1PVBA

X-ray structure of a new crystal form of pike 4.10 parvalbumin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title X-ray structure of a new crystal form of pike 4.10 beta parvalbumin.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 42
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pvbA00
1PVAA 1KWOB 4UPGA 2G2BA 2KDHA 5G08A 2MAZA 3SJSA 2LMTA 1NCYA 1SCMB 4JWQA 2L4HA 1BG1A 2LVJA 3DVJA 3SG2A 5CSIA 1RJVA 4M2PA 2R2IA 3JVTB 1WRKA 1QIWA 1LVCD 2FJUB 2KQYA 3O2PA 1UHHA 2LCPA 2FCDA 2H2KA 4HRHA 1DF0A 1CLLA 4HSZA 1V1FA 1IKUA 2KBIA 4N1FA 3CR2A 5HLVA 3I5HC 1XFYO 2LUXA 1WLMA 2BE4A 1FF1A 2JPTA 3D0YA 2I94A 3BXKA 1NX1A 4BY4A 1K2HA 4MN0A 3SG7A 1AHRA 1OOJA 1W7IB 1KFXS 1QXPA 1XVJA 1J55A 2F3YA 1TOPA 3O78A 4WQ2A 1CTRA 1D1OA 1JUOA 1MXLC 1NSHA 3SG3A 1NUBA 1A4PA 1HT9A 1CDPA 1PALA 1Y6WA 2E6WA 2JWWA 1DJYA 3FS7A 4L9MA 3WHTB 3EK7A 5AFPA 4NDBA 5K89A 1S26D 1RTP1 1UURA 1YVHA 1RK9A 4FQOA 1J7OA 4N5XA 1KQVA 2BKHB 4ICBA 4AOMA 1YR5A 1KCYA 1TNPA 1JSAA 2P6BB 1OE9B 3I5HB 5HKWA 1QX7A 4YI9A 4PHJA 1Y0VH 1JWDA 4GGFA 3VRRA 2OS8B 1B8LA 1FI6A 1SW8A 2JXCA 3LCPC 1DF0B 1K9KA 1TNWA 4MVFA 1J1DA 2MA2A 3BUOB 1CM1A 1J1EA 4GAOA 4MSPA 1CLMA 2EGDA 2WC8A 1BU3A 3VRQA 2CXJA 3D10A 4YGBB 4YRUA 1KK8C 5BPJA 1IGVA 3NSIA 3DVKA 2L50A 4A4CA 2QPTA 3A8RA 2WNDA 3KF9A 1IQ5A 2CNPA 1NX2A 1SRAA 1HQVA 5CPVA 4DRWA 1JF2A 3CGAA 3KO0A 5HKZA 3LL8B 1B7TZ 1YUSA 1A03A 4MLWA 1KSOA 5KSZA 2JNXA 3BYAA 4MRXA 1CFFA 1TN4A 1S5GZ 4XJKA 4MRYA 1N65A 4E68A 1YTZC 2F3ZA 3AAKA 3OX6A 2JTTA 1B1GA 4PCWA 3BOWB 2F8PA 1FI5A 1AVSA 1UHIA 1KQMC 2JC2A 1F54A 1W7JB 2NZ0A 4WQ3A 2Y4QA 1PRWA 2K7CA 2LLSA 2JT8A 3NSKA 3CS1A 4I5NB 1RECA 3PN7B 2JNFA 3A4UB 2JXLA 2Q4UA 1KSMA 2M7LA 1CM4A 1SCMC 3CZTX 1CFDA 5JJGA 2NCPA 1WLZA 2NCOA 2Y5IA 2HQWA 3JVTC 5CSNA 2D8NA 2LHIA 5CSFA 4YGDB 4ORAB 3JTDC 2MLEC 1IH0A 1SKTA 4MZLA 1KQMB 3EKJA 3RM1A 2KYCA 1RROA 2KSPA 5CSJA 2BL0B 2ZFDA 1QVIZ 4USLA 1F8HA 1NCXA 2O60A 1AUIB 3IF7A 2I2RE 1DJHA 2OTGC 4CPVA 4XJKB 1M45A 1ZOTB 2LLUA 1IRJA 4JQ0D 3AKBA 2HPSA 1K8UA 1K95A 2LMVA 4QJ4B 1CLBA 3SG6A 2VRGA 5HYDA 2K7BA 1K94A 2HQ8A 1WRLA 4P5OE 3AKAA 3SIAA 2L98A 2BECA 2K7DA 2K8MB 3LK1A 4QJ3B 2KFGA 3VRNA 1NCZA 3EK4A 3FIAA 3JTDB 5ER4X 2WOSA 1BF5A 3KPXA 2KFHA 1YRUB 4GNKB 4DUQA 2KFFA 2F2OA 2KYFA 3WXAA 4C0KA 2OS8C 5I2LA 2LAPA 1S6JA 1L2OB 1X02A 2OTGB 3ZNIA 4P2YB 3PFVA 4NQGA 3DVMA 1MHOA 2FCEA 1LA3A 4YBHB 1ODBA 1DMOA 4GBAA 1SBJA 2KI4B 3TS5B 4ETOA 2H61A 2V53A 2PRUA 2KNEA 1YUTA 1DGUA 1EG3A 1JC2A 1ZMZA 1WY9A 1PSRA 2BE6A 1BOCA 3I5FB 1XFZO 3O6BA 1JFJA 2COLB 3PSRA 5AEQA 4ZCUA 3VGOA 4N1GA 2Y1NA 3SG4A 5D7FA 1B7TY 3WNXB 2K7OA 1M46A 1S1EA 3CR4X 3PALA 3GOFA 3M0WA 4R1EA 5GQQC 2LVVA 1CNPA 2KAYA 1MF8B 1K90D 1SNLA 2M9GA 2NLNA 1G4YR 1EH2A 1G8IA 3D0YB 3O4YA 4GGFC 5DKNA 3TZ1A 1CDMA 2K61A 1KFUS 2ZRSA 5ER5A 1CMGA 5FYXA 1AK8A 1BLQA 4PE4A 3IQOA 1QV0A 3PN7C 1CDNA 1C7VA 1R6PA 2CTNA 2KGBC 1KFUL 1F4OA 1XFUO 3OX5A 1J7RA 1A2XA 1QLKA 1S3PA 1KK7Z 2O5GA 3EVRA 4CLNA 1FBVA 3FWBA 3K21A 4F0ZB 1NIWA 1UUSA 2L2EA 5HLOA 1Q80A 1F55A 1N0YA 1R2UA 1DJGA 2M8UA 1BMOA 2ZN9A 1XFWO 1TCFA 3I5IB 4MEWA 1NP8A 4NDCA 1UHKA 1SCVA 4MZJA 2M97A 5J3XA 2KI6D 2LANA 1ZUZA 2BCBA 1MUXA 1YURA 2B1UA 2BL0C 4JPZB 5DKQA 4CIDA 2DOQA 4BY5A 1QVIY 2LM5A 2ISDA 1QS7A 3CWGA 3TDIA 2KQ6A 2AUCA 2SASA 1EXRA 3BUXB 1LA0A 1B8RA 1QIVA 1TCOB 2ZNDA 4M2QA 5TNCA 5KU1A 1CKKA 1VRKA 2MRDA 2K0JA 4YGAA 1YX7A 4QJ5B 1CMFA 1QV1A 5KTYA 2CT9A 1DVIA 2LNKA 1C07A 1MQ1A 3CTNA 3GK2A 4NDDA 2WCFA 3CLNA 1QX2A 2LP3A 1PK0D 4FTGA 4DIRA 3GK4X 1RWYA 1BR4B 2MHHA 3EVVA 2LV7A 4OV2A 1BJFA 1E8AA 2M49B 1CFCA 1PULA 3NSOA 2E30A 2RGIA 3KHEA 4HRGA 3TDZA 2GV5A 2L51A 1BT6A 1OQPA 1L2OC 2OPOA 2QACA 1F70A 1A29A 1BR1B 1N2DA 2CCMA 1AJ5A 4PHKA 4PHNA 2L4IA 2PASA 1OMDA 2TN4A 4WRIA 4PE1A 2KI4C 3TS5C 1XK4A 4PDZA 3OB1B 2LC5A 1DJWA 4C0JA 2BCAA 1NX3A 2ZKMX 1LINA 1QASA 2FOTA 1XFXO 2KAVA 2LVKA 2M29A 3I5FC 3LLEA 4AQIA 3E3RA 3I5GB 4TNCA 1IQ3A 1H8BA 1MR8A 1OMVA 4OKHA 1DJIA 5D69A 1Y1AA 1LKJA 2F33A 3VRPA 1SK6D 3ICBA 3DF0A 2PALA 1JFKA 1WDCC 2A4JA 2I7AA 1ZFSA 4PE7A 1DT7B 2HF5A 4GPLB 2L5XB 1EG4A 4GFTA 4IL1A 3BUMB 3NSLA 1UHNA 3MSEB 1XYDA 1XA5A 4PALA 1MWNA 1DJXA 2M0RA 1GGWA 3HCMA 2M7NA 1PSBA 2GGMA 3C1VA 1H4BA 3GK1A 4PHMA 2AAOA 3BQ3A 1C7WA 1DTLA 1YVLA 1SR6B 4M2OA 3EVUA 1SL9A 2EC6B 1AJ4A 2BCXA 4Q04A 1IG5A 3FWCA 2HETA 3HX4A 1Y1UA 4MZKA 3TUYB 4AQJA 1YX8A 1CFPA 3LK0A 5PALA 1WDCB 3EKHA 5JOLA 2GGZA 2H61C 1CB1A 4A4BA 3OP0A 2KGRA 2M1KB 3PLFB 1KK7Y 2BBMA 2KAXA 4YGEB 1KFXL 1J7PA 2JULA 1S5GY 2KOTA 1TNQA 4ORBB 2AMIA 2PVBA 2ZRTA 1QTXA 1UHJA 1A75A 3I5IC 1BODA 1L7ZA 1PVBA 1QJTA 2MLFC 2M1UA 1SL7A 3DF0B 5I2QA 5I2OA 3BOWA 1M39A 2JT0A 3OB2B 2LUCA 2M3WA 2BKIB 1K96A 1NYAA 1SY9A 1K9PA 1OSAA 2BBNA 4YGCB 1SMGA 2ZN8A 2CBLA 4OCIA 1YRTB 1SPYA 2ZNEA 1DGVA 1TRFA 1MXEA 1SYMA 2G9BA 1XO5A 2K2FA 1XFVO 3TDUA 1B47A 1U5IA 3WHUB 4D1EA 1ZACA 1M31A 1V1GA 1NPQA 5F6TA 4ZCVA 5I8NA 2KHNA 2K2AA 2L0PA 1FPWA 2LVIA 2JZIA 1S6IA 2WCEA 3OHMB 3PM8A 1B4CA 4ORCB 4CFQA 1K93D 1F71A 3EK8A 3QRXA 1ALWA 4YI8A 1AP4A 1M63B 1F4QA 1GGZA 3NXAA 3VROA 1TIZA 2F2PA 1IJ6A 1A75B 1G33A 5IBWA 2Y1MA 4U8DA 2JU0A 2JRFA 5AERA 1NWDA 4OVNF 3PATA 4OR9B 5AXIA 1UWOA 3ZWHA 3CR5X 1ALVA 1LXFC 1OZSA 1DJZA 1TNXA 1GQMA 1WRZA 2LHLA 1Y1XA 4I5KA 3I5GC 4CFRA 1QLSA 4I5LB 3KEVA 5AANA 5DKRA 1NX0A 1IWQA 1RFJA 5B8IB 1B9AA 1KK8B 4GUKA 1K9UA 3RLZA 4DCKA 2WCBA 2LP2A 2KI6C 2LE9B 4HREE 2SCPA 2JQ6A 1QATA 1QX5B 1KWOC 3H4SE 3IQQA 1B8CA 1IJ5A 1YUUA 3SG5A 2LMUA 3DVEA 2IS9A 2JTZA 2NXQA 1EL4A 4XYNA 2Q91A 1U5IB 3BUWB 4GGNA 4MBEA 3BUNB 1S36A 2I18A 5HKYA 1EJ3A 3F45A 1FW4A 1UP5A 1JF0A 1SR6C 3DD4A 2EC6C 1JBAA 1TTXA 2EHBA 4PE0A 2MBXA 2WORA 1SL8A 2JOJA 2MJWB 2LLTA 1OZOA 1S6CA 3TUYC 1OMRA 2JT3A 2PSRA 1GJYA 2KBMA 1CDLA 4C0LA 3AAJA 3SIBA 2PMYA 1XK4C 4DS7A 4I5JA 1J7QA
