1SRAA

Structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
151
structure length
151
Chain Sequence
b'PPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPARC
publication title Structure of a novel extracellular Ca(2+)-binding module in BM-40.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 52
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1995-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sraA00
2HF5A 3TUYC 1XYDA 1BR4B 3OX6A 2BBNA 1DJWA 1LA0A 3CLNA 4OV2A 3DVKA 2PASA 2JT3A 3LCPC 3BOWB 4ICBA 4MLWA 1WRKA 2P6BB 5G08A 5ER4X 4YGEB 3SIAA 3OP0A 1SCMC 3SG5A 5TNCA 1TOPA 1XFZO 4PHMA 3PALA 3VROA 1SR6C 4AQJA 1G4YR 5ER5A 1SPYA 4UPGA 2KAYA 3PFVA 5CSJA 1IRJA 2ISDA 1S6IA 2KFFA 4M2OA 1K9PA 4DS7A 1DT7B 1ALWA 4C0LA 4ORBB 3OHMB 1Y1UA 1XFWO 2CCMA 2BE4A 4CFQA 2WNDA 2K8MB 3DVMA 1M63B 4Q04A 1KK8C 1B8LA 1NX1A 1A29A 1TCFA 1S1EA 2I2RE 4JPZB 1PVBA 1M46A 1SL9A 4MZJA 1MXLC 1RWYA 2JWWA 3CWGA 4A4CA 2CNPA 2LHLA 2TN4A 1KWOB 4D1EA 2B1UA 2KI6C 2WCEA 3GOFA 3DF0A 2EC6C 2PMYA 4ZCVA 2LMUA 1TNQA 2WORA 3PSRA 4FQOA 2LNKA 1PVAA 1BT6A 2G9BA 2KDHA 1XFYO 1EG3A 2JT0A 1PSRA 3I5GC 1JBAA 1U5IB 1Y1XA 1ZMZA 4MVFA 1RTP1 2H2KA 2LLTA 2WOSA 1F8HA 3OX5A 1QIWA 1NCXA 2MLFC 2ZFDA 1DJZA 1DVIA 4MZLA 1IWQA 3QRXA 1ODBA 3KPXA 3C1VA 3BYAA 1IG5A 2M97A 3ZNIA 1C07A 3H4SE 1OMRA 1SL8A 2LLUA 1J1DA 5I2OA 1UP5A 3EVUA 1OZOA 2BL0B 2OTGC 1NX3A 1JF2A 1KFUS 4MSPA 2F3ZA 3AAJA 1K8UA 1CDMA 3D10A 1CDLA 1MWNA 1R2UA 2BKIB 3LK0A 3GK1A 1NP8A 4IL1A 2KYFA 4PDZA 1KK7Y 1F55A 3FS7A 3KEVA 5HKYA 4TNCA 2KYCA 1WDCC 3NSKA 1K90D 1C7VA 2LP3A 1QV1A 1YVHA 1YRTB 2CTNA 3EKHA 4YI8A 4JWQA 3O2PA 2KNEA 1RECA 4PHJA 1QX5B 3BUNB 3A4UB 2JRFA 2HQ8A 2JULA 1IQ5A 4N5XA 4PHKA 1X02A 1TNPA 1RFJA 4XYNA 2LVIA 1V1FA 2GGMA 4E68A 5DKQA 1DJIA 2L2EA 3DF0B 2I18A 2LVKA 3JTDB 3SG4A 4CFRA 1XK4C 4R1EA 4MN0A 1XO5A 4OR9B 1K2HA 3EVVA 1JFKA 3WXAA 4DIRA 1YRUB 5F6TA 2D8NA 2M0RA 3SG7A 1QJTA 1AUIB 1QATA 2F33A 2BBMA 2JXLA 2KGBC 4ZCUA 5D7FA 1QV0A 3KHEA 2WCBA 5AEQA 3TUYB 1KFUL 3IQOA 4AQIA 4PE0A 3TDUA 1K9UA 1BJFA 2KBIA 1TN4A 2LV7A 4BY5A 5HYDA 2JNFA 1SCVA 4JQ0D 1NX2A 3TZ1A 1WRLA 3CZTX 3EK4A 1N65A 4MZKA 3WHTB 1SR6B 2H61A 1NX0A 1J7OA 1F54A 2HQWA 1KSMA 2Y5IA 1WRZA 2KFGA 3IQQA 1Y1AA 4BY4A 3D0YA 4DUQA 3HX4A 1S3PA 3GK2A 3OB2B 1DF0A 4YGBB 1YUSA 4M2PA 1YTZC 2NCPA 2L0PA 4YI9A 5I8NA 1J7RA 5J3XA 2O5GA 4I5KA 5HKWA 2VRGA 1KK8B 1FI5A 1XFUO 2L4IA 5KU1A 1SKTA 3TS5C 2LC5A 2HETA 1G8IA 1S26D 2IS9A 2ZNDA 2E30A 3JVTC 1J55A 2NXQA 4MRXA 5DKNA 2LCPA 2NLNA 2KGRA 3I5FC 2A4JA 1K93D 1MR8A 3BUWB 1ZFSA 3CS1A 4N1GA 1JFJA 1XK4A 1NUBA 1A2XA 5AERA 3DD4A 1YX7A 1WLZA 2Y1NA 1NWDA 2HPSA 1CLLA 1WLMA 3PN7C 3VRPA 1BU3A 1OMVA 1CLMA 1LKJA 3KO0A 1GJYA 1KQMB 3HCMA 2QPTA 3F45A 2KBMA 1B8CA 1DGVA 1Y6WA 1J1EA 3DVEA 1JUOA 1S36A 4P2YB 3I5GB 4PCWA 1V1GA 5DKRA 4C0KA 1B1GA 1A75A 2M9GA 1L7ZA 5KSZA 1YR5A 1KFXS 1IH0A 2K2AA 1MUXA 2M3WA 2M7LA 2BECA 2ZN8A 1N0YA 2FOTA 4USLA 2K61A 2Q4UA 4F0ZB 2K0JA 3SG6A 2JC2A 2M8UA 1CDPA 1SBJA 1GQMA 1HQVA 1K9KA 1CMFA 2OTGB 2KAXA 2MHHA 1F4OA 1MHOA 2OS8C 4A4BA 3EK8A 3SG2A 1PRWA 4MEWA 1M45A 4YBHB 3D0YB 1EH2A 3O4YA 1DF0B 2AMIA 1IJ6A 3M0WA 5B8IB 1H8BA 1J7QA 1ZOTB 3PLFB 3TDIA 1LA3A 2JNXA 2FJUB 1KWOC 4M2QA 3VRQA 1GGZA 4QJ4B 1HT9A 2Q91A 3EVRA 3VRNA 1DMOA 1SY9A 2SCPA 1CFFA 4QJ5B 1AVSA 3MSEB 2L98A 1EJ3A 3CR4X 1CB1A 1KFXL 1SYMA 3O6BA 3SJSA 1MXEA 3LLEA 4DCKA 2F8PA 4OCIA 1CFDA 2BCAA 2KI4B 5AFPA 2G2BA 2JZIA 1N2DA 1RK9A 2JU0A 2LMVA 2CBLA 2LP2A 5AANA 2PALA 2JT8A 2BKHB 3E3RA 3I5IB 4HRGA 4YGAA 3SIBA 2KQ6A 4YGDB 3WNXB 2NCOA 1CKKA 1AJ4A 1QIVA 1NIWA 3PATA 1H4BA 1LVCD 1YX8A 4ETOA 1UHJA 2F3YA 1A75B 5BPJA 2ZN9A 2JQ6A 2Y1MA 1NCZA 3NSIA 2BCXA 2JXCA 4XJKA 2PSRA 2LANA 3EK7A 3LK1A 1SK6D 2LAPA 5HKZA 1QXPA 3TDZA 1EXRA 1NYAA 1TTXA 1XFXO 1L2OC 1S6CA 1ALVA 5CSNA 1SRAA 4C0JA 1ZUZA 1F70A 4L9MA 1K94A 1VRKA 2MAZA 1A4PA 3I5HC 4PE1A 3VGOA 1Y0VH 1UHKA 2JTZA 2CXJA 2GV5A 2K2FA 4ORCB 1SCMB 2COLB 5CSIA 1DJHA 5KTYA 4MRYA 2E6WA 3BXKA 2K7BA 1IQ3A 1SNLA 2BCBA 1QX7A 1JC2A 1A03A 1ZACA 3JVTB 5GQQC 1SL7A 2PRUA 4PALA 3CR2A 1UHIA 2O60A 3I5FB 1UUSA 3CTNA 1S6JA 4WQ3A 1B47A 2LM5A 4GGNA 5IBWA 1TRFA 2KHNA 1CFCA 1U5IA 1NPQA 2LMTA 3FWCA 1F71A 5CPVA 3PN7B 2R2IA 1BG1A 1JF0A 3LL8B 1BLQA 1KQVA 2M1KB 2JPTA 2WC8A 3GK4X 2LUCA 2F2PA 4PE4A 2NZ0A 1UHNA 1SW8A 2FCEA 2EC6B 4GUKA 4YGCB 1IKUA 4HREE 1KCYA 1DJXA 1KSOA 2F2OA 2KOTA 1YVLA 5PALA 1M39A 2LVVA 4HSZA 1PK0D 4WRIA 2KFHA 2ZNEA 3AAKA 1TNWA 1DTLA 3IF7A 1DGUA 1PSBA 2M29A 1LXFC 2I7AA 3ICBA 4CIDA 5K89A 4QJ3B 2KI6D 4OKHA 1UWOA 2K7CA 4MBEA 1CLBA 2L4HA 3K21A 1B9AA 4XJKB 1CM1A 3PM8A 2OS8B 3CGAA 2M49B 1TIZA 1BF5A 4I5NB 1TCOB 1WY9A 3BUMB 2M7NA 4U8DA 3WHUB 2BE6A 1OSAA 2V53A 3NSOA 1J7PA 1C7WA 1FI6A 1XVJA 2JTTA 2MA2A 4GGFC 1Q80A 3FIAA 3FWBA 4HRHA 2ZRSA 1BOCA 1S5GY 1IJ5A 1OMDA 3NSLA 4PE7A 1CM4A 3BUOB 3AKBA 2SASA 1E8AA 1B4CA 1YUTA 5FYXA 1QLSA 1OE9B 1QX2A 5I2LA 1WDCB 2OPOA 3CR5X 3DVJA 4CLNA 1YUUA 1YURA 4I5JA 1KQMC 1OQPA 3VRRA 4AOMA 1CNPA 4GFTA 1FBVA 2ZKMX 4YRUA 4I5LB 1D1OA 3NXAA 1PULA 2WCFA 1EG4A 1CDNA 3EKJA 5CSFA 1QS7A 4PHNA 1LINA 1B7TY 2GGZA 2AAOA 3KF9A 1F4QA 1S5GZ 5JOLA 1AJ5A 1JSAA 4GPLB 1AK8A 1OZSA 1RROA 2L50A 2MJWB 3BOWA 5HLVA 3ZWHA 2H61C 1FPWA 2EHBA 3AKAA 2PVBA 1QTXA 1L2OB 2I94A 1XFVO 4NQGA 1EL4A 2K7OA 3OB1B 1OOJA 4N1FA 4NDCA 1AP4A 4GAOA 4NDBA 4CPVA 3I5HB 1QVIY 1R6PA 2LVJA 5HLOA 1QLKA 4GGFA 1MF8B 1FW4A 1MQ1A 1NSHA 2BL0C 1CTRA 2MLEC 2KAVA 2ZRTA 3RLZA 4DRWA 1M31A 1K96A 2M1UA 1W7JB 2MRDA 1FF1A 2CT9A 4GBAA 1UURA 2LLSA 2K7DA 2JOJA 1BMOA 2KSPA 2LHIA 1B7TZ 2QACA 2Y4QA 4ORAB 2RGIA 1PALA 4OVNF 1NCYA 2EGDA 1TNXA 4FTGA 4P5OE 2FCDA 1B8RA 3RM1A 1G33A 1DJGA 5I2QA 3A8RA 3BQ3A 5JJGA 1BODA 1AHRA 2AUCA 2KI4C 2KQYA 1DJYA 5AXIA 1QASA 4GNKB 1RJVA 1W7IB 3I5IC 3TS5B 2DOQA 3O78A 1CFPA 2LUXA 1CMGA 3SG3A 1KK7Z 2MBXA 1JWDA 1BR1B 1QVIZ 3JTDC 4WQ2A 2LE9B 1K95A 1SMGA 1UHHA 4NDDA 1IGVA 1GGWA 1XA5A 5D69A 3BUXB 2L5XB 2L51A
