1YX7A 2KAXA 4JPZB 3CTNA 2L4IA 1BT6A 3BUNB 2GV5A 2LNKA 3NSLA 4OKHA 2Y5IA 2M49B 1J1DA 1JC2A 4GGNA 1MHOA 1OQPA 1QASA 1J7OA 1SPYA 2LMTA 2ZRSA 1YX8A 4WQ2A 4NDDA 1DJWA 3BUOB 5KU1A 1DVIA 3EK8A 1F4OA 1UP5A 1IJ6A 1IRJA 3I5GB 5K89A 3I5HB 3PATA 4DS7A 3SG4A 2KDHA 3CLNA 3ZWHA 3BOWB 4OVNF 4MBEA 3AKAA 1TNXA 1TRFA 2OS8C 1Y1UA 2I2RE 1LXFC 2LVIA 4N5XA 5GQQC 3PLFB 2M29A 1KCYA 3HCMA 1CFFA 4PE1A 2WORA 3SG2A 1FF1A 1CDLA 1M63B 1OSAA 1BR1B 4M2OA 3LL8B 2PRUA 4PCWA 5DKNA 4Q04A 2WNDA 1J7QA 2M1UA 4R1EA 4C0LA 2JT8A 3CWGA 2HQWA 3PN7B 2D8NA 3OB1B 1F54A 1SYMA 1Y1XA 3KEVA 1K96A 2AUCA 1KK8C 2OTGB 2HPSA 2K8MB 3BXKA 1DGVA 1UURA 2EHBA 1CDPA 1AJ5A 2GGZA 3VRPA 4A4CA 2LAPA 1SL8A 5FYXA 1B1GA 2KI6C 2CT9A 1CLLA 1NIWA 2BBMA 2ZN8A 2JWWA 2GGMA 2O60A 3MSEB 1BR4B 4IL1A 4PHNA 3BOWA 2Y1NA 1ALWA 2K7OA 2KAYA 2LANA 3JVTC 1QVIZ 1TCOB 4GAOA 1R2UA 1PVBA 3LK0A 1M31A 2L50A 2M3WA 1AVSA 2M1KB 4DUQA 2BL0C 1IWQA 3SG5A 1K9PA 2Y4QA 4ZCUA 1R6PA 1AJ4A 2CNPA 1JUOA 4GGFA 2WOSA 1KFXL 5CSIA 2OPOA 4ORBB 2BKHB 3AAJA 1K9KA 3M0WA 3FIAA 1SY9A 1FI6A 5HKWA 3QRXA 1NX2A 1QJTA 5AERA 2FCEA 2SCPA 2NCOA 4USLA 1WRZA 1M45A 3VRQA 2CCMA 1IH0A 2AMIA 5KTYA 2OS8B 3C1VA 4M2QA 3TDZA 1PSRA 1CFCA 1SNLA 3BUXB 1J7RA 1WLMA 4PHMA 1RFJA 2LM5A 2CTNA 2KGBC 5AEQA 3FWCA 1LINA 3HX4A 2F2OA 4GPLB 4I5KA 1S5GY 1BU3A 2JOJA 1GQMA 2O5GA 1YUUA 3LCPC 3OHMB 1A29A 1QX2A 2KI4C 3I5FC 2ISDA 1S1EA 2MLFC 3TS5C 2NLNA 4GUKA 1QLSA 4MLWA 1CNPA 1ZFSA 4ORAB 4OCIA 1ZUZA 2EGDA 4YGBB 1WRKA 5HKYA 1H4BA 3TUYC 1YVHA 1KK8B 1AP4A 2JT3A 4D1EA 4PDZA 1DJGA 2PMYA 1IGVA 2ZKMX 1MF8B 1LVCD 2LUCA 1KSOA 1SL9A 5I8NA 2MJWB 1DJHA 2L98A 3KHEA 2L5XB 1K8UA 1MWNA 2KI6D 3OX6A 2PASA 3JVTB 1ZACA 1C7VA 4GFTA 1CM4A 2LVVA 4I5NB 2LLUA 2MRDA 4MVFA 1B7TY 1KWOC 1N65A 4HRHA 3GOFA 5AFPA 2KFGA 3NXAA 3WXAA 2BL0B 3GK2A 1B4CA 1OOJA 2K2AA 3GK4X 2JULA 5F6TA 4C0JA 1XFZO 4AOMA 4PE7A 3LK1A 4MZLA 1KK7Z 2H2KA 4P2YB 1G4YR 1V1FA 2L4HA 1SBJA 1BJFA 4PHKA 1UHNA 1XA5A 4YGEB 4CFQA 3E3RA 2JZIA 2F3ZA 4MRXA 1UUSA 2M7NA 1WRLA 3FWBA 5PALA 2FCDA 2M9GA 4HRGA 2Q91A 1FW4A 1QVIY 1KFXS 1PULA 4AQIA 1N2DA 2BE6A 1RTP1 1XFXO 3O78A 3WHUB 1B8LA 1UWOA 5CSFA 2KFFA 5DKRA 3OX5A 2KI4B 3DVMA 3I5FB 1TIZA 1KQMC 3TS5B 1RWYA 3CZTX 2K7DA 1EG4A 2LP3A 1BF5A 1N0YA 1OZOA 4GNKB 3TUYB 2PSRA 3DF0B 1M39A 1B8RA 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  2BE4 A;  1DJI A;  3KF9 A;  1GGZ A;  2JRF A;  1DJZ A;  4XYN A;  2K0J A;  3NSO A;  4N1G A;  1UHI A;  2JPT A;  4MZJ A;  2L2E A;  1CFP A;  1AHR A;  2LLS A;  4QJ4 B;  1EJ3 A;  2MLE C;  1KFU L;  1YUR A;  3PM8 A;  2EC6 C;  1OMR A;  2LMV A;  1CFD A;  3BYA A;  1SR6 C;  5D69 A;  4PE4 A;  4I5J A;  1KWO B;  2HQ8 A;  3SG6 A;  4BY4 A;  1U5I B;  3I5I B;  1LA0 A;  1MQ1 A;  3VGO A;  1CKK A;  2JU0 A;  4HRE E;  2JXL A;  1F8H A;  2CXJ A;  2LUX A;  4YBH B;  1TOP A;  4NDC A;  4PE0 A;  4ETO A;  4YRU A;  1NX3 A;  3DVE A;  1DMO A;  1E8A A;  3JTD C;  4CLN A;  5I2O A;  2F3Y A;  4DCK A;  3ICB A;  4NQG A;  3VRO A;  5HYD A;  2NCP A;  4YGA A;  2MA2 A;  3EVR A;  2BEC A;  1PSB A;  1S6I A;  2VRG A;  3DF0 A;  3O6B A;  4YGD B;  1W7I B;  1AUI B;  1Q80 A;  2IS9 A;  2KSP A;  5I2Q A;  3EKH A;  2R2I A;  3ZNI A;  2KBM A;  2KNE A;  2V53 A;  2LP2 A;  1IQ3 A;  2ZFD A;  3VRR A;  2P6B B;  4C0K A;  1XFW O;  4DRW A;  3EVV A;  2QAC A;  1J55 A;  1NSH A;  4N1F A;  2KHN A;  2WCE A;  3KPX A;  1UHH A;  1H8B A;  1XFY O;  2KGR A;  2NZ0 A;  1KQM B;  3CR5 X;  3FS7 A;  1QXP A;  2BKI B;  5HLO A;  4AQJ A;  1DGU A;  1U5I A;  3SJS A;  3IQO A;  1RRO A;  5CSJ A;  2BCA