chains in the Genus database with same CATH superfamily
1PVAA 1KWOB 4UPGA 2QEOA 2G2BA 2KDHA 5G08A 2MAZA 3K1EA 3SJSA 2LMTA 1NCYA 1SCMB 4JWQA 2L4HA 1BG1A 2LVJA 3DVJA 3SG2A 5CSIA 1RJVA 4M2PA 2R2IA 3JVTB 1WRKA 1QIWA 1LVCD 2FJUB 2KQYA 3O2PA 1UHHA 2LCPA 2FCDA 2H2KA 4HRHA 1DF0A 1CLLA 3R1OA 1V1FA 4HSZA 1IKUA 3DYEA 2KBIA 4N1FA 3CR2A 5HLVA 3I5HC 3V2LA 1XFYO 2LUXA 1WLMA 2BE4A 1FF1A 3S0EA 2JPTA 3D0YA 2I94A 3BXKA 1NX1A 4BY4A 1K2HA 4MN0A 1OOFA 3SG7A 1AHRA 1OOJA 1W7IB 1KFXS 1QXPA 1XVJA 3CZ2A 5I94A 1J55A 2F3YA 1TOPA 3O78A 4WQ2A 1CTRA 1D1OA 1JUOA 2QEBA 1OOIX 1MXLC 1NSHA 2WCJA 3SG3A 1NUBA 1A4PA 1HT9A 1CDPA 1PALA 1Y6WA 2E6WA 2JWWA 1DJYA 3DXLA 1DQEA 3FS7A 3EK7A 4L9MA 3SS3A 4NDBA 3WHTB 5K89A 1S26D 1RTP1 1UURA 1YVHA 1RK9A 1Z4HA 4FQOA 4N5XA 1J7OA 2BKHB 2KPHA 1KQVA 4ICBA 4AOMA 3RZSA 1C3YA 1YR5A 1KCYA 1TNPA 1JSAA 2P6BB 1OE9B 3I5HB 5HKWA 1GM0A 1QX7A 4YI9A 4PHJA 1TUZA 1Y0VH 1JWDA 1TUJA 4GGFA 3VRRA 2OS8B 1B8LA 1FI6A 1SW8A 2JXCA 3LCPC 1DF0B 1K9KA 1TNWA 3B88A 4MVFA 1J1DA 2MA2A 3BUOB 1CM1A 1J1EA 4GAOA 4MSPA 1CLMA 1LS8A 2EGDA 2WC8A 1BU3A 3VRQA 2CXJA 3FE6A 3D10A 4YGBB 4YRUA 2FJYA 1KK8C 5BPJA 1IGVA 3NSIA 3DVKA 2L50A 4A4CA 3S0AA 2QPTA 3A8RA 2WNDA 3KF9A 1IQ5A 2CNPA 1NX2A 3PJIA 1SRAA 1HQVA 5CPVA 4DRWA 1JF2A 3CGAA 3KO0A 5HKZA 3LL8B 2KLDA 2QEVA 1B7TZ 1YUSA 1A03A 4MLWA 1KSOA 5KSZA 2JNXA 3BYAA 4MRXA 1CFFA 1TN4A 1S5GZ 2KLEA 4OZDA 4XJKA 4MRYA 1N65A 4E68A 1YTZC 2F3ZA 3AAKA 3OX6A 2JTTA 1B1GA 4PCWA 3BOWB 3CABA 2F8PA 1FI5A 1AVSA 1UHIA 1KQMC 2JC2A 4IJ7A 1F54A 1W7JB 2NZ0A 3B6XA 4WQ3A 5DICA 2Y4QA 1PRWA 2K7CA 2LLSA 2JT8A 3BFBA 3FE9A 3NSKA 3CS1A 3D78A 3D77A 1RECA 4I5NB 3PN7B 2JNFA 3A4UB 3UNWA 2JXLA 2Q4UA 1KSMA 2M7LA 1CM4A 2H8VA 1SCMC 4FQTA 3CZTX 1CFDA 5JJGA 2NCPA 1WLZA 2NCOA 2Y5IA 2HQWA 2WC6A 3JVTC 5CSNA 2D8NA 2LHIA 5CSFA 4YGDB 2GTEA 4ORAB 3JTDC 2MLEC 1IH0A 1SKTA 4MZLA 1KQMB 3EKJA 3RM1A 2KYCA 1RROA 2KSPA 5CSJA 2BL0B 2ZFDA 3CZ1A 1QVIZ 4USLA 1F8HA 1NCXA 2O60A 1AUIB 3IF7A 2I2RE 1DJHA 2OTGC 4CPVA 3CDNA 4XJKB 1M45A 1ZOTB 2LLUA 1IRJA 4JQ0D 3CYZA 3AKBA 2HPSA 4INWA 1K8UA 1K95A 2LMVA 4QJ4B 1CLBA 3FE8A 2VRGA 3SG6A 5HYDA 2K7BA 1K94A 2HQ8A 2QDIA 1WRLA 4P5OE 3AKAA 3SIAA 2L98A 2BECA 2K7DA 2K8MB 3LK1A 4QJ3B 2KFGA 3SS4A 1NCZA 3VRNA 3EK4A 3FIAA 3JTDB 5ER4X 2WOSA 1BF5A 3KPXA 2KFHA 1YRUB 4GNKB 4DUQA 2KFFA 2F2OA 3S0DA 2KYFA 3L4LA 3WXAA 4C0KA 2OS8C 5I2LA 2LAPA 1S6JA 1L2OB 1X02A 2OTGB 3ZNIA 4P2YB 3PFVA 4NQGA 3DVMA 1MHOA 2FCEA 1LA3A 4YBHB 1ODBA 1DMOA 4GBAA 1SBJA 2KI4B 3TS5B 3NHIA 2H61A 4ETOA 2V53A 2PRUA 2KNEA 1YUTA 1OOHA 1DGUA 1EG3A 3BJHA 1JC2A 1ZMZA 5FI7A 1WY9A 1PSRA 2BE6A 1BOCA 3I5FB 2BNXA 1XFZO 3O6BA 3EG5B 1JFJA 5D3OA 2COLB 3PSRA 5AEQA 4ZCUA 3VGOA 4N1GA 1ORGA 2Y1NA 3SG4A 5D7FA 3NHTA 1B7TY 3WNXB 1IIOA 2K7OA 1M46A 1S1EA 3CR4X 3D76A 3PALA 3GOFA 3M0WA 4R1EA 5GQQC 2LVVA 1OOGA 3IVTA 1CNPA 1DEKA 2KAYA 1MF8B 1K90D 1SNLA 2M9GA 2NLNA 1G4YR 1EH2A 1G8IA 3D0YB 3R1VA 3BFAA 3O4YA 2WC5A 4GGFC 5DKNA 3TZ1A 1CDMA 2K61A 1KFUS 2ZRSA 5ER5A 1CMGA 5FYXA 1AK8A 3DZTA 1BLQA 4PE4A 3IQOA 1QV0A 3PN7C 1CDNA 1C7VA 1R6PA 2CTNA 2KGBC 1KFUL 1F4OA 1XFUO 3OX5A 1J7RA 1A2XA 1QLKA 1S3PA 1KK7Z 2O5GA 3EVRA 4CLNA 1FBVA 3FWBA 3K21A 4F0ZB 1NIWA 1UUSA 2L2EA 3O4XA 1Q80A 5HLOA 1N0YA 1F55A 1R2UA 1DJGA 2M8UA 1BMOA 3SS5A 2ZN9A 1XFWO 1TCFA 3I5IB 4MEWA 1NP8A 4NDCA 1UHKA 1SCVA 2WCHA 3L4AA 4MZJA 2M97A 5J3XA 2KI6D 2LANA 1ZUZA 2BCBA 1MUXA 1YURA 2B1UA 2BL0C 4JPZB 5DKQA 4CIDA 2DOQA 4BY5A 1QVIY 3BFHA 2LM5A 2ISDA 3D74A 1QS7A 3CWGA 3TDIA 1W9ZA 2AUCA 2KQ6A 1EXRA 2SASA 3BUXB 1LA0A 1B8RA 1QIVA 1TCOB 2ZNDA 3OGNA 4M2QA 5TNCA 5KU1A 1CKKA 1VRKA 2MRDA 2K0JA 4YGAA 1YX7A 4QJ5B 1CMFA 1QV1A 5KTYA 2CT9A 1DVIA 2LNKA 1C07A 1MQ1A 3CTNA 3NGVA 3GK2A 4NDDA 2WCFA 3CLNA 2JPOA 1QX2A 2ERBA 2LP3A 1DC1A 1PK0D 4FTGA 4DIRA 3GK4X 1RWYA 1BR4B 2P70A 2MHHA 3EVVA 2LV7A 4OV2A 1BJFA 1E8AA 1TWOA 2M49B 1CFCA 1PULA 3NSOA 2E30A 2RGIA 3KHEA 4HRGA 3TDZA 2GV5A 2L51A 1BT6A 1OQPA 1Z2CB 1L2OC 2OPOA 2QACA 3B87A 1A29A 1F70A 1BR1B 1N2DA 2CCMA 3DY9A 1AJ5A 4PHKA 4PHNA 4JKTA 2L4IA 2PASA 1OMDA 2TN4A 4WRIA 4PE1A 2KI4C 3TS5C 1XK4A 4PDZA 3OB1B 2LC5A 1DJWA 4C0JA 2BCAA 1NX3A 2ZKMX 1LINA 1QASA 2FOTA 1XFXO 2KAVA 2LVKA 2M29A 3I5FC 3LLEA 4AQIA 3E3RA 3I5GB 4TNCA 1IQ3A 1H8BA 1MR8A 1OMVA 4OKHA 1DJIA 5D69A 1Y1AA 1LKJA 2F33A 3VRPA 1SK6D 2L5YA 3ICBA 3DF0A 2PALA 1JFKA 1WDCC 2A4JA 2I7AA 3D73A 1ZFSA 4PE7A 1DT7B 1T14A 2HF5A 4GPLB 4INXA 2L5XB 1EG4A 2P71A 4GFTA 2K60A 3BUMB 3NSLA 4IL1A 1UHNA 3MSEB 1XYDA 1XA5A 4PALA 1MWNA 1DJXA 2M0RA 1GGWA 3HCMA 2M7NA 1PSBA 2GGMA 3C1VA 3S0GA 3GK1A 4PHMA 1H4BA 2AAOA 3BQ3A 1C7WA 1DTLA 1YVLA 1SR6B 4M2OA 3EVUA 1SL9A 2EC6B 1AJ4A 3N7HA 2BCXA 4Q04A 1IG5A 3FWCA 2HETA 3HX4A 1Y1UA 3Q8IA 4MZKA 3TUYB 4AQJA 1YX8A 3L47A 1CFPA 3LK0A 5PALA 1WDCB 3EKHA 5JOLA 1SSEB 2WCMA 2GGZA 2H61C 1CB1A 4A4BA 3OP0A 2KGRA 2M1KB 3PLFB 1KK7Y 2BBMA 2KAXA 2BAPA 4YGEB 1KFXL 1J7PA 2JULA 1S5GY 2KOTA 1TNQA 4ORBB 2AMIA 2PVBA 2ZRTA 1QTXA 1UHJA 1A75A 3I5IC 1BODA 1L7ZA 1PVBA 1QJTA 4PT1A 2MLFC 2M1UA 1SL7A 3DF0B 5I2QA 2WCLA 4JD9A 5I2OA 3BOWA 1M39A 3UO9A 3VB1A 2JT0A 3OB2B 2LUCA 2M3WA 2BKIB 3B86A 1K96A 1NYAA 1SY9A 3S0BA 3S0FA 1K9PA 1OSAA 2BBNA 