chains in the Genus database with same CATH superfamily
2HF5A 3BJHA 3SS3A 3TUYC 1XYDA 2KLEA 1BR4B 3OX6A 2BBNA 1DJWA 1LA0A 3CLNA 4OV2A 3DVKA 2PASA 2JT3A 3LCPC 3BOWB 4ICBA 4MLWA 1WRKA 2P6BB 5G08A 2BNXA 5ER4X 2WC5A 4YGEB 3SIAA 2ERBA 3OP0A 1SCMC 3SG5A 5TNCA 1TOPA 1XFZO 4PHMA 3PALA 3VROA 1SR6C 4AQJA 1G4YR 5ER5A 1SPYA 4UPGA 2KAYA 3PFVA 5CSJA 1IRJA 3D77A 2ISDA 1S6IA 2KFFA 2QEOA 4M2OA 1K9PA 4DS7A 1OOFA 1DT7B 3CZ2A 2WCHA 1ALWA 4C0LA 1GM0A 3D73A 4ORBB 3OHMB 1Y1UA 1XFWO 2CCMA 2BE4A 3FE8A 3D76A 4CFQA 2WNDA 2K8MB 3DVMA 1M63B 4Q04A 1KK8C 1B8LA 1NX1A 1A29A 1TCFA 1S1EA 2I2RE 4JPZB 1PVBA 1M46A 1SL9A 4MZJA 3S0GA 1MXLC 1RWYA 2JWWA 3CWGA 4A4CA 2CNPA 2LHLA 2TN4A 1KWOB 4D1EA 2B1UA 2KI6C 2WCEA 3GOFA 3DF0A 2EC6C 2PMYA 4ZCVA 2LMUA 1TNQA 3SS5A 2WORA 1Z4HA 3D78A 3PSRA 2BAPA 4FQOA 2LNKA 1PVAA 3OBVA 1BT6A 2G9BA 5D3OA 2KDHA 1XFYO 1EG3A 2JT0A 1PSRA 3I5GC 1JBAA 1U5IB 1Y1XA 1T14A 5EL2A 1ZMZA 3NHIA 4MVFA 1RTP1 2H2KA 2LLTA 2WOSA 1F8HA 3OX5A 1QIWA 1NCXA 2MLFC 2ZFDA 1DJZA 1DVIA 2YGUA 1IWQA 3QRXA 1ODBA 3KPXA 4MZLA 3C1VA 3BYAA 1IG5A 2M97A 3ZNIA 1C07A 3H4SE 1OMRA 1SL8A 2LLUA 1J1DA 5I2OA 1UP5A 3EVUA 1OZOA 2BL0B 2OTGC 1NX3A 1JF2A 1KFUS 4MSPA 2F3ZA 3AAJA 1K8UA 1CDMA 3D10A 1CDLA 1MWNA 1R2UA 2BKIB 2K60A 3LK0A 3GK1A 1NP8A 4IL1A 4PT1A 2KYFA 4PDZA 1KK7Y 3R1PA 1F55A 3FS7A 1DQEA 3KEVA 5HKYA 4TNCA 2KYCA 1WDCC 3NSKA 1K90D 1C7VA 2LP3A 1QV1A 1YVHA 1YRTB 2CTNA 3EKHA 4YI8A 4JWQA 3O2PA 2KNEA 1RECA 4PHJA 1QX5B 2QEBA 3BUNB 3A4UB 2JRFA 2HQ8A 2JULA 1IQ5A 4N5XA 4PHKA 1X02A 1TNPA 1RFJA 4XYNA 2LVIA 1V1FA 3D75A 3S0DA 2GGMA 4E68A 3B88A 5DKQA 1DJIA 2L2EA 3DF0B 2I18A 2LVKA 3JTDB 3SG4A 4CFRA 2PQLA 1XK4C 4R1EA 3B87A 4MN0A 2WCLA 1XO5A 4INWA 4OR9B 1K2HA 3EVVA 1JFKA 3SS4A 3WXAA 4DIRA 1YRUB 5F6TA 3L47A 2D8NA 2M0RA 3SG7A 1QJTA 3S0EA 1AUIB 1QATA 2F33A 1ORGA 2BBMA 2JXLA 2KGBC 4ZCUA 5D7FA 1QV0A 3KHEA 3QMEA 2WCBA 5AEQA 3TUYB 1KFUL 3IQOA 4AQIA 4PE0A 3TDUA 1K9UA 1BJFA 2KBIA 1TN4A 2LV7A 3B7AA 4BY5A 1Z2CB 2JNFA 1SCVA 4JQ0D 1NX2A 3BFAA 3TZ1A 1WRLA 3CZTX 3EK4A 1N65A 4MZKA 3WHTB 1SR6B 2H61A 1NX0A 3CZ1A 1OOIX 1J7OA 2HQWA 1KSMA 4C0KA 1F54A 3R1VA 2Y5IA 1DEKA 1WRZA 2KFGA 2P70A 2PYQA 3IQQA 1Y1AA 4BY4A 3D0YA 4DUQA 3HX4A 1S3PA 3GK2A 3OB2B 1DF0A 4YGBB 1YUSA 4M2PA 1YTZC 2NCPA 5DICA 2L0PA 4YI9A 5I8NA 1J7RA 5J3XA 3R1OA 2O5GA 4I5KA 5HKWA 2VRGA 1KK8B 3D74A 3CDNA 1FI5A 1XFUO 2L4IA 5KU1A 1SKTA 3TS5C 2LC5A 2HETA 4JKTA 1G8IA 1S26D 2IS9A 2ZNDA 2E30A 3JVTC 1J55A 2NXQA 4MRXA 5DKNA 2LCPA 2NLNA 2KGRA 3I5FC 2A4JA 1K93D 1MR8A 3BUWB 1ZFSA 3CS1A 4N1GA 1JFJA 1XK4A 1NUBA 1A2XA 2WCKA 5AERA 3DD4A 1YX7A 1WLZA 2Y1NA 1NWDA 2HPSA 1CLLA 1WLMA 3PN7C 3VRPA 1BU3A 3IVTA 1OMVA 1CLMA 1LKJA 3KO0A 1GJYA 1KQMB 3HCMA 2QPTA 3F45A 2KBMA 1B8CA 1DGVA 1Y6WA 4F7FA 1J1EA 3DVEA 1JUOA 1S36A 1LS8A 3I5GB 4P2YB 1V1GA 4PCWA 5DKRA 3OGNA 1B1GA 1A75A 2M9GA 1L7ZA 5KSZA 3DY9A 1YR5A 1KFXS 1IH0A 2K2AA 1MUXA 2M3WA 2QEVA 2M7LA 2BECA 2ZN8A 1N0YA 4FQTA 2FOTA 5I94A 4USLA 2K61A 2Q4UA 4F0ZB 2K0JA 2L5YA 3SG6A 3S0FA 2JC2A 2M8UA 1DC1A 1CDPA 1SBJA 1GQMA 1HQVA 1K9KA 1CMFA 2OTGB 2KAXA 2MHHA 1F4OA 1MHOA 2OS8C 1TUZA 4A4BA 3EK8A 3SG2A 1PRWA 3B86A 4MEWA 1M45A 4YBHB 3D0YB 1EH2A 3O4YA 1DF0B 2AMIA 1IJ6A 3M0WA 5B8IB 1P28A 5HL1A 1H8BA 3EG5B 1J7QA 1ZOTB 3BFBA 3PLFB 3TDIA 2KPHA 1LA3A 2JNXA 2FJUB 1KWOC 3RZSA 4M2QA 3VRQA 1GGZA 4QJ4B 1HT9A 2Q91A 3EVRA 3VRNA 3O4XA 1SY9A 2SCPA 1DMOA 1CFFA 4QJ5B 1AVSA 1OW4A 3MSEB 2L98A 1EJ3A 1W9ZA 3CR4X 1CB1A 1KFXL 1SYMA 3O6BA 3SJSA 1MXEA 3LLEA 4DCKA 2F8PA 4OCIA 1CFDA 2BCAA 2KI4B 5AFPA 2G2BA 2JZIA 1N2DA 1RK9A 2JU0A 2WCJA 2LMVA 2CBLA 2LP2A 5AANA 2PALA 2JT8A 2BKHB 3E3RA 3I5IB 4HRGA 4YGAA 3SIBA 3BFHA 2KQ6A 4YGDB 3WNXB 2NCOA 1CKKA 1AJ4A 1QIVA 1NIWA 3PATA 1H4BA 1LVCD 1YX8A 4ETOA 1UHJA 2F3YA 1A75B 5BPJA 4OZDA 2ZN9A 2JQ6A 2Y1MA 3L4LA 1NCZA 3NSIA 2BCXA 2JXCA 4XJKA 2PSRA 2LANA 3EK7A 3LK1A 1SK6D 2LAPA 5HKZA 1QXPA 3TDZA 1EXRA 1NYAA 1TTXA 1XFXO 1L2OC 1S6CA 1ALVA 5CSNA 1SRAA 4C0JA 1ZUZA 1F70A 4L9MA 1K94A 1VRKA 2MAZA 1A4PA 3I5HC 4PE1A 3VGOA 1Y0VH 1UHKA 2JTZA 2CXJA 2GV5A 2K2FA 4ORCB 1SCMB 2COLB 5CSIA 1DJHA 1SSEB 4INXA 5KTYA 4MRYA 2E6WA 3BXKA 2K7BA 1IQ3A 1SNLA 2BCBA 1QX7A 1JC2A 1A03A 1ZACA 3JVTB 5GQQC 5FI2A 1SL7A 2PRUA 1DELA 3CR2A 1UHIA 2O60A 4PALA 3I5FB 1UUSA 3CTNA 1S6JA 3L4AA 4WQ3A 1B47A 2LM5A 4GGNA 5IBWA 1TRFA 2KHNA 3R72A 1U5IA 1CFCA 1NPQA 2LMTA 3FWCA 1F71A 3CYZA 1OOHA 5CPVA 3PN7B 3FE9A 2R2IA 1BG1A 1JF0A 3LL8B 1BLQA 1KQVA 2M1KB 2WCMA 3PJIA 2JPTA 2WC8A 3GK4X 2L2CA 2LUCA 2F2PA 4PE4A 2NZ0A 1UHNA 1SW8A 2FCEA 2EC6B 4GUKA 4YGCB 1IKUA 4HREE 1KCYA 1DJXA 1KSOA 2F2OA 2KOTA 1YVLA 4IJ7A 1C3YA 5PALA 1M39A 2LVVA 3K1EA 1PK0D 4HSZA 4WRIA 2KFHA 2ZNEA 3AAKA 1TNWA 1DTLA 3IF7A 1DGUA 3V2LA 1PSBA 3NHTA 2M29A 1LXFC 2I7AA 3ICBA 4CIDA 5K89A 4QJ3B 2GTEA 2KI6D 4OKHA 1UWOA 2K7CA 4MBEA 1CLBA 2L4HA 3K21A 1B9AA 4XJKB 1CM1A 3PM8A 2OS8B 4KYNA 2WC6A 3CGAA 2M49B 1C3ZA 2H8VA 1TIZA 1BF5A 4I5NB 3S0BA 1TCOB 1WY9A 3BUMB 2M7NA 4U8DA 3WHUB 2BE6A 1OSAA 2V53A 3NSOA 4JD9A 1J7PA 1C7WA 1FI6A 1XVJA 2JTTA 2MA2A 4GGFC 1Q80A 3PM2A 3FIAA 3FWBA 4HRHA 