1PVBA

X-ray structure of a new crystal form of pike 4.10 parvalbumin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
b'SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
molecule tags Calcium binding protein
source organism Esox lucius
publication title X-ray structure of a new crystal form of pike 4.10 beta parvalbumin.
pubmed doi rcsb
total genus 42
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pvbA00
4JPZB 3IQOA 3OX5A 1S3PA 1OOJA 1S6IA 5FYXA 2QPTA 2KGRA 3MSEB 3TS5B 1K93D 1TTXA 3PSRA 3GK1A 3O6BA 4OCIA 2KBMA 2KI4B 5I2OA 1FI6A 3JTDC 1TNPA 1NP8A 4NDDA 3FWBA 3JVTB 1G4YR 1C07A 2LVIA 2A4JA 1RK9A 1K2HA 1IQ5A 1NCYA 1SBJA 1CFDA 1M46A 2O5GA 2WC8A 1Y1UA 1DGUA 1DJYA 2ZNEA 2I2RE 1ZACA 1IG5A 4HRHA 1A03A 4CLNA 1DJWA 1AP4A 1F8HA 1BU3A 5I2QA 1EJ3A 4D1EA 1JWDA 3LK1A 2K2FA 2K61A 2JNXA 2KI4C 3EVUA 4MRXA 2JRFA 2JT0A 1UWOA 1SRAA 1QVIZ 1FPWA 5CSJA 3A4UB 2G2BA 1J7OA 4XYNA 2F3ZA 2O60A 1YX7A 1PVAA 3BOWB 5AEQA 3LK0A 1SNLA 1ALVA 2MAZA 4WRIA 1NX2A 3TS5C 1SYMA 5I2LA 1ZUZA 1J1DA 3LL8B 4FQOA 4PCWA 4HSZA 1WRKA 1K96A 1WDCB 2BL0B 2HF5A 4DCKA 3HX4A 1EL4A 4N1GA 1OMDA 1SY9A 1BOCA 1LXFC 1C7WA 1OSAA 2L4IA 1KWOB 1H8BA 1KWOC 2JPTA 3OX6A 2KQ6A 1NYAA 2KHNA 5K89A 3SG4A 4QJ5B 1JFKA 1XFWO 1TOPA 1CB1A 2KOTA 2LMUA 3F45A 2SCPA 2MHHA 1DTLA 4C0JA 2OTGC 2GGMA 2KYCA 1K9UA 2ZFDA 4N5XA 4YGCB 1WY9A 2JT3A 2M8UA 5CSIA 5AERA 1TCFA 1PRWA 3EK8A 3I5GB 2BKHB 3QRXA 4QJ4B 2E30A 2EHBA 2ZKMX 4GGFC 1JBAA 2AUCA 1XO5A 2PMYA 3JVTC 3NSLA 4P2YB 1QLKA 3RM1A 1G33A 2M97A 4MZKA 1BR4B 1K90D 2KYFA 3KHEA 1SK6D 1YVLA 4BY4A 1YUTA 1F54A 1K95A 3PALA 1V1GA 3RLZA 2L98A 1K9KA 1DVIA 1AUIB 1WDCC 5DKNA 2NXQA 1CMFA 1SL8A 1XVJA 1TNXA 2CXJA 1KFUS 2F2PA 2F33A 3I5IB 1DGVA 5ER5A 2LC5A 2NCOA 4YGAA 1ZFSA 1PULA 2JU0A 2M29A 5HKZA 1B1GA 3AKBA 1SL9A 1OE9B 4L9MA 1S5GZ 1F70A 4PALA 2JXLA 3TUYC 3FS7A 1SKTA 4MLWA 2FCEA 2HPSA 2WNDA 3DF0A 2K7CA 3I5HC 4PE1A 3NSIA 2I94A 3TZ1A 1F4OA 1QASA 2KAYA 2CTNA 4PDZA 4M2PA 3DD4A 1DJZA 2KAVA 2BL0C 1KSMA 1QLSA 1QTXA 5D69A 1CM1A 2BCAA 1NCZA 1ODBA 1RTP1 5KSZA 1F71A 1TNWA 2KNEA 2PALA 2LANA 1SCMC 1BODA 1KK8C 1CDMA 2BE4A 3AKAA 1NCXA 1VRKA 1U5IB 2P6BB 2F3YA 3GK2A 1CLLA 1SL7A 2CBLA 1FBVA 1C7VA 3JTDB 1A4PA 3I5FC 4WQ3A 3I5FB 1TRFA 3PATA 1OMVA 2L5XB 1NSHA 2LVKA 2RGIA 3BUXB 3SG2A 2CT9A 3CGAA 3KO0A 1UUSA 3E3RA 3EKHA 2IS9A 3TUYB 2FJUB 2ZN9A 3TDIA 1YURA 1QS7A 2BECA 4ORCB 1CM4A 1SCMB 2JTZA 4A4CA 1OZOA 4WQ2A 1S5GY 3SIAA 1KQVA 3SG5A 1CDPA 3A8RA 1LA0A 2LHIA 4GNKB 1WRZA 2Y1MA 1EH2A 2KFHA 2KI6C 4PHKA 3SJSA 4ZCVA 2H2KA 1B4CA 3GOFA 4CIDA 1DJHA 1V1FA 2LHLA 2LVJA 4GUKA 1KK8B 1KCYA 3GK4X 2WOSA 1ALWA 1S6CA 1QIVA 2NZ0A 3EVVA 1NIWA 5DKQA 1CKKA 1NX3A 2LUXA 1RJVA 2LVVA 2M7NA 1BR1B 1W7JB 4AOMA 2FCDA 2M1KB 3TDUA 1QX2A 2AAOA 1WLMA 2L2EA 1QATA 4I5JA 2E6WA 1B8LA 4NQGA 1XK4C 1PALA 2LAPA 1BJFA 1F4QA 2VRGA 3WHUB 1A29A 2KBIA 1E8AA 3CWGA 4GAOA 4MVFA 1CLBA 1JF2A 3OHMB 2K7DA 3OP0A 4MSPA 4UPGA 2GGZA 2JULA 3WXAA 4I5KA 4AQIA 4IL1A 2EC6C 2Y5IA 4I5NB 4ORBB 1J7RA 1N2DA 1YUSA 2WCBA 4PHJA 3EK7A 2KSPA 1ZMZA 1DJGA 1RECA 2HQ8A 5KU1A 5DKRA 2KFFA 1N65A 2LLUA 3D0YA 2MRDA 5PALA 1L2OB 1CFCA 3I5HB 4USLA 2OPOA 1AJ4A 2Y4QA 1BLQA 1CNPA 1J7QA 1IWQA 2LMVA 2WCEA 4PHNA 1IJ5A 1R2UA 3BQ3A 1MXEA 3ZNIA 1DJXA 1BMOA 1QVIY 3O4YA 2JC2A 1W7IB 5CSNA 1XFXO 1H4BA 4YRUA 3PM8A 2F2OA 3CS1A 2ZRSA 3VRRA 5CPVA 3PLFB 2I18A 3OB1B 1CFPA 2H61C 3CR4X 2L4HA 1CTRA 1XA5A 2BCBA 2KGBC 3DVJA 5JOLA 3VRNA 3C1VA 1YVHA 3AAJA 2JXCA 3KEVA 2KQYA 4R1EA 2K8MB 2D8NA 2MBXA 4HREE 5IBWA 2DOQA 1Y1XA 1SW8A 4GFTA 2G9BA 1S1EA 5G08A 4PE4A 1PVBA 3SG7A 2JQ6A 1M31A 2M7LA 2JNFA 1JFJA 3BXKA 5ER4X 2CNPA 1IQ3A 1TCOB 2BBNA 3DF0B 1QJTA 4XJKB 1XK4A 1M45A 1MQ1A 1YRTB 1TN4A 4DS7A 2LM5A 1Q80A 1CFFA 1XFVO 4GPLB 2H61A 3PN7C 1UHHA 5HLOA 3KF9A 3BYAA 2JZIA 4GGFA 1CDLA 4F0ZB 4AQJA 1B8CA 3FWCA 2MLFC 2K0JA 2EC6B 2Q91A 1J55A 2LUCA 4ORAB 5AFPA 1HQVA 2ZN8A 3CZTX 2WORA 1A2XA 5HKWA 2LMTA 4MZJA 2TN4A 4M2OA 5I8NA 3VRPA 1L2OC 3H4SE 1PK0D 4YI9A 1CMGA 1QX5B 1AHRA 3EK4A 3TDZA 3IF7A 2LLTA 3DVKA 2K2AA 1MWNA 3FIAA 1B7TZ 4DRWA 1CDNA 2PVBA 1BT6A 4C0KA 1FF1A 1S36A 4OKHA 1QV0A 2ISDA 2LNKA 3WHTB 1LVCD 1PSBA 1GJYA 1WLZA 3DVMA 1X02A 3ZWHA 1R6PA 3O2PA 3SG3A 1FW4A 2K7OA 1A75A 4FTGA 1KFUL 4PHMA 4BY5A 1KFXS 1XYDA 1JF0A 1NUBA 2BKIB 3DVEA 1BG1A 1AVSA 4MRYA 4MZLA 1BF5A 1AJ5A 1JC2A 1RWYA 3CTNA 2R2IA 5JJGA 3NSOA 1YX8A 2HQWA 4OR9B 4YI8A 1L7ZA 1TNQA 4PE0A 2LP3A 1DF0B 4E68A 4GBAA 1D1OA 1Y6WA 5AANA 2L51A 1RROA 1SR6B 3AAKA 4M2QA 1KQMB 2M49B 2KDHA 5GQQC 1UHKA 1QV1A 2JWWA 3WNXB 5HLVA 2PRUA 5J3XA 1UHNA 5D7FA 5F6TA 4DIRA 4MBEA 3VGOA 2ZNDA 3CR2A 3SIBA 4ETOA 1NPQA 2M1UA 3BOWA 4HRGA 2OS8B 1J7PA 4YGDB 4NDBA 1S6JA 1UHIA 1ZOTB 2WCFA 4OVNF 3SG6A 4XJKA 1G8IA 1NWDA 1UURA 2HETA 1YRUB 4CFRA 4N1FA 1SPYA 1KK7Z 1K8UA 3VROA 3O78A 1MF8B 2QACA 1YR5A 2V53A 5CSFA 4U8DA 2CCMA 1KK7Y 3LCPC 1DT7B 3NSKA 1OMRA 1TIZA 5B8IB 5AXIA 2LP2A 4A4BA 1LA3A 1XFZO 2EGDA 1OZSA 1NX1A 4TNCA 3K21A 4P5OE 1YTZC 1IGVA 1IKUA 1B47A 1IJ6A 2OTGB 2LLSA 2LV7A 2B1UA 3PFVA 2KAXA 1JUOA 2L0PA 1EXRA 2SASA 4ICBA 1GQMA 3BUNB 4PE7A 4YBHB 1QXPA 2LE9B 1F55A 1B8RA 3IQQA 1M39A 4CFQA 1SMGA 1B9AA 1K94A 2JOJA 2COLB 1M63B 1QX7A 1XFUO 4ZCUA 4NDCA 4MEWA 2MJWB 4OV2A 2JTTA 3CR5X 1OQPA 2FOTA 1MUXA 2M0RA 1UP5A 1K9PA 1NX0A 1DJIA 1EG4A 2F8PA 1DMOA 2KFGA 2BBMA 3BUOB 5BPJA 4YGBB 2NLNA 4Q04A 4DUQA 1DF0A 2JT8A 3CLNA 3VRQA 3D10A 1S26D 3D0YB 1AK8A 1XFYO 3KPXA 1SR6C 1KQMC 2KI6D 3ICBA 1U5IA 1SCVA 2BCXA 1LINA 1KSOA 1RFJA 1YUUA 4JQ0D 3I5GC 3OB2B 4YGEB 1IH0A 3BUWB 2Q4UA 2I7AA 2MA2A 4C0LA 2M3WA 3M0WA 1Y1AA 2NCPA 3PN7B 2ZRTA 3NXAA 2OS8C 1EG3A 1PSRA 1A75B 1B7TY 2LCPA 4GGNA 1GGWA 4JWQA 1UHJA 1Y0VH 1MHOA 1QIWA 2K7BA 1N0YA 5TNCA 2AMIA 2MLEC 3HCMA 5HKYA 4I5LB 5HYDA 1MR8A 4CPVA 1J1EA 2PASA 5KTYA 4MN0A 1GGZA 3LLEA 3EVRA 1KFXL 2L50A 2GV5A 3EKJA 1MXLC 2BE6A 1CLMA 2M9GA 3BUMB 3I5IC 1FI5A 1HT9A 1LKJA 2Y1NA 1WRLA 2PSRA 1IRJA 1JSAA 4QJ3B