A;  3DD4 A;  1MUX A;  2G9B A;  5KSZ A;  3PAL A;  4YI8 A;  2LHL A;  3EKJ A;  2KQ6 A;  1QX7 A;  1QIW A;  2WC8 A;  2ZNE A;  4NDB A;  3OP0 A;  3SG3 A;  1L2O C;  4OR9 B;  3RM1 A;  2FOT A;  2FJU B;  2JTT A;  1CDN A;  4HSZ A;  2DOQ A;  3TDI A;  1B9A A;  1HQV A;  4QJ5 B;  1EL4 A;  4PHJ A;  2JNF A;  2EC6 B;  3DVJ A;  1IQ5 A;  3OB2 B;  1OE9 B;  1SR6 B;  1ODB A;  2BBN A;  2LVK A;  1WY9 A;  2MHH A;  3I5I C;  3O2P A;  1NP8 A;  1YUT A;  1QIV A;  2I94 A;  1PAL A;  4MEW A;  1NYA A;  5CSN A;  2K61 A;  3GK1 A;  1DJX A;  2JNX A;  2WCB A;  1J7P A;  1QAT A;  3JTD B;  2K2F A;  1A75 B;  4E68 A;  1HT9 A;  1KFU S;  2F2P A;  1NX0 A;  1ZMZ A;  1XYD A;  1CTR A;  2ZN9 A;  5G08 A;  5ER5 A;  2KAV A;  1SCV A;  1JF0 A;  1PRW A;  1WDC B;  4CPV A;  2ZRT A;  1BG1 A;  1AK8 A;  1S5G Z;  1NCZ A;  1EG3 A;  1TCF A;  3NSI A;  2PAL A;  3WHT B;  4JWQ A;  2Y1M A;  4CID A;  4P5O E;  1EH2 A;  3BUM B;  3DVK A;  1S3P A;  4XJK B;  2HF5 A;  2KYC A;  2LCP A;  1LKJ A;  4ORC B;  2I7A A;  4TNC A;  3WNX B;  1BLQ A;  4BY5 A;  3VRN A;  4MSP A;  1IJ5 A;  3TZ1 A;  2COL B;  1OMD A;  1SRA A;  1ZOT B;  1SL7 A;  1UHK A;  3CR4 X;  2AAO A;  2M0R A;  1K93 D;  5ER4 X;  1XVJ A;  2M7L A;  5CPV A;  3A4U B;  2LVJ A;  5I2L A;  2MAZ A;  2G2B A;  1TN4 A;  1GJY A;  1Y1A A;  1XFV O;  3D0Y B;  1L7Z A;  3IQQ A;  1L2O B;  2LLT A;  5HKZ A;  1A75 A;  2CBL A;  4WQ3 A;  2QPT A;  1OZS A;  5B8I B;  1B7T Z;  1IKU A;  2KYF A;  1RK9 A;  2JTZ A;  1DJY A;  2LE9 B;  2KOT A;  4YGC B;  1JWD A;  3CGA A;  2KBI A;  2WCF A;  2BCX A;  2A4J A;  2F33 A;  2LC5 A;  3CS1 A;  4GBA A;  3BUW B;  1UHJ A;  4DIR A;  1C07 A;  5AAN A;  4M2P A;  1JFJ A;  2M97 A;  4XJK A;  1Y6W A;  2LHI A;  1XFU O;  1MXE A;  2SAS A;  4ICB A;  1REC A;  2BCB A;  2KQY A;  2L0P A;  4WRI A;  5J3X A;  1XO5 A;  1F55 A;  1RJV A;  4L9M A;  1S26 D;  1SCM C;  1CMF A;  4FTG A;  4MRY A;  2NXQ A;  1MR8 A;  2JT0 A;  3D10 A;  5IBW A;  1KQV A;  2I18 A;  3AAK A;  3KO0 A;  1SW8 A;  1M46 A;  2RGI A;  1DF0 B;  3AKB A;  1K90 D;  2JC2 A;  1TNP A;  3D0Y A;  4I5L B;  4MN0 A;  1WDC C;  2JXC A;  1JFK A;  1YUS A;  5D7F A;  3PFV A;  5AXI A;  1TTX A;  2H61 A;  1TNQ A;  1S36 A;  1GGW A;  1CM1 A;  1QS7 A;  1YTZ C;  2KFH A;  2Q4U A;  3F45 A;  3O4Y A;  1CMG A;  2LV7 A;  1LA3 A;  2M8U A;  1BOD A;  1A4P A;  2MBX A;  3SG7 A;  1YRT B;  2HET A;  3TDU A;  4PAL A;  1FBV A;  2B1U A;  1S6J A;  1V1G A;  2JQ6 A;  3K21 A;  3SIA A;  1D1O A;  1Y0V H;  5JJG A;  1NUB A;  1CDM A;  1C7W A;  2L51 A;  3I5G C;  3I5H C;  1PK0 D;  1NCX A;  3IF7 A;  1G8I A;  1QTX A;  3EK7 A;  3PSR A;  1DT7 B;  1KK7 Y;  4ZCV A;  1J1E A;  1BOC A;  5TNC A;  1A2X A;  5HLV A;  3EK4 A;  1G33 A;  1YRU B;  4YI9 A;  1F4Q A;  4FQO A;  1NX1 A;  1B8C A;  1KSM A;  4QJ3 B;  1MXL C;  2E6W A;  2H61 C;  1JBA A;  1DF0 A;  1BMO A;  1S6C A;  1QX5 B;  1A03 A;  1K2H A;  1NPQ A;  2TN4 A;  1XK4 A;  4U8D A;  4GGF C;  1CLB A;  1NCY A;  1SK6 D;  1DTL A;  1WLZ A;  2E30 A;  4OV2 A;  1SKT A;  2LMU A;  4JQ0 D;  1OMV A;  2K7C A;  3PN7 C;  5DKQ A;  3CR2 A;  3SIB A;  1PVA A;  1QLK A;  1K95 A;  4CFR A;  1K94 A;  1NWD A;  1W7J B;  2OTG C;  3A8R A;  4A4B A;  4UPG A;  1IG5 A;  3NSK A;  4F0Z B;  3LLE A;  1SCM B;  1JF2 A;  2F8P A;  3EVU A;  1VRK A;  3BQ3 A;  1B47 A;  2K7B A;  1F70 A;  1EXR A;  1JSA A;  2ZND A;  1QV0 A;  1TNW A;  1K9U A;  1FPW A;  1X02 A;  1QV1 A;  4MZK A;  5BPJ A;  1XK4 C;  1SMG A;  1CLM A;  3RLZ A;  3H4S E;  1YVL A;  1CB1 A;  1ALV A;  5JOL A;  2PVB A;  1F71 A;  1YX7 A;  2KAX