2ZRSA 1BOCA 1S5GY 1IJ5A 1OMDA 3NSLA 4PE7A 1CM4A 3BUOB 3AKBA 2SASA 1E8AA 1B4CA 1YUTA 5FYXA 1QLSA 1OE9B 1QX2A 2JPOA 5I2LA 1WDCB 2OPOA 3CR5X 1IIOA 3DVJA 4CLNA 1YUUA 1YURA 4I5JA 1KQMC 1OQPA 3VRRA 4AOMA 1CNPA 4GFTA 1FBVA 2ZKMX 4YRUA 4I5LB 1D1OA 3NXAA 1PULA 2WCFA 1TWOA 1EG4A 1CDNA 3EKJA 5CSFA 1QS7A 4PHNA 1LINA 1B7TY 2GGZA 2AAOA 3KF9A 1F4QA 1S5GZ 5JOLA 5HYDA 1AJ5A 3N7HA 1JSAA 3DYEA 4GPLB 1AK8A 1OZSA 2QDIA 2P71A 1RROA 2L50A 2MJWB 3BOWA 5HLVA 3ZWHA 2H61C 1FPWA 2EHBA 3AKAA 3S0AA 2PVBA 3DZTA 1OOGA 1QTXA 1L2OB 2I94A 1XFVO 3Q8IA 1EL4A 4NQGA 2K7OA 3OB1B 1OOJA 1TUJA 4N1FA 4NDCA 1QWVA 2KLDA 4GAOA 4NDBA 4CPVA 1AP4A 3I5HB 2FJYA 3FE6A 3B6XA 1QVIY 1R6PA 2LVJA 1XFRA 5HLOA 1QLKA 4GGFA 1MF8B 1FW4A 1MQ1A 1NSHA 2BL0C 1CTRA 2MLEC 2KAVA 2ZRTA 3RLZA 4DRWA 1M31A 3UNWA 1K96A 2M1UA 1W7JB 2MRDA 1FF1A 2CT9A 4GBAA 1UURA 2LLSA 2K7DA 2JOJA 3UO9A 1BMOA 2KSPA 2LHIA 3NGVA 1B7TZ 2QACA 2Y4QA 4ORAB 2RGIA 1PALA 3CABA 4OVNF 1NCYA 2EGDA 1TNXA 4FTGA 4P5OE 2FCDA 1B8RA 3RM1A 1G33A 1DJGA 5I2QA 3A8RA 3BQ3A 5JJGA 1BODA 5FI7A 1AHRA 2AUCA 2KI4C 2KQYA 1DJYA 5AXIA 1QASA 4GNKB 1RJVA 5FI6A 1W7IB 3CZ0A 3I5IC 3TS5B 2DOQA 3O78A 1CFPA 2LUXA 1CMGA 3SG3A 1KK7Z 2MBXA 1JWDA 1BR1B 1QVIZ 3JTDC 4WQ2A 2LE9B 1K95A 3DXLA 1SMGA 3VB1A 1UHHA 4NDDA 1IGVA 2QEHA 1GGWA 1XA5A 5D69A 3BUXB 2L5XB 2L51A
chains in the Genus database with same CATH topology
2HF5A 3TUYC 1XYDA 1BR4B 3OX6A 2BBNA 1DJWA 1LA0A 3CLNA 4OV2A 3DVKA 2PASA 2JT3A 3LCPC 3BOWB 4ICBA 4MLWA 1WRKA 2P6BB 5G08A 5ER4X 4YGEB 3SIAA 3OP0A 1SCMC 3SG5A 5TNCA 1TOPA 1XFZO 4PHMA 3PALA 3VROA 1SR6C 4AQJA 1G4YR 5ER5A 1SPYA 4UPGA 2KAYA 3PFVA 5CSJA 1IRJA 2ISDA 1S6IA 2KFFA 4M2OA 1K9PA 4DS7A 1DT7B 1ALWA 4C0LA 4ORBB 3OHMB 1Y1UA 1XFWO 2CCMA 2BE4A 4CFQA 2WNDA 2K8MB 3DVMA 1M63B 4Q04A 1KK8C 1B8LA 1NX1A 1A29A 1TCFA 1S1EA 2I2RE 4JPZB 1PVBA 1M46A 1SL9A 4MZJA 1MXLC 1RWYA 2JWWA 3CWGA 4A4CA 2CNPA 2LHLA 2TN4A 1KWOB 4D1EA 2B1UA 2KI6C 2WCEA 3GOFA 3DF0A 2EC6C 2PMYA 4ZCVA 2LMUA 1TNQA 2WORA 3PSRA 4FQOA 2LNKA 1PVAA 1BT6A 2G9BA 2KDHA 1XFYO 1EG3A 2JT0A 1PSRA 3I5GC 1JBAA 1U5IB 1Y1XA 1ZMZA 4MVFA 1RTP1 2H2KA 2LLTA 2WOSA 1F8HA 3OX5A 1QIWA 1NCXA 2MLFC 2ZFDA 1DJZA 1DVIA 4MZLA 1IWQA 3QRXA 1ODBA 3KPXA 3C1VA 3BYAA 1IG5A 2M97A 3ZNIA 1C07A 3H4SE 1OMRA 1SL8A 2LLUA 1J1DA 5I2OA 1UP5A 3EVUA 1OZOA 2BL0B 2OTGC 1NX3A 1JF2A 1KFUS 4MSPA 2F3ZA 3AAJA 1K8UA 1CDMA 3D10A 1CDLA 1MWNA 1R2UA 2BKIB 3LK0A 3GK1A 1NP8A 4IL1A 2KYFA 4PDZA 1KK7Y 1F55A 3FS7A 3KEVA 5HKYA 4TNCA 2KYCA 1WDCC 3NSKA 1K90D 1C7VA 2LP3A 1QV1A 1YVHA 1YRTB 2CTNA 3EKHA 4YI8A 4JWQA 3O2PA 2KNEA 1RECA 4PHJA 1QX5B 3BUNB 3A4UB 2JRFA 2HQ8A 2JULA 1IQ5A 4N5XA 4PHKA 1X02A 1TNPA 1RFJA 4XYNA 2LVIA 1V1FA 2GGMA 4E68A 5DKQA 1DJIA 2L2EA 3DF0B 2I18A 2LVKA 3JTDB 3SG4A 4CFRA 1XK4C 4R1EA 4MN0A 1XO5A 4OR9B 1K2HA 3EVVA 1JFKA 3WXAA 4DIRA 1YRUB 5F6TA 2D8NA 2M0RA 3SG7A 1QJTA 1AUIB 1QATA 2F33A 2BBMA 2JXLA 2KGBC 4ZCUA 5D7FA 1QV0A 3KHEA 2WCBA 5AEQA 3TUYB 1KFUL 3IQOA 4AQIA 4PE0A 3TDUA 1K9UA 1BJFA 2KBIA 1TN4A 2LV7A 4BY5A 5HYDA 2JNFA 1SCVA 4JQ0D 1NX2A 3TZ1A 1WRLA 3CZTX 3EK4A 1N65A 4MZKA 3WHTB 1SR6B 2H61A 1NX0A 1J7OA 1F54A 2HQWA 1KSMA 2Y5IA 1WRZA 2KFGA 3IQQA 1Y1AA 4BY4A 3D0YA 4DUQA 3HX4A 1S3PA 3GK2A 3OB2B 1DF0A 4YGBB 1YUSA 4M2PA 1YTZC 2NCPA 2L0PA 4YI9A 5I8NA 1J7RA 5J3XA 2O5GA 4I5KA 5HKWA 2VRGA 1KK8B 1FI5A 1XFUO 2L4IA 5KU1A 1SKTA 3TS5C 2LC5A 2HETA 1G8IA 1S26D 2IS9A 2ZNDA 2E30A 3JVTC 1J55A 2NXQA 4MRXA 5DKNA 2LCPA 2NLNA 2KGRA 3I5FC 2A4JA 1K93D 1MR8A 3BUWB 1ZFSA 3CS1A 4N1GA 1JFJA 1XK4A 1NUBA 1A2XA 5AERA 3DD4A 1YX7A 1WLZA 2Y1NA 1NWDA 2HPSA 1CLLA 1WLMA 3PN7C 3VRPA 1BU3A 1OMVA 1CLMA 1LKJA 3KO0A 1GJYA 1KQMB 3HCMA 2QPTA 3F45A 2KBMA 1B8CA 1DGVA 1Y6WA 1J1EA 3DVEA 1JUOA 1S36A 4P2YB 3I5GB 4PCWA 1V1GA 5DKRA 4C0KA 1B1GA 1A75A 2M9GA 1L7ZA 5KSZA 1YR5A 1KFXS 1IH0A 2K2AA 1MUXA 2M3WA 2M7LA 2BECA 2ZN8A 1N0YA 2FOTA 4USLA 2K61A 2Q4UA 4F0ZB 2K0JA 3SG6A 2JC2A 2M8UA 1CDPA 1SBJA 1GQMA 1HQVA 1K9KA 1CMFA 2OTGB 2KAXA 2MHHA 1F4OA 1MHOA 2OS8C 4A4BA 3EK8A 3SG2A 1PRWA 4MEWA 1M45A 4YBHB 3D0YB 1EH2A 3O4YA 1DF0B 2AMIA 1IJ6A 3M0WA 5B8IB 1H8BA 1J7QA 1ZOTB 3PLFB 3TDIA 1LA3A 2JNXA 2FJUB 1KWOC 4M2QA 3VRQA 1GGZA 4QJ4B 1HT9A 2Q91A 3EVRA 3VRNA 1DMOA 1SY9A 2SCPA 1CFFA 4QJ5B 1AVSA 3MSEB 2L98A 1EJ3A 3CR4X 1CB1A 1KFXL 1SYMA 3O6BA 3SJSA 1MXEA 3LLEA 4DCKA 2F8PA 4OCIA 1CFDA 2BCAA 2KI4B 5AFPA 2G2BA 2JZIA 1N2DA 1RK9A 2JU0A 2LMVA 2CBLA 2LP2A 5AANA 2PALA 2JT8A 2BKHB 3E3RA 3I5IB 4HRGA 4YGAA 3SIBA 2KQ6A 4YGDB 3WNXB 2NCOA 1CKKA 1AJ4A 1QIVA 1NIWA 3PATA 1H4BA 1LVCD 1YX8A 4ETOA 1UHJA 2F3YA 1A75B 5BPJA 2ZN9A 2JQ6A 2Y1MA 1NCZA 3NSIA 2BCXA 2JXCA 4XJKA 2PSRA 2LANA 3EK7A 3LK1A 1SK6D 2LAPA 5HKZA 1QXPA 3TDZA 1EXRA 1NYAA 1TTXA 1XFXO 1L2OC 1S6CA 1ALVA 5CSNA 1SRAA 4C0JA 1ZUZA 1F70A 4L9MA 1K94A 1VRKA 2MAZA 1A4PA 3I5HC 4PE1A 3VGOA 1Y0VH 1UHKA 2JTZA 2CXJA 2GV5A 2K2FA 4ORCB 1SCMB 2COLB 5CSIA 1DJHA 5KTYA 4MRYA 2E6WA 3BXKA 2K7BA 1IQ3A 1SNLA 2BCBA 1QX7A 1JC2A 1A03A 1ZACA 3JVTB 5GQQC 1SL7A 2PRUA 4PALA 3CR2A 1UHIA 2O60A 3I5FB 1UUSA 3CTNA 1S6JA 4WQ3A 1B47A 2LM5A 4GGNA 5IBWA 1TRFA 2KHNA 1CFCA 1U5IA 1NPQA 2LMTA 3FWCA 1F71A 5CPVA 3PN7B 2R2IA 1BG1A 1JF0A 3LL8B 1BLQA 1KQVA 2M1KB 2JPTA 2WC8A 3GK4X 2LUCA 2F2PA 4PE4A 2NZ0A 1UHNA 1SW8A 2FCEA 2EC6B 4GUKA 4YGCB 1IKUA 4HREE 1KCYA 1DJXA 1KSOA 2F2OA 2KOTA 1YVLA 5PALA 1M39A 2LVVA 4HSZA 1PK0D 4WRIA 2KFHA 2ZNEA 3AAKA 1TNWA 1DTLA 3IF7A 1DGUA 1PSBA 2M29A 1LXFC 2I7AA 3ICBA 4CIDA 5K89A 4QJ3B 2KI6D 4OKHA 1UWOA 2K7CA 4MBEA 1CLBA 