4YGCB 1SMGA 2L2CA 5FI2A 2ZN8A 2CBLA 3QMEA 4OCIA 1YRTB 1SPYA 2ZNEA 1DGVA 1TRFA 1MXEA 1SYMA 2G9BA 1XO5A 2K2FA 2WCKA 1XFVO 3TDUA 1B47A 1U5IA 3WHUB 5FI6A 4D1EA 1ZACA 1M31A 1V1GA 1NPQA 5F6TA 4ZCVA 5I8NA 2KHNA 2K2AA 2L0PA 1QWVA 3B7AA 1FPWA 2LVIA 2JZIA 1S6IA 2WCEA 3OBVA 3OHMB 3PM8A 1B4CA 4ORCB 4CFQA 1K93D 1F71A 3EK8A 3QRXA 4F7FA 1ALWA 4YI8A 1AP4A 1M63B 2PYQA 1F4QA 1GGZA 3PM2A 1P28A 3NXAA 3CZ0A 3VROA 1TIZA 2F2PA 1IJ6A 1A75B 1G33A 5IBWA 2Y1MA 4U8DA 2JU0A 2JRFA 5EL2A 5AERA 1NWDA 4OVNF 3PATA 4OR9B 5AXIA 1UWOA 3R72A 3ZWHA 3CR5X 1ALVA 4KYNA 1LXFC 1OZSA 1DJZA 1TNXA 1GQMA 1WRZA 2LHLA 1Y1XA 4I5KA 1XFRA 3I5GC 2QEHA 1QLSA 4I5LB 4CFRA 3KEVA 3R1PA 5DKRA 1NX0A 1IWQA 5AANA 5HL1A 1RFJA 5B8IB 1B9AA 1KK8B 4GUKA 1K9UA 3RLZA 4DCKA 1DELA 2WCBA 2LP2A 2KI6C 2LE9B 4HREE 2SCPA 2JQ6A 1QATA 1QX5B 1KWOC 3H4SE 3IQQA 1B8CA 1OW4A 1IJ5A 1YUUA 3D75A 3SG5A 2LMUA 3DVEA 2IS9A 2JTZA 2NXQA 1EL4A 4XYNA 2Q91A 1U5IB 1C3ZA 2PQLA 3BUWB 4GGNA 4MBEA 3BUNB 1S36A 2I18A 5HKYA 1EJ3A 3F45A 1FW4A 1UP5A 1JF0A 1SR6C 5AFPA 3DD4A 2EC6C 1JBAA 1TTXA 2EHBA 4PE0A 2MBXA 2WORA 1SL8A 2JOJA 2YGUA 2MJWB 2LLTA 1OZOA 1S6CA 3TUYC 1OMRA 2JT3A 2PSRA 1GJYA 2KBMA 1CDLA 4C0LA 3AAJA 3SIBA 2PMYA 1XK4C 4DS7A 4I5JA 1J7QA
chains in the Genus database with same CATH topology
1PVAA 1KWOB 4UPGA 2G2BA 2KDHA 5G08A 2MAZA 3SJSA 2LMTA 1NCYA 1SCMB 4JWQA 2L4HA 1BG1A 2LVJA 3DVJA 3SG2A 5CSIA 1RJVA 4M2PA 2R2IA 3JVTB 1WRKA 1QIWA 1LVCD 2FJUB 2KQYA 3O2PA 1UHHA 2LCPA 2FCDA 2H2KA 4HRHA 1DF0A 1CLLA 4HSZA 1V1FA 1IKUA 2KBIA 4N1FA 3CR2A 5HLVA 3I5HC 1XFYO 2LUXA 1WLMA 2BE4A 1FF1A 2JPTA 3D0YA 2I94A 3BXKA 1NX1A 4BY4A 1K2HA 4MN0A 3SG7A 1AHRA 1OOJA 1W7IB 1KFXS 1QXPA 1XVJA 1J55A 2F3YA 1TOPA 3O78A 4WQ2A 1CTRA 1D1OA 1JUOA 1MXLC 1NSHA 3SG3A 1NUBA 1A4PA 1HT9A 1CDPA 1PALA 1Y6WA 2E6WA 2JWWA 1DJYA 3FS7A 4L9MA 3WHTB 3EK7A 5AFPA 4NDBA 5K89A 1S26D 1RTP1 1UURA 1YVHA 1RK9A 4FQOA 1J7OA 4N5XA 1KQVA 2BKHB 4ICBA 4AOMA 1YR5A 1KCYA 1TNPA 1JSAA 2P6BB 1OE9B 3I5HB 5HKWA 1QX7A 4YI9A 4PHJA 1Y0VH 1JWDA 4GGFA 3VRRA 2OS8B 1B8LA 1FI6A 1SW8A 2JXCA 3LCPC 1DF0B 1K9KA 1TNWA 4MVFA 1J1DA 2MA2A 3BUOB 1CM1A 1J1EA 4GAOA 4MSPA 1CLMA 2EGDA 2WC8A 1BU3A 3VRQA 2CXJA 3D10A 4YGBB 4YRUA 1KK8C 5BPJA 1IGVA 3NSIA 3DVKA 2L50A 4A4CA 2QPTA 3A8RA 2WNDA 3KF9A 1IQ5A 2CNPA 1NX2A 1SRAA 1HQVA 5CPVA 4DRWA 1JF2A 3CGAA 3KO0A 5HKZA 3LL8B 1B7TZ 1YUSA 1A03A 4MLWA 1KSOA 5KSZA 2JNXA 3BYAA 4MRXA 1CFFA 1TN4A 1S5GZ 4XJKA 4MRYA 1N65A 4E68A 1YTZC 2F3ZA 3AAKA 3OX6A 2JTTA 1B1GA 4PCWA 3BOWB 2F8PA 1FI5A 1AVSA 1UHIA 1KQMC 2JC2A 1F54A 1W7JB 2NZ0A 4WQ3A 2Y4QA 1PRWA 2K7CA 2LLSA 2JT8A 3NSKA 3CS1A 4I5NB 1RECA 3PN7B 2JNFA 3A4UB 2JXLA 2Q4UA 1KSMA 2M7LA 1CM4A 1SCMC 3CZTX 1CFDA 5JJGA 2NCPA 1WLZA 2NCOA 2Y5IA 2HQWA 3JVTC 5CSNA 2D8NA 2LHIA 5CSFA 4YGDB 4ORAB 3JTDC 2MLEC 1IH0A 1SKTA 4MZLA 1KQMB 3EKJA 3RM1A 2KYCA 1RROA 2KSPA 5CSJA 2BL0B 2ZFDA 1QVIZ 4USLA 1F8HA 1NCXA 2O60A 1AUIB 3IF7A 2I2RE 1DJHA 2OTGC 4CPVA 4XJKB 1M45A 1ZOTB 2LLUA 1IRJA 4JQ0D 3AKBA 2HPSA 1K8UA 1K95A 2LMVA 4QJ4B 1CLBA 3SG6A 2VRGA 5HYDA 2K7BA 1K94A 2HQ8A 1WRLA 4P5OE 3AKAA 3SIAA 2L98A 2BECA 2K7DA 2K8MB 3LK1A 4QJ3B 2KFGA 3VRNA 1NCZA 3EK4A 3FIAA 3JTDB 5ER4X 2WOSA 1BF5A 3KPXA 2KFHA 1YRUB 4GNKB 4DUQA 2KFFA 2F2OA 2KYFA 3WXAA 4C0KA 2OS8C 5I2LA 2LAPA 1S6JA 1L2OB 1X02A 2OTGB 3ZNIA 4P2YB 3PFVA 4NQGA 3DVMA 1MHOA 2FCEA 1LA3A 4YBHB 1ODBA 1DMOA 4GBAA 1SBJA 2KI4B 3TS5B 4ETOA 2H61A 2V53A 2PRUA 2KNEA 1YUTA 1DGUA 1EG3A 1JC2A 1ZMZA 1WY9A 1PSRA 2BE6A 1BOCA 3I5FB 1XFZO 3O6BA 1JFJA 2COLB 3PSRA 5AEQA 4ZCUA 3VGOA 4N1GA 2Y1NA 3SG4A 5D7FA 1B7TY 3WNXB 2K7OA 1M46A 1S1EA 3CR4X 3PALA 3GOFA 3M0WA 4R1EA 5GQQC 2LVVA 1CNPA 2KAYA 1MF8B 1K90D 1SNLA 2M9GA 2NLNA 1G4YR 1EH2A 1G8IA 3D0YB 3O4YA 4GGFC 5DKNA 3TZ1A 1CDMA 2K61A 1KFUS 2ZRSA 5ER5A 1CMGA 5FYXA 1AK8A 1BLQA 4PE4A 3IQOA 1QV0A 3PN7C 1CDNA 1C7VA 1R6PA 2CTNA 2KGBC 1KFUL 1F4OA 1XFUO 3OX5A 1J7RA 1A2XA 1QLKA 1S3PA 1KK7Z 2O5GA 3EVRA 4CLNA 1FBVA 3FWBA 3K21A 4F0ZB 1NIWA 1UUSA 2L2EA 5HLOA 1Q80A 1F55A 1N0YA 1R2UA 1DJGA 2M8UA 1BMOA 2ZN9A 1XFWO 1TCFA 3I5IB 4MEWA 1NP8A 4NDCA 1UHKA 1SCVA 4MZJA 2M97A 5J3XA 2KI6D 2LANA 1ZUZA 2BCBA 1MUXA 1YURA 2B1UA 2BL0C 4JPZB 5DKQA 4CIDA 2DOQA 4BY5A 1QVIY 2LM5A 2ISDA 1QS7A 3CWGA 3TDIA 2KQ6A 2AUCA 2SASA 1EXRA 3BUXB 1LA0A 1B8RA 1QIVA 1TCOB 2ZNDA 4M2QA 5TNCA 5KU1A 1CKKA 1VRKA 2MRDA 2K0JA 4YGAA 1YX7A 4QJ5B 1CMFA 1QV1A 5KTYA 2CT9A 1DVIA 2LNKA 1C07A 1MQ1A 3CTNA 3GK2A 4NDDA 2WCFA 3CLNA 1QX2A 2LP3A 1PK0D 4FTGA 4DIRA 3GK4X 1RWYA 1BR4B 2MHHA 3EVVA 2LV7A 4OV2A 1BJFA 1E8AA 2M49B 1CFCA 1PULA 3NSOA 2E30A 2RGIA 3KHEA 4HRGA 3TDZA 2GV5A 2L51A 1BT6A 1OQPA 1L2OC 2OPOA 2QACA 1F70A 1A29A 1BR1B 1N2DA 2CCMA 1AJ5A 4PHKA 4PHNA 2L4IA 2PASA 1OMDA 2TN4A 4WRIA 4PE1A 2KI4C 3TS5C 1XK4A 4PDZA 3OB1B 2LC5A 1DJWA 4C0JA 2BCAA 1NX3A 2ZKMX 1LINA 1QASA 2FOTA 1XFXO 2KAVA 2LVKA 2M29A 3I5FC 3LLEA 4AQIA 3E3RA 3I5GB 4TNCA 1IQ3A 1H8BA 1MR8A 1OMVA 4OKHA 1DJIA 5D69A 1Y1AA 1LKJA 2F33A 3VRPA 1SK6D 3ICBA 3DF0A 2PALA 1JFKA 1WDCC 2A4JA 2I7AA 1ZFSA 4PE7A 1DT7B 2HF5A 4GPLB 2L5XB 1EG4A 4GFTA 4IL1A 3BUMB 3NSLA 1UHNA 3MSEB 1XYDA 1XA5A 4PALA 1MWNA 1DJXA 2M0RA 1GGWA 3HCMA 2M7NA 1PSBA 2GGMA 3C1VA 1H4BA 3GK1A 4PHMA 2AAOA 3BQ3A 1C7WA 1DTLA 1YVLA 1SR6B 4M2OA 3EVUA 1SL9A 2EC6B 1AJ4A 2BCXA 4Q04A 1IG5A 3FWCA 2HETA 3HX4A 1Y1UA 4MZKA 3TUYB 4AQJA 1YX8A 1CFPA 3LK0A 5PALA 1WDCB 3EKHA 5JOLA 2GGZA 2H61C 1CB1A 4A4BA 3OP0A 2KGRA 2M1KB 3PLFB 1KK7Y 2BBMA 2KAXA 4YGEB 1KFXL 1J7PA 2JULA 1S5GY 