chains in the Genus database with same CATH superfamily
4JPZB 3IQOA 3OX5A 1S3PA 1OOJA 1S6IA 5FYXA 2QPTA 3NHTA 2KGRA 3MSEB 3TS5B 1K93D 1TTXA 3PSRA 3GK1A 3O6BA 4OCIA 2KBMA 2KI4B 3EG5B 5I2OA 3JTDC 1FI6A 1TNPA 1NP8A 4NDDA 3FWBA 3JVTB 1G4YR 3L4LA 1C07A 2LVIA 2A4JA 1RK9A 1K2HA 1IQ5A 1NCYA 1SBJA 1CFDA 1M46A 2O5GA 2WC8A 1Y1UA 1DGUA 1DJYA 2ZNEA 2I2RE 1ZACA 1IG5A 4HRHA 1A03A 4CLNA 1DJWA 1AP4A 1F8HA 3B6XA 1BU3A 5I2QA 1TUZA 2WCJA 1EJ3A 4D1EA 1JWDA 3LK1A 2K2FA 1DELA 2K61A 2JNXA 2KI4C 3EVUA 4MRXA 2JRFA 2JT0A 1UWOA 1SRAA 1QVIZ 1FPWA 5CSJA 3A4UB 2G2BA 1J7OA 4XYNA 2F3ZA 3QMEA 2O60A 1YX7A 1PVAA 3BOWB 5AEQA 3LK0A 1SNLA 1ALVA 2MAZA 4WRIA 1NX2A 3TS5C 3FE8A 1SYMA 5I2LA 3CZ0A 1ZUZA 1J1DA 1Z4HA 3LL8B 4FQOA 4HSZA 1WRKA 1K96A 1LS8A 1WDCB 2BL0B 2HF5A 3HX4A 3R1PA 4OZDA 1EL4A 4N1GA 3D74A 1OMDA 2PYQA 1SY9A 3SS3A 1LXFC 1C7WA 1OSAA 2L4IA 1KWOB 1BOCA 1H8BA 1KWOC 2JPTA 3OX6A 2KQ6A 1NYAA 2KHNA 5K89A 3SG4A 4QJ5B 1JFKA 1XFWO 1TOPA 1CB1A 2KOTA 2LMUA 3F45A 2SCPA 2MHHA 1DTLA 4C0JA 2OTGC 2KLEA 2GGMA 2KYCA 1K9UA 2ZFDA 4N5XA 4YGCB 1WY9A 2JT3A 2M8UA 5CSIA 2WCMA 5AERA 1TCFA 1PRWA 3EK8A 3I5GB 2BAPA 2BKHB 3QRXA 4QJ4B 2E30A 2L5YA 2EHBA 2ZKMX 4GGFC 1JBAA 2AUCA 2WC5A 1XO5A 2PMYA 3JVTC 3NSLA 4P2YB 1QLKA 3RM1A 1G33A 2M97A 4MZKA 1BR4B 1K90D 2KYFA 3KHEA 1SK6D 1YVLA 4BY4A 1YUTA 1F54A 1K95A 3PALA 1V1GA 3RLZA 3B7AA 1ORGA 2L98A 1IIOA 1K9KA 2KLDA 1DVIA 1AUIB 1WDCC 5DKNA 2NXQA 2YGUA 1CMFA 1SL8A 1XVJA 1TNXA 2CXJA 1KFUS 2F2PA 2F33A 3I5IB 1DGVA 5ER5A 2LC5A 2NCOA 3CZ1A 4JD9A 3BFBA 1ZFSA 1P28A 4YGAA 1PULA 2JU0A 2M29A 5HKZA 1B1GA 3AKBA 1SL9A 1OE9B 4L9MA 1S5GZ 1F70A 2QEVA 4PALA 2JXLA 3TUYC 3FS7A 1SKTA 3O4XA 4MLWA 2FCEA 2HPSA 2WNDA 3DF0A 1T14A 2K7CA 3I5HC 4PE1A 3NSIA 2I94A 3TZ1A 1F4OA 1QASA 2KAYA 2CTNA 2P71A 4PDZA 4M2PA 3DD4A 1DJZA 2KAVA 2BL0C 1KSMA 1QLSA 1QTXA 5D69A 1CM1A 2BCAA 3R72A 1NCZA 1ODBA 1RTP1 5KSZA 1F71A 1TNWA 2ERBA 2KNEA 2WCHA 3CYZA 2PALA 2BNXA 2LANA 1SCMC 1BODA 1KK8C 1CDMA 2BE4A 3AKAA 1NCXA 1VRKA 1U5IB 1W9ZA 2P6BB 2F3YA 3GK2A 2WC6A 1CLLA 1SL7A 2CBLA 1FBVA 2PQLA 1C7VA 2FJYA 3JTDB 1A4PA 3I5FC 4WQ3A 3I5FB 1TRFA 3PATA 1OMVA 2L5XB 1NSHA 2LVKA 2RGIA 3BUXB 3OGNA 3SG2A 2CT9A 3CGAA 3KO0A 1UUSA 3E3RA 3EKHA 3PJIA 1DQEA 2IS9A 3TUYB 2FJUB 2ZN9A 3TDIA 1YURA 5D3OA 3FE6A 3K1EA 1QS7A 2BECA 4ORCB 3SS4A 1CM4A 1SCMB 2JTZA 4A4CA 1OZOA 4WQ2A 1S5GY 3SIAA 1KQVA 3RZSA 3SG5A 1CDPA 3A8RA 1LA0A 2LHIA 4GNKB 1WRZA 3FE9A 2Y1MA 1Z2CB 1EH2A 2KFHA 2KI6C 4PHKA 3SJSA 1DC1A 4ZCVA 2H2KA 1B4CA 3GOFA 4CIDA 1DJHA 3S0EA 1V1FA 2LHLA 2LVJA 4GUKA 1KK8B 1KCYA 3GK4X 2WOSA 4KYNA 1ALWA 1S6CA 1QIVA 2NZ0A 3EVVA 1NIWA 5DKQA 1CKKA 1OOGA 1NX3A 2LUXA 1RJVA 2LVVA 2M7NA 1BR1B 1W7JB 4AOMA 2FCDA 2M1KB 3V2LA 3TDUA 1QX2A 2AAOA 1WLMA 2L2EA 1QATA 4I5JA 2E6WA 1B8LA 4NQGA 5FI2A 1XK4C 1PALA 2LAPA 1BJFA 3N7HA 1F4QA 2VRGA 4FQTA 3WHUB 2K60A 1A29A 2KBIA 3L47A 1E8AA 3CWGA 4GAOA 4MVFA 1CLBA 1JF2A 3OHMB 2K7DA 3OP0A 4MSPA 4UPGA 4PT1A 2GGZA 2JULA 3WXAA 4I5KA 4AQIA 3S0FA 4IL1A 2EC6C 2Y5IA 2QEOA 4I5NB 4ORBB 2QEBA 1J7RA 1N2DA 1YUSA 2WCBA 4PHJA 3EK7A 2KSPA 1ZMZA 1DJGA 1RECA 2HQ8A 5KU1A 2WCKA 3D73A 5DKRA 2KFFA 1N65A 2LLUA 3D0YA 2MRDA 5PALA 1L2OB 1CFCA 3I5HB 4USLA 2OPOA 1AJ4A 2Y4QA 1BLQA 1CNPA 1J7QA 1IWQA 2LMVA 2WCEA 4PHNA 1IJ5A 4PCWA 3UO9A 1R2UA 3BQ3A 1MXEA 4INXA 3ZNIA 1DJXA 2QDIA 1BMOA 1QVIY 3O4YA 2JC2A 1W7IB 5CSNA 1XFXO 1H4BA 4YRUA 3PM8A 2F2OA 3CS1A 2ZRSA 3OBVA 3VRRA 1OOFA 3IVTA 5CPVA 3PLFB 2I18A 3OB1B 1CFPA 2H61C 2QEHA 3R1OA 4JKTA 5EL2A 3B86A 3CR4X 2L4HA 1CTRA 1XA5A 2BCBA 2H8VA 2KGBC 3DVJA 5JOLA 3S0BA 3C1VA 3VRNA 1YVHA 3AAJA 2JXCA 3KEVA 2KQYA 4R1EA 2K8MB 2D8NA 2MBXA 4HREE 5IBWA 2DOQA 5FI6A 1Y1XA 1QWVA 1SW8A 4GFTA 2G9BA 1S1EA 5G08A 4PE4A 1PVBA 3SG7A 2JQ6A 3UNWA 1M31A 2M7LA 2JNFA 1JFJA 3BXKA 5ER4X 2CNPA 1IQ3A 1TCOB 2JPOA 2BBNA 3DF0B 1QJTA 4XJKB 1XK4A 1M45A 1MQ1A 1YRTB 1TN4A 4DS7A 2LM5A 1Q80A 1CFFA 1XFVO 4GPLB 2H61A 3CZ2A 3PN7C 1UHHA 5HLOA 3KF9A 3BYAA 2JZIA 4GGFA 1CDLA 4F0ZB 4AQJA 1B8CA 3FWCA 2MLFC 2K0JA 2EC6B 2Q91A 3L4AA 1J55A 2LUCA 4ORAB 5AFPA 1HQVA 2ZN8A 3CZTX 2WORA 1A2XA 5HKWA 2LMTA 4MZJA 2TN4A 2P70A 4M2OA 5I8NA 2GTEA 3R1VA 1L2OC 3VRPA 3H4SE 1PK0D 4YI9A 1CMGA 1QX5B 4INWA 1AHRA 3EK4A 3TDZA 3IF7A 2LLTA 3DVKA 2K2AA 1MWNA 3FIAA 1B7TZ 4DRWA 1OOIX 1CDNA 2PVBA 3CABA 1BT6A 4C0KA 1FF1A 1S36A 4OKHA 1QV0A 3B87A 2ISDA 2LNKA 3WHTB 1LVCD 1PSBA 3D78A 3DZTA 3D75A 1GJYA 1WLZA 3DVMA 1X02A 3ZWHA 1R6PA 3O2PA 3SG3A 1FW4A 5DICA 2K7OA 1A75A 4FTGA 1KFUL 3S0GA 4PHMA 4BY5A 1KFXS 1XYDA 1JF0A 1NUBA 2BKIB 3DVEA 1BG1A 1AVSA 4MRYA 1TUJA 4MZLA 1BF5A 1AJ5A 1JC2A 1RWYA 3CTNA 2R2IA 5JJGA 3NSOA 1YX8A 2HQWA 4OR9B 4YI8A 5FI7A 1L7ZA 1TNQA 1OOHA 4PE0A 2LP3A 1DF0B 4E68A 4GBAA 4DCKA 1D1OA 1Y6WA 5AANA 2L51A 1RROA 1SR6B 3AAKA 4M2QA 1C3YA 1KQMB 2M49B 2KDHA 5GQQC 1UHKA 1QV1A 2JWWA 3WNXB 4F7FA 5HLVA 2PRUA 5J3XA 1UHNA 5D7FA 5F6TA 4DIRA 4MBEA 3VGOA 2ZNDA 3CR2A 3NHIA 3SIBA 4ETOA 3S0AA 1GM0A 1NPQA 2M1UA 3BOWA 4HRGA 2OS8B 1J7PA 4YGDB 1SSEB 4NDBA 1S6JA 1UHIA 1ZOTB 2WCFA 4OVNF 3SG6A 4XJKA 1G8IA 1NWDA 1UURA 2HETA 3PM2A 1YRUB 