2L4HA 3K21A 1B9AA 4XJKB 1CM1A 3PM8A 2OS8B 3CGAA 2M49B 1TIZA 1BF5A 4I5NB 1TCOB 1WY9A 3BUMB 2M7NA 4U8DA 3WHUB 2BE6A 1OSAA 2V53A 3NSOA 1J7PA 1C7WA 1FI6A 1XVJA 2JTTA 2MA2A 4GGFC 1Q80A 3FIAA 3FWBA 4HRHA 2ZRSA 1BOCA 1S5GY 1IJ5A 1OMDA 3NSLA 4PE7A 1CM4A 3BUOB 3AKBA 2SASA 1E8AA 1B4CA 1YUTA 5FYXA 1QLSA 1OE9B 1QX2A 5I2LA 1WDCB 2OPOA 3CR5X 3DVJA 4CLNA 1YUUA 1YURA 4I5JA 1KQMC 1OQPA 3VRRA 4AOMA 1CNPA 4GFTA 1FBVA 2ZKMX 4YRUA 4I5LB 1D1OA 3NXAA 1PULA 2WCFA 1EG4A 1CDNA 3EKJA 5CSFA 1QS7A 4PHNA 1LINA 1B7TY 2GGZA 2AAOA 3KF9A 1F4QA 1S5GZ 5JOLA 1AJ5A 1JSAA 4GPLB 1AK8A 1OZSA 1RROA 2L50A 2MJWB 3BOWA 5HLVA 3ZWHA 2H61C 1FPWA 2EHBA 3AKAA 2PVBA 1QTXA 1L2OB 2I94A 1XFVO 4NQGA 1EL4A 2K7OA 3OB1B 1OOJA 4N1FA 4NDCA 1AP4A 4GAOA 4NDBA 4CPVA 3I5HB 1QVIY 1R6PA 2LVJA 5HLOA 1QLKA 4GGFA 1MF8B 1FW4A 1MQ1A 1NSHA 2BL0C 1CTRA 2MLEC 2KAVA 2ZRTA 3RLZA 4DRWA 1M31A 1K96A 2M1UA 1W7JB 2MRDA 1FF1A 2CT9A 4GBAA 1UURA 2LLSA 2K7DA 2JOJA 1BMOA 2KSPA 2LHIA 1B7TZ 2QACA 2Y4QA 4ORAB 2RGIA 1PALA 4OVNF 1NCYA 2EGDA 1TNXA 4FTGA 4P5OE 2FCDA 1B8RA 3RM1A 1G33A 1DJGA 5I2QA 3A8RA 3BQ3A 5JJGA 1BODA 1AHRA 2AUCA 2KI4C 2KQYA 1DJYA 5AXIA 1QASA 4GNKB 1RJVA 1W7IB 3I5IC 3TS5B 2DOQA 3O78A 1CFPA 2LUXA 1CMGA 3SG3A 1KK7Z 2MBXA 1JWDA 1BR1B 1QVIZ 3JTDC 4WQ2A 2LE9B 1K95A 1SMGA 1UHHA 4NDDA 1IGVA 1GGWA 1XA5A 5D69A 3BUXB 2L5XB 2L51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  3TUY C;  1XYD A;  1BR4 B;  3OX6 A;  2BBN A;  1DJW A;  1LA0 A;  3CLN A;  4OV2 A;  3DVK A;  2PAS A;  2JT3 A;  3LCP C;  3BOW B;  4ICB A;  4MLW A;  1WRK A;  2P6B B;  5G08 A;  5ER4 X;  4YGE B;  3SIA A;  3OP0 A;  1SCM C;  3SG5 A;  5TNC A;  1TOP A;  1XFZ O;  4PHM A;  3PAL A;  3VRO A;  1SR6 C;  4AQJ A;  1G4Y R;  5ER5 A;  1SPY A;  4UPG A;  2KAY A;  3PFV A;  5CSJ A;  1IRJ A;  2ISD A;  1S6I A;  2KFF A;  4M2O A;  1K9P A;  4DS7 A;  1DT7 B;  1ALW A;  4C0L A;  4ORB B;  3OHM B;  1Y1U A;  1XFW O;  2CCM A;  2BE4 A;  4CFQ A;  2WND A;  2K8M B;  3DVM A;  1M63 B;  4Q04 A;  1KK8 C;  1B8L A;  1NX1 A;  1A29 A;  1TCF A;  1S1E A;  2I2R E;  4JPZ B;  1PVB A;  1M46 A;  1SL9 A;  4MZJ A;  1MXL C;  1RWY A;  2JWW A;  3CWG A;  4A4C A;  2CNP A;  2LHL A;  2TN4 A;  1KWO B;  4D1E A;  2B1U A;  2KI6 C;  2WCE A;  3GOF A;  3DF0 A;  2EC6 C;  2PMY A;  4ZCV A;  2LMU A;  1TNQ A;  2WOR A;  3PSR A;  4FQO A;  2LNK A;  1PVA A;  1BT6 A;  2G9B A;  2KDH A;  1XFY O;  1EG3 A;  2JT0 A;  1PSR A;  3I5G C;  1JBA A;  1U5I B;  1Y1X A;  1ZMZ A;  4MVF A;  1RTP 1;  2H2K A;  2LLT A;  2WOS A;  1F8H A;  3OX5 A;  1QIW A;  1NCX A;  2MLF C;  2ZFD A;  1DJZ A;  1DVI A;  4MZL A;  1IWQ A;  3QRX A;  1ODB A;  3KPX A;  3C1V A;  3BYA A;  1IG5 A;  2M97 A;  3ZNI A;  1C07 A;  3H4S E;  1OMR A;  1SL8 A;  2LLU A;  1J1D A;  5I2O A;  1UP5 A;  3EVU A;  1OZO A;  2BL0 B;  2OTG C;  1NX3 A;  1JF2 A;  1KFU S;  4MSP A;  2F3Z A;  3AAJ A;  1K8U A;  1CDM A;  3D10 A;  1CDL A;  1MWN A;  1R2U A;  2BKI B;  3LK0 A;  3GK1 A;  1NP8 A;  4IL1 A;  2KYF A;  4PDZ A;  1KK7 Y;  1F55 A;  3FS7 A;  3KEV A;  5HKY A;  4TNC A;  2KYC A;  1WDC C;  3NSK A;  1K90 D;  1C7V A;  2LP3 A;  1QV1 A;  1YVH A;  1YRT B;  2CTN A;  3EKH A;  4YI8 A;  4JWQ A;  3O2P A;  2KNE A;  1REC A;  4PHJ A;  1QX5 B;  3BUN B;  3A4U B;  2JRF A;  2HQ8 A;  2JUL A;  1IQ5 A;  4N5X A;  4PHK A;  1X02 A;  1TNP A;  1RFJ A;  4XYN A;  2LVI A;  1V1F A;  2GGM A;  4E68 A;  5DKQ A;  1DJI A;  2L2E A;  3DF0 B;  2I18 A;  2LVK A;  3JTD B;  3SG4 A;  4CFR A;  1XK4 C;  4R1E A;  4MN0 A;  1XO5 A;  4OR9 B;  1K2H A;  3EVV A;  1JFK A;  3WXA A;  4DIR A;  1YRU B;  5F6T A;  2D8N A;  2M0R A;  3SG7 A;  1QJT A;  1AUI B;  1QAT A;  2F33 A;  2BBM A;  2JXL A;  2KGB C;  4ZCU A;  5D7F A;  1QV0 A;  3KHE A;  2WCB A;  5AEQ A;  3TUY B;  1KFU L;  3IQO A;  4AQI A;  4PE0 A;  3TDU A;  1K9U A;  1BJF A;  2KBI A;  1TN4 A;  2LV7 A;  4BY5 A;  5HYD A;  2JNF A;  1SCV A;  4JQ0 D;  1NX2 A;  3TZ1 A;  1WRL A;  3CZT X;  3EK4 A;  1N65 A;  4MZK A;  3WHT B;  1SR6 B;  2H61 A;  1NX0 A;  1J7O A;  1F54 A;  2HQW A;  1KSM A;  2Y5I A;  1WRZ A;  2KFG A;  3IQQ A;  1Y1A A;  4BY4 A;  3D0Y A;  4DUQ A;  3HX4 A;  1S3P A;  3GK2 A;  3OB2 B;  1DF0 A;  4YGB B;  1YUS A;  4M2P A;  1YTZ C;  2NCP A;  2L0P A;  4YI9 A;  5I8N A;  1J7R A;  5J3X A;  2O5G A;  4I5K A;  5HKW A;  2VRG A;  1KK8 B;  1FI5 A;  1XFU O;  2L4I A;  5KU1 A;  1SKT A;  3TS5 C;  2LC5 A;  2HET A;  1G8I A;  1S26 D;  2IS9 A;  2ZND A;  2E30 A;  3JVT C;  1J55 A;  2NXQ A;  4MRX A;  5DKN A;  2LCP A;  2NLN A;  2KGR A;  3I5F C;  2A4J A;  1K93 D;  1MR8 A;  3BUW B;  1ZFS A;  3CS1 A;  4N1G A;  1JFJ A;  1XK4 A;  1NUB A;  1A2X A;  5AER A;  3DD4 A;  1YX7 A;  1WLZ A;  2Y1N A;  1NWD A;  2HPS A;  1CLL A;  1WLM A;  3PN7 C;  3VRP A;  1BU3 A;  1OMV A;  1CLM A;  1LKJ A;  3KO0 A;  1GJY A;  1KQM B;  3HCM A;  2QPT A;  3F45 A;  2KBM A;  1B8C A;  1DGV A;  1Y6W A;  1J1E A;  3DVE A;  1JUO A;  1S36 A;  4P2Y B;  3I5G B;  4PCW A;  1V1G A;  5DKR A;  4C0K A;  1B1G A;  1A75 A;  2M9G A;  1L7Z A;  5KSZ A;  1YR5 A;  1KFX S;  1IH0 A;  2K2A A;  1MUX A;  2M3W A;  2M7L A;  2BEC A;  2ZN8 A;  1N0Y A;  2FOT A;  4USL A;  2K61 A;  2Q4U A;  4F0Z B;  2K0J A;  3SG6 A;  2JC2 A;  2M8U A;  1CDP A;  1SBJ A;  1GQM A;  1HQV A;  1K9K A;  1CMF A;  2OTG B;  2KAX A;  2MHH A;  1F4O A;  1MHO A;  2OS8 C;  4A4B A;  3EK8 A;  3SG2 A;  1PRW A;  4MEW A;  1M45 A;  4YBH B;  3D0Y B;  1EH2 A;  3O4Y A;  1DF0 B;  2AMI A;  1IJ6 A;  3M0W A;  5B8I B;  1H8B A;  1J7Q A;  1ZOT B;  