A;  4JPZ B;  3CTN A;  2L4I A;  1BT6 A;  3BUN B;  2GV5 A;  2LNK A;  3NSL A;  4OKH A;  2Y5I A;  2M49 B;  1J1D A;  1JC2 A;  4GGN A;  1MHO A;  1OQP A;  1QAS A;  1J7O A;  1SPY A;  2LMT A;  2ZRS A;  1YX8 A;  4WQ2 A;  4NDD A;  1DJW A;  3BUO B;  5KU1 A;  1DVI A;  3EK8 A;  1F4O A;  1UP5 A;  1IJ6 A;  1IRJ A;  3I5G B;  5K89 A;  3I5H B;  3PAT A;  4DS7 A;  3SG4 A;  2KDH A;  3CLN A;  3ZWH A;  3BOW B;  4OVN F;  4MBE A;  3AKA A;  1TNX A;  1TRF A;  2OS8 C;  1Y1U A;  2I2R E;  1LXF C;  2LVI A;  4N5X A;  5GQQ C;  3PLF B;  2M29 A;  1KCY A;  3HCM A;  1CFF A;  4PE1 A;  2WOR A;  3SG2 A;  1FF1 A;  1CDL A;  1M63 B;  1OSA A;  1BR1 B;  4M2O A;  3LL8 B;  2PRU A;  4PCW A;  5DKN A;  4Q04 A;  2WND A;  1J7Q A;  2M1U A;  4R1E A;  4C0L A;  2JT8 A;  3CWG A;  2HQW A;  3PN7 B;  2D8N A;  3OB1 B;  1F54 A;  1SYM A;  1Y1X A;  3KEV A;  1K96 A;  2AUC A;  1KK8 C;  2OTG B;  2HPS A;  2K8M B;  3BXK A;  1DGV A;  1UUR A;  2EHB A;  1CDP A;  1AJ5 A;  2GGZ A;  3VRP A;  4A4C A;  2LAP A;  1SL8 A;  5FYX A;  1B1G A;  2KI6 C;  2CT9 A;  1CLL A;  1NIW A;  2BBM A;  2ZN8 A;  2JWW A;  2GGM A;  2O60 A;  3MSE B;  1BR4 B;  4IL1 A;  4PHN A;  3BOW A;  2Y1N A;  1ALW A;  2K7O A;  2KAY A;  2LAN A;  3JVT C;  1QVI Z;  1TCO B;  4GAO A;  1R2U A;  1PVB A;  3LK0 A;  1M31 A;  2L50 A;  2M3W A;  1AVS A;  2M1K B;  4DUQ A;  2BL0 C;  1IWQ A;  3SG5 A;  1K9P A;  2Y4Q A;  4ZCU A;  1R6P A;  1AJ4 A;  2CNP A;  1JUO A;  4GGF A;  2WOS A;  1KFX L;  5CSI A;  2OPO A;  4ORB B;  2BKH B;  3AAJ A;  1K9K A;  3M0W A;  3FIA A;  1SY9 A;  1FI6 A;  5HKW A;  3QRX A;  1NX2 A;  1QJT A;  5AER A;  2FCE A;  2SCP A;  2NCO A;  4USL A;  1WRZ A;  1M45 A;  3VRQ A;  2CCM A;  1IH0 A;  2AMI A;  5KTY A;  2OS8 B;  3C1V A;  4M2Q A;  3TDZ A;  1PSR A;  1CFC A;  1SNL A;  3BUX B;  1J7R A;  1WLM A;  4PHM A;  1RFJ A;  2LM5 A;  2CTN A;  2KGB C;  5AEQ A;  3FWC A;  1LIN A;  3HX4 A;  2F2O A;  4GPL B;  4I5K A;  1S5G Y;  1BU3 A;  2JOJ A;  1GQM A;  2O5G A;  1YUU A;  3LCP C;  3OHM B;  1A29 A;  1QX2 A;  2KI4 C;  3I5F C;  2ISD A;  1S1E A;  2MLF C;  3TS5 C;  2NLN A;  4GUK A;  1QLS A;  4MLW A;  1CNP A;  1ZFS A;  4ORA B;  4OCI A;  1ZUZ A;  2EGD A;  4YGB B;  1WRK A;  5HKY A;  1H4B A;  3TUY C;  1YVH A;  1KK8 B;  1AP4 A;  2JT3 A;  4D1E A;  4PDZ A;  1DJG A;  2PMY A;  1IGV A;  2ZKM X;  1MF8 B;  1LVC D;  2LUC A;  1KSO A;  1SL9 A;  5I8N A;  2MJW B;  1DJH A;  2L98 A;  3KHE A;  2L5X B;  1K8U A;  1MWN A;  2KI6 D;  3OX6 A;  2PAS A;  3JVT B;  1ZAC A;  1C7V A;  4GFT A;  1CM4 A;  2LVV A;  4I5N B;  2LLU A;  2MRD A;  4MVF A;  1B7T Y;  1KWO C;  1N65 A;  4HRH A;  3GOF A;  5AFP A;  2KFG A;  3NXA A;  3WXA A;  2BL0 B;  3GK2 A;  1B4C A;  1OOJ A;  2K2A A;  3GK4 X;  2JUL A;  5F6T A;  4C0J A;  1XFZ O;  4AOM A;  4PE7 A;  3LK1 A;  4MZL A;  1KK7 Z;  2H2K A;  4P2Y B;  1G4Y R;  1V1F A;  2L4H A;  1SBJ A;  1BJF A;  4PHK A;  1UHN A;  1XA5 A;  4YGE B;  4CFQ A;  3E3R A;  2JZI A;  2F3Z A;  4MRX A;  1UUS A;  2M7N A;  1WRL A;  3FWB A;  5PAL A;  2FCD A;  2M9G A;  4HRG A;  2Q91 A;  1FW4 A;  1QVI Y;  1KFX S;  1PUL A;  4AQI A;  1N2D A;  2BE6 A;  1RTP 1;  1XFX O;  3O78 A;  3WHU B;  1B8L A;  1UWO A;  5CSF A;  2KFF A;  5DKR A;  3OX5 A;  2KI4 B;  3DVM A;  3I5F B;  1TIZ A;  1KQM C;  3TS5 B;  1RWY A;  3CZT X;  2K7D A;  1EG4 A;  2LP3 A;  1BF5 A;  1N0Y A;  1OZO A;  4GNK B;  3TUY B;  2PSR A;  3DF0 B;  1M39 A;  1B8R A;  1FI5 A; 
#chains in the Genus database with same CATH topology