2KOTA 1TNQA 4ORBB 2AMIA 2PVBA 2ZRTA 1QTXA 1UHJA 1A75A 3I5IC 1BODA 1L7ZA 1PVBA 1QJTA 2MLFC 2M1UA 1SL7A 3DF0B 5I2QA 5I2OA 3BOWA 1M39A 2JT0A 3OB2B 2LUCA 2M3WA 2BKIB 1K96A 1NYAA 1SY9A 1K9PA 1OSAA 2BBNA 4YGCB 1SMGA 2ZN8A 2CBLA 4OCIA 1YRTB 1SPYA 2ZNEA 1DGVA 1TRFA 1MXEA 1SYMA 2G9BA 1XO5A 2K2FA 1XFVO 3TDUA 1B47A 1U5IA 3WHUB 4D1EA 1ZACA 1M31A 1V1GA 1NPQA 5F6TA 4ZCVA 5I8NA 2KHNA 2K2AA 2L0PA 1FPWA 2LVIA 2JZIA 1S6IA 2WCEA 3OHMB 3PM8A 1B4CA 4ORCB 4CFQA 1K93D 1F71A 3EK8A 3QRXA 1ALWA 4YI8A 1AP4A 1M63B 1F4QA 1GGZA 3NXAA 3VROA 1TIZA 2F2PA 1IJ6A 1A75B 1G33A 5IBWA 2Y1MA 4U8DA 2JU0A 2JRFA 5AERA 1NWDA 4OVNF 3PATA 4OR9B 5AXIA 1UWOA 3ZWHA 3CR5X 1ALVA 1LXFC 1OZSA 1DJZA 1TNXA 1GQMA 1WRZA 2LHLA 1Y1XA 4I5KA 3I5GC 4CFRA 1QLSA 4I5LB 3KEVA 5AANA 5DKRA 1NX0A 1IWQA 1RFJA 5B8IB 1B9AA 1KK8B 4GUKA 1K9UA 3RLZA 4DCKA 2WCBA 2LP2A 2KI6C 2LE9B 4HREE 2SCPA 2JQ6A 1QATA 1QX5B 1KWOC 3H4SE 3IQQA 1B8CA 1IJ5A 1YUUA 3SG5A 2LMUA 3DVEA 2IS9A 2JTZA 2NXQA 1EL4A 4XYNA 2Q91A 1U5IB 3BUWB 4GGNA 4MBEA 3BUNB 1S36A 2I18A 5HKYA 1EJ3A 3F45A 1FW4A 1UP5A 1JF0A 1SR6C 3DD4A 2EC6C 1JBAA 1TTXA 2EHBA 4PE0A 2MBXA 2WORA 1SL8A 2JOJA 2MJWB 2LLTA 1OZOA 1S6CA 3TUYC 1OMRA 2JT3A 2PSRA 1GJYA 2KBMA 1CDLA 4C0LA 3AAJA 3SIBA 2PMYA 1XK4C 4DS7A 4I5JA 1J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVA A;  1KWO B;  4UPG A;  2G2B A;  2KDH A;  5G08 A;  2MAZ A;  3SJS A;  2LMT A;  1NCY A;  1SCM B;  4JWQ A;  2L4H A;  1BG1 A;  2LVJ A;  3DVJ A;  3SG2 A;  5CSI A;  1RJV A;  4M2P A;  2R2I A;  3JVT B;  1WRK A;  1QIW A;  1LVC D;  2FJU B;  2KQY A;  3O2P A;  1UHH A;  2LCP A;  2FCD A;  2H2K A;  4HRH A;  1DF0 A;  1CLL A;  4HSZ A;  1V1F A;  1IKU A;  2KBI A;  4N1F A;  3CR2 A;  5HLV A;  3I5H C;  1XFY O;  2LUX A;  1WLM A;  2BE4 A;  1FF1 A;  2JPT A;  3D0Y A;  2I94 A;  3BXK A;  1NX1 A;  4BY4 A;  1K2H A;  4MN0 A;  3SG7 A;  1AHR A;  1OOJ A;  1W7I B;  1KFX S;  1QXP A;  1XVJ A;  1J55 A;  2F3Y A;  1TOP A;  3O78 A;  4WQ2 A;  1CTR A;  1D1O A;  1JUO A;  1MXL C;  1NSH A;  3SG3 A;  1NUB A;  1A4P A;  1HT9 A;  1CDP A;  1PAL A;  1Y6W A;  2E6W A;  2JWW A;  1DJY A;  3FS7 A;  4L9M A;  3WHT B;  3EK7 A;  5AFP A;  4NDB A;  5K89 A;  1S26 D;  1RTP 1;  1UUR A;  1YVH A;  1RK9 A;  4FQO A;  1J7O A;  4N5X A;  1KQV A;  2BKH B;  4ICB A;  4AOM A;  1YR5 A;  1KCY A;  1TNP A;  1JSA A;  2P6B B;  1OE9 B;  3I5H B;  5HKW A;  1QX7 A;  4YI9 A;  4PHJ A;  1Y0V H;  1JWD A;  4GGF A;  3VRR A;  2OS8 B;  1B8L A;  1FI6 A;  1SW8 A;  2JXC A;  3LCP C;  1DF0 B;  1K9K A;  1TNW A;  4MVF A;  1J1D A;  2MA2 A;  3BUO B;  1CM1 A;  1J1E A;  4GAO A;  4MSP A;  1CLM A;  2EGD A;  2WC8 A;  1BU3 A;  3VRQ A;  2CXJ A;  3D10 A;  4YGB B;  4YRU A;  1KK8 C;  5BPJ A;  1IGV A;  3NSI A;  3DVK A;  2L50 A;  4A4C A;  2QPT A;  3A8R A;  2WND A;  3KF9 A;  1IQ5 A;  2CNP A;  1NX2 A;  1SRA A;  1HQV A;  5CPV A;  4DRW A;  1JF2 A;  3CGA A;  3KO0 A;  5HKZ A;  3LL8 B;  1B7T Z;  1YUS A;  1A03 A;  4MLW A;  1KSO A;  5KSZ A;  2JNX A;  3BYA A;  4MRX A;  1CFF A;  1TN4 A;  1S5G Z;  4XJK A;  4MRY A;  1N65 A;  4E68 A;  1YTZ C;  2F3Z A;  3AAK A;  3OX6 A;  2JTT A;  1B1G A;  4PCW A;  3BOW B;  2F8P A;  1FI5 A;  1AVS A;  1UHI A;  1KQM C;  2JC2 A;  1F54 A;  1W7J B;  2NZ0 A;  4WQ3 A;  2Y4Q A;  1PRW A;  2K7C A;  2LLS A;  2JT8 A;  3NSK A;  3CS1 A;  4I5N B;  1REC A;  3PN7 B;  2JNF A;  3A4U B;  2JXL A;  2Q4U A;  1KSM A;  2M7L A;  1CM4 A;  1SCM C;  3CZT X;  1CFD A;  5JJG A;  2NCP A;  1WLZ A;  2NCO A;  2Y5I A;  2HQW A;  3JVT C;  5CSN A;  2D8N A;  2LHI A;  5CSF A;  4YGD B;  4ORA B;  3JTD C;  2MLE C;  1IH0 A;  1SKT A;  4MZL A;  1KQM B;  3EKJ A;  3RM1 A;  2KYC A;  1RRO A;  2KSP A;  5CSJ A;  2BL0 B;  2ZFD A;  1QVI Z;  4USL A;  1F8H A;  1NCX A;  2O60 A;  1AUI B;  3IF7 A;  2I2R E;  1DJH A;  2OTG C;  4CPV A;  4XJK B;  1M45 A;  1ZOT B;  2LLU A;  1IRJ A;  4JQ0 D;  3AKB A;  2HPS A;  1K8U A;  1K95 A;  2LMV A;  4QJ4 B;  1CLB A;  3SG6 A;  2VRG A;  5HYD A;  2K7B A;  1K94 A;  2HQ8 A;  1WRL A;  4P5O E;  3AKA A;  3SIA A;  2L98 A;  2BEC A;  2K7D A;  2K8M B;  3LK1 A;  4QJ3 B;  2KFG A;  3VRN A;  1NCZ A;  3EK4 A;  3FIA A;  3JTD B;  5ER4 X;  2WOS A;  1BF5 A;  3KPX A;  2KFH A;  1YRU B;  4GNK B;  4DUQ A;  2KFF A;  2F2O A;  2KYF A;  3WXA A;  4C0K A;  2OS8 C;  5I2L A;  2LAP A;  1S6J A;  1L2O B;  1X02 A;  2OTG B;  3ZNI A;  4P2Y B;  3PFV A;  4NQG A;  3DVM A;  1MHO A;  2FCE A;  1LA3 A;  4YBH B;  1ODB A;  1DMO A;  4GBA A;  1SBJ A;  2KI4 B;  3TS5 B;  4ETO A;  2H61 A;  2V53 A;  2PRU A;  2KNE A;  1YUT A;  1DGU A;  1EG3 A;  1JC2 A;  1ZMZ A;  1WY9 A;  1PSR A;  2BE6 A;  1BOC A;  3I5F B;  1XFZ O;  3O6B A;  1JFJ A;  2COL B;  3PSR A;  5AEQ A;  4ZCU A;  3VGO A;  4N1G A;  2Y1N A;  3SG4 A;  5D7F A;  1B7T Y;  3WNX B;  2K7O A;  1M46 A;  1S1E A;  3CR4 X;  3PAL A;  3GOF A;  3M0W A;  4R1E A;  5GQQ C;  2LVV A;  1CNP A;  2KAY A;  1MF8 B;  1K90 D;  1SNL A;  2M9G A;  2NLN A;  1G4Y R;  1EH2 A;  1G8I A;  3D0Y B;  3O4Y A;  4GGF C;  5DKN A;  3TZ1 A;  1CDM A;  2K61 A;  1KFU S;  2ZRS A;  5ER5 A;  1CMG A;  5FYX A;  1AK8 A;  1BLQ A;  4PE4 A;  3IQO A;  1QV0 A;  3PN7 C;  1CDN A;  1C7V A;  1R6P A;  2CTN A;  2KGB C;  1KFU L;  1F4O A;  1XFU O;  3OX5 A;  1J7R A;  1A2X A;  1QLK A;  1S3P A;  1KK7 Z;  2O5G A;  3EVR A;  4CLN A;  1FBV A;  3FWB A;  3K21 A;  4F0Z B;  1NIW A;  1UUS A;  2L2E A;  5HLO A;  1Q80 A;  1F55 A;  1N0Y A;  1R2U A;  1DJG A;  2M8U A;  1BMO A;  2ZN9 A;  1XFW O;  1TCF A;  