3PLF B;  3TDI A;  1LA3 A;  2JNX A;  2FJU B;  1KWO C;  4M2Q A;  3VRQ A;  1GGZ A;  4QJ4 B;  1HT9 A;  2Q91 A;  3EVR A;  3VRN A;  1DMO A;  1SY9 A;  2SCP A;  1CFF A;  4QJ5 B;  1AVS A;  3MSE B;  2L98 A;  1EJ3 A;  3CR4 X;  1CB1 A;  1KFX L;  1SYM A;  3O6B A;  3SJS A;  1MXE A;  3LLE A;  4DCK A;  2F8P A;  4OCI A;  1CFD A;  2BCA A;  2KI4 B;  5AFP A;  2G2B A;  2JZI A;  1N2D A;  1RK9 A;  2JU0 A;  2LMV A;  2CBL A;  2LP2 A;  5AAN A;  2PAL A;  2JT8 A;  2BKH B;  3E3R A;  3I5I B;  4HRG A;  4YGA A;  3SIB A;  2KQ6 A;  4YGD B;  3WNX B;  2NCO A;  1CKK A;  1AJ4 A;  1QIV A;  1NIW A;  3PAT A;  1H4B A;  1LVC D;  1YX8 A;  4ETO A;  1UHJ A;  2F3Y A;  1A75 B;  5BPJ A;  2ZN9 A;  2JQ6 A;  2Y1M A;  1NCZ A;  3NSI A;  2BCX A;  2JXC A;  4XJK A;  2PSR A;  2LAN A;  3EK7 A;  3LK1 A;  1SK6 D;  2LAP A;  5HKZ A;  1QXP A;  3TDZ A;  1EXR A;  1NYA A;  1TTX A;  1XFX O;  1L2O C;  1S6C A;  1ALV A;  5CSN A;  1SRA A;  4C0J A;  1ZUZ A;  1F70 A;  4L9M A;  1K94 A;  1VRK A;  2MAZ A;  1A4P A;  3I5H C;  4PE1 A;  3VGO A;  1Y0V H;  1UHK A;  2JTZ A;  2CXJ A;  2GV5 A;  2K2F A;  4ORC B;  1SCM B;  2COL B;  5CSI A;  1DJH A;  5KTY A;  4MRY A;  2E6W A;  3BXK A;  2K7B A;  1IQ3 A;  1SNL A;  2BCB A;  1QX7 A;  1JC2 A;  1A03 A;  1ZAC A;  3JVT B;  5GQQ C;  1SL7 A;  2PRU A;  4PAL A;  3CR2 A;  1UHI A;  2O60 A;  3I5F B;  1UUS A;  3CTN A;  1S6J A;  4WQ3 A;  1B47 A;  2LM5 A;  4GGN A;  5IBW A;  1TRF A;  2KHN A;  1CFC A;  1U5I A;  1NPQ A;  2LMT A;  3FWC A;  1F71 A;  5CPV A;  3PN7 B;  2R2I A;  1BG1 A;  1JF0 A;  3LL8 B;  1BLQ A;  1KQV A;  2M1K B;  2JPT A;  2WC8 A;  3GK4 X;  2LUC A;  2F2P A;  4PE4 A;  2NZ0 A;  1UHN A;  1SW8 A;  2FCE A;  2EC6 B;  4GUK A;  4YGC B;  1IKU A;  4HRE E;  1KCY A;  1DJX A;  1KSO A;  2F2O A;  2KOT A;  1YVL A;  5PAL A;  1M39 A;  2LVV A;  4HSZ A;  1PK0 D;  4WRI A;  2KFH A;  2ZNE A;  3AAK A;  1TNW A;  1DTL A;  3IF7 A;  1DGU A;  1PSB A;  2M29 A;  1LXF C;  2I7A A;  3ICB A;  4CID A;  5K89 A;  4QJ3 B;  2KI6 D;  4OKH A;  1UWO A;  2K7C A;  4MBE A;  1CLB A;  2L4H A;  3K21 A;  1B9A A;  4XJK B;  1CM1 A;  3PM8 A;  2OS8 B;  3CGA A;  2M49 B;  1TIZ A;  1BF5 A;  4I5N B;  1TCO B;  1WY9 A;  3BUM B;  2M7N A;  4U8D A;  3WHU B;  2BE6 A;  1OSA A;  2V53 A;  3NSO A;  1J7P A;  1C7W A;  1FI6 A;  1XVJ A;  2JTT A;  2MA2 A;  4GGF C;  1Q80 A;  3FIA A;  3FWB A;  4HRH A;  2ZRS A;  1BOC A;  1S5G Y;  1IJ5 A;  1OMD A;  3NSL A;  4PE7 A;  1CM4 A;  3BUO B;  3AKB A;  2SAS A;  1E8A A;  1B4C A;  1YUT A;  5FYX A;  1QLS A;  1OE9 B;  1QX2 A;  5I2L A;  1WDC B;  2OPO A;  3CR5 X;  3DVJ A;  4CLN A;  1YUU A;  1YUR A;  4I5J A;  1KQM C;  1OQP A;  3VRR A;  4AOM A;  1CNP A;  4GFT A;  1FBV A;  2ZKM X;  4YRU A;  4I5L B;  1D1O A;  3NXA A;  1PUL A;  2WCF A;  1EG4 A;  1CDN A;  3EKJ A;  5CSF A;  1QS7 A;  4PHN A;  1LIN A;  1B7T Y;  2GGZ A;  2AAO A;  3KF9 A;  1F4Q A;  1S5G Z;  5JOL A;  1AJ5 A;  1JSA A;  4GPL B;  1AK8 A;  1OZS A;  1RRO A;  2L50 A;  2MJW B;  3BOW A;  5HLV A;  3ZWH A;  2H61 C;  1FPW A;  2EHB A;  3AKA A;  2PVB A;  1QTX A;  1L2O B;  2I94 A;  1XFV O;  4NQG A;  1EL4 A;  2K7O A;  3OB1 B;  1OOJ A;  4N1F A;  4NDC A;  1AP4 A;  4GAO A;  4NDB A;  4CPV A;  3I5H B;  1QVI Y;  1R6P A;  2LVJ A;  5HLO A;  1QLK A;  4GGF A;  1MF8 B;  1FW4 A;  1MQ1 A;  1NSH A;  2BL0 C;  1CTR A;  2MLE C;  2KAV A;  2ZRT A;  3RLZ A;  4DRW A;  1M31 A;  1K96 A;  2M1U A;  1W7J B;  2MRD A;  1FF1 A;  2CT9 A;  4GBA A;  1UUR A;  2LLS A;  2K7D A;  2JOJ A;  1BMO A;  2KSP A;  2LHI A;  1B7T Z;  2QAC A;  2Y4Q A;  4ORA B;  2RGI A;  1PAL A;  4OVN F;  1NCY A;  2EGD A;  1TNX A;  4FTG A;  4P5O E;  2FCD A;  1B8R A;  3RM1 A;  1G33 A;  1DJG A;  5I2Q A;  3A8R A;  3BQ3 A;  5JJG A;  1BOD A;  1AHR A;  2AUC A;  2KI4 C;  2KQY A;  1DJY A;  5AXI A;  1QAS A;  4GNK B;  1RJV A;  1W7I B;  3I5I C;  3TS5 B;  2DOQ A;  3O78 A;  1CFP A;  2LUX A;  1CMG A;  3SG3 A;  1KK7 Z;  2MBX A;  1JWD A;  1BR1 B;  1QVI Z;  3JTD C;  4WQ2 A;  2LE9 B;  1K95 A;  1SMG A;  1UHH A;  4NDD A;  1IGV A;  1GGW A;  1XA5 A;  5D69 A;  3BUX B;  2L5X B;  2L51 A; 
#chains in the Genus database with same CATH topology
 2HF5 A;  3BJH A;  3SS3 A;  3TUY C;  1XYD A;  2KLE A;  1BR4 B;  3OX6 A;  2BBN A;  1DJW A;  1LA0 A;  3CLN A;  4OV2 A;  3DVK A;  2PAS A;  2JT3 A;  3LCP C;  3BOW B;  4ICB A;  4MLW A;  1WRK A;  2P6B B;  5G08 A;  2BNX A;  5ER4 X;  2WC5 A;  4YGE B;  3SIA A;  2ERB A;  3OP0 A;  1SCM C;  3SG5 A;  5TNC A;  1TOP A;  1XFZ O;  4PHM A;  3PAL A;  3VRO A;  1SR6 C;  4AQJ A;  1G4Y R;  5ER5 A;  1SPY A;  4UPG A;  2KAY A;  3PFV A;  5CSJ A;  1IRJ A;  3D77 A;  2ISD A;  1S6I A;  2KFF A;  2QEO A;  4M2O A;  1K9P A;  4DS7 A;  1OOF A;  1DT7 B;  3CZ2 A;  2WCH A;  1ALW A;  4C0L A;  1GM0 A;  3D73 A;  4ORB B;  3OHM B;  1Y1U A;  1XFW O;  2CCM A;  2BE4 A;  3FE8 A;  3D76 A;  4CFQ A;  2WND A;  2K8M B;  3DVM A;  1M63 B;  4Q04 A;  1KK8 C;  1B8L A;  1NX1 A;  1A29 A;  1TCF A;  1S1E A;  2I2R E;  4JPZ B;  1PVB A;  1M46 A;  1SL9 A;  4MZJ A;  3S0G A;  1MXL C;  1RWY A;  2JWW A;  3CWG A;  4A4C A;  2CNP A;  2LHL A;  2TN4 A;  1KWO B;  4D1E A;  2B1U A;  2KI6 C;  2WCE A;  3GOF A;  3DF0 A;  2EC6 C;  2PMY A;  4ZCV A;  2LMU A;  1TNQ A;  3SS5 A;  2WOR A;  1Z4H A;  3D78 A;  3PSR A;  2BAP A;  4FQO A;  2LNK A;  1PVA A;  3OBV A;  1BT6 A;  2G9B A;  5D3O A;  2KDH A;  1XFY O;  1EG3 A;  2JT0 A;  1PSR A;  3I5G C;  1JBA A;  1U5I B;  1Y1X A;  1T14 A;  5EL2 A;  1ZMZ A;  3NHI A;  4MVF A;  1RTP 