 1YR5 A;  3D76 A;  2BE4 A;  1DJI A;  3KF9 A;  1GGZ A;  2JRF A;  3D75 A;  1DJZ A;  4XYN A;  2K0J A;  3NSO A;  3R1V A;  4N1G A;  1UHI A;  2JPT A;  3QME A;  4MZJ A;  2L2E A;  3SS4 A;  1CFP A;  1AHR A;  2LLS A;  4QJ4 B;  1EJ3 A;  2MLE C;  1KFU L;  1YUR A;  4F7F A;  3PM8 A;  2EC6 C;  1OMR A;  2LMV A;  1CFD A;  3BYA A;  1SR6 C;  1ORG A;  5D69 A;  4PE4 A;  4I5J A;  1KWO B;  2HQ8 A;  3SG6 A;  4BY4 A;  1U5I B;  3CZ1 A;  3I5I B;  1LA0 A;  1MQ1 A;  3VGO A;  1CKK A;  2JU0 A;  4HRE E;  2JXL A;  3PJI A;  1F8H A;  2CXJ A;  2LUX A;  3NHI A;  4YBH B;  1TOP A;  4NDC A;  4PE0 A;  2PQL A;  4ETO A;  2KPH A;  4YRU A;  1NX3 A;  3DVE A;  1DMO A;  1E8A A;  3JTD C;  4CLN A;  5I2O A;  2F3Y A;  4DCK A;  3ICB A;  4NQG A;  3VRO A;  5HYD A;  2NCP A;  4YGA A;  2MA2 A;  3EVR A;  2BEC A;  1PSB A;  1S6I A;  2VRG A;  3DF0 A;  3O6B A;  4YGD B;  4JKT A;  1W7I B;  1AUI B;  1Q80 A;  2IS9 A;  2KSP A;  5I2Q A;  3EKH A;  2WCK A;  2R2I A;  3B6X A;  3ZNI A;  2KBM A;  1SSE B;  2KNE A;  2LP2 A;  2V53 A;  2L2C A;  3RZS A;  1IQ3 A;  2ZFD A;  3VRR A;  2P6B B;  4C0K A;  1XFW O;  4DRW A;  3EVV A;  1TUJ A;  2QAC A;  1J55 A;  1NSH A;  2K60 A;  4N1F A;  2KHN A;  2WCE A;  3KPX A;  1UHH A;  1H8B A;  1XFY O;  1P28 A;  2KGR A;  3R1O A;  2NZ0 A;  1KQM B;  3CR5 X;  3FS7 A;  1QXP A;  2BKI B;  5HLO A;  4AQJ A;  1DGU A;  1U5I A;  3SJS A;  3IQO A;  1RRO A;  5CSJ A;  2BCA A;  2WC5 A;  1MUX A;  3DD4 A;  2G9B A;  5KSZ A;  3D78 A;  3PAL A;  4YI8 A;  1IIO A;  2LHL A;  2KLD A;  3EKJ A;  3D77 A;  2KQ6 A;  1QX7 A;  1QIW A;  2WC8 A;  2ZNE A;  4NDB A;  3OP0 A;  3SG3 A;  3FE8 A;  1L2O C;  4OR9 B;  3RM1 A;  2FOT A;  2FJU B;  2JTT A;  1CDN A;  4HSZ A;  1OOF A;  2DOQ A;  3TDI A;  1B9A A;  1HQV A;  4QJ5 B;  1EL4 A;  4PHJ A;  2JNF A;  2EC6 B;  3DVJ A;  1IQ5 A;  3OB2 B;  1OE9 B;  1SR6 B;  1ODB A;  2BBN A;  2LVK A;  1WY9 A;  2PYQ A;  2MHH A;  3I5I C;  3O2P A;  3FE6 A;  1NP8 A;  1YUT A;  1QIV A;  4INX A;  2I94 A;  1PAL A;  4MEW A;  1NYA A;  5CSN A;  2K61 A;  3GK1 A;  5D3O A;  1DJX A;  5I94 A;  2JNX A;  2WCB A;  1J7P A;  1QAT A;  3JTD B;  2K2F A;  1A75 B;  4E68 A;  1HT9 A;  1KFU S;  2F2P A;  3NGV A;  4FQT A;  3UO9 A;  1NX0 A;  1ZMZ A;  1XYD A;  1CTR A;  2KLE A;  2ZN9 A;  5G08 A;  5ER5 A;  2KAV A;  1SCV A;  1JF0 A;  3FE9 A;  1PRW A;  1WDC B;  4CPV A;  2ZRT A;  1BG1 A;  1AK8 A;  1S5G Z;  1NCZ A;  1EG3 A;  1TCF A;  3O4X A;  3NSI A;  2PAL A;  5DIC A;  4JWQ A;  2Y1M A;  3WHT B;  1OW4 A;  4CID A;  4P5O E;  1EH2 A;  3BUM B;  3DVK A;  1S3P A;  4XJK B;  2HF5 A;  2KYC A;  2LCP A;  2QEB A;  1LKJ A;  4ORC B;  2I7A A;  4TNC A;  3WNX B;  1BLQ A;  4BY5 A;  3VRN A;  4MSP A;  1IJ5 A;  3TZ1 A;  2COL B;  1OMD A;  1SRA A;  1ZOT B;  1SL7 A;  1UHK A;  3CR4 X;  2AAO A;  2M0R A;  5HL1 A;  1K93 D;  3CAB A;  1XVJ A;  5ER4 X;  2M7L A;  5CPV A;  3A4U B;  2LVJ A;  5I2L A;  2MAZ A;  4PT1 A;  2G2B A;  1TN4 A;  1GJY A;  1Y1A A;  1XFV O;  3D0Y B;  1L7Z A;  3IQQ A;  1L2O B;  2LLT A;  3BFH A;  5HKZ A;  1A75 A;  3S0B A;  2CBL A;  4WQ3 A;  2QPT A;  1OZS A;  5B8I B;  3B86 A;  1B7T Z;  1IKU A;  2KYF A;  2QDI A;  1RK9 A;  2JTZ A;  1DJY A;  2LE9 B;  2KOT A;  3B88 A;  4YGC B;  1JWD A;  3CGA A;  4JD9 A;  2KBI A;  2WCF A;  2BCX A;  2A4J A;  2F33 A;  2BNX A;  1DQE A;  2LC5 A;  3CS1 A;  4GBA A;  3BUW B;  1UHJ A;  4DIR A;  1C07 A;  5EL2 A;  5AAN A;  4M2P A;  1JFJ A;  2M97 A;  4XJK A;  1DEK A;  1Y6W A;  2LHI A;  1XFU O;  1MXE A;  2SAS A;  4ICB A;  1REC A;  2BCB A;  2KQY A;  2L0P A;  4WRI A;  5FI2 A;  1XO5 A;  5J3X A;  3S0E A;  1F55 A;  