3I5I B;  4MEW A;  1NP8 A;  4NDC A;  1UHK A;  1SCV A;  4MZJ A;  2M97 A;  5J3X A;  2KI6 D;  2LAN A;  1ZUZ A;  2BCB A;  1MUX A;  1YUR A;  2B1U A;  2BL0 C;  4JPZ B;  5DKQ A;  4CID A;  2DOQ A;  4BY5 A;  1QVI Y;  2LM5 A;  2ISD A;  1QS7 A;  3CWG A;  3TDI A;  2KQ6 A;  2AUC A;  2SAS A;  1EXR A;  3BUX B;  1LA0 A;  1B8R A;  1QIV A;  1TCO B;  2ZND A;  4M2Q A;  5TNC A;  5KU1 A;  1CKK A;  1VRK A;  2MRD A;  2K0J A;  4YGA A;  1YX7 A;  4QJ5 B;  1CMF A;  1QV1 A;  5KTY A;  2CT9 A;  1DVI A;  2LNK A;  1C07 A;  1MQ1 A;  3CTN A;  3GK2 A;  4NDD A;  2WCF A;  3CLN A;  1QX2 A;  2LP3 A;  1PK0 D;  4FTG A;  4DIR A;  3GK4 X;  1RWY A;  1BR4 B;  2MHH A;  3EVV A;  2LV7 A;  4OV2 A;  1BJF A;  1E8A A;  2M49 B;  1CFC A;  1PUL A;  3NSO A;  2E30 A;  2RGI A;  3KHE A;  4HRG A;  3TDZ A;  2GV5 A;  2L51 A;  1BT6 A;  1OQP A;  1L2O C;  2OPO A;  2QAC A;  1F70 A;  1A29 A;  1BR1 B;  1N2D A;  2CCM A;  1AJ5 A;  4PHK A;  4PHN A;  2L4I A;  2PAS A;  1OMD A;  2TN4 A;  4WRI A;  4PE1 A;  2KI4 C;  3TS5 C;  1XK4 A;  4PDZ A;  3OB1 B;  2LC5 A;  1DJW A;  4C0J A;  2BCA A;  1NX3 A;  2ZKM X;  1LIN A;  1QAS A;  2FOT A;  1XFX O;  2KAV A;  2LVK A;  2M29 A;  3I5F C;  3LLE A;  4AQI A;  3E3R A;  3I5G B;  4TNC A;  1IQ3 A;  1H8B A;  1MR8 A;  1OMV A;  4OKH A;  1DJI A;  5D69 A;  1Y1A A;  1LKJ A;  2F33 A;  3VRP A;  1SK6 D;  3ICB A;  3DF0 A;  2PAL A;  1JFK A;  1WDC C;  2A4J A;  2I7A A;  1ZFS A;  4PE7 A;  1DT7 B;  2HF5 A;  4GPL B;  2L5X B;  1EG4 A;  4GFT A;  4IL1 A;  3BUM B;  3NSL A;  1UHN A;  3MSE B;  1XYD A;  1XA5 A;  4PAL A;  1MWN A;  1DJX A;  2M0R A;  1GGW A;  3HCM A;  2M7N A;  1PSB A;  2GGM A;  3C1V A;  1H4B A;  3GK1 A;  4PHM A;  2AAO A;  3BQ3 A;  1C7W A;  1DTL A;  1YVL A;  1SR6 B;  4M2O A;  3EVU A;  1SL9 A;  2EC6 B;  1AJ4 A;  2BCX A;  4Q04 A;  1IG5 A;  3FWC A;  2HET A;  3HX4 A;  1Y1U A;  4MZK A;  3TUY B;  4AQJ A;  1YX8 A;  1CFP A;  3LK0 A;  5PAL A;  1WDC B;  3EKH A;  5JOL A;  2GGZ A;  2H61 C;  1CB1 A;  4A4B A;  3OP0 A;  2KGR A;  2M1K B;  3PLF B;  1KK7 Y;  2BBM A;  2KAX A;  4YGE B;  1KFX L;  1J7P A;  2JUL A;  1S5G Y;  2KOT A;  1TNQ A;  4ORB B;  2AMI A;  2PVB A;  2ZRT A;  1QTX A;  1UHJ A;  1A75 A;  3I5I C;  1BOD A;  1L7Z A;  1PVB A;  1QJT A;  2MLF C;  2M1U A;  1SL7 A;  3DF0 B;  5I2Q A;  5I2O A;  3BOW A;  1M39 A;  2JT0 A;  3OB2 B;  2LUC A;  2M3W A;  2BKI B;  1K96 A;  1NYA A;  1SY9 A;  1K9P A;  1OSA A;  2BBN A;  4YGC B;  1SMG A;  2ZN8 A;  2CBL A;  4OCI A;  1YRT B;  1SPY A;  2ZNE A;  1DGV A;  1TRF A;  1MXE A;  1SYM A;  2G9B A;  1XO5 A;  2K2F A;  1XFV O;  3TDU A;  1B47 A;  1U5I A;  3WHU B;  4D1E A;  1ZAC A;  1M31 A;  1V1G A;  1NPQ A;  5F6T A;  4ZCV A;  5I8N A;  2KHN A;  2K2A A;  2L0P A;  1FPW A;  2LVI A;  2JZI A;  1S6I A;  2WCE A;  3OHM B;  3PM8 A;  1B4C A;  4ORC B;  4CFQ A;  1K93 D;  1F71 A;  3EK8 A;  3QRX A;  1ALW A;  4YI8 A;  1AP4 A;  1M63 B;  1F4Q A;  1GGZ A;  3NXA A;  3VRO A;  1TIZ A;  2F2P A;  1IJ6 A;  1A75 B;  1G33 A;  5IBW A;  2Y1M A;  4U8D A;  2JU0 A;  2JRF A;  5AER A;  1NWD A;  4OVN F;  3PAT A;  4OR9 B;  5AXI A;  1UWO A;  3ZWH A;  3CR5 X;  1ALV A;  1LXF C;  1OZS A;  1DJZ A;  1TNX A;  1GQM A;  1WRZ A;  2LHL A;  1Y1X A;  4I5K A;  3I5G C;  4CFR A;  1QLS A;  4I5L B;  3KEV A;  5AAN A;  5DKR A;  1NX0 A;  1IWQ A;  1RFJ A;  5B8I B;  1B9A A;  1KK8 B;  4GUK A;  1K9U A;  3RLZ A;  4DCK A;  2WCB A;  2LP2 A;  2KI6 C;  2LE9 B;  4HRE E;  2SCP A;  2JQ6 A;  1QAT A;  1QX5 B;  1KWO C;  3H4S E;  3IQQ A;  1B8C A;  1IJ5 A;  1YUU A;  3SG5 A;  2LMU A;  3DVE A;  2IS9 A;  2JTZ A;  2NXQ A;  1EL4 A;  4XYN A;  2Q91 A;  1U5I B;  3BUW B;  4GGN A;  4MBE A;  3BUN B;  1S36 A;  2I18 A;  5HKY A;  1EJ3 A;  3F45 A;  1FW4 A;  1UP5 A;  1JF0 A;  1SR6 C;  3DD4 A;  2EC6 C;  1JBA A;  1TTX A;  2EHB A;  4PE0 A;  2MBX A;  2WOR A;  1SL8 A;  2JOJ A;  2MJW B;  2LLT A;  1OZO A;  1S6C A;  3TUY C;  1OMR A;  2JT3 A;  2PSR A;  1GJY A;  2KBM A;  1CDL A;  4C0L A;  3AAJ A;  3SIB A;  2PMY A;  1XK4 C;  4DS7 A;  4I5J A;  1J7Q A; 
#chains in the Genus database with same CATH topology
 1PVA A;  1KWO B;  4UPG A;  2QEO A;  2G2B A;  2KDH A;  5G08 A;  2MAZ A;  3K1E A;  3SJS A;  2LMT A;  1NCY A;  1SCM B;  4JWQ A;  2L4H A;  1BG1 A;  2LVJ A;  3DVJ A;  3SG2 A;  5CSI A;  1RJV A;  4M2P A;  2R2I A;  3JVT B;  1WRK A;  1QIW A;  1LVC D;  2FJU B;  2KQY A;  3O2P A;  1UHH A;  2LCP A;  2FCD A;  2H2K A;  4HRH A;  1DF0 A;  1CLL A;  3R1O A;  1V1F A;  4HSZ A;  1IKU A;  3DYE A;  2KBI A;  4N1F A;  3CR2 A;  5HLV A;  3I5H C;  3V2L A;  1XFY O;  2LUX A;  1WLM A;  2BE4 A;  1FF1 A;  3S0E A;  2JPT A;  3D0Y A;  2I94 A;  3BXK A;  1NX1 A;  4BY4 A;  1K2H A;  4MN0 A;  1OOF A;  3SG7 A;  1AHR A;  1OOJ A;  1W7I B;  1KFX S;  1QXP A;  1XVJ A;  3CZ2 A;  5I94 A;  1J55 A;  2F3Y A;  1TOP A;  3O78 A;  4WQ2 A;  1CTR A;  1D1O A;  1JUO A;  2QEB A;  1OOI X;  1MXL C;  1NSH A;  2WCJ A;  3SG3 A;  1NUB A;  1A4P A;  1HT9 A;  1CDP A;  1PAL A;  1Y6W A;  2E6W A;  2JWW A;  1DJY A;  3DXL A;  1DQE A;  3FS7 A;  3EK7 A;  4L9M A;  3SS3 A;  4NDB A;  3WHT B;  5K89 A;  1S26 D;  1RTP 1;  1UUR A;  1YVH A;  1RK9 A;  1Z4H A;  4FQO A;  4N5X A;  1J7O A;  2BKH B;  2KPH A;  1KQV A;  4ICB A;  4AOM A;  3RZS A;  1C3Y A;  1YR5 A;  1KCY A;  1TNP A;  1JSA A;  2P6B B;  1OE9 B;  3I5H B;  5HKW A;  1GM0 A;  1QX7 A;  4YI9 A;  4PHJ A;  1TUZ A;  1Y0V H;  1JWD A;  1TUJ A;  4GGF A;  3VRR A;  2OS8 B;  1B8L A;  1FI6 A;  1SW8 A;  2JXC A;  