1;  2H2K A;  2LLT A;  2WOS A;  1F8H A;  3OX5 A;  1QIW A;  1NCX A;  2MLF C;  2ZFD A;  1DJZ A;  1DVI A;  2YGU A;  1IWQ A;  3QRX A;  1ODB A;  3KPX A;  4MZL A;  3C1V A;  3BYA A;  1IG5 A;  2M97 A;  3ZNI A;  1C07 A;  3H4S E;  1OMR A;  1SL8 A;  2LLU A;  1J1D A;  5I2O A;  1UP5 A;  3EVU A;  1OZO A;  2BL0 B;  2OTG C;  1NX3 A;  1JF2 A;  1KFU S;  4MSP A;  2F3Z A;  3AAJ A;  1K8U A;  1CDM A;  3D10 A;  1CDL A;  1MWN A;  1R2U A;  2BKI B;  2K60 A;  3LK0 A;  3GK1 A;  1NP8 A;  4IL1 A;  4PT1 A;  2KYF A;  4PDZ A;  1KK7 Y;  3R1P A;  1F55 A;  3FS7 A;  1DQE A;  3KEV A;  5HKY A;  4TNC A;  2KYC A;  1WDC C;  3NSK A;  1K90 D;  1C7V A;  2LP3 A;  1QV1 A;  1YVH A;  1YRT B;  2CTN A;  3EKH A;  4YI8 A;  4JWQ A;  3O2P A;  2KNE A;  1REC A;  4PHJ A;  1QX5 B;  2QEB A;  3BUN B;  3A4U B;  2JRF A;  2HQ8 A;  2JUL A;  1IQ5 A;  4N5X A;  4PHK A;  1X02 A;  1TNP A;  1RFJ A;  4XYN A;  2LVI A;  1V1F A;  3D75 A;  3S0D A;  2GGM A;  4E68 A;  3B88 A;  5DKQ A;  1DJI A;  2L2E A;  3DF0 B;  2I18 A;  2LVK A;  3JTD B;  3SG4 A;  4CFR A;  2PQL A;  1XK4 C;  4R1E A;  3B87 A;  4MN0 A;  2WCL A;  1XO5 A;  4INW A;  4OR9 B;  1K2H A;  3EVV A;  1JFK A;  3SS4 A;  3WXA A;  4DIR A;  1YRU B;  5F6T A;  3L47 A;  2D8N A;  2M0R A;  3SG7 A;  1QJT A;  3S0E A;  1AUI B;  1QAT A;  2F33 A;  1ORG A;  2BBM A;  2JXL A;  2KGB C;  4ZCU A;  5D7F A;  1QV0 A;  3KHE A;  3QME A;  2WCB A;  5AEQ A;  3TUY B;  1KFU L;  3IQO A;  4AQI A;  4PE0 A;  3TDU A;  1K9U A;  1BJF A;  2KBI A;  1TN4 A;  2LV7 A;  3B7A A;  4BY5 A;  1Z2C B;  2JNF A;  1SCV A;  4JQ0 D;  1NX2 A;  3BFA A;  3TZ1 A;  1WRL A;  3CZT X;  3EK4 A;  1N65 A;  4MZK A;  3WHT B;  1SR6 B;  2H61 A;  1NX0 A;  3CZ1 A;  1OOI X;  1J7O A;  2HQW A;  1KSM A;  4C0K A;  1F54 A;  3R1V A;  2Y5I A;  1DEK A;  1WRZ A;  2KFG A;  2P70 A;  2PYQ A;  3IQQ A;  1Y1A A;  4BY4 A;  3D0Y A;  4DUQ A;  3HX4 A;  1S3P A;  3GK2 A;  3OB2 B;  1DF0 A;  4YGB B;  1YUS A;  4M2P A;  1YTZ C;  2NCP A;  5DIC A;  2L0P A;  4YI9 A;  5I8N A;  1J7R A;  5J3X A;  3R1O A;  2O5G A;  4I5K A;  5HKW A;  2VRG A;  1KK8 B;  3D74 A;  3CDN A;  1FI5 A;  1XFU O;  2L4I A;  5KU1 A;  1SKT A;  3TS5 C;  2LC5 A;  2HET A;  4JKT A;  1G8I A;  1S26 D;  2IS9 A;  2ZND A;  2E30 A;  3JVT C;  1J55 A;  2NXQ A;  4MRX A;  5DKN A;  2LCP A;  2NLN A;  2KGR A;  3I5F C;  2A4J A;  1K93 D;  1MR8 A;  3BUW B;  1ZFS A;  3CS1 A;  4N1G A;  1JFJ A;  1XK4 A;  1NUB A;  1A2X A;  2WCK A;  5AER A;  3DD4 A;  1YX7 A;  1WLZ A;  2Y1N A;  1NWD A;  2HPS A;  1CLL A;  1WLM A;  3PN7 C;  3VRP A;  1BU3 A;  3IVT A;  1OMV A;  1CLM A;  1LKJ A;  3KO0 A;  1GJY A;  1KQM B;  3HCM A;  2QPT A;  3F45 A;  2KBM A;  1B8C A;  1DGV A;  1Y6W A;  4F7F A;  1J1E A;  3DVE A;  1JUO A;  1S36 A;  1LS8 A;  3I5G B;  4P2Y B;  1V1G A;  4PCW A;  5DKR A;  3OGN A;  1B1G A;  1A75 A;  2M9G A;  1L7Z A;  5KSZ A;  3DY9 A;  1YR5 A;  1KFX S;  1IH0 A;  2K2A A;  1MUX A;  2M3W A;  2QEV A;  2M7L A;  2BEC A;  2ZN8 A;  1N0Y A;  4FQT A;  2FOT A;  5I94 A;  4USL A;  2K61 A;  2Q4U A;  4F0Z B;  2K0J A;  2L5Y A;  3SG6 A;  3S0F A;  2JC2 A;  2M8U A;  1DC1 A;  1CDP A;  1SBJ A;  1GQM A;  1HQV A;  1K9K A;  1CMF A;  2OTG B;  2KAX A;  2MHH A;  1F4O A;  1MHO A;  2OS8 C;  1TUZ A;  4A4B A;  3EK8 A;  3SG2 A;  1PRW A;  3B86 A;  4MEW A;  1M45 A;  4YBH B;  3D0Y B;  1EH2 A;  3O4Y A;  1DF0 B;  2AMI A;  1IJ6 A;  3M0W A;  5B8I B;  1P28 A;  5HL1 A;  1H8B A;  3EG5 B;  1J7Q A;  1ZOT B;  3BFB A;  3PLF B;  3TDI A;  2KPH A;  1LA3 A;  2JNX A;  2FJU B;  1KWO C;  3RZS A;  4M2Q A;  3VRQ A;  1GGZ A;  4QJ4 B;  1HT9 A;  2Q91 A;  3EVR A;  3VRN A;  3O4X A;  1SY9 A;  2SCP A;  1DMO A;  1CFF A;  4QJ5 B;  1AVS A;  1OW4 A;  3MSE B;  2L98 A;  1EJ3 A;  1W9Z A;  3CR4 X;  1CB1 A;  1KFX L;  1SYM A;  3O6B A;  3SJS A;  1MXE A;  3LLE A;  4DCK A;  2F8P A;  4OCI A;  1CFD A;  2BCA A;  2KI4 B;  5AFP A;  2G2B A;  2JZI A;  1N2D A;  1RK9 A;  2JU0 A;  2WCJ A;  2LMV A;  2CBL A;  2LP2 A;  5AAN A;  2PAL A;  2JT8 A;  2BKH B;  3E3R A;  3I5I B;  4HRG A;  4YGA A;  3SIB A;  3BFH A;  2KQ6 A;  4YGD B;  3WNX B;  2NCO A;  1CKK A;  1AJ4 A;  1QIV A;  1NIW A;  3PAT A;  1H4B A;  1LVC D;  1YX8 A;  4ETO A;  1UHJ A;  2F3Y A;  1A75 B;  5BPJ A;  4OZD A;  2ZN9 A;  2JQ6 A;  2Y1M A;  3L4L A;  1NCZ A;  3NSI A;  2BCX A;  2JXC A;  4XJK A;  2PSR A;  2LAN A;  3EK7 A;  3LK1 A;  1SK6 D;  2LAP A;  5HKZ A;  1QXP A;  3TDZ A;  1EXR A;  1NYA A;  1TTX A;  1XFX O;  1L2O C;  1S6C A;  1ALV A;  5CSN A;  1SRA A;  4C0J A;  1ZUZ A;  1F70 A;  4L9M A;  1K94 A;  1VRK A;  2MAZ A;  1A4P A;  3I5H C;  4PE1 A;  3VGO A;  1Y0V H;  1UHK A;  2JTZ A;  2CXJ A;  2GV5 A;  2K2F A;  4ORC B;  1SCM B;  2COL B;  5CSI A;  1DJH A;  1SSE B;  4INX A;  5KTY A;  4MRY A;  2E6W A;  3BXK A;  2K7B A;  1IQ3 A;  1SNL A;  2BCB A;  1QX7 A;  1JC2 A;  1A03 A;  1ZAC A;  3JVT B;  5GQQ C;  5FI2 A;  1SL7 A;  2PRU A;  1DEL A;  3CR2 A;  1UHI A;  2O60 A;  4PAL A;  3I5F B;  1UUS A;  3CTN A;  1S6J A;  3L4A A;  4WQ3 A;  1B47 A;  2LM5 A;  4GGN A;  5IBW A;  1TRF A;  2KHN A;  3R72 A;  1U5I A;  1CFC A;  1NPQ A;  2LMT A;  3FWC A;  1F71 A;  3CYZ A;  1OOH A;  5CPV A;  3PN7 B;  3FE9 A;  2R2I A;  1BG1 A;  1JF0 A;  3LL8 B;  1BLQ A;  1KQV A;  2M1K B;  2WCM A;  3PJI A;  2JPT A;  2WC8 A;  3GK4 X;  2L2C A;  2LUC A;  2F2P A;  4PE4 A;  2NZ0 A;  1UHN A;  1SW8 A;  2FCE A;  2EC6 B;  4GUK A;  4YGC B;  1IKU A;  4HRE E;  1KCY A;  1DJX A;  1KSO A;  2F2O A;  2KOT A;  1YVL A;  4IJ7 A;  1C3Y A;  