1RJV A;  4L9M A;  1S26 D;  1SCM C;  1CMF A;  4FTG A;  4MRY A;  2NXQ A;  1MR8 A;  2JT0 A;  3D10 A;  5IBW A;  1KQV A;  2I18 A;  3AAK A;  3KO0 A;  3DZT A;  1SW8 A;  1M46 A;  2RGI A;  1DF0 B;  2WC6 A;  3AKB A;  1K90 D;  2JC2 A;  1OOI X;  1TNP A;  3D0Y A;  4I5L B;  1T14 A;  1WDC C;  4MN0 A;  2JXC A;  1JFK A;  1YUS A;  5D7F A;  3PFV A;  5AXI A;  1TTX A;  2H61 A;  1TNQ A;  3S0A A;  1S36 A;  1GGW A;  1CM1 A;  1QS7 A;  1YTZ C;  2KFH A;  2Q4U A;  3F45 A;  3O4Y A;  1CMG A;  2LV7 A;  1LA3 A;  1QWV A;  2M8U A;  1BOD A;  1A4P A;  2MBX A;  3SG7 A;  1YRT B;  2HET A;  3TDU A;  4PAL A;  2JPO A;  1FBV A;  2B1U A;  1S6J A;  1V1G A;  2JQ6 A;  3D73 A;  3K21 A;  2WCL A;  3SIA A;  1D1O A;  1Y0V H;  1DEL A;  5JJG A;  1NUB A;  1CDM A;  1C7W A;  2L51 A;  3I5G C;  3I5H C;  1PK0 D;  1NCX A;  3IF7 A;  1G8I A;  1QTX A;  3EK7 A;  3PSR A;  3BFA A;  1DT7 B;  1KK7 Y;  2QEH A;  4ZCV A;  1J1E A;  1BOC A;  5TNC A;  1A2X A;  5HLV A;  3EK4 A;  1G33 A;  1YRU B;  4YI9 A;  1F4Q A;  4FQO A;  1NX1 A;  1B8C A;  1KSM A;  4QJ3 B;  1MXL C;  2E6W A;  2H61 C;  1JBA A;  1DF0 A;  1BMO A;  1S6C A;  1QX5 B;  1A03 A;  3DXL A;  1K2H A;  1NPQ A;  2TN4 A;  1XK4 A;  4U8D A;  4GGF C;  1CLB A;  1NCY A;  2FJY A;  1SK6 D;  1DTL A;  4OZD A;  1WLZ A;  3DY9 A;  2E30 A;  4OV2 A;  1SKT A;  2LMU A;  4JQ0 D;  1OMV A;  2K7C A;  3PN7 C;  5FI6 A;  5DKQ A;  3CR2 A;  3SIB A;  1PVA A;  1QLK A;  1K95 A;  3NHT A;  4CFR A;  1K94 A;  1NWD A;  1W7J B;  2OTG C;  3A8R A;  4A4B A;  4UPG A;  3VB1 A;  1IG5 A;  3NSK A;  4F0Z B;  3LLE A;  1SCM B;  1JF2 A;  2F8P A;  3EVU A;  1VRK A;  3BQ3 A;  1B47 A;  2K7B A;  1F70 A;  1EXR A;  1JSA A;  2ZND A;  1QV0 A;  1TNW A;  1K9U A;  1FPW A;  1X02 A;  1QV1 A;  4MZK A;  5BPJ A;  1XK4 C;  1SMG A;  1CLM A;  3RLZ A;  3B7A A;  3H4S E;  1YVL A;  3IVT A;  1ALV A;  3K1E A;  5JOL A;  1CB1 A;  2PVB A;  1OOG A;  3R72 A;  1F71 A;  1YX7 A;  2KAX A;  4JPZ B;  3CTN A;  2L4I A;  1BT6 A;  3BUN B;  2GV5 A;  2LNK A;  3NSL A;  4OKH A;  2Y5I A;  2M49 B;  1J1D A;  2P71 A;  1JC2 A;  4GGN A;  1MHO A;  1OQP A;  1QAS A;  1J7O A;  1SPY A;  2LMT A;  2ZRS A;  1YX8 A;  4WQ2 A;  4NDD A;  1DJW A;  3BUO B;  5KU1 A;  4INW A;  1DVI A;  3EK8 A;  1F4O A;  1UP5 A;  1IJ6 A;  1W9Z A;  1IRJ A;  3I5G B;  5K89 A;  3I5H B;  3PAT A;  4DS7 A;  3SG4 A;  2KDH A;  3CLN A;  3ZWH A;  3BOW B;  4OVN F;  4MBE A;  3AKA A;  3L4L A;  3L47 A;  1TNX A;  1TRF A;  2OS8 C;  1Y1U A;  2I2R E;  1LXF C;  3S0F A;  2LVI A;  4N5X A;  5GQQ C;  3PLF B;  3CDN A;  2M29 A;  1KCY A;  3HCM A;  1CFF A;  4PE1 A;  2WOR A;  3SG2 A;  1FF1 A;  1CDL A;  1M63 B;  1OSA A;  1BR1 B;  4M2O A;  3LL8 B;  2PRU A;  2H8V A;  4PCW A;  5DKN A;  4Q04 A;  2WND A;  1J7Q A;  1C3Y A;  2M1U A;  4R1E A;  4C0L A;  2YGU A;  2JT8 A;  3CWG A;  2HQW A;  3PN7 B;  2D8N A;  4IJ7 A;  3OB1 B;  1F54 A;  1SYM A;  1Y1X A;  3KEV A;  1K96 A;  2AUC A;  3BFB A;  1KK8 C;  2OTG B;  2HPS A;  2K8M B;  3BXK A;  1DGV A;  1UUR A;  2EHB A;  1CDP A;  1AJ5 A;  2GGZ A;  2WCM A;  3BJH A;  3VRP A;  4A4C A;  2LAP A;  1SL8 A;  5FYX A;  1B1G A;  2KI6 C;  2CT9 A;  1CLL A;  1NIW A;  2BBM A;  2ZN8 A;  2JWW A;  2GGM A;  2O60 A;  2WCJ A;  1BR4 B;  3MSE B;  3OGN A;  4IL1 A;  4PHN A;  3BOW A;  2Y1N A;  1ALW A;  2K7O A;  2KAY A;  2LAN A;  3S0G A;  3JVT C;  1QVI Z;  1TCO B;  2P70 A;  3N7H A;  4GAO A;  1R2U A;  1PVB A;  3LK0 A;  1M31 A;  2L50 A;  2M3W A;  1LS8 A;  1AVS A;  1Z2C B;  2M1K B;  4DUQ A;  2BL0 C;  1IWQ A;  3SG5 A;  3D74 A;  1K9P A;  