4CFRA 4N1FA 3D77A 1SPYA 1KK7Z 1K8UA 3VROA 3O78A 1MF8B 2QACA 1YR5A 2V53A 5CSFA 4U8DA 2CCMA 3CDNA 1KK7Y 3LCPC 1DT7B 3NSKA 1OMRA 1TIZA 5B8IB 5AXIA 2LP2A 3B88A 4A4BA 1LA3A 1XFZO 2EGDA 1OZSA 1NX1A 3S0DA 4TNCA 5HL1A 3K21A 4P5OE 1YTZC 1IGVA 1IKUA 1B47A 1IJ6A 3NGVA 2OTGB 2LLSA 2LV7A 2B1UA 3PFVA 2KAXA 1JUOA 2L0PA 1EXRA 2SASA 3BFHA 1GQMA 3BUNB 4ICBA 4PE7A 1QXPA 2LE9B 4YBHB 1F55A 1B8RA 3IQQA 1M39A 3SS5A 4CFQA 1SMGA 1B9AA 1K94A 2JOJA 2COLB 1M63B 1QX7A 1XFUO 4ZCUA 1C3ZA 4MEWA 2MJWB 4NDCA 2JTTA 4OV2A 3CR5X 1OQPA 2FOTA 1MUXA 2M0RA 1UP5A 1K9PA 1NX0A 1OW4A 1DJIA 3DXLA 1EG4A 2F8PA 3D76A 1DMOA 2KFGA 2BBMA 3BUOB 5BPJA 4YGBB 2NLNA 4Q04A 4DUQA 3BFAA 1DF0A 2JT8A 3CLNA 3VRQA 3D10A 1S26D 3D0YB 5I94A 1DEKA 1XFYO 3KPXA 1AK8A 1SR6C 1KQMC 2KI6D 3ICBA 2L2CA 2WCLA 1U5IA 1SCVA 2BCXA 1LINA 1KSOA 1RFJA 1YUUA 4JQ0D 3I5GC 3OB2B 4YGEB 1IH0A 3BUWB 2Q4UA 2I7AA 2MA2A 4C0LA 2M3WA 3M0WA 1Y1AA 4IJ7A 2NCPA 3PN7B 2ZRTA 3NXAA 2OS8C 1EG3A 1PSRA 2KPHA 1A75B 1B7TY 2LCPA 3DYEA 4GGNA 1GGWA 4JWQA 1UHJA 1Y0VH 1MHOA 1QIWA 3VB1A 2K7BA 3Q8IA 1N0YA 5TNCA 2AMIA 2MLEC 3HCMA 3DY9A 5HKYA 4I5LB 5HYDA 1MR8A 1TWOA 4CPVA 1J1EA 2PASA 5KTYA 4MN0A 1GGZA 1XFRA 3LLEA 3EVRA 1KFXL 3BJHA 2L50A 2GV5A 3EKJA 1MXLC 2BE6A 1CLMA 2M9GA 3BUMB 3I5IC 1FI5A 1HT9A 1LKJA 2Y1NA 1WRLA 2PSRA 1IRJA 1JSAA 4QJ3B
chains in the Genus database with same CATH topology
4JPZB 3IQOA 3OX5A 1S3PA 1OOJA 1S6IA 5FYXA 2QPTA 2KGRA 3MSEB 3TS5B 1K93D 1TTXA 3PSRA 3GK1A 3O6BA 4OCIA 2KBMA 2KI4B 5I2OA 1FI6A 3JTDC 1TNPA 1NP8A 4NDDA 3FWBA 3JVTB 1G4YR 1C07A 2LVIA 2A4JA 1RK9A 1K2HA 1IQ5A 1NCYA 1SBJA 1CFDA 1M46A 2O5GA 2WC8A 1Y1UA 1DGUA 1DJYA 2ZNEA 2I2RE 1ZACA 1IG5A 4HRHA 1A03A 4CLNA 1DJWA 1AP4A 1F8HA 1BU3A 5I2QA 1EJ3A 4D1EA 1JWDA 3LK1A 2K2FA 2K61A 2JNXA 2KI4C 3EVUA 4MRXA 2JRFA 2JT0A 1UWOA 1SRAA 1QVIZ 1FPWA 5CSJA 3A4UB 2G2BA 1J7OA 4XYNA 2F3ZA 2O60A 1YX7A 1PVAA 3BOWB 5AEQA 3LK0A 1SNLA 1ALVA 2MAZA 4WRIA 1NX2A 3TS5C 1SYMA 5I2LA 1ZUZA 1J1DA 3LL8B 4FQOA 4PCWA 4HSZA 1WRKA 1K96A 1WDCB 2BL0B 2HF5A 4DCKA 3HX4A 1EL4A 4N1GA 1OMDA 1SY9A 1BOCA 1LXFC 1C7WA 1OSAA 2L4IA 1KWOB 1H8BA 1KWOC 2JPTA 3OX6A 2KQ6A 1NYAA 2KHNA 5K89A 3SG4A 4QJ5B 1JFKA 1XFWO 1TOPA 1CB1A 2KOTA 2LMUA 3F45A 2SCPA 2MHHA 1DTLA 4C0JA 2OTGC 2GGMA 2KYCA 1K9UA 2ZFDA 4N5XA 4YGCB 1WY9A 2JT3A 2M8UA 5CSIA 5AERA 1TCFA 1PRWA 3EK8A 3I5GB 2BKHB 3QRXA 4QJ4B 2E30A 2EHBA 2ZKMX 4GGFC 1JBAA 2AUCA 1XO5A 2PMYA 3JVTC 3NSLA 4P2YB 1QLKA 3RM1A 1G33A 2M97A 4MZKA 1BR4B 1K90D 2KYFA 3KHEA 1SK6D 1YVLA 4BY4A 1YUTA 1F54A 1K95A 3PALA 1V1GA 3RLZA 2L98A 1K9KA 1DVIA 1AUIB 1WDCC 5DKNA 2NXQA 1CMFA 1SL8A 1XVJA 1TNXA 2CXJA 1KFUS 2F2PA 2F33A 3I5IB 1DGVA 5ER5A 2LC5A 2NCOA 4YGAA 1ZFSA 1PULA 2JU0A 2M29A 5HKZA 1B1GA 3AKBA 1SL9A 1OE9B 4L9MA 1S5GZ 1F70A 4PALA 2JXLA 3TUYC 3FS7A 1SKTA 4MLWA 2FCEA 2HPSA 2WNDA 3DF0A 2K7CA 3I5HC 4PE1A 3NSIA 2I94A 3TZ1A 1F4OA 1QASA 2KAYA 2CTNA 4PDZA 4M2PA 3DD4A 1DJZA 2KAVA 2BL0C 1KSMA 1QLSA 1QTXA 5D69A 1CM1A 2BCAA 1NCZA 1ODBA 1RTP1 5KSZA 1F71A 1TNWA 2KNEA 2PALA 2LANA 1SCMC 1BODA 1KK8C 1CDMA 2BE4A 3AKAA 1NCXA 1VRKA 1U5IB 2P6BB 2F3YA 3GK2A 1CLLA 1SL7A 2CBLA 1FBVA 1C7VA 3JTDB 1A4PA 3I5FC 4WQ3A 3I5FB 1TRFA 3PATA 1OMVA 2L5XB 1NSHA 2LVKA 2RGIA 3BUXB 3SG2A 2CT9A 3CGAA 3KO0A 1UUSA 3E3RA 3EKHA 2IS9A 3TUYB 2FJUB 2ZN9A 3TDIA 1YURA 1QS7A 2BECA 4ORCB 1CM4A 1SCMB 2JTZA 4A4CA 1OZOA 4WQ2A 1S5GY 3SIAA 1KQVA 3SG5A 1CDPA 3A8RA 1LA0A 2LHIA 4GNKB 1WRZA 2Y1MA 1EH2A 2KFHA 2KI6C 4PHKA 3SJSA 4ZCVA 2H2KA 1B4CA 3GOFA 4CIDA 1DJHA 1V1FA 2LHLA 2LVJA 4GUKA 1KK8B 1KCYA 3GK4X 2WOSA 1ALWA 1S6CA 1QIVA 2NZ0A 3EVVA 1NIWA 5DKQA 1CKKA 1NX3A 2LUXA 1RJVA 2LVVA 2M7NA 1BR1B 1W7JB 4AOMA 2FCDA 2M1KB 3TDUA 1QX2A 2AAOA 1WLMA 2L2EA 1QATA 4I5JA 2E6WA 1B8LA 4NQGA 1XK4C 1PALA 2LAPA 1BJFA 1F4QA 2VRGA 3WHUB 1A29A 2KBIA 1E8AA 3CWGA 4GAOA 4MVFA 1CLBA 1JF2A 3OHMB 2K7DA 3OP0A 4MSPA 4UPGA 2GGZA 2JULA 3WXAA 4I5KA 4AQIA 4IL1A 2EC6C 2Y5IA 4I5NB 4ORBB 1J7RA 1N2DA 1YUSA 2WCBA 4PHJA 3EK7A 2KSPA 1ZMZA 1DJGA 1RECA 2HQ8A 5KU1A 5DKRA 2KFFA 1N65A 2LLUA 3D0YA 2MRDA 5PALA 1L2OB 1CFCA 3I5HB 4USLA 2OPOA 1AJ4A 2Y4QA 1BLQA 1CNPA 1J7QA 1IWQA 2LMVA 2WCEA 4PHNA 1IJ5A 1R2UA 3BQ3A 1MXEA 3ZNIA 1DJXA 1BMOA 1QVIY 3O4YA 2JC2A 1W7IB 5CSNA 1XFXO 1H4BA 4YRUA 3PM8A 2F2OA 3CS1A 2ZRSA 3VRRA 5CPVA 3PLFB 2I18A 3OB1B 1CFPA 2H61C 3CR4X 2L4HA 1CTRA 1XA5A 2BCBA 2KGBC 3DVJA 5JOLA 3VRNA 3C1VA 1YVHA 3AAJA 2JXCA 3KEVA 2KQYA 4R1EA 2K8MB 2D8NA 2MBXA 4HREE 5IBWA 2DOQA 1Y1XA 1SW8A 4GFTA 2G9BA 1S1EA 5G08A 4PE4A 1PVBA 3SG7A 2JQ6A 1M31A 2M7LA 2JNFA 1JFJA 3BXKA 5ER4X 2CNPA 1IQ3A 1TCOB 2BBNA 3DF0B 1QJTA 4XJKB 1XK4A 1M45A 1MQ1A 1YRTB 1TN4A 4DS7A 2LM5A 1Q80A 1CFFA 1XFVO 4GPLB 2H61A 3PN7C 1UHHA 5HLOA 3KF9A 3BYAA 2JZIA 4GGFA 1CDLA 4F0ZB 4AQJA 1B8CA 3FWCA 2MLFC 2K0JA 2EC6B 2Q91A 1J55A 2LUCA 4ORAB 5AFPA 1HQVA 2ZN8A 3CZTX 2WORA 1A2XA 5HKWA 2LMTA 4MZJA 2TN4A 4M2OA 5I8NA 3VRPA 1L2OC 3H4SE 1PK0D 4YI9A 1CMGA 1QX5B 1AHRA 3EK4A 3TDZA 3IF7A 2LLTA 3DVKA 2K2AA 1MWNA 3FIAA 1B7TZ 4DRWA 1CDNA 2PVBA 1BT6A 4C0KA 1FF1A 1S36A 4OKHA 1QV0A 2ISDA 2LNKA 3WHTB 1LVCD 1PSBA 1GJYA 1WLZA 3DVMA 1X02A 3ZWHA 1R6PA 3O2PA 3SG3A 1FW4A 2K7OA 1A75A 4FTGA 1KFUL 4PHMA 4BY5A 1KFXS 1XYDA 1JF0A 1NUBA 2BKIB 3DVEA 1BG1A 1AVSA 4MRYA 4MZLA 1BF5A 1AJ5A 1JC2A 1RWYA 3CTNA 2R2IA 5JJGA 3NSOA 1YX8A 2HQWA 4OR9B 4YI8A 1L7ZA 1TNQA 4PE0A 2LP3A 1DF0B 4E68A 4GBAA 1D1OA 1Y6WA 5AANA 2L51A 1RROA 1SR6B 3AAKA 4M2QA 1KQMB 2M49B 2KDHA 5GQQC 1UHKA 1QV1A 2JWWA 3WNXB 5HLVA 2PRUA 5J3XA 1UHNA 