5PAL A;  1M39 A;  2LVV A;  3K1E A;  1PK0 D;  4HSZ A;  4WRI A;  2KFH A;  2ZNE A;  3AAK A;  1TNW A;  1DTL A;  3IF7 A;  1DGU A;  3V2L A;  1PSB A;  3NHT A;  2M29 A;  1LXF C;  2I7A A;  3ICB A;  4CID A;  5K89 A;  4QJ3 B;  2GTE A;  2KI6 D;  4OKH A;  1UWO A;  2K7C A;  4MBE A;  1CLB A;  2L4H A;  3K21 A;  1B9A A;  4XJK B;  1CM1 A;  3PM8 A;  2OS8 B;  4KYN A;  2WC6 A;  3CGA A;  2M49 B;  1C3Z A;  2H8V A;  1TIZ A;  1BF5 A;  4I5N B;  3S0B A;  1TCO B;  1WY9 A;  3BUM B;  2M7N A;  4U8D A;  3WHU B;  2BE6 A;  1OSA A;  2V53 A;  3NSO A;  4JD9 A;  1J7P A;  1C7W A;  1FI6 A;  1XVJ A;  2JTT A;  2MA2 A;  4GGF C;  1Q80 A;  3PM2 A;  3FIA A;  3FWB A;  4HRH A;  2ZRS A;  1BOC A;  1S5G Y;  1IJ5 A;  1OMD A;  3NSL A;  4PE7 A;  1CM4 A;  3BUO B;  3AKB A;  2SAS A;  1E8A A;  1B4C A;  1YUT A;  5FYX A;  1QLS A;  1OE9 B;  1QX2 A;  2JPO A;  5I2L A;  1WDC B;  2OPO A;  3CR5 X;  1IIO A;  3DVJ A;  4CLN A;  1YUU A;  1YUR A;  4I5J A;  1KQM C;  1OQP A;  3VRR A;  4AOM A;  1CNP A;  4GFT A;  1FBV A;  2ZKM X;  4YRU A;  4I5L B;  1D1O A;  3NXA A;  1PUL A;  2WCF A;  1TWO A;  1EG4 A;  1CDN A;  3EKJ A;  5CSF A;  1QS7 A;  4PHN A;  1LIN A;  1B7T Y;  2GGZ A;  2AAO A;  3KF9 A;  1F4Q A;  1S5G Z;  5JOL A;  5HYD A;  1AJ5 A;  3N7H A;  1JSA A;  3DYE A;  4GPL B;  1AK8 A;  1OZS A;  2QDI A;  2P71 A;  1RRO A;  2L50 A;  2MJW B;  3BOW A;  5HLV A;  3ZWH A;  2H61 C;  1FPW A;  2EHB A;  3AKA A;  3S0A A;  2PVB A;  3DZT A;  1OOG A;  1QTX A;  1L2O B;  2I94 A;  1XFV O;  3Q8I A;  1EL4 A;  4NQG A;  2K7O A;  3OB1 B;  1OOJ A;  1TUJ A;  4N1F A;  4NDC A;  1QWV A;  2KLD A;  4GAO A;  4NDB A;  4CPV A;  1AP4 A;  3I5H B;  2FJY A;  3FE6 A;  3B6X A;  1QVI Y;  1R6P A;  2LVJ A;  1XFR A;  5HLO A;  1QLK A;  4GGF A;  1MF8 B;  1FW4 A;  1MQ1 A;  1NSH A;  2BL0 C;  1CTR A;  2MLE C;  2KAV A;  2ZRT A;  3RLZ A;  4DRW A;  1M31 A;  3UNW A;  1K96 A;  2M1U A;  1W7J B;  2MRD A;  1FF1 A;  2CT9 A;  4GBA A;  1UUR A;  2LLS A;  2K7D A;  2JOJ A;  3UO9 A;  1BMO A;  2KSP A;  2LHI A;  3NGV A;  1B7T Z;  2QAC A;  2Y4Q A;  4ORA B;  2RGI A;  1PAL A;  3CAB A;  4OVN F;  1NCY A;  2EGD A;  1TNX A;  4FTG A;  4P5O E;  2FCD A;  1B8R A;  3RM1 A;  1G33 A;  1DJG A;  5I2Q A;  3A8R A;  3BQ3 A;  5JJG A;  1BOD A;  5FI7 A;  1AHR A;  2AUC A;  2KI4 C;  2KQY A;  1DJY A;  5AXI A;  1QAS A;  4GNK B;  1RJV A;  5FI6 A;  1W7I B;  3CZ0 A;  3I5I C;  3TS5 B;  2DOQ A;  3O78 A;  1CFP A;  2LUX A;  1CMG A;  3SG3 A;  1KK7 Z;  2MBX A;  1JWD A;  1BR1 B;  1QVI Z;  3JTD C;  4WQ2 A;  2LE9 B;  1K95 A;  3DXL A;  1SMG A;  3VB1 A;  1UHH A;  4NDD A;  1IGV A;  2QEH A;  1GGW A;  1XA5 A;  5D69 A;  3BUX B;  2L5X B;  2L51 A; 
#chains in the Genus database with same CATH homology
 2HF5 A;  3TUY C;  1XYD A;  1BR4 B;  3OX6 A;  2BBN A;  1DJW A;  1LA0 A;  3CLN A;  4OV2 A;  3DVK A;  2PAS A;  2JT3 A;  3LCP C;  3BOW B;  4ICB A;  4MLW A;  1WRK A;  2P6B B;  5G08 A;  5ER4 X;  4YGE B;  3SIA A;  3OP0 A;  1SCM C;  3SG5 A;  5TNC A;  1TOP A;  1XFZ O;  4PHM A;  3PAL A;  3VRO A;  1SR6 C;  4AQJ A;  1G4Y R;  5ER5 A;  1SPY A;  4UPG A;  2KAY A;  3PFV A;  5CSJ A;  1IRJ A;  2ISD A;  1S6I A;  2KFF A;  4M2O A;  1K9P A;  4DS7 A;  1DT7 B;  1ALW A;  4C0L A;  4ORB B;  3OHM B;  1Y1U A;  1XFW O;  2CCM A;  2BE4 A;  4CFQ A;  2WND A;  2K8M B;  3DVM A;  1M63 B;  4Q04 A;  1KK8 C;  1B8L A;  1NX1 A;  1A29 A;  1TCF A;  1S1E A;  2I2R E;  4JPZ B;  1PVB A;  1M46 A;  1SL9 A;  4MZJ A;  1MXL C;  1RWY A;  2JWW A;  3CWG A;  4A4C A;  2CNP A;  2LHL A;  2TN4 A;  1KWO B;  4D1E A;  2B1U A;  2KI6 C;  2WCE A;  3GOF A;  3DF0 A;  2EC6 C;  2PMY A;  4ZCV A;  2LMU A;  1TNQ A;  2WOR A;  3PSR A;  4FQO A;  2LNK A;  1PVA A;  1BT6 A;  2G9B A;  2KDH A;  1XFY O;  1EG3 A;  2JT0 A;  1PSR A;  3I5G C;  1JBA A;  1U5I B;  1Y1X A;  1ZMZ A;  4MVF A;  1RTP 1;  2H2K A;  2LLT A;  2WOS A;  1F8H A;  3OX5 A;  1QIW A;  1NCX A;  2MLF C;  2ZFD A;  1DJZ A;  1DVI A;  4MZL A;  1IWQ A;  3QRX A;  1ODB A;  3KPX A;  3C1V A;  3BYA A;  1IG5 A;  2M97 A;  3ZNI A;  1C07 A;  3H4S E;  1OMR A;  1SL8 A;  2LLU A;  1J1D A;  5I2O A;  1UP5 A;  3EVU A;  1OZO A;  2BL0 B;  2OTG C;  1NX3 A;  1JF2 A;  1KFU S;  4MSP A;  2F3Z A;  3AAJ A;  1K8U A;  1CDM A;  3D10 A;  1CDL A;  1MWN A;  1R2U A;  2BKI B;  3LK0 A;  3GK1 A;  1NP8 A;  4IL1 A;  2KYF A;  4PDZ A;  1KK7 Y;  1F55 A;  3FS7 A;  3KEV A;  5HKY A;  4TNC A;  2KYC A;  1WDC C;  3NSK A;  1K90 D;  1C7V A;  2LP3 A;  1QV1 A;  1YVH A;  1YRT B;  2CTN A;  3EKH A;  4YI8 A;  4JWQ A;  3O2P A;  2KNE A;  1REC A;  4PHJ A;  1QX5 B;  3BUN B;  3A4U B;  2JRF A;  2HQ8 A;  2JUL A;  1IQ5 A;  4N5X A;  4PHK A;  1X02 A;  1TNP A;  1RFJ A;  4XYN A;  2LVI A;  1V1F A;  2GGM A;  4E68 A;  5DKQ A;  1DJI A;  2L2E A;  3DF0 B;  2I18 A;  2LVK A;  3JTD B;  3SG4 A;  4CFR A;  1XK4 C;  4R1E A;  4MN0 A;  1XO5 A;  4OR9 B;  1K2H A;  3EVV A;  1JFK A;  3WXA A;  4DIR A;  1YRU B;  5F6T A;  2D8N A;  2M0R A;  3SG7 A;  1QJT A;  1AUI B;  1QAT A;  2F33 A;  2BBM A;  2JXL A;  2KGB C;  4ZCU A;  5D7F A;  1QV0 A;  3KHE A;  2WCB A;  5AEQ A;  3TUY B;  1KFU L;  3IQO A;  4AQI A;  4PE0 A;  3TDU A;  1K9U A;  1BJF A;  2KBI A;  1TN4 A;  2LV7 A;  4BY5 A;  5HYD A;  2JNF A;  1SCV A;  4JQ0 D;  1NX2 A;  3TZ1 A;  1WRL A;  3CZT X;  3EK4 A;  1N65 A;  4MZK A;  3WHT B;  1SR6 B;  2H61 A;  1NX0 A;  1J7O A;  1F54 A;  2HQW A;  1KSM A;  2Y5I A;  1WRZ A;  2KFG A;  3IQQ A;  1Y1A A;  4BY4 A;  3D0Y A;  4DUQ A;  3HX4 A;  1S3P A;  3GK2 A;  