2Y4Q A;  4ZCU A;  1R6P A;  1AJ4 A;  1JUO A;  2CNP A;  4GGF A;  2WOS A;  1KFX L;  5CSI A;  2OPO A;  4ORB B;  1Z4H A;  2BKH B;  3AAJ A;  1K9K A;  3M0W A;  3FIA A;  1SY9 A;  1FI6 A;  5HKW A;  3QRX A;  1NX2 A;  1QJT A;  5AER A;  2FCE A;  2SCP A;  2NCO A;  1TWO A;  4USL A;  1WRZ A;  1M45 A;  3V2L A;  3VRQ A;  2CCM A;  1IH0 A;  2AMI A;  5KTY A;  2OS8 B;  3C1V A;  4M2Q A;  3TDZ A;  1PSR A;  1CFC A;  1SNL A;  3BUX B;  3SS5 A;  1J7R A;  1WLM A;  4PHM A;  1RFJ A;  2LM5 A;  2QEO A;  2CTN A;  2KGB C;  5AEQ A;  3FWC A;  1LIN A;  3HX4 A;  2F2O A;  4GPL B;  4I5K A;  1S5G Y;  3SS3 A;  1BU3 A;  2JOJ A;  1GQM A;  2O5G A;  1YUU A;  3LCP C;  3OHM B;  1A29 A;  1QX2 A;  2KI4 C;  3I5F C;  2ISD A;  1S1E A;  2MLF C;  3TS5 C;  2NLN A;  4GUK A;  1QLS A;  4MLW A;  1CNP A;  1ZFS A;  4ORA B;  4OCI A;  1ZUZ A;  2EGD A;  3CZ0 A;  4YGB B;  1WRK A;  1XFR A;  5HKY A;  1H4B A;  3TUY C;  1YVH A;  1KK8 B;  1AP4 A;  2JT3 A;  4D1E A;  4PDZ A;  1DJG A;  2PMY A;  1IGV A;  2WCH A;  2ZKM X;  1MF8 B;  3B87 A;  2ERB A;  1LVC D;  2LUC A;  1KSO A;  1SL9 A;  5I8N A;  1OOH A;  2MJW B;  1DJH A;  2L98 A;  3KHE A;  1GM0 A;  2L5X B;  1K8U A;  1MWN A;  2KI6 D;  3OX6 A;  2PAS A;  3JVT B;  1C3Z A;  1ZAC A;  1C7V A;  2QEV A;  4GFT A;  1CM4 A;  2LVV A;  4I5N B;  2LLU A;  2MRD A;  4MVF A;  1B7T Y;  1KWO C;  1N65 A;  3CZ2 A;  4HRH A;  3GOF A;  5AFP A;  2KFG A;  3NXA A;  4KYN A;  3WXA A;  3PM2 A;  2BL0 B;  3GK2 A;  1DC1 A;  1B4C A;  1OOJ A;  1TUZ A;  2K2A A;  3GK4 X;  2JUL A;  5F6T A;  4C0J A;  1XFZ O;  4AOM A;  4PE7 A;  3LK1 A;  4MZL A;  1KK7 Z;  2H2K A;  4P2Y B;  2GTE A;  1G4Y R;  1V1F A;  2L4H A;  1SBJ A;  5FI7 A;  1BJF A;  3R1P A;  4PHK A;  1UHN A;  1XA5 A;  4YGE B;  3DYE A;  3Q8I A;  4CFQ A;  3UNW A;  3E3R A;  2JZI A;  2F3Z A;  4MRX A;  1UUS A;  2M7N A;  1WRL A;  3FWB A;  5PAL A;  2FCD A;  2M9G A;  3EG5 B;  4HRG A;  3S0D A;  3OBV A;  2Q91 A;  1FW4 A;  1QVI Y;  1KFX S;  1PUL A;  4AQI A;  1N2D A;  2BE6 A;  1RTP 1;  1XFX O;  3O78 A;  3WHU B;  1B8L A;  1UWO A;  5CSF A;  2KFF A;  5DKR A;  2BAP A;  3OX5 A;  2KI4 B;  3DVM A;  3I5F B;  1TIZ A;  1KQM C;  3TS5 B;  1RWY A;  3CZT X;  2K7D A;  2L5Y A;  3CYZ A;  1EG4 A;  2LP3 A;  3L4A A;  1N0Y A;  1OZO A;  4GNK B;  1BF5 A;  3TUY B;  2PSR A;  3DF0 B;  1M39 A;  1B8R A;  1FI5 A; 
#chains in the Genus database with same CATH homology
 1YR5 A;  2BE4 A;  1DJI A;  3KF9 A;  1GGZ A;  2JRF A;  1DJZ A;  4XYN A;  2K0J A;  3NSO A;  4N1G A;  1UHI A;  2JPT A;  4MZJ A;  2L2E A;  1CFP A;  1AHR A;  2LLS A;  4QJ4 B;  1EJ3 A;  2MLE C;  1KFU L;  1YUR A;  3PM8 A;  2EC6 C;  1OMR A;  2LMV A;  1CFD A;  3BYA A;  1SR6 C;  5D69 A;  4PE4 A;  4I5J A;  1KWO B;  2HQ8 A;  3SG6 A;  4BY4 A;  1U5I B;  3I5I B;  1LA0 A;  1MQ1 A;  3VGO A;  1CKK A;  2JU0 A;  4HRE E;  2JXL A;  1F8H A;  2CXJ A;  2LUX A;  4YBH B;  1TOP A;  4NDC A;  4PE0 A;  4ETO A;  4YRU A;  1NX3 A;  3DVE A;  1DMO A;  1E8A A;  3JTD C;  4CLN A;  5I2O A;  2F3Y A;  4DCK A;  3ICB A;  4NQG A;  3VRO A;  5HYD A;  2NCP A;  4YGA A;  2MA2 A;  3EVR A;  2BEC A;  1PSB A;  1S6I A;  2VRG A;  3DF0 A;  3O6B A;  4YGD B;  1W7I B;  1AUI B;  1Q80 A;  2IS9 A;  2KSP A;  5I2Q A;  3EKH A;  2R2I A;  3ZNI A;  2KBM A;  2KNE A;  2V53 A;  2LP2 A;  1IQ3 A;  2ZFD A;  3VRR A;  2P6B B;  4C0K A;  1XFW O;  4DRW A;  3EVV A;  2QAC A;  1J55 A;  1NSH A;  4N1F A;  2KHN A;  2WCE A;  3KPX A;  1UHH A;  1H8B A;  1XFY O;  2KGR A;  2NZ0 A;  1KQM B;  3CR5 X;  3FS7 A;  1QXP A;  2BKI B;  5HLO A;  