5D7FA 5F6TA 4DIRA 4MBEA 3VGOA 2ZNDA 3CR2A 3SIBA 4ETOA 1NPQA 2M1UA 3BOWA 4HRGA 2OS8B 1J7PA 4YGDB 4NDBA 1S6JA 1UHIA 1ZOTB 2WCFA 4OVNF 3SG6A 4XJKA 1G8IA 1NWDA 1UURA 2HETA 1YRUB 4CFRA 4N1FA 1SPYA 1KK7Z 1K8UA 3VROA 3O78A 1MF8B 2QACA 1YR5A 2V53A 5CSFA 4U8DA 2CCMA 1KK7Y 3LCPC 1DT7B 3NSKA 1OMRA 1TIZA 5B8IB 5AXIA 2LP2A 4A4BA 1LA3A 1XFZO 2EGDA 1OZSA 1NX1A 4TNCA 3K21A 4P5OE 1YTZC 1IGVA 1IKUA 1B47A 1IJ6A 2OTGB 2LLSA 2LV7A 2B1UA 3PFVA 2KAXA 1JUOA 2L0PA 1EXRA 2SASA 4ICBA 1GQMA 3BUNB 4PE7A 4YBHB 1QXPA 2LE9B 1F55A 1B8RA 3IQQA 1M39A 4CFQA 1SMGA 1B9AA 1K94A 2JOJA 2COLB 1M63B 1QX7A 1XFUO 4ZCUA 4NDCA 4MEWA 2MJWB 4OV2A 2JTTA 3CR5X 1OQPA 2FOTA 1MUXA 2M0RA 1UP5A 1K9PA 1NX0A 1DJIA 1EG4A 2F8PA 1DMOA 2KFGA 2BBMA 3BUOB 5BPJA 4YGBB 2NLNA 4Q04A 4DUQA 1DF0A 2JT8A 3CLNA 3VRQA 3D10A 1S26D 3D0YB 1AK8A 1XFYO 3KPXA 1SR6C 1KQMC 2KI6D 3ICBA 1U5IA 1SCVA 2BCXA 1LINA 1KSOA 1RFJA 1YUUA 4JQ0D 3I5GC 3OB2B 4YGEB 1IH0A 3BUWB 2Q4UA 2I7AA 2MA2A 4C0LA 2M3WA 3M0WA 1Y1AA 2NCPA 3PN7B 2ZRTA 3NXAA 2OS8C 1EG3A 1PSRA 1A75B 1B7TY 2LCPA 4GGNA 1GGWA 4JWQA 1UHJA 1Y0VH 1MHOA 1QIWA 2K7BA 1N0YA 5TNCA 2AMIA 2MLEC 3HCMA 5HKYA 4I5LB 5HYDA 1MR8A 4CPVA 1J1EA 2PASA 5KTYA 4MN0A 1GGZA 3LLEA 3EVRA 1KFXL 2L50A 2GV5A 3EKJA 1MXLC 2BE6A 1CLMA 2M9GA 3BUMB 3I5IC 1FI5A 1HT9A 1LKJA 2Y1NA 1WRLA 2PSRA 1IRJA 1JSAA 4QJ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPZ B;  3IQO A;  3OX5 A;  1S3P A;  1OOJ A;  1S6I A;  5FYX A;  2QPT A;  2KGR A;  3MSE B;  3TS5 B;  1K93 D;  1TTX A;  3PSR A;  3GK1 A;  3O6B A;  4OCI A;  2KBM A;  2KI4 B;  5I2O A;  1FI6 A;  3JTD C;  1TNP A;  1NP8 A;  4NDD A;  3FWB A;  3JVT B;  1G4Y R;  1C07 A;  2LVI A;  2A4J A;  1RK9 A;  1K2H A;  1IQ5 A;  1NCY A;  1SBJ A;  1CFD A;  1M46 A;  2O5G A;  2WC8 A;  1Y1U A;  1DGU A;  1DJY A;  2ZNE A;  2I2R E;  1ZAC A;  1IG5 A;  4HRH A;  1A03 A;  4CLN A;  1DJW A;  1AP4 A;  1F8H A;  1BU3 A;  5I2Q A;  1EJ3 A;  4D1E A;  1JWD A;  3LK1 A;  2K2F A;  2K61 A;  2JNX A;  2KI4 C;  3EVU A;  4MRX A;  2JRF A;  2JT0 A;  1UWO A;  1SRA A;  1QVI Z;  1FPW A;  5CSJ A;  3A4U B;  2G2B A;  1J7O A;  4XYN A;  2F3Z A;  2O60 A;  1YX7 A;  1PVA A;  3BOW B;  5AEQ A;  3LK0 A;  1SNL A;  1ALV A;  2MAZ A;  4WRI A;  1NX2 A;  3TS5 C;  1SYM A;  5I2L A;  1ZUZ A;  1J1D A;  3LL8 B;  4FQO A;  4PCW A;  4HSZ A;  1WRK A;  1K96 A;  1WDC B;  2BL0 B;  2HF5 A;  4DCK A;  3HX4 A;  1EL4 A;  4N1G A;  1OMD A;  1SY9 A;  1BOC A;  1LXF C;  1C7W A;  1OSA A;  2L4I A;  1KWO B;  1H8B A;  1KWO C;  2JPT A;  3OX6 A;  2KQ6 A;  1NYA A;  2KHN A;  5K89 A;  3SG4 A;  4QJ5 B;  1JFK A;  1XFW O;  1TOP A;  1CB1 A;  2KOT A;  2LMU A;  3F45 A;  2SCP A;  2MHH A;  1DTL A;  4C0J A;  2OTG C;  2GGM A;  2KYC A;  1K9U A;  2ZFD A;  4N5X A;  4YGC B;  1WY9 A;  2JT3 A;  2M8U A;  5CSI A;  5AER A;  1TCF A;  1PRW A;  3EK8 A;  3I5G B;  2BKH B;  3QRX A;  4QJ4 B;  2E30 A;  2EHB A;  2ZKM X;  4GGF C;  1JBA A;  2AUC A;  1XO5 A;  2PMY A;  3JVT C;  3NSL A;  4P2Y B;  1QLK A;  3RM1 A;  1G33 A;  2M97 A;  4MZK A;  1BR4 B;  1K90 D;  2KYF A;  3KHE A;  1SK6 D;  1YVL A;  4BY4 A;  1YUT A;  1F54 A;  1K95 A;  3PAL A;  1V1G A;  3RLZ A;  2L98 A;  1K9K A;  1DVI A;  1AUI B;  1WDC C;  5DKN A;  2NXQ A;  1CMF A;  1SL8 A;  1XVJ A;  1TNX A;  2CXJ A;  1KFU S;  2F2P A;  2F33 A;  3I5I B;  1DGV A;  5ER5 A;  2LC5 A;  2NCO A;  4YGA A;  1ZFS A;  1PUL A;  2JU0 A;  2M29 A;  5HKZ A;  1B1G A;  3AKB A;  1SL9 A;  1OE9 B;  4L9M A;  1S5G Z;  1F70 A;  4PAL A;  2JXL A;  3TUY C;  3FS7 A;  1SKT A;  4MLW A;  2FCE A;  2HPS A;  2WND A;  3DF0 A;  2K7C A;  3I5H C;  4PE1 A;  3NSI A;  2I94 A;  3TZ1 A;  1F4O A;  1QAS A;  2KAY A;  2CTN A;  4PDZ A;  4M2P A;  3DD4 A;  1DJZ A;  2KAV A;  2BL0 C;  1KSM A;  1QLS A;  1QTX A;  5D69 A;  1CM1 A;  2BCA A;  1NCZ A;  1ODB A;  1RTP 1;  5KSZ A;  1F71 A;  1TNW A;  2KNE A;  2PAL A;  2LAN A;  1SCM C;  1BOD A;  1KK8 C;  1CDM A;  2BE4 A;  3AKA A;  1NCX A;  1VRK A;  1U5I B;  2P6B B;  2F3Y A;  3GK2 A;  1CLL A;  1SL7 A;  2CBL A;  1FBV A;  1C7V A;  3JTD B;  1A4P A;  3I5F C;  4WQ3 A;  3I5F B;  1TRF A;  3PAT A;  1OMV A;  2L5X B;  1NSH A;  2LVK A;  2RGI A;  3BUX B;  3SG2 A;  2CT9 A;  3CGA A;  3KO0 A;  1UUS A;  3E3R A;  3EKH A;  2IS9 A;  3TUY B;  2FJU B;  2ZN9 A;  3TDI A;  1YUR A;  1QS7 A;  2BEC A;  4ORC B;  1CM4 A;  1SCM B;  2JTZ A;  4A4C A;  1OZO A;  4WQ2 A;  1S5G Y;  3SIA A;  1KQV A;  3SG5 A;  1CDP A;  3A8R A;  1LA0 A;  2LHI A;  4GNK B;  1WRZ A;  2Y1M A;  1EH2 A;  2KFH A;  2KI6 C;  4PHK A;  3SJS A;  4ZCV A;  2H2K A;  1B4C A;  3GOF A;  4CID A;  1DJH A;  1V1F A;  2LHL A;  2LVJ A;  4GUK A;  1KK8 B;  1KCY A;  3GK4 X;  2WOS A;  1ALW A;  1S6C A;  1QIV A;  2NZ0 A;  3EVV A;  1NIW A;  5DKQ A;  1CKK A;  1NX3 A;  2LUX A;  1RJV A;  2LVV A;  2M7N A;  1BR1 B;  1W7J B;  4AOM A;  2FCD A;  2M1K B;  3TDU A;  1QX2 A;  2AAO A;  1WLM A;  2L2E A;  1QAT A;  4I5J A;  2E6W A;  1B8L A;  4NQG A;  1XK4 C;  1PAL A;  2LAP A;  1BJF A;  1F4Q A;  2VRG A;  3WHU B;  1A29 A;  2KBI A;  1E8A A;  3CWG A;  4GAO A;  4MVF A;  1CLB A;  1JF2 A;  3OHM B;  2K7D A;  3OP0 A;  4MSP A;  4UPG A;  2GGZ A;  2JUL A;  3WXA A;  4I5K A;  4AQI A;  4IL1 A;  2EC6 C;  2Y5I A;  4I5N B;  4ORB B;  1J7R A;  1N2D A;  1YUS A;  2WCB A;  4PHJ A;  3EK7 A;  2KSP A;  1ZMZ A;  1DJG A;  1REC A;  2HQ8 A;  5KU1 A;  5DKR A;  2KFF A;  1N65 A;  2LLU A;  3D0Y A;  2MRD A;  5PAL A;  1L2O B;  1CFC A;  3I5H B;  4USL A;  2OPO A;  1AJ4 A;  2Y4Q A;  1BLQ A;  