3LCP C;  1DF0 B;  1K9K A;  1TNW A;  3B88 A;  4MVF A;  1J1D A;  2MA2 A;  3BUO B;  1CM1 A;  1J1E A;  4GAO A;  4MSP A;  1CLM A;  1LS8 A;  2EGD A;  2WC8 A;  1BU3 A;  3VRQ A;  2CXJ A;  3FE6 A;  3D10 A;  4YGB B;  4YRU A;  2FJY A;  1KK8 C;  5BPJ A;  1IGV A;  3NSI A;  3DVK A;  2L50 A;  4A4C A;  3S0A A;  2QPT A;  3A8R A;  2WND A;  3KF9 A;  1IQ5 A;  2CNP A;  1NX2 A;  3PJI A;  1SRA A;  1HQV A;  5CPV A;  4DRW A;  1JF2 A;  3CGA A;  3KO0 A;  5HKZ A;  3LL8 B;  2KLD A;  2QEV A;  1B7T Z;  1YUS A;  1A03 A;  4MLW A;  1KSO A;  5KSZ A;  2JNX A;  3BYA A;  4MRX A;  1CFF A;  1TN4 A;  1S5G Z;  2KLE A;  4OZD A;  4XJK A;  4MRY A;  1N65 A;  4E68 A;  1YTZ C;  2F3Z A;  3AAK A;  3OX6 A;  2JTT A;  1B1G A;  4PCW A;  3BOW B;  3CAB A;  2F8P A;  1FI5 A;  1AVS A;  1UHI A;  1KQM C;  2JC2 A;  4IJ7 A;  1F54 A;  1W7J B;  2NZ0 A;  3B6X A;  4WQ3 A;  5DIC A;  2Y4Q A;  1PRW A;  2K7C A;  2LLS A;  2JT8 A;  3BFB A;  3FE9 A;  3NSK A;  3CS1 A;  3D78 A;  3D77 A;  1REC A;  4I5N B;  3PN7 B;  2JNF A;  3A4U B;  3UNW A;  2JXL A;  2Q4U A;  1KSM A;  2M7L A;  1CM4 A;  2H8V A;  1SCM C;  4FQT A;  3CZT X;  1CFD A;  5JJG A;  2NCP A;  1WLZ A;  2NCO A;  2Y5I A;  2HQW A;  2WC6 A;  3JVT C;  5CSN A;  2D8N A;  2LHI A;  5CSF A;  4YGD B;  2GTE A;  4ORA B;  3JTD C;  2MLE C;  1IH0 A;  1SKT A;  4MZL A;  1KQM B;  3EKJ A;  3RM1 A;  2KYC A;  1RRO A;  2KSP A;  5CSJ A;  2BL0 B;  2ZFD A;  3CZ1 A;  1QVI Z;  4USL A;  1F8H A;  1NCX A;  2O60 A;  1AUI B;  3IF7 A;  2I2R E;  1DJH A;  2OTG C;  4CPV A;  3CDN A;  4XJK B;  1M45 A;  1ZOT B;  2LLU A;  1IRJ A;  4JQ0 D;  3CYZ A;  3AKB A;  2HPS A;  4INW A;  1K8U A;  1K95 A;  2LMV A;  4QJ4 B;  1CLB A;  3FE8 A;  2VRG A;  3SG6 A;  5HYD A;  2K7B A;  1K94 A;  2HQ8 A;  2QDI A;  1WRL A;  4P5O E;  3AKA A;  3SIA A;  2L98 A;  2BEC A;  2K7D A;  2K8M B;  3LK1 A;  4QJ3 B;  2KFG A;  3SS4 A;  1NCZ A;  3VRN A;  3EK4 A;  3FIA A;  3JTD B;  5ER4 X;  2WOS A;  1BF5 A;  3KPX A;  2KFH A;  1YRU B;  4GNK B;  4DUQ A;  2KFF A;  2F2O A;  3S0D A;  2KYF A;  3L4L A;  3WXA A;  4C0K A;  2OS8 C;  5I2L A;  2LAP A;  1S6J A;  1L2O B;  1X02 A;  2OTG B;  3ZNI A;  4P2Y B;  3PFV A;  4NQG A;  3DVM A;  1MHO A;  2FCE A;  1LA3 A;  4YBH B;  1ODB A;  1DMO A;  4GBA A;  1SBJ A;  2KI4 B;  3TS5 B;  3NHI A;  2H61 A;  4ETO A;  2V53 A;  2PRU A;  2KNE A;  1YUT A;  1OOH A;  1DGU A;  1EG3 A;  3BJH A;  1JC2 A;  1ZMZ A;  5FI7 A;  1WY9 A;  1PSR A;  2BE6 A;  1BOC A;  3I5F B;  2BNX A;  1XFZ O;  3O6B A;  3EG5 B;  1JFJ A;  5D3O A;  2COL B;  3PSR A;  5AEQ A;  4ZCU A;  3VGO A;  4N1G A;  1ORG A;  2Y1N A;  3SG4 A;  5D7F A;  3NHT A;  1B7T Y;  3WNX B;  1IIO A;  2K7O A;  1M46 A;  1S1E A;  3CR4 X;  3D76 A;  3PAL A;  3GOF A;  3M0W A;  4R1E A;  5GQQ C;  2LVV A;  1OOG A;  3IVT A;  1CNP A;  1DEK A;  2KAY A;  1MF8 B;  1K90 D;  1SNL A;  2M9G A;  2NLN A;  1G4Y R;  1EH2 A;  1G8I A;  3D0Y B;  3R1V A;  3BFA A;  3O4Y A;  2WC5 A;  4GGF C;  5DKN A;  3TZ1 A;  1CDM A;  2K61 A;  1KFU S;  2ZRS A;  5ER5 A;  1CMG A;  5FYX A;  1AK8 A;  3DZT A;  1BLQ A;  4PE4 A;  3IQO A;  1QV0 A;  3PN7 C;  1CDN A;  1C7V A;  1R6P A;  2CTN A;  2KGB C;  1KFU L;  1F4O A;  1XFU O;  3OX5 A;  1J7R A;  1A2X A;  1QLK A;  1S3P A;  1KK7 Z;  2O5G A;  3EVR A;  4CLN A;  1FBV A;  3FWB A;  3K21 A;  4F0Z B;  1NIW A;  1UUS A;  2L2E A;  3O4X A;  1Q80 A;  5HLO A;  1N0Y A;  1F55 A;  1R2U A;  1DJG A;  2M8U A;  1BMO A;  3SS5 A;  2ZN9 A;  1XFW O;  1TCF A;  3I5I B;  4MEW A;  1NP8 A;  4NDC A;  1UHK A;  1SCV A;  2WCH A;  3L4A A;  4MZJ A;  2M97 A;  5J3X A;  2KI6 D;  2LAN A;  1ZUZ A;  2BCB A;  1MUX A;  1YUR A;  2B1U A;  2BL0 C;  4JPZ B;  5DKQ A;  4CID A;  2DOQ A;  4BY5 A;  1QVI Y;  3BFH A;  2LM5 A;  2ISD A;  3D74 A;  1QS7 A;  3CWG A;  3TDI A;  1W9Z A;  2AUC A;  2KQ6 A;  1EXR A;  2SAS A;  3BUX B;  1LA0 A;  1B8R A;  1QIV A;  1TCO B;  2ZND A;  3OGN A;  4M2Q A;  5TNC A;  5KU1 A;  1CKK A;  1VRK A;  2MRD A;  2K0J A;  4YGA A;  1YX7 A;  4QJ5 B;  1CMF A;  1QV1 A;  5KTY A;  2CT9 A;  1DVI A;  2LNK A;  1C07 A;  1MQ1 A;  3CTN A;  3NGV A;  3GK2 A;  4NDD A;  2WCF A;  3CLN A;  2JPO A;  1QX2 A;  2ERB A;  2LP3 A;  1DC1 A;  1PK0 D;  4FTG A;  4DIR A;  3GK4 X;  1RWY A;  1BR4 B;  2P70 A;  2MHH A;  3EVV A;  2LV7 A;  4OV2 A;  1BJF A;  1E8A A;  1TWO A;  2M49 B;  1CFC A;  1PUL A;  3NSO A;  2E30 A;  2RGI A;  3KHE A;  4HRG A;  3TDZ A;  2GV5 A;  2L51 A;  1BT6 A;  1OQP A;  1Z2C B;  1L2O C;  2OPO A;  2QAC A;  3B87 A;  1A29 A;  1F70 A;  1BR1 B;  1N2D A;  2CCM A;  3DY9 A;  1AJ5 A;  4PHK A;  4PHN A;  4JKT A;  2L4I A;  2PAS A;  1OMD A;  2TN4 A;  4WRI A;  4PE1 A;  2KI4 C;  3TS5 C;  1XK4 A;  4PDZ A;  3OB1 B;  2LC5 A;  1DJW A;  4C0J A;  2BCA A;  1NX3 A;  2ZKM X;  1LIN A;  1QAS A;  2FOT A;  1XFX O;  2KAV A;  2LVK A;  2M29 A;  3I5F C;  3LLE A;  4AQI A;  3E3R A;  3I5G B;  4TNC A;  1IQ3 A;  1H8B A;  1MR8 A;  1OMV A;  4OKH A;  1DJI A;  5D69 A;  1Y1A A;  1LKJ A;  2F33 A;  3VRP A;  1SK6 D;  2L5Y A;  3ICB A;  3DF0 A;  2PAL A;  1JFK A;  1WDC C;  2A4J A;  2I7A A;  3D73 A;  1ZFS A;  4PE7 A;  1DT7 B;  1T14 A;  2HF5 A;  4GPL B;  4INX A;  2L5X B;  1EG4 A;  2P71 A;  4GFT A;  2K60 A;  3BUM B;  3NSL A;  4IL1 A;  1UHN A;  3MSE B;  1XYD A;  1XA5 A;  4PAL A;  1MWN A;  1DJX A;  2M0R A;  1GGW A;  3HCM A;  2M7N A;  1PSB A;  2GGM A;  3C1V A;  3S0G A;  3GK1 A;  4PHM A;  1H4B A;  2AAO A;  3BQ3 A;  1C7W A;  1DTL A;  1YVL A;  1SR6 B;  4M2O A;  3EVU A;  1SL9 