4AQJ A;  1DGU A;  1U5I A;  3SJS A;  3IQO A;  1RRO A;  5CSJ A;  2BCA A;  3DD4 A;  1MUX A;  2G9B A;  5KSZ A;  3PAL A;  4YI8 A;  2LHL A;  3EKJ A;  2KQ6 A;  1QX7 A;  1QIW A;  2WC8 A;  2ZNE A;  4NDB A;  3OP0 A;  3SG3 A;  1L2O C;  4OR9 B;  3RM1 A;  2FOT A;  2FJU B;  2JTT A;  1CDN A;  4HSZ A;  2DOQ A;  3TDI A;  1B9A A;  1HQV A;  4QJ5 B;  1EL4 A;  4PHJ A;  2JNF A;  2EC6 B;  3DVJ A;  1IQ5 A;  3OB2 B;  1OE9 B;  1SR6 B;  1ODB A;  2BBN A;  2LVK A;  1WY9 A;  2MHH A;  3I5I C;  3O2P A;  1NP8 A;  1YUT A;  1QIV A;  2I94 A;  1PAL A;  4MEW A;  1NYA A;  5CSN A;  2K61 A;  3GK1 A;  1DJX A;  2JNX A;  2WCB A;  1J7P A;  1QAT A;  3JTD B;  2K2F A;  1A75 B;  4E68 A;  1HT9 A;  1KFU S;  2F2P A;  1NX0 A;  1ZMZ A;  1XYD A;  1CTR A;  2ZN9 A;  5G08 A;  5ER5 A;  2KAV A;  1SCV A;  1JF0 A;  1PRW A;  1WDC B;  4CPV A;  2ZRT A;  1BG1 A;  1AK8 A;  1S5G Z;  1NCZ A;  1EG3 A;  1TCF A;  3NSI A;  2PAL A;  3WHT B;  4JWQ A;  2Y1M A;  4CID A;  4P5O E;  1EH2 A;  3BUM B;  3DVK A;  1S3P A;  4XJK B;  2HF5 A;  2KYC A;  2LCP A;  1LKJ A;  4ORC B;  2I7A A;  4TNC A;  3WNX B;  1BLQ A;  4BY5 A;  3VRN A;  4MSP A;  1IJ5 A;  3TZ1 A;  2COL B;  1OMD A;  1SRA A;  1ZOT B;  1SL7 A;  1UHK A;  3CR4 X;  2AAO A;  2M0R A;  1K93 D;  5ER4 X;  1XVJ A;  2M7L A;  5CPV A;  3A4U B;  2LVJ A;  5I2L A;  2MAZ A;  2G2B A;  1TN4 A;  1GJY A;  1Y1A A;  1XFV O;  3D0Y B;  1L7Z A;  3IQQ A;  1L2O B;  2LLT A;  5HKZ A;  1A75 A;  2CBL A;  4WQ3 A;  2QPT A;  1OZS A;  5B8I B;  1B7T Z;  1IKU A;  2KYF A;  1RK9 A;  2JTZ A;  1DJY A;  2LE9 B;  2KOT A;  4YGC B;  1JWD A;  3CGA A;  2KBI A;  2WCF A;  2BCX A;  2A4J A;  2F33 A;  2LC5 A;  3CS1 A;  4GBA A;  3BUW B;  1UHJ A;  4DIR A;  1C07 A;  5AAN A;  4M2P A;  1JFJ A;  2M97 A;  4XJK A;  1Y6W A;  2LHI A;  1XFU O;  1MXE A;  2SAS A;  4ICB A;  1REC A;  2BCB A;  2KQY A;  2L0P A;  4WRI A;  5J3X A;  1XO5 A;  1F55 A;  1RJV A;  4L9M A;  1S26 D;  1SCM C;  1CMF A;  4FTG A;  4MRY A;  2NXQ A;  1MR8 A;  2JT0 A;  3D10 A;  5IBW A;  1KQV A;  2I18 A;  3AAK A;  3KO0 A;  1SW8 A;  1M46 A;  2RGI A;  1DF0 B;  3AKB A;  1K90 D;  2JC2 A;  1TNP A;  3D0Y A;  4I5L B;  4MN0 A;  1WDC C;  2JXC A;  1JFK A;  1YUS A;  5D7F A;  3PFV A;  5AXI A;  1TTX A;  2H61 A;  1TNQ A;  1S36 A;  1GGW A;  1CM1 A;  1QS7 A;  1YTZ C;  2KFH A;  2Q4U A;  3F45 A;  3O4Y A;  1CMG A;  2LV7 A;  1LA3 A;  2M8U A;  1BOD A;  1A4P A;  2MBX A;  3SG7 A;  1YRT B;  2HET A;  3TDU A;  4PAL A;  1FBV A;  2B1U A;  1S6J A;  1V1G A;  2JQ6 A;  3K21 A;  3SIA A;  1D1O A;  1Y0V H;  5JJG A;  1NUB A;  1CDM A;  1C7W A;  2L51 A;  3I5G C;  3I5H C;  1PK0 D;  1NCX A;  3IF7 A;  1G8I A;  1QTX A;  3EK7 A;  3PSR A;  1DT7 B;  1KK7 Y;  4ZCV A;  1J1E A;  1BOC A;  5TNC A;  1A2X A;  5HLV A;  3EK4 A;  1G33 A;  1YRU B;  4YI9 A;  1F4Q A;  4FQO A;  1NX1 A;  1B8C A;  1KSM A;  4QJ3 B;  1MXL C;  2E6W A;  2H61 C;  1JBA A;  1DF0 A;  1BMO A;  1S6C A;  1QX5 B;  1A03 A;  1K2H A;  1NPQ A;  2TN4 A;  1XK4 A;  4U8D A;  4GGF C;  1CLB A;  1NCY A;  1SK6 D;  1DTL A;  1WLZ A;  2E30 A;  4OV2 A;  1SKT A;  2LMU A;  4JQ0 D;  1OMV A;  2K7C A;  3PN7 C;  5DKQ A;  3CR2 A;  3SIB A;  1PVA A;  1QLK A;  1K95 A;  4CFR A;  1K94 A;  1NWD A;  1W7J B;  2OTG C;  3A8R A;  4A4B A;  4UPG A;  1IG5 A;  3NSK A;  4F0Z B;  3LLE A;  1SCM B;  1JF2 A;  2F8P A;  3EVU A;  1VRK A;  3BQ3 A;  1B47 A;  2K7B A;  1F70 A;  1EXR A;  1JSA A;  2ZND A;  1QV0 A;  1TNW A;  1K9U A;  1FPW A;  1X02 A;  1QV1 A;  4MZK A;  5BPJ A;  1XK4 C;  1SMG A;  1CLM A;  3RLZ A;  3H4S E;  