1CNP A;  1J7Q A;  1IWQ A;  2LMV A;  2WCE A;  4PHN A;  1IJ5 A;  1R2U A;  3BQ3 A;  1MXE A;  3ZNI A;  1DJX A;  1BMO A;  1QVI Y;  3O4Y A;  2JC2 A;  1W7I B;  5CSN A;  1XFX O;  1H4B A;  4YRU A;  3PM8 A;  2F2O A;  3CS1 A;  2ZRS A;  3VRR A;  5CPV A;  3PLF B;  2I18 A;  3OB1 B;  1CFP A;  2H61 C;  3CR4 X;  2L4H A;  1CTR A;  1XA5 A;  2BCB A;  2KGB C;  3DVJ A;  5JOL A;  3VRN A;  3C1V A;  1YVH A;  3AAJ A;  2JXC A;  3KEV A;  2KQY A;  4R1E A;  2K8M B;  2D8N A;  2MBX A;  4HRE E;  5IBW A;  2DOQ A;  1Y1X A;  1SW8 A;  4GFT A;  2G9B A;  1S1E A;  5G08 A;  4PE4 A;  1PVB A;  3SG7 A;  2JQ6 A;  1M31 A;  2M7L A;  2JNF A;  1JFJ A;  3BXK A;  5ER4 X;  2CNP A;  1IQ3 A;  1TCO B;  2BBN A;  3DF0 B;  1QJT A;  4XJK B;  1XK4 A;  1M45 A;  1MQ1 A;  1YRT B;  1TN4 A;  4DS7 A;  2LM5 A;  1Q80 A;  1CFF A;  1XFV O;  4GPL B;  2H61 A;  3PN7 C;  1UHH A;  5HLO A;  3KF9 A;  3BYA A;  2JZI A;  4GGF A;  1CDL A;  4F0Z B;  4AQJ A;  1B8C A;  3FWC A;  2MLF C;  2K0J A;  2EC6 B;  2Q91 A;  1J55 A;  2LUC A;  4ORA B;  5AFP A;  1HQV A;  2ZN8 A;  3CZT X;  2WOR A;  1A2X A;  5HKW A;  2LMT A;  4MZJ A;  2TN4 A;  4M2O A;  5I8N A;  3VRP A;  1L2O C;  3H4S E;  1PK0 D;  4YI9 A;  1CMG A;  1QX5 B;  1AHR A;  3EK4 A;  3TDZ A;  3IF7 A;  2LLT A;  3DVK A;  2K2A A;  1MWN A;  3FIA A;  1B7T Z;  4DRW A;  1CDN A;  2PVB A;  1BT6 A;  4C0K A;  1FF1 A;  1S36 A;  4OKH A;  1QV0 A;  2ISD A;  2LNK A;  3WHT B;  1LVC D;  1PSB A;  1GJY A;  1WLZ A;  3DVM A;  1X02 A;  3ZWH A;  1R6P A;  3O2P A;  3SG3 A;  1FW4 A;  2K7O A;  1A75 A;  4FTG A;  1KFU L;  4PHM A;  4BY5 A;  1KFX S;  1XYD A;  1JF0 A;  1NUB A;  2BKI B;  3DVE A;  1BG1 A;  1AVS A;  4MRY A;  4MZL A;  1BF5 A;  1AJ5 A;  1JC2 A;  1RWY A;  3CTN A;  2R2I A;  5JJG A;  3NSO A;  1YX8 A;  2HQW A;  4OR9 B;  4YI8 A;  1L7Z A;  1TNQ A;  4PE0 A;  2LP3 A;  1DF0 B;  4E68 A;  4GBA A;  1D1O A;  1Y6W A;  5AAN A;  2L51 A;  1RRO A;  1SR6 B;  3AAK A;  4M2Q A;  1KQM B;  2M49 B;  2KDH A;  5GQQ C;  1UHK A;  1QV1 A;  2JWW A;  3WNX B;  5HLV A;  2PRU A;  5J3X A;  1UHN A;  5D7F A;  5F6T A;  4DIR A;  4MBE A;  3VGO A;  2ZND A;  3CR2 A;  3SIB A;  4ETO A;  1NPQ A;  2M1U A;  3BOW A;  4HRG A;  2OS8 B;  1J7P A;  4YGD B;  4NDB A;  1S6J A;  1UHI A;  1ZOT B;  2WCF A;  4OVN F;  3SG6 A;  4XJK A;  1G8I A;  1NWD A;  1UUR A;  2HET A;  1YRU B;  4CFR A;  4N1F A;  1SPY A;  1KK7 Z;  1K8U A;  3VRO A;  3O78 A;  1MF8 B;  2QAC A;  1YR5 A;  2V53 A;  5CSF A;  4U8D A;  2CCM A;  1KK7 Y;  3LCP C;  1DT7 B;  3NSK A;  1OMR A;  1TIZ A;  5B8I B;  5AXI A;  2LP2 A;  4A4B A;  1LA3 A;  1XFZ O;  2EGD A;  1OZS A;  1NX1 A;  4TNC A;  3K21 A;  4P5O E;  1YTZ C;  1IGV A;  1IKU A;  1B47 A;  1IJ6 A;  2OTG B;  2LLS A;  2LV7 A;  2B1U A;  3PFV A;  2KAX A;  1JUO A;  2L0P A;  1EXR A;  2SAS A;  4ICB A;  1GQM A;  3BUN B;  4PE7 A;  4YBH B;  1QXP A;  2LE9 B;  1F55 A;  1B8R A;  3IQQ A;  1M39 A;  4CFQ A;  1SMG A;  1B9A A;  1K94 A;  2JOJ A;  2COL B;  1M63 B;  1QX7 A;  1XFU O;  4ZCU A;  4NDC A;  4MEW A;  2MJW B;  4OV2 A;  2JTT A;  3CR5 X;  1OQP A;  2FOT A;  1MUX A;  2M0R A;  1UP5 A;  1K9P A;  1NX0 A;  1DJI A;  1EG4 A;  2F8P A;  1DMO A;  2KFG A;  2BBM A;  3BUO B;  5BPJ A;  4YGB B;  2NLN A;  4Q04 A;  4DUQ A;  1DF0 A;  2JT8 A;  3CLN A;  3VRQ A;  3D10 A;  1S26 D;  3D0Y B;  1AK8 A;  1XFY O;  3KPX A;  1SR6 C;  1KQM C;  2KI6 D;  3ICB A;  1U5I A;  1SCV A;  2BCX A;  1LIN A;  1KSO A;  1RFJ A;  1YUU A;  4JQ0 D;  3I5G C;  3OB2 B;  4YGE B;  1IH0 A;  3BUW B;  2Q4U A;  2I7A A;  2MA2 A;  4C0L A;  2M3W A;  3M0W A;  1Y1A A;  2NCP A;  3PN7 B;  2ZRT A;  3NXA A;  2OS8 C;  1EG3 A;  1PSR A;  1A75 B;  1B7T Y;  2LCP A;  4GGN A;  1GGW A;  4JWQ A;  1UHJ A;  1Y0V H;  1MHO A;  1QIW A;  2K7B A;  1N0Y A;  5TNC A;  2AMI A;  2MLE C;  3HCM A;  5HKY A;  4I5L B;  5HYD A;  1MR8 A;  4CPV A;  1J1E A;  2PAS A;  5KTY A;  4MN0 A;  1GGZ A;  3LLE A;  3EVR A;  1KFX L;  2L50 A;  2GV5 A;  3EKJ A;  1MXL C;  2BE6 A;  1CLM A;  2M9G A;  3BUM B;  3I5I C;  1FI5 A;  1HT9 A;  1LKJ A;  2Y1N A;  1WRL A;  2PSR A;  1IRJ A;  1JSA A;  4QJ3 B; 
#chains in the Genus database with same CATH topology
 4JPZ B;  3IQO A;  3OX5 A;  1S3P A;  1OOJ A;  1S6I A;  5FYX A;  2QPT A;  3NHT A;  2KGR A;  3MSE B;  3TS5 B;  1K93 D;  1TTX A;  3PSR A;  3GK1 A;  3O6B A;  4OCI A;  2KBM A;  2KI4 B;  3EG5 B;  5I2O A;  3JTD C;  1FI6 A;  1TNP A;  1NP8 A;  4NDD A;  3FWB A;  3JVT B;  1G4Y R;  3L4L A;  1C07 A;  2LVI A;  2A4J A;  1RK9 A;  1K2H A;  1IQ5 A;  1NCY A;  1SBJ A;  1CFD A;  1M46 A;  2O5G A;  2WC8 A;  1Y1U A;  1DGU A;  1DJY A;  2ZNE A;  2I2R E;  1ZAC A;  1IG5 A;  4HRH A;  1A03 A;  4CLN A;  1DJW A;  1AP4 A;  1F8H A;  3B6X A;  1BU3 A;  5I2Q A;  1TUZ A;  2WCJ A;  1EJ3 A;  4D1E A;  1JWD A;  3LK1 A;  2K2F A;  1DEL A;  2K61 A;  2JNX A;  2KI4 C;  3EVU A;  4MRX A;  2JRF A;  2JT0 A;  1UWO A;  1SRA A;  1QVI Z;  1FPW A;  5CSJ A;  3A4U B;  2G2B A;  1J7O A;  4XYN A;  2F3Z A;  3QME A;  2O60 A;  1YX7 A;  1PVA A;  3BOW B;  5AEQ A;  3LK0 A;  1SNL A;  1ALV A;  2MAZ A;  4WRI A;  1NX2 A;  3TS5 C;  3FE8 A;  1SYM A;  5I2L A;  3CZ0 A;  1ZUZ A;  1J1D A;  1Z4H A;  3LL8 B;  4FQO A;  4HSZ A;  1WRK A;  1K96 A;  1LS8 A;  1WDC B;  2BL0 B;  2HF5 A;  3HX4 A;  3R1P A;  4OZD A;  1EL4 A;  4N1G A;  3D74 A;  1OMD A;  2PYQ A;  1SY9 A;  3SS3 A;  1LXF C;  1C7W A;  1OSA A;  2L4I A;  1KWO B;  1BOC A;  1H8B A;  1KWO C;  2JPT A;  3OX6 A;  2KQ6 A;  1NYA A;  2KHN A;  5K89 A;  3SG4 A;  4QJ5 