A;  2EC6 B;  1AJ4 A;  3N7H A;  2BCX A;  4Q04 A;  1IG5 A;  3FWC A;  2HET A;  3HX4 A;  1Y1U A;  3Q8I A;  4MZK A;  3TUY B;  4AQJ A;  1YX8 A;  3L47 A;  1CFP A;  3LK0 A;  5PAL A;  1WDC B;  3EKH A;  5JOL A;  1SSE B;  2WCM A;  2GGZ A;  2H61 C;  1CB1 A;  4A4B A;  3OP0 A;  2KGR A;  2M1K B;  3PLF B;  1KK7 Y;  2BBM A;  2KAX A;  2BAP A;  4YGE B;  1KFX L;  1J7P A;  2JUL A;  1S5G Y;  2KOT A;  1TNQ A;  4ORB B;  2AMI A;  2PVB A;  2ZRT A;  1QTX A;  1UHJ A;  1A75 A;  3I5I C;  1BOD A;  1L7Z A;  1PVB A;  1QJT A;  4PT1 A;  2MLF C;  2M1U A;  1SL7 A;  3DF0 B;  5I2Q A;  2WCL A;  4JD9 A;  5I2O A;  3BOW A;  1M39 A;  3UO9 A;  3VB1 A;  2JT0 A;  3OB2 B;  2LUC A;  2M3W A;  2BKI B;  3B86 A;  1K96 A;  1NYA A;  1SY9 A;  3S0B A;  3S0F A;  1K9P A;  1OSA A;  2BBN A;  4YGC B;  1SMG A;  2L2C A;  5FI2 A;  2ZN8 A;  2CBL A;  3QME A;  4OCI A;  1YRT B;  1SPY A;  2ZNE A;  1DGV A;  1TRF A;  1MXE A;  1SYM A;  2G9B A;  1XO5 A;  2K2F A;  2WCK A;  1XFV O;  3TDU A;  1B47 A;  1U5I A;  3WHU B;  5FI6 A;  4D1E A;  1ZAC A;  1M31 A;  1V1G A;  1NPQ A;  5F6T A;  4ZCV A;  5I8N A;  2KHN A;  2K2A A;  2L0P A;  1QWV A;  3B7A A;  1FPW A;  2LVI A;  2JZI A;  1S6I A;  2WCE A;  3OBV A;  3OHM B;  3PM8 A;  1B4C A;  4ORC B;  4CFQ A;  1K93 D;  1F71 A;  3EK8 A;  3QRX A;  4F7F A;  1ALW A;  4YI8 A;  1AP4 A;  1M63 B;  2PYQ A;  1F4Q A;  1GGZ A;  3PM2 A;  1P28 A;  3NXA A;  3CZ0 A;  3VRO A;  1TIZ A;  2F2P A;  1IJ6 A;  1A75 B;  1G33 A;  5IBW A;  2Y1M A;  4U8D A;  2JU0 A;  2JRF A;  5EL2 A;  5AER A;  1NWD A;  4OVN F;  3PAT A;  4OR9 B;  5AXI A;  1UWO A;  3R72 A;  3ZWH A;  3CR5 X;  1ALV A;  4KYN A;  1LXF C;  1OZS A;  1DJZ A;  1TNX A;  1GQM A;  1WRZ A;  2LHL A;  1Y1X A;  4I5K A;  1XFR A;  3I5G C;  2QEH A;  1QLS A;  4I5L B;  4CFR A;  3KEV A;  3R1P A;  5DKR A;  1NX0 A;  1IWQ A;  5AAN A;  5HL1 A;  1RFJ A;  5B8I B;  1B9A A;  1KK8 B;  4GUK A;  1K9U A;  3RLZ A;  4DCK A;  1DEL A;  2WCB A;  2LP2 A;  2KI6 C;  2LE9 B;  4HRE E;  2SCP A;  2JQ6 A;  1QAT A;  1QX5 B;  1KWO C;  3H4S E;  3IQQ A;  1B8C A;  1OW4 A;  1IJ5 A;  1YUU A;  3D75 A;  3SG5 A;  2LMU A;  3DVE A;  2IS9 A;  2JTZ A;  2NXQ A;  1EL4 A;  4XYN A;  2Q91 A;  1U5I B;  1C3Z A;  2PQL A;  3BUW B;  4GGN A;  4MBE A;  3BUN B;  1S36 A;  2I18 A;  5HKY A;  1EJ3 A;  3F45 A;  1FW4 A;  1UP5 A;  1JF0 A;  1SR6 C;  5AFP A;  3DD4 A;  2EC6 C;  1JBA A;  1TTX A;  2EHB A;  4PE0 A;  2MBX A;  2WOR A;  1SL8 A;  2JOJ A;  2YGU A;  2MJW B;  2LLT A;  1OZO A;  1S6C A;  3TUY C;  1OMR A;  2JT3 A;  2PSR A;  1GJY A;  2KBM A;  1CDL A;  4C0L A;  3AAJ A;  3SIB A;  2PMY A;  1XK4 C;  4DS7 A;  4I5J A;  1J7Q A; 
#chains in the Genus database with same CATH homology
 1PVA A;  1KWO B;  4UPG A;  2G2B A;  2KDH A;  5G08 A;  2MAZ A;  3SJS A;  2LMT A;  1NCY A;  1SCM B;  4JWQ A;  2L4H A;  1BG1 A;  2LVJ A;  3DVJ A;  3SG2 A;  5CSI A;  1RJV A;  4M2P A;  2R2I A;  3JVT B;  1WRK A;  1QIW A;  1LVC D;  2FJU B;  2KQY A;  3O2P A;  1UHH A;  2LCP A;  2FCD A;  2H2K A;  4HRH A;  1DF0 A;  1CLL A;  4HSZ A;  1V1F A;  1IKU A;  2KBI A;  4N1F A;  3CR2 A;  5HLV A;  3I5H C;  1XFY O;  2LUX A;  1WLM A;  2BE4 A;  1FF1 A;  2JPT A;  3D0Y A;  2I94 A;  3BXK A;  1NX1 A;  4BY4 A;  1K2H A;  4MN0 A;  3SG7 A;  1AHR A;  1OOJ A;  1W7I B;  1KFX S;  1QXP A;  1XVJ A;  1J55 A;  2F3Y A;  1TOP A;  3O78 A;  4WQ2 A;  1CTR A;  1D1O A;  1JUO A;  1MXL C;  1NSH A;  3SG3 A;  1NUB A;  1A4P A;  1HT9 A;  1CDP A;  1PAL A;  1Y6W A;  2E6W A;  2JWW A;  1DJY A;  3FS7 A;  4L9M A;  3WHT B;  3EK7 A;  5AFP A;  4NDB A;  5K89 A;  1S26 D;  1RTP 1;  1UUR A;  1YVH A;  1RK9 A;  4FQO A;  1J7O A;  4N5X A;  1KQV A;  2BKH B;  4ICB A;  4AOM A;  1YR5 A;  1KCY A;  1TNP A;  1JSA A;  2P6B B;  1OE9 B;  3I5H B;  5HKW A;  1QX7 A;  4YI9 A;  4PHJ A;  1Y0V H;  1JWD A;  4GGF A;  3VRR A;  2OS8 B;  1B8L A;  1FI6 A;  1SW8 A;  2JXC A;  3LCP C;  1DF0 B;  1K9K A;  1TNW A;  4MVF A;  1J1D A;  2MA2 A;  3BUO B;  1CM1 A;  1J1E A;  4GAO A;  4MSP A;  1CLM A;  2EGD A;  2WC8 A;  1BU3 A;  3VRQ A;  2CXJ A;  3D10 A;  4YGB B;  4YRU A;  1KK8 C;  5BPJ A;  1IGV A;  3NSI A;  3DVK A;  2L50 A;  4A4C A;  2QPT A;  3A8R A;  2WND A;  3KF9 A;  1IQ5 A;  2CNP A;  1NX2 A;  1SRA A;  1HQV A;  5CPV A;  4DRW A;  1JF2 A;  3CGA A;  3KO0 A;  5HKZ A;  3LL8 B;  1B7T Z;  1YUS A;  1A03 A;  4MLW A;  1KSO A;  5KSZ A;  2JNX A;  3BYA A;  4MRX A;  1CFF A;  1TN4 A;  1S5G Z;  4XJK A;  4MRY A;  1N65 A;  4E68 A;  1YTZ C;  2F3Z A;  3AAK A;  3OX6 A;  2JTT A;  1B1G A;  4PCW A;  3BOW B;  2F8P A;  1FI5 A;  1AVS A;  1UHI A;  1KQM C;  2JC2 A;  1F54 A;  1W7J B;  2NZ0 A;  4WQ3 A;  2Y4Q A;  1PRW A;  2K7C A;  2LLS A;  2JT8 A;  3NSK A;  3CS1 A;  4I5N B;  1REC A;  3PN7 B;  2JNF A;  3A4U B;  2JXL A;  2Q4U A;  1KSM A;  2M7L A;  1CM4 A;  1SCM C;  3CZT X;  1CFD A;  5JJG A;  2NCP A;  1WLZ A;  2NCO A;  2Y5I A;  2HQW A;  3JVT C;  5CSN A;  2D8N A;  2LHI A;  5CSF A;  4YGD B;  4ORA B;  3JTD C;  2MLE C;  1IH0 A;  1SKT A;  4MZL A;  1KQM B;  3EKJ A;  3RM1 A;  2KYC A;  1RRO A;  2KSP A;  5CSJ A;  2BL0 B;  2ZFD A;  1QVI Z;  4USL A;  1F8H A;  1NCX A;  2O60 A;  1AUI B;  3IF7 A;  2I2R E;  1DJH A;  2OTG C;  4CPV A;  4XJK B;  1M45 A;  1ZOT B;  2LLU A;  1IRJ A;  4JQ0 D;  3AKB A;  2HPS A;  1K8U A;  1K95 A;  2LMV A;  4QJ4 B;  1CLB A;  3SG6 A;  2VRG A;  5HYD A;  2K7B A;  1K94 A;  2HQ8 A;  1WRL A;  4P5O E;  3AKA A;  3SIA A;  2L98 A;  2BEC A;  2K7D A;  2K8M B;  3LK1 A;  4QJ3 