1YVL A;  1CB1 A;  1ALV A;  5JOL A;  2PVB A;  1F71 A;  1YX7 A;  2KAX A;  4JPZ B;  3CTN A;  2L4I A;  1BT6 A;  3BUN B;  2GV5 A;  2LNK A;  3NSL A;  4OKH A;  2Y5I A;  2M49 B;  1J1D A;  1JC2 A;  4GGN A;  1MHO A;  1OQP A;  1QAS A;  1J7O A;  1SPY A;  2LMT A;  2ZRS A;  1YX8 A;  4WQ2 A;  4NDD A;  1DJW A;  3BUO B;  5KU1 A;  1DVI A;  3EK8 A;  1F4O A;  1UP5 A;  1IJ6 A;  1IRJ A;  3I5G B;  5K89 A;  3I5H B;  3PAT A;  4DS7 A;  3SG4 A;  2KDH A;  3CLN A;  3ZWH A;  3BOW B;  4OVN F;  4MBE A;  3AKA A;  1TNX A;  1TRF A;  2OS8 C;  1Y1U A;  2I2R E;  1LXF C;  2LVI A;  4N5X A;  5GQQ C;  3PLF B;  2M29 A;  1KCY A;  3HCM A;  1CFF A;  4PE1 A;  2WOR A;  3SG2 A;  1FF1 A;  1CDL A;  1M63 B;  1OSA A;  1BR1 B;  4M2O A;  3LL8 B;  2PRU A;  4PCW A;  5DKN A;  4Q04 A;  2WND A;  1J7Q A;  2M1U A;  4R1E A;  4C0L A;  2JT8 A;  3CWG A;  2HQW A;  3PN7 B;  2D8N A;  3OB1 B;  1F54 A;  1SYM A;  1Y1X A;  3KEV A;  1K96 A;  2AUC A;  1KK8 C;  2OTG B;  2HPS A;  2K8M B;  3BXK A;  1DGV A;  1UUR A;  2EHB A;  1CDP A;  1AJ5 A;  2GGZ A;  3VRP A;  4A4C A;  2LAP A;  1SL8 A;  5FYX A;  1B1G A;  2KI6 C;  2CT9 A;  1CLL A;  1NIW A;  2BBM A;  2ZN8 A;  2JWW A;  2GGM A;  2O60 A;  3MSE B;  1BR4 B;  4IL1 A;  4PHN A;  3BOW A;  2Y1N A;  1ALW A;  2K7O A;  2KAY A;  2LAN A;  3JVT C;  1QVI Z;  1TCO B;  4GAO A;  1R2U A;  1PVB A;  3LK0 A;  1M31 A;  2L50 A;  2M3W A;  1AVS A;  2M1K B;  4DUQ A;  2BL0 C;  1IWQ A;  3SG5 A;  1K9P A;  2Y4Q A;  4ZCU A;  1R6P A;  1AJ4 A;  2CNP A;  1JUO A;  4GGF A;  2WOS A;  1KFX L;  5CSI A;  2OPO A;  4ORB B;  2BKH B;  3AAJ A;  1K9K A;  3M0W A;  3FIA A;  1SY9 A;  1FI6 A;  5HKW A;  3QRX A;  1NX2 A;  1QJT A;  5AER A;  2FCE A;  2SCP A;  2NCO A;  4USL A;  1WRZ A;  1M45 A;  3VRQ A;  2CCM A;  1IH0 A;  2AMI A;  5KTY A;  2OS8 B;  3C1V A;  4M2Q A;  3TDZ A;  1PSR A;  1CFC A;  1SNL A;  3BUX B;  1J7R A;  1WLM A;  4PHM A;  1RFJ A;  2LM5 A;  2CTN A;  2KGB C;  5AEQ A;  3FWC A;  1LIN A;  3HX4 A;  2F2O A;  4GPL B;  4I5K A;  1S5G Y;  1BU3 A;  2JOJ A;  1GQM A;  2O5G A;  1YUU A;  3LCP C;  3OHM B;  1A29 A;  1QX2 A;  2KI4 C;  3I5F C;  2ISD A;  1S1E A;  2MLF C;  3TS5 C;  2NLN A;  4GUK A;  1QLS A;  4MLW A;  1CNP A;  1ZFS A;  4ORA B;  4OCI A;  1ZUZ A;  2EGD A;  4YGB B;  1WRK A;  5HKY A;  1H4B A;  3TUY C;  1YVH A;  1KK8 B;  1AP4 A;  2JT3 A;  4D1E A;  4PDZ A;  1DJG A;  2PMY A;  1IGV A;  2ZKM X;  1MF8 B;  1LVC D;  2LUC A;  1KSO A;  1SL9 A;  5I8N A;  2MJW B;  1DJH A;  2L98 A;  3KHE A;  2L5X B;  1K8U A;  1MWN A;  2KI6 D;  3OX6 A;  2PAS A;  3JVT B;  1ZAC A;  1C7V A;  4GFT A;  1CM4 A;  2LVV A;  4I5N B;  2LLU A;  2MRD A;  4MVF A;  1B7T Y;  1KWO C;  1N65 A;  4HRH A;  3GOF A;  5AFP A;  2KFG A;  3NXA A;  3WXA A;  2BL0 B;  3GK2 A;  1B4C A;  1OOJ A;  2K2A A;  3GK4 X;  2JUL A;  5F6T A;  4C0J A;  1XFZ O;  4AOM A;  4PE7 A;  3LK1 A;  4MZL A;  1KK7 Z;  2H2K A;  4P2Y B;  1G4Y R;  1V1F A;  2L4H A;  1SBJ A;  1BJF A;  4PHK A;  1UHN A;  1XA5 A;  4YGE B;  4CFQ A;  3E3R A;  2JZI A;  2F3Z A;  4MRX A;  1UUS A;  2M7N A;  1WRL A;  3FWB A;  5PAL A;  2FCD A;  2M9G A;  4HRG A;  2Q91 A;  1FW4 A;  1QVI Y;  1KFX S;  1PUL A;  4AQI A;  1N2D A;  2BE6 A;  1RTP 1;  1XFX O;  3O78 A;  3WHU B;  1B8L A;  1UWO A;  5CSF A;  2KFF A;  5DKR A;  3OX5 A;  2KI4 B;  3DVM A;  3I5F B;  1TIZ A;  1KQM C;  3TS5 B;  1RWY A;  3CZT X;  2K7D A;  1EG4 A;  2LP3 A;  1BF5 A;  1N0Y A;  1OZO A;  4GNK B;  3TUY B;  2PSR A;  3DF0 B;  1M39 A;  1B8R A;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...