B;  1JFK A;  1XFW O;  1TOP A;  1CB1 A;  2KOT A;  2LMU A;  3F45 A;  2SCP A;  2MHH A;  1DTL A;  4C0J A;  2OTG C;  2KLE A;  2GGM A;  2KYC A;  1K9U A;  2ZFD A;  4N5X A;  4YGC B;  1WY9 A;  2JT3 A;  2M8U A;  5CSI A;  2WCM A;  5AER A;  1TCF A;  1PRW A;  3EK8 A;  3I5G B;  2BAP A;  2BKH B;  3QRX A;  4QJ4 B;  2E30 A;  2L5Y A;  2EHB A;  2ZKM X;  4GGF C;  1JBA A;  2AUC A;  2WC5 A;  1XO5 A;  2PMY A;  3JVT C;  3NSL A;  4P2Y B;  1QLK A;  3RM1 A;  1G33 A;  2M97 A;  4MZK A;  1BR4 B;  1K90 D;  2KYF A;  3KHE A;  1SK6 D;  1YVL A;  4BY4 A;  1YUT A;  1F54 A;  1K95 A;  3PAL A;  1V1G A;  3RLZ A;  3B7A A;  1ORG A;  2L98 A;  1IIO A;  1K9K A;  2KLD A;  1DVI A;  1AUI B;  1WDC C;  5DKN A;  2NXQ A;  2YGU A;  1CMF A;  1SL8 A;  1XVJ A;  1TNX A;  2CXJ A;  1KFU S;  2F2P A;  2F33 A;  3I5I B;  1DGV A;  5ER5 A;  2LC5 A;  2NCO A;  3CZ1 A;  4JD9 A;  3BFB A;  1ZFS A;  1P28 A;  4YGA A;  1PUL A;  2JU0 A;  2M29 A;  5HKZ A;  1B1G A;  3AKB A;  1SL9 A;  1OE9 B;  4L9M A;  1S5G Z;  1F70 A;  2QEV A;  4PAL A;  2JXL A;  3TUY C;  3FS7 A;  1SKT A;  3O4X A;  4MLW A;  2FCE A;  2HPS A;  2WND A;  3DF0 A;  1T14 A;  2K7C A;  3I5H C;  4PE1 A;  3NSI A;  2I94 A;  3TZ1 A;  1F4O A;  1QAS A;  2KAY A;  2CTN A;  2P71 A;  4PDZ A;  4M2P A;  3DD4 A;  1DJZ A;  2KAV A;  2BL0 C;  1KSM A;  1QLS A;  1QTX A;  5D69 A;  1CM1 A;  2BCA A;  3R72 A;  1NCZ A;  1ODB A;  1RTP 1;  5KSZ A;  1F71 A;  1TNW A;  2ERB A;  2KNE A;  2WCH A;  3CYZ A;  2PAL A;  2BNX A;  2LAN A;  1SCM C;  1BOD A;  1KK8 C;  1CDM A;  2BE4 A;  3AKA A;  1NCX A;  1VRK A;  1U5I B;  1W9Z A;  2P6B B;  2F3Y A;  3GK2 A;  2WC6 A;  1CLL A;  1SL7 A;  2CBL A;  1FBV A;  2PQL A;  1C7V A;  2FJY A;  3JTD B;  1A4P A;  3I5F C;  4WQ3 A;  3I5F B;  1TRF A;  3PAT A;  1OMV A;  2L5X B;  1NSH A;  2LVK A;  2RGI A;  3BUX B;  3OGN A;  3SG2 A;  2CT9 A;  3CGA A;  3KO0 A;  1UUS A;  3E3R A;  3EKH A;  3PJI A;  1DQE A;  2IS9 A;  3TUY B;  2FJU B;  2ZN9 A;  3TDI A;  1YUR A;  5D3O A;  3FE6 A;  3K1E A;  1QS7 A;  2BEC A;  4ORC B;  3SS4 A;  1CM4 A;  1SCM B;  2JTZ A;  4A4C A;  1OZO A;  4WQ2 A;  1S5G Y;  3SIA A;  1KQV A;  3RZS A;  3SG5 A;  1CDP A;  3A8R A;  1LA0 A;  2LHI A;  4GNK B;  1WRZ A;  3FE9 A;  2Y1M A;  1Z2C B;  1EH2 A;  2KFH A;  2KI6 C;  4PHK A;  3SJS A;  1DC1 A;  4ZCV A;  2H2K A;  1B4C A;  3GOF A;  4CID A;  1DJH A;  3S0E A;  1V1F A;  2LHL A;  2LVJ A;  4GUK A;  1KK8 B;  1KCY A;  3GK4 X;  2WOS A;  4KYN A;  1ALW A;  1S6C A;  1QIV A;  2NZ0 A;  3EVV A;  1NIW A;  5DKQ A;  1CKK A;  1OOG A;  1NX3 A;  2LUX A;  1RJV A;  2LVV A;  2M7N A;  1BR1 B;  1W7J B;  4AOM A;  2FCD A;  2M1K B;  3V2L A;  3TDU A;  1QX2 A;  2AAO A;  1WLM A;  2L2E A;  1QAT A;  4I5J A;  2E6W A;  1B8L A;  4NQG A;  5FI2 A;  1XK4 C;  1PAL A;  2LAP A;  1BJF A;  3N7H A;  1F4Q A;  2VRG A;  4FQT A;  3WHU B;  2K60 A;  1A29 A;  2KBI A;  3L47 A;  1E8A A;  3CWG A;  4GAO A;  4MVF A;  1CLB A;  1JF2 A;  3OHM B;  2K7D A;  3OP0 A;  4MSP A;  4UPG A;  4PT1 A;  2GGZ A;  2JUL A;  3WXA A;  4I5K A;  4AQI A;  3S0F A;  4IL1 A;  2EC6 C;  2Y5I A;  2QEO A;  4I5N B;  4ORB B;  2QEB A;  1J7R A;  1N2D A;  1YUS A;  2WCB A;  4PHJ A;  3EK7 A;  2KSP A;  1ZMZ A;  1DJG A;  1REC A;  2HQ8 A;  5KU1 A;  2WCK A;  3D73 A;  5DKR A;  2KFF A;  1N65 A;  2LLU A;  3D0Y A;  2MRD A;  5PAL A;  1L2O B;  1CFC A;  3I5H B;  4USL A;  2OPO A;  1AJ4 A;  2Y4Q A;  1BLQ A;  1CNP A;  1J7Q A;  1IWQ A;  2LMV A;  2WCE A;  4PHN A;  1IJ5 A;  4PCW A;  3UO9 A;  1R2U A;  3BQ3 A;  1MXE A;  4INX A;  3ZNI A;  1DJX A;  2QDI A;  1BMO A;  1QVI Y;  3O4Y A;  2JC2 A;  1W7I B;  5CSN A;  1XFX O;  1H4B A;  4YRU A;  3PM8 A;  2F2O A;  3CS1 A;  2ZRS A;  3OBV A;  3VRR A;  1OOF A;  3IVT A;  5CPV A;  3PLF B;  2I18 A;  3OB1 B;  1CFP A;  2H61 C;  2QEH A;  3R1O A;  4JKT A;  5EL2 A;  3B86 A;  3CR4 X;  2L4H A;  1CTR A;  1XA5 A;  2BCB A;  2H8V A;  2KGB C;  3DVJ A;  5JOL A;  3S0B A;  3C1V A;  3VRN A;  1YVH A;  3AAJ A;  2JXC A;  3KEV A;  2KQY A;  4R1E A;  2K8M B;  2D8N A;  2MBX A;  4HRE E;  5IBW A;  2DOQ A;  5FI6 A;  1Y1X A;  1QWV A;  1SW8 A;  4GFT A;  2G9B A;  1S1E A;  5G08 A;  4PE4 A;  1PVB A;  3SG7 A;  2JQ6 A;  3UNW A;  1M31 A;  2M7L A;  2JNF A;  1JFJ A;  3BXK A;  5ER4 X;  2CNP A;  1IQ3 A;  1TCO B;  2JPO A;  2BBN A;  3DF0 B;  1QJT A;  4XJK B;  1XK4 A;  1M45 A;  1MQ1 A;  1YRT B;  1TN4 A;  4DS7 A;  2LM5 A;  1Q80 A;  1CFF A;  1XFV O;  4GPL B;  2H61 A;  3CZ2 A;  3PN7 C;  1UHH A;  5HLO A;  3KF9 A;  3BYA A;  2JZI A;  4GGF A;  1CDL A;  4F0Z B;  4AQJ A;  1B8C A;  3FWC A;  2MLF C;  2K0J A;  2EC6 B;  2Q91 A;  3L4A A;  1J55 A;  2LUC A;  4ORA B;  5AFP A;  1HQV A;  2ZN8 A;  3CZT X;  2WOR A;  1A2X A;  5HKW A;  2LMT A;  4MZJ A;  2TN4 A;  2P70 A;  4M2O A;  5I8N A;  2GTE A;  3R1V A;  1L2O C;  3VRP A;  3H4S E;  1PK0 D;  4YI9 A;  1CMG A;  1QX5 B;  4INW A;  1AHR A;  3EK4 A;  3TDZ A;  3IF7 A;  2LLT A;  3DVK A;  2K2A A;  1MWN A;  3FIA A;  1B7T Z;  4DRW A;  1OOI X;  1CDN A;  2PVB A;  3CAB A;  1BT6 A;  4C0K A;  1FF1 A;  1S36 A;  4OKH A;  1QV0 A;  3B87 A;  2ISD A;  2LNK A;  3WHT B;  1LVC D;  1PSB A;  3D78 A;  3DZT A;  3D75 A;  1GJY A;  1WLZ A;  3DVM A;  1X02 A;  3ZWH A;  1R6P A;  3O2P A;  3SG3 A;  1FW4 A;  5DIC A;  2K7O A;  1A75 A;  4FTG A;  1KFU L;  3S0G A;  4PHM A;  4BY5 A;  1KFX S;  1XYD A;  1JF0 A;  1NUB A;  2BKI B;  3DVE A;  1BG1 A;  1AVS A;  4MRY A;  1TUJ A;  4MZL A;  1BF5 A;  1AJ5 A;  1JC2 A;  1RWY A;  3CTN A;  2R2I A;  5JJG