B;  2KFG A;  3VRN A;  1NCZ A;  3EK4 A;  3FIA A;  3JTD B;  5ER4 X;  2WOS A;  1BF5 A;  3KPX A;  2KFH A;  1YRU B;  4GNK B;  4DUQ A;  2KFF A;  2F2O A;  2KYF A;  3WXA A;  4C0K A;  2OS8 C;  5I2L A;  2LAP A;  1S6J A;  1L2O B;  1X02 A;  2OTG B;  3ZNI A;  4P2Y B;  3PFV A;  4NQG A;  3DVM A;  1MHO A;  2FCE A;  1LA3 A;  4YBH B;  1ODB A;  1DMO A;  4GBA A;  1SBJ A;  2KI4 B;  3TS5 B;  4ETO A;  2H61 A;  2V53 A;  2PRU A;  2KNE A;  1YUT A;  1DGU A;  1EG3 A;  1JC2 A;  1ZMZ A;  1WY9 A;  1PSR A;  2BE6 A;  1BOC A;  3I5F B;  1XFZ O;  3O6B A;  1JFJ A;  2COL B;  3PSR A;  5AEQ A;  4ZCU A;  3VGO A;  4N1G A;  2Y1N A;  3SG4 A;  5D7F A;  1B7T Y;  3WNX B;  2K7O A;  1M46 A;  1S1E A;  3CR4 X;  3PAL A;  3GOF A;  3M0W A;  4R1E A;  5GQQ C;  2LVV A;  1CNP A;  2KAY A;  1MF8 B;  1K90 D;  1SNL A;  2M9G A;  2NLN A;  1G4Y R;  1EH2 A;  1G8I A;  3D0Y B;  3O4Y A;  4GGF C;  5DKN A;  3TZ1 A;  1CDM A;  2K61 A;  1KFU S;  2ZRS A;  5ER5 A;  1CMG A;  5FYX A;  1AK8 A;  1BLQ A;  4PE4 A;  3IQO A;  1QV0 A;  3PN7 C;  1CDN A;  1C7V A;  1R6P A;  2CTN A;  2KGB C;  1KFU L;  1F4O A;  1XFU O;  3OX5 A;  1J7R A;  1A2X A;  1QLK A;  1S3P A;  1KK7 Z;  2O5G A;  3EVR A;  4CLN A;  1FBV A;  3FWB A;  3K21 A;  4F0Z B;  1NIW A;  1UUS A;  2L2E A;  5HLO A;  1Q80 A;  1F55 A;  1N0Y A;  1R2U A;  1DJG A;  2M8U A;  1BMO A;  2ZN9 A;  1XFW O;  1TCF A;  3I5I B;  4MEW A;  1NP8 A;  4NDC A;  1UHK A;  1SCV A;  4MZJ A;  2M97 A;  5J3X A;  2KI6 D;  2LAN A;  1ZUZ A;  2BCB A;  1MUX A;  1YUR A;  2B1U A;  2BL0 C;  4JPZ B;  5DKQ A;  4CID A;  2DOQ A;  4BY5 A;  1QVI Y;  2LM5 A;  2ISD A;  1QS7 A;  3CWG A;  3TDI A;  2KQ6 A;  2AUC A;  2SAS A;  1EXR A;  3BUX B;  1LA0 A;  1B8R A;  1QIV A;  1TCO B;  2ZND A;  4M2Q A;  5TNC A;  5KU1 A;  1CKK A;  1VRK A;  2MRD A;  2K0J A;  4YGA A;  1YX7 A;  4QJ5 B;  1CMF A;  1QV1 A;  5KTY A;  2CT9 A;  1DVI A;  2LNK A;  1C07 A;  1MQ1 A;  3CTN A;  3GK2 A;  4NDD A;  2WCF A;  3CLN A;  1QX2 A;  2LP3 A;  1PK0 D;  4FTG A;  4DIR A;  3GK4 X;  1RWY A;  1BR4 B;  2MHH A;  3EVV A;  2LV7 A;  4OV2 A;  1BJF A;  1E8A A;  2M49 B;  1CFC A;  1PUL A;  3NSO A;  2E30 A;  2RGI A;  3KHE A;  4HRG A;  3TDZ A;  2GV5 A;  2L51 A;  1BT6 A;  1OQP A;  1L2O C;  2OPO A;  2QAC A;  1F70 A;  1A29 A;  1BR1 B;  1N2D A;  2CCM A;  1AJ5 A;  4PHK A;  4PHN A;  2L4I A;  2PAS A;  1OMD A;  2TN4 A;  4WRI A;  4PE1 A;  2KI4 C;  3TS5 C;  1XK4 A;  4PDZ A;  3OB1 B;  2LC5 A;  1DJW A;  4C0J A;  2BCA A;  1NX3 A;  2ZKM X;  1LIN A;  1QAS A;  2FOT A;  1XFX O;  2KAV A;  2LVK A;  2M29 A;  3I5F C;  3LLE A;  4AQI A;  3E3R A;  3I5G B;  4TNC A;  1IQ3 A;  1H8B A;  1MR8 A;  1OMV A;  4OKH A;  1DJI A;  5D69 A;  1Y1A A;  1LKJ A;  2F33 A;  3VRP A;  1SK6 D;  3ICB A;  3DF0 A;  2PAL A;  1JFK A;  1WDC C;  2A4J A;  2I7A A;  1ZFS A;  4PE7 A;  1DT7 B;  2HF5 A;  4GPL B;  2L5X B;  1EG4 A;  4GFT A;  4IL1 A;  3BUM B;  3NSL A;  1UHN A;  3MSE B;  1XYD A;  1XA5 A;  4PAL A;  1MWN A;  1DJX A;  2M0R A;  1GGW A;  3HCM A;  2M7N A;  1PSB A;  2GGM A;  3C1V A;  1H4B A;  3GK1 A;  4PHM A;  2AAO A;  3BQ3 A;  1C7W A;  1DTL A;  1YVL A;  1SR6 B;  4M2O A;  3EVU A;  1SL9 A;  2EC6 B;  1AJ4 A;  2BCX A;  4Q04 A;  1IG5 A;  3FWC A;  2HET A;  3HX4 A;  1Y1U A;  4MZK A;  3TUY B;  4AQJ A;  1YX8 A;  1CFP A;  3LK0 A;  5PAL A;  1WDC B;  3EKH A;  5JOL A;  2GGZ A;  2H61 C;  1CB1 A;  4A4B A;  3OP0 A;  2KGR A;  2M1K B;  3PLF B;  1KK7 Y;  2BBM A;  2KAX A;  4YGE B;  1KFX L;  1J7P A;  2JUL A;  1S5G Y;  2KOT A;  1TNQ A;  4ORB B;  2AMI A;  2PVB A;  2ZRT A;  1QTX A;  1UHJ A;  1A75 A;  3I5I C;  1BOD A;  1L7Z A;  1PVB A;  1QJT A;  2MLF C;  2M1U A;  1SL7 A;  3DF0 B;  5I2Q A;  5I2O A;  3BOW A;  1M39 A;  2JT0 A;  3OB2 B;  2LUC A;  2M3W A;  2BKI B;  1K96 A;  1NYA A;  1SY9 A;  1K9P A;  1OSA A;  2BBN A;  4YGC B;  1SMG A;  2ZN8 A;  2CBL A;  4OCI A;  1YRT B;  1SPY A;  2ZNE A;  1DGV A;  1TRF A;  1MXE A;  1SYM A;  2G9B A;  1XO5 A;  2K2F A;  1XFV O;  3TDU A;  1B47 A;  1U5I A;  3WHU B;  4D1E A;  1ZAC A;  1M31 A;  1V1G A;  1NPQ A;  5F6T A;  4ZCV A;  5I8N A;  2KHN A;  2K2A A;  2L0P A;  1FPW A;  2LVI A;  2JZI A;  1S6I A;  2WCE A;  3OHM B;  3PM8 A;  1B4C A;  4ORC B;  4CFQ A;  1K93 D;  1F71 A;  3EK8 A;  3QRX A;  1ALW A;  4YI8 A;  1AP4 A;  1M63 B;  1F4Q A;  1GGZ A;  3NXA A;  3VRO A;  1TIZ A;  2F2P A;  1IJ6 A;  1A75 B;  1G33 A;  5IBW A;  2Y1M A;  4U8D A;  2JU0 A;  2JRF A;  5AER A;  1NWD A;  4OVN F;  3PAT A;  4OR9 B;  5AXI A;  1UWO A;  3ZWH A;  3CR5 X;  1ALV A;  1LXF C;  1OZS A;  1DJZ A;  1TNX A;  1GQM A;  1WRZ A;  2LHL A;  1Y1X A;  4I5K A;  3I5G C;  4CFR A;  1QLS A;  4I5L B;  3KEV A;  5AAN A;  5DKR A;  1NX0 A;  1IWQ A;  1RFJ A;  5B8I B;  1B9A A;  1KK8 B;  4GUK A;  1K9U A;  3RLZ A;  4DCK A;  2WCB A;  2LP2 A;  2KI6 C;  2LE9 B;  4HRE E;  2SCP A;  2JQ6 A;  1QAT A;  1QX5 B;  1KWO C;  3H4S E;  3IQQ A;  1B8C A;  1IJ5 A;  1YUU A;  3SG5 A;  2LMU A;  3DVE A;  2IS9 A;  2JTZ A;  2NXQ A;  1EL4 A;  4XYN A;  2Q91 A;  1U5I B;  3BUW B;  4GGN A;  4MBE A;  3BUN B;  1S36 A;  2I18 A;  5HKY A;  1EJ3 A;  3F45 A;  1FW4 A;  1UP5 A;  1JF0 A;  1SR6 C;  3DD4 A;  2EC6 C;  1JBA A;  1TTX A;  2EHB A;  4PE0 A;  2MBX A;  2WOR A;  1SL8 A;  2JOJ A;  2MJW B;  2LLT A;  1OZO A;  1S6C A;  3TUY C;  1OMR A;  2JT3 A;  2PSR A;  1GJY A;  2KBM A;  1CDL A;  4C0L A;  3AAJ A;  3SIB A;  2PMY A;  1XK4 C;  4DS7 A;  4I5J A;  1J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...