3OB2 B;  1DF0 A;  4YGB B;  1YUS A;  4M2P A;  1YTZ C;  2NCP A;  2L0P A;  4YI9 A;  5I8N A;  1J7R A;  5J3X A;  2O5G A;  4I5K A;  5HKW A;  2VRG A;  1KK8 B;  1FI5 A;  1XFU O;  2L4I A;  5KU1 A;  1SKT A;  3TS5 C;  2LC5 A;  2HET A;  1G8I A;  1S26 D;  2IS9 A;  2ZND A;  2E30 A;  3JVT C;  1J55 A;  2NXQ A;  4MRX A;  5DKN A;  2LCP A;  2NLN A;  2KGR A;  3I5F C;  2A4J A;  1K93 D;  1MR8 A;  3BUW B;  1ZFS A;  3CS1 A;  4N1G A;  1JFJ A;  1XK4 A;  1NUB A;  1A2X A;  5AER A;  3DD4 A;  1YX7 A;  1WLZ A;  2Y1N A;  1NWD A;  2HPS A;  1CLL A;  1WLM A;  3PN7 C;  3VRP A;  1BU3 A;  1OMV A;  1CLM A;  1LKJ A;  3KO0 A;  1GJY A;  1KQM B;  3HCM A;  2QPT A;  3F45 A;  2KBM A;  1B8C A;  1DGV A;  1Y6W A;  1J1E A;  3DVE A;  1JUO A;  1S36 A;  4P2Y B;  3I5G B;  4PCW A;  1V1G A;  5DKR A;  4C0K A;  1B1G A;  1A75 A;  2M9G A;  1L7Z A;  5KSZ A;  1YR5 A;  1KFX S;  1IH0 A;  2K2A A;  1MUX A;  2M3W A;  2M7L A;  2BEC A;  2ZN8 A;  1N0Y A;  2FOT A;  4USL A;  2K61 A;  2Q4U A;  4F0Z B;  2K0J A;  3SG6 A;  2JC2 A;  2M8U A;  1CDP A;  1SBJ A;  1GQM A;  1HQV A;  1K9K A;  1CMF A;  2OTG B;  2KAX A;  2MHH A;  1F4O A;  1MHO A;  2OS8 C;  4A4B A;  3EK8 A;  3SG2 A;  1PRW A;  4MEW A;  1M45 A;  4YBH B;  3D0Y B;  1EH2 A;  3O4Y A;  1DF0 B;  2AMI A;  1IJ6 A;  3M0W A;  5B8I B;  1H8B A;  1J7Q A;  1ZOT B;  3PLF B;  3TDI A;  1LA3 A;  2JNX A;  2FJU B;  1KWO C;  4M2Q A;  3VRQ A;  1GGZ A;  4QJ4 B;  1HT9 A;  2Q91 A;  3EVR A;  3VRN A;  1DMO A;  1SY9 A;  2SCP A;  1CFF A;  4QJ5 B;  1AVS A;  3MSE B;  2L98 A;  1EJ3 A;  3CR4 X;  1CB1 A;  1KFX L;  1SYM A;  3O6B A;  3SJS A;  1MXE A;  3LLE A;  4DCK A;  2F8P A;  4OCI A;  1CFD A;  2BCA A;  2KI4 B;  5AFP A;  2G2B A;  2JZI A;  1N2D A;  1RK9 A;  2JU0 A;  2LMV A;  2CBL A;  2LP2 A;  5AAN A;  2PAL A;  2JT8 A;  2BKH B;  3E3R A;  3I5I B;  4HRG A;  4YGA A;  3SIB A;  2KQ6 A;  4YGD B;  3WNX B;  2NCO A;  1CKK A;  1AJ4 A;  1QIV A;  1NIW A;  3PAT A;  1H4B A;  1LVC D;  1YX8 A;  4ETO A;  1UHJ A;  2F3Y A;  1A75 B;  5BPJ A;  2ZN9 A;  2JQ6 A;  2Y1M A;  1NCZ A;  3NSI A;  2BCX A;  2JXC A;  4XJK A;  2PSR A;  2LAN A;  3EK7 A;  3LK1 A;  1SK6 D;  2LAP A;  5HKZ A;  1QXP A;  3TDZ A;  1EXR A;  1NYA A;  1TTX A;  1XFX O;  1L2O C;  1S6C A;  1ALV A;  5CSN A;  1SRA A;  4C0J A;  1ZUZ A;  1F70 A;  4L9M A;  1K94 A;  1VRK A;  2MAZ A;  1A4P A;  3I5H C;  4PE1 A;  3VGO A;  1Y0V H;  1UHK A;  2JTZ A;  2CXJ A;  2GV5 A;  2K2F A;  4ORC B;  1SCM B;  2COL B;  5CSI A;  1DJH A;  5KTY A;  4MRY A;  2E6W A;  3BXK A;  2K7B A;  1IQ3 A;  1SNL A;  2BCB A;  1QX7 A;  1JC2 A;  1A03 A;  1ZAC A;  3JVT B;  5GQQ C;  1SL7 A;  2PRU A;  4PAL A;  3CR2 A;  1UHI A;  2O60 A;  3I5F B;  1UUS A;  3CTN A;  1S6J A;  4WQ3 A;  1B47 A;  2LM5 A;  4GGN A;  5IBW A;  1TRF A;  2KHN A;  1CFC A;  1U5I A;  1NPQ A;  2LMT A;  3FWC A;  1F71 A;  5CPV A;  3PN7 B;  2R2I A;  1BG1 A;  1JF0 A;  3LL8 B;  1BLQ A;  1KQV A;  2M1K B;  2JPT A;  2WC8 A;  3GK4 X;  2LUC A;  2F2P A;  4PE4 A;  2NZ0 A;  1UHN A;  1SW8 A;  2FCE A;  2EC6 B;  4GUK A;  4YGC B;  1IKU A;  4HRE E;  1KCY A;  1DJX A;  1KSO A;  2F2O A;  2KOT A;  1YVL A;  5PAL A;  1M39 A;  2LVV A;  4HSZ A;  1PK0 D;  4WRI A;  2KFH A;  2ZNE A;  3AAK A;  1TNW A;  1DTL A;  3IF7 A;  1DGU A;  1PSB A;  2M29 A;  1LXF C;  2I7A A;  3ICB A;  4CID A;  5K89 A;  4QJ3 B;  2KI6 D;  4OKH A;  1UWO A;  2K7C A;  4MBE A;  1CLB A;  2L4H A;  3K21 A;  1B9A A;  4XJK B;  1CM1 A;  3PM8 A;  2OS8 B;  3CGA A;  2M49 B;  1TIZ A;  1BF5 A;  4I5N B;  1TCO B;  1WY9 A;  3BUM B;  2M7N A;  4U8D A;  3WHU B;  2BE6 A;  1OSA A;  2V53 A;  3NSO A;  1J7P A;  1C7W A;  1FI6 A;  1XVJ A;  2JTT A;  2MA2 A;  4GGF C;  1Q80 A;  3FIA A;  3FWB A;  4HRH A;  2ZRS A;  1BOC A;  1S5G Y;  1IJ5 A;  1OMD A;  3NSL A;  4PE7 A;  1CM4 A;  3BUO B;  3AKB A;  2SAS A;  1E8A A;  1B4C A;  1YUT A;  5FYX A;  1QLS A;  1OE9 B;  1QX2 A;  5I2L A;  1WDC B;  2OPO A;  3CR5 X;  3DVJ A;  4CLN A;  1YUU A;  1YUR A;  4I5J A;  1KQM C;  1OQP A;  3VRR A;  4AOM A;  1CNP A;  4GFT A;  1FBV A;  2ZKM X;  4YRU A;  4I5L B;  1D1O A;  3NXA A;  1PUL A;  2WCF A;  1EG4 A;  1CDN A;  3EKJ A;  5CSF A;  1QS7 A;  4PHN A;  1LIN A;  1B7T Y;  2GGZ A;  2AAO A;  3KF9 A;  1F4Q A;  1S5G Z;  5JOL A;  1AJ5 A;  1JSA A;  4GPL B;  1AK8 A;  1OZS A;  1RRO A;  2L50 A;  2MJW B;  3BOW A;  5HLV A;  3ZWH A;  2H61 C;  1FPW A;  2EHB A;  3AKA A;  2PVB A;  1QTX A;  1L2O B;  2I94 A;  1XFV O;  4NQG A;  1EL4 A;  2K7O A;  3OB1 B;  1OOJ A;  4N1F A;  4NDC A;  1AP4 A;  4GAO A;  4NDB A;  4CPV A;  3I5H B;  1QVI Y;  1R6P A;  2LVJ A;  5HLO A;  1QLK A;  4GGF A;  1MF8 B;  1FW4 A;  1MQ1 A;  1NSH A;  2BL0 C;  1CTR A;  2MLE C;  2KAV A;  2ZRT A;  3RLZ A;  4DRW A;  1M31 A;  1K96 A;  2M1U A;  1W7J B;  2MRD A;  1FF1 A;  2CT9 A;  4GBA A;  1UUR A;  2LLS A;  2K7D A;  2JOJ A;  1BMO A;  2KSP A;  2LHI A;  1B7T Z;  2QAC A;  2Y4Q A;  4ORA B;  2RGI A;  1PAL A;  4OVN F;  1NCY A;  2EGD A;  1TNX A;  4FTG A;  4P5O E;  2FCD A;  1B8R A;  3RM1 A;  1G33 A;  1DJG A;  5I2Q A;  3A8R A;  3BQ3 A;  5JJG A;  1BOD A;  1AHR A;  2AUC A;  2KI4 C;  2KQY A;  1DJY A;  5AXI A;  1QAS A;  4GNK B;  1RJV A;  1W7I B;  3I5I C;  3TS5 B;  2DOQ A;  3O78 A;  1CFP A;  2LUX A;  1CMG A;  3SG3 A;  1KK7 Z;  2MBX A;  1JWD A;  1BR1 B;  1QVI Z;  3JTD C;  4WQ2 A;  2LE9 B;  1K95 A;  1SMG A;  1UHH A;  4NDD A;  1IGV A;  1GGW A;  1XA5 A;  5D69 A;  3BUX B;  2L5X B;  2L51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...