A;  3NSO A;  1YX8 A;  2HQW A;  4OR9 B;  4YI8 A;  5FI7 A;  1L7Z A;  1TNQ A;  1OOH A;  4PE0 A;  2LP3 A;  1DF0 B;  4E68 A;  4GBA A;  4DCK A;  1D1O A;  1Y6W A;  5AAN A;  2L51 A;  1RRO A;  1SR6 B;  3AAK A;  4M2Q A;  1C3Y A;  1KQM B;  2M49 B;  2KDH A;  5GQQ C;  1UHK A;  1QV1 A;  2JWW A;  3WNX B;  4F7F A;  5HLV A;  2PRU A;  5J3X A;  1UHN A;  5D7F A;  5F6T A;  4DIR A;  4MBE A;  3VGO A;  2ZND A;  3CR2 A;  3NHI A;  3SIB A;  4ETO A;  3S0A A;  1GM0 A;  1NPQ A;  2M1U A;  3BOW A;  4HRG A;  2OS8 B;  1J7P A;  4YGD B;  1SSE B;  4NDB A;  1S6J A;  1UHI A;  1ZOT B;  2WCF A;  4OVN F;  3SG6 A;  4XJK A;  1G8I A;  1NWD A;  1UUR A;  2HET A;  3PM2 A;  1YRU B;  4CFR A;  4N1F A;  3D77 A;  1SPY A;  1KK7 Z;  1K8U A;  3VRO A;  3O78 A;  1MF8 B;  2QAC A;  1YR5 A;  2V53 A;  5CSF A;  4U8D A;  2CCM A;  3CDN A;  1KK7 Y;  3LCP C;  1DT7 B;  3NSK A;  1OMR A;  1TIZ A;  5B8I B;  5AXI A;  2LP2 A;  3B88 A;  4A4B A;  1LA3 A;  1XFZ O;  2EGD A;  1OZS A;  1NX1 A;  3S0D A;  4TNC A;  5HL1 A;  3K21 A;  4P5O E;  1YTZ C;  1IGV A;  1IKU A;  1B47 A;  1IJ6 A;  3NGV A;  2OTG B;  2LLS A;  2LV7 A;  2B1U A;  3PFV A;  2KAX A;  1JUO A;  2L0P A;  1EXR A;  2SAS A;  3BFH A;  1GQM A;  3BUN B;  4ICB A;  4PE7 A;  1QXP A;  2LE9 B;  4YBH B;  1F55 A;  1B8R A;  3IQQ A;  1M39 A;  3SS5 A;  4CFQ A;  1SMG A;  1B9A A;  1K94 A;  2JOJ A;  2COL B;  1M63 B;  1QX7 A;  1XFU O;  4ZCU A;  1C3Z A;  4MEW A;  2MJW B;  4NDC A;  2JTT A;  4OV2 A;  3CR5 X;  1OQP A;  2FOT A;  1MUX A;  2M0R A;  1UP5 A;  1K9P A;  1NX0 A;  1OW4 A;  1DJI A;  3DXL A;  1EG4 A;  2F8P A;  3D76 A;  1DMO A;  2KFG A;  2BBM A;  3BUO B;  5BPJ A;  4YGB B;  2NLN A;  4Q04 A;  4DUQ A;  3BFA A;  1DF0 A;  2JT8 A;  3CLN A;  3VRQ A;  3D10 A;  1S26 D;  3D0Y B;  5I94 A;  1DEK A;  1XFY O;  3KPX A;  1AK8 A;  1SR6 C;  1KQM C;  2KI6 D;  3ICB A;  2L2C A;  2WCL A;  1U5I A;  1SCV A;  2BCX A;  1LIN A;  1KSO A;  1RFJ A;  1YUU A;  4JQ0 D;  3I5G C;  3OB2 B;  4YGE B;  1IH0 A;  3BUW B;  2Q4U A;  2I7A A;  2MA2 A;  4C0L A;  2M3W A;  3M0W A;  1Y1A A;  4IJ7 A;  2NCP A;  3PN7 B;  2ZRT A;  3NXA A;  2OS8 C;  1EG3 A;  1PSR A;  2KPH A;  1A75 B;  1B7T Y;  2LCP A;  3DYE A;  4GGN A;  1GGW A;  4JWQ A;  1UHJ A;  1Y0V H;  1MHO A;  1QIW A;  3VB1 A;  2K7B A;  3Q8I A;  1N0Y A;  5TNC A;  2AMI A;  2MLE C;  3HCM A;  3DY9 A;  5HKY A;  4I5L B;  5HYD A;  1MR8 A;  1TWO A;  4CPV A;  1J1E A;  2PAS A;  5KTY A;  4MN0 A;  1GGZ A;  1XFR A;  3LLE A;  3EVR A;  1KFX L;  3BJH A;  2L50 A;  2GV5 A;  3EKJ A;  1MXL C;  2BE6 A;  1CLM A;  2M9G A;  3BUM B;  3I5I C;  1FI5 A;  1HT9 A;  1LKJ A;  2Y1N A;  1WRL A;  2PSR A;  1IRJ A;  1JSA A;  4QJ3 B; 
#chains in the Genus database with same CATH homology
 4JPZ B;  3IQO A;  3OX5 A;  1S3P A;  1OOJ A;  1S6I A;  5FYX A;  2QPT A;  2KGR A;  3MSE B;  3TS5 B;  1K93 D;  1TTX A;  3PSR A;  3GK1 A;  3O6B A;  4OCI A;  2KBM A;  2KI4 B;  5I2O A;  1FI6 A;  3JTD C;  1TNP A;  1NP8 A;  4NDD A;  3FWB A;  3JVT B;  1G4Y R;  1C07 A;  2LVI A;  2A4J A;  1RK9 A;  1K2H A;  1IQ5 A;  1NCY A;  1SBJ A;  1CFD A;  1M46 A;  2O5G A;  2WC8 A;  1Y1U A;  1DGU A;  1DJY A;  2ZNE A;  2I2R E;  1ZAC A;  1IG5 A;  4HRH A;  1A03 A;  4CLN A;  1DJW A;  1AP4 A;  1F8H A;  1BU3 A;  5I2Q A;  1EJ3 A;  4D1E A;  1JWD A;  3LK1 A;  2K2F A;  2K61 A;  2JNX A;  2KI4 C;  3EVU A;  4MRX A;  2JRF A;  2JT0 A;  1UWO A;  1SRA A;  1QVI Z;  1FPW A;  5CSJ A;  3A4U B;  2G2B A;  1J7O A;  4XYN A;  2F3Z A;  2O60 A;  1YX7 A;  1PVA A;  3BOW B;  5AEQ A;  3LK0 A;  1SNL A;  1ALV A;  2MAZ A;  4WRI A;  1NX2 A;  3TS5 C;  1SYM A;  5I2L A;  1ZUZ A;  1J1D A;  3LL8 B;  4FQO A;  4PCW A;  4HSZ A;  1WRK A;  1K96 A;  1WDC B;  2BL0 B;  2HF5 A;  4DCK A;  3HX4 A;  1EL4 A;  4N1G A;  1OMD A;  1SY9 A;  1BOC A;  1LXF C;  1C7W A;  1OSA A;  2L4I A;  1KWO B;  1H8B A;  1KWO C;  2JPT A;  3OX6 A;  2KQ6 A;  1NYA A;  2KHN A;  5K89 A;  3SG4 A;  4QJ5 B;  1JFK A;  1XFW O;  1TOP A;  1CB1 A;  2KOT A;  2LMU A;  3F45 A;  2SCP A;  2MHH A;  1DTL A;  4C0J A;  2OTG C;  2GGM A;  2KYC A;  1K9U A;  2ZFD A;  4N5X A;  4YGC B;  1WY9 A;  2JT3 A;  2M8U A;  5CSI A;  5AER A;  1TCF A;  1PRW A;  3EK8 A;  3I5G B;  2BKH B;  3QRX A;  4QJ4 B;  2E30 A;  2EHB A;  2ZKM X;  4GGF C;  1JBA A;  2AUC A;  1XO5 A;  2PMY A;  3JVT C;  3NSL A;  4P2Y B;  1QLK A;  3RM1 A;  1G33 A;  2M97 A;  4MZK A;  1BR4 B;  1K90 D;  2KYF A;  3KHE A;  1SK6 D;  1YVL A;  4BY4 A;  1YUT A;  1F54 A;  1K95 A;  3PAL A;  1V1G A;  3RLZ A;  2L98 A;  1K9K A;  1DVI A;  1AUI B;  1WDC C;  5DKN A;  2NXQ A;  1CMF A;  1SL8 A;  1XVJ A;  1TNX A;  2CXJ A;  1KFU S;  2F2P A;  2F33 A;  3I5I B;  1DGV A;  5ER5 A;  2LC5 A;  2NCO A;  4YGA A;  1ZFS A;  1PUL A;  2JU0 A;  2M29 A;  5HKZ A;  1B1G A;  3AKB A;  1SL9 A;  1OE9 B;  4L9M A;  1S5G Z;  1F70 A;  4PAL A;  2JXL A;  3TUY C;  3FS7 A;  1SKT A;  4MLW A;  2FCE A;  2HPS A;  2WND A;  3DF0 A;  2K7C A;  3I5H C;  4PE1 A;  3NSI A;  2I94 A;  3TZ1 A;  1F4O A;  1QAS A;  2KAY A;  2CTN A;  4PDZ A;  4M2P A;  3DD4 A;  1DJZ A;  2KAV A;  2BL0 C;  1KSM A;  1QLS A;  1QTX A;  5D69 A;  1CM1 A;  2BCA A;  1NCZ A;  1ODB A;  1RTP 1;  5KSZ A;  1F71 A;  1TNW A;  2KNE A;  2PAL A;  2LAN A;  1SCM C;  1BOD A;  1KK8 C;  1CDM A;  2BE4 A;  3AKA A;  1NCX A;  1VRK A;  1U5I B;  2P6B B;  2F3Y A;  3GK2 A;  1CLL A;  1SL7 A;  2CBL A;  1FBV A;  1C7V A;  3JTD B;  1A4P A;  3I5F C;  4WQ3 A;  3I5F B;  1TRF A;  3PAT A;  1OMV A;  2L5X B;  1NSH A;  2LVK A;  2RGI A;  3BUX B;  3SG2 A;  2CT9 A;  3CGA A;  3KO0 A;  1UUS A;  3E3R A;  3EKH A;  2IS9 A;  3TUY B;  2FJU B;  2ZN9 A;  3TDI A;  1YUR A;  1QS7 A;  2BEC A;  4ORC B;  1CM4 A;  1SCM B;  2JTZ A;  4A4C A;  1OZO A;  4WQ2 A;  1S5G Y;  3SIA A;  1KQV A;  3SG5 A;  1CDP A;  3A8R A;  1LA0 A;  2LHI A;  4GNK B;  1WRZ A;  2Y1M A;  1EH2 A;  2KFH A;  2KI6 C;  4PHK A;  3SJS A;  4ZCV A;  2H2K A;  1B4C A;  3GOF A;  4CID A;  1DJH A;  1V1F A;  2LHL A;  2LVJ A;  4GUK A;  1KK8 B;  1KCY A;  3GK4 X;  2WOS A;  1ALW A;  1S6C A;  1QIV A;  2NZ0 A;  3EVV A;  1NIW A;  5DKQ A;  1CKK A;  1NX3 A;  2LUX A;  1RJV A;  2LVV A;  2M7N A;  1BR1 B;  1W7J B;  4AOM A;  2FCD A;  2M1K B;  3TDU A;  1QX2 A;  2AAO A;  1WLM A;  2L2E A;  1QAT A;  4I5J A;  2E6W A;  1B8L A;  4NQG A;  1XK4 C;  1PAL A;  2LAP A;  1BJF A;  1F4Q A;  2VRG A;  3WHU B;  1A29 A;  2KBI A;  1E8A A;  3CWG A;  4GAO A;  4MVF A;  1CLB A;  1JF2 A;  3OHM B;  2K7D A;  3OP0 A;  4MSP A;  4UPG A;  2GGZ A;  2JUL A;  3WXA A;  4I5K A;  4AQI A;  4IL1 A;  2EC6 C;  2Y5I A;  4I5N B;  4ORB B;  1J7R A;  1N2D A;  1YUS A;  2WCB A;  4PHJ A;  3EK7 A;  2KSP A;  1ZMZ A;  1DJG A;  1REC A;  2HQ8 A;  5KU1 A;  5DKR A;  2KFF A;  1N65 A;  2LLU A;  3D0Y A;  2MRD A;  5PAL A;  1L2O B;  1CFC A;  3I5H B;  4USL A;  2OPO A;  1AJ4 A;  2Y4Q A;  1BLQ A;  1CNP A;  1J7Q A;  1IWQ A;  2LMV A;  2WCE A;  4PHN A;  1IJ5 A;  1R2U A;  3BQ3 A;  1MXE A;  3ZNI A;  1DJX A;  1BMO A;  1QVI Y;  3O4Y A;  2JC2 A;  1W7I B;  5CSN A;  1XFX O;  1H4B A;  4YRU A;  3PM8 A;  2F2O A;  3CS1 A;  2ZRS A;  3VRR A;  5CPV A;  3PLF B;  2I18 A;  3OB1 B;  1CFP A;  2H61 C;  3CR4 X;  2L4H A;  1CTR A;  1XA5 A;  2BCB A;  2KGB C;  3DVJ A;  5JOL A;  3VRN A;  3C1V A;  1YVH A;  3AAJ A;  2JXC A;  3KEV A;  2KQY A;  4R1E A;  2K8M B;  2D8N A;  2MBX A;  4HRE E;  5IBW A;  2DOQ A;  1Y1X A;  1SW8 A;  4GFT A;  2G9B A;  1S1E A;  5G08 A;  4PE4 A;  1PVB A;  3SG7 A;  2JQ6 A;  1M31 A;  2M7L A;  2JNF A;  1JFJ A;  3BXK A;  5ER4 X;  2CNP A;  1IQ3 A;  1TCO B;  2BBN A;  3DF0 B;  1QJT A;  4XJK B;  1XK4 A;  1M45 A;  1MQ1 A;  1YRT B;  1TN4 A;  4DS7 A;  2LM5 A;  1Q80 A;  1CFF A;  1XFV O;  4GPL B;  2H61 A;  3PN7 C;  1UHH A;  5HLO A;  3KF9 A;  3BYA A;  2JZI A;  4GGF A;  1CDL A;  4F0Z B;  4AQJ A;  1B8C A;  3FWC A;  2MLF C;  2K0J A;  2EC6 B;  2Q91 A;  1J55 A;  2LUC A;  4ORA B;  5AFP A;  1HQV A;  2ZN8 A;  3CZT X;  2WOR A;  1A2X A;  5HKW A;  2LMT A;  4MZJ A;  2TN4 A;  4M2O A;  5I8N A;  3VRP A;  1L2O C;  3H4S E;  1PK0 D;  4YI9 A;  1CMG A;  1QX5 B;  1AHR A;  3EK4 A;  3TDZ A;  3IF7 A;  2LLT A;  3DVK A;  2K2A A;  1MWN A;  3FIA A;  1B7T Z;  4DRW A;  1CDN A;  2PVB A;  1BT6 A;  4C0K A;  1FF1 A;  1S36 A;  4OKH A;  1QV0 A;  2ISD A;  2LNK A;  3WHT B;  1LVC D;  1PSB A;  1GJY A;  1WLZ A;  3DVM A;  1X02 A;  3ZWH A;  1R6P A;  3O2P A;  3SG3 A;  1FW4 A;  2K7O A;  1A75 A;  4FTG A;  1KFU L;  4PHM A;  4BY5 A;  1KFX S;  1XYD A;  1JF0 A;  1NUB A;  2BKI B;  3DVE A;  1BG1 A;  1AVS A;  4MRY A;  4MZL A;  1BF5 A;  1AJ5 A;  1JC2 A;  1RWY A;  3CTN A;  2R2I A;  5JJG A;  3NSO A;  1YX8 A;  2HQW A;  4OR9 B;  4YI8 A;  1L7Z A;  1TNQ A;  4PE0 A;  2LP3 A;  1DF0 B;  4E68 A;  4GBA A;  1D1O A;  1Y6W A;  5AAN A;  2L51 A;  1RRO A;  1SR6 B;  3AAK A;  4M2Q A;  1KQM B;  2M49 B;  2KDH A;  5GQQ C;  1UHK A;  1QV1 A;  2JWW A;  3WNX B;  5HLV A;  2PRU A;  5J3X A;  1UHN A;  5D7F A;  5F6T A;  4DIR A;  4MBE A;  3VGO A;  2ZND A;  3CR2 A;  3SIB A;  4ETO A;  1NPQ A;  2M1U A;  3BOW A;  4HRG A;  2OS8 B;  1J7P A;  4YGD B;  4NDB A;  1S6J A;  1UHI A;  1ZOT B;  2WCF A;  4OVN F;  3SG6 A;  4XJK A;  1G8I A;  1NWD A;  1UUR A;  2HET A;  1YRU B;  4CFR A;  4N1F A;  1SPY A;  1KK7 Z;  1K8U A;  3VRO A;  3O78 A;  1MF8 B;  2QAC A;  1YR5 A;  2V53 A;  5CSF A;  4U8D A;  2CCM A;  1KK7 Y;  3LCP C;  1DT7 B;  3NSK A;  1OMR A;  1TIZ A;  5B8I B;  5AXI A;  2LP2 A;  4A4B A;  1LA3 A;  1XFZ O;  2EGD A;  1OZS A;  1NX1 A;  4TNC A;  3K21 A;  4P5O E;  1YTZ C;  1IGV A;  1IKU A;  1B47 A;  1IJ6 A;  2OTG B;  2LLS A;  2LV7 A;  2B1U A;  3PFV A;  2KAX A;  1JUO A;  2L0P A;  1EXR A;  2SAS A;  4ICB A;  1GQM A;  3BUN B;  4PE7 A;  4YBH B;  1QXP A;  2LE9 B;  1F55 A;  1B8R A;  3IQQ A;  1M39 A;  4CFQ A;  1SMG A;  1B9A A;  1K94 A;  2JOJ A;  2COL B;  1M63 B;  1QX7 A;  1XFU O;  4ZCU A;  4NDC A;  4MEW A;  2MJW B;  4OV2 A;  2JTT A;  3CR5 X;  1OQP A;  2FOT A;  1MUX A;  2M0R A;  1UP5 A;  1K9P A;  1NX0 A;  1DJI A;  1EG4 A;  2F8P A;  1DMO A;  2KFG A;  2BBM A;  3BUO B;  5BPJ A;  4YGB B;  2NLN A;  4Q04 A;  4DUQ A;  1DF0 A;  2JT8 A;  3CLN A;  3VRQ A;  3D10 A;  1S26 D;  3D0Y B;  1AK8 A;  1XFY O;  3KPX A;  1SR6 C;  1KQM C;  2KI6 D;  3ICB A;  1U5I A;  1SCV A;  2BCX A;  1LIN A;  1KSO A;  1RFJ A;  1YUU A;  4JQ0 D;  3I5G C;  3OB2 B;  4YGE B;  1IH0 A;  3BUW B;  2Q4U A;  2I7A A;  2MA2 A;  4C0L A;  2M3W A;  3M0W A;  1Y1A A;  2NCP A;  3PN7 B;  2ZRT A;  3NXA A;  2OS8 C;  1EG3 A;  1PSR A;  1A75 B;  1B7T Y;  2LCP A;  4GGN A;  1GGW A;  4JWQ A;  1UHJ A;  1Y0V H;  1MHO A;  1QIW A;  2K7B A;  1N0Y A;  5TNC A;  2AMI A;  2MLE C;  3HCM A;  5HKY A;  4I5L B;  5HYD A;  1MR8 A;  4CPV A;  1J1E A;  2PAS A;  5KTY A;  4MN0 A;  1GGZ A;  3LLE A;  3EVR A;  1KFX L;  2L50 A;  2GV5 A;  3EKJ A;  1MXL C;  2BE6 A;  1CLM A;  2M9G A;  3BUM B;  3I5I C;  1FI5 A;  1HT9 A;  1LKJ A;  2Y1N A;  1WRL A;  2PSR A;  1IRJ A;  1JSA A;  4QJ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...