1PVBA

X-ray structure of a new crystal form of pike 4.10 parvalbumin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title X-ray structure of a new crystal form of pike 4.10 beta parvalbumin.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 42
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pvbA00
1BT6A 1C7VA 2KI6C 5J3XA 4BY4A 1M39A 1S6CA 2LMTA 2LLSA 1CB1A 2M97A 4PHKA 4XJKA 2FCDA 5I8NA 1OZOA 5K89A 3FWBA 2I2RE 2LP3A 2M7NA 5I2LA 1CTRA 4JWQA 1RECA 1YUSA 2LLTA 2TN4A 5GQQC 2BECA 3SIBA 3VRNA 3BUNB 1EL4A 4FQOA 3EK7A 2K7DA 3LLEA 1QX7A 3VRPA 3RM1A 1K90D 3H4SE 5D7FA 3JVTB 1ODBA 3GK1A 2MAZA 3JVTC 3EVVA 1KFUS 4DIRA 5ER5A 1NWDA 1IJ6A 2BCXA 1S6IA 1AP4A 1BLQA 2M49B 2I94A 1NCZA 2L4HA 2RGIA 2WC8A 3SG4A 4FTGA 5D69A 3TUYB 1EJ3A 1JBAA 4N1FA 1H4BA 3TUYC 4C0JA 2LVKA 3WHUB 1SYMA 2KOTA 2EC6C 4GGFC 5I2QA 2HETA 3BOWB 1DJGA 3PFVA 1DT7B 2AAOA 5HKZA 2L98A 1F4OA 2PSRA 1ALWA 3EK8A 4UPGA 3D0YA 4TNCA 1EH2A 1YX7A 1M31A 1XA5A 2HQWA 1JC2A 1Y1UA 2LHLA 2QACA 3O6BA 1QIWA 4YGEB 2ZNDA 2I7AA 1CLBA 1UHJA 1RFJA 2KFGA 1SY9A 2NCOA 3CZTX 5TNCA 1ZMZA 1NX0A 4MRYA 1AJ4A 2ZN8A 4MSPA 2L0PA 2LMVA 4DCKA 3HX4A 1PVBA 2BBMA 2JNXA 2LE9B 1QATA 1KFXS 1NCYA 1YURA 1SCMC 4Q04A 2DOQA 4HRGA 1K93D 2COLB 4HSZA 4PE4A 2NXQA 1RROA 1AJ5A 5PALA 2LM5A 1M45A 3GK4X 1CLLA 1QVIY 1YTZC 3VROA 4YGDB 2ZRSA 1OQPA 2I18A 4BY5A 1KK7Z 1B7TZ 1CFDA 2JT0A 1NCXA 1WRZA 2F2OA 1CFPA 1HT9A 1TCFA 2KAXA 4XYNA 4OV2A 3KO0A 1L7ZA 1R2UA 3CTNA 1A29A 1K2HA 1D1OA 3VRQA 3VRRA 4CPVA 1SL8A 1QVIZ 4QJ3B 3A4UB 1XFUO 1XYDA 1DVIA 3AKBA 5HLOA 1S36A 3LCPC 1NUBA 4M2QA 1A2XA 4OCIA 1Y1AA 1EG3A 2ISDA 1UHHA 4ETOA 4I5JA 3PN7B 1B8CA 3NXAA 2L5XB 5JJGA 3PN7C 1VRKA 1X02A 4USLA 1QASA 2K7OA 1G33A 1IWQA 1OOJA 4WRIA 1FBVA 2LC5A 2MJWB 2JULA 5CPVA 1HQVA 5CSFA 1QV0A 2OTGC 3A8RA 1S5GZ 1BR4B 2KQYA 1B8RA 4CFQA 2LP2A 3AKAA 4GAOA 1B8LA 1K9UA 3NSLA 4AQJA 1G4YR 1KWOB 1WRLA 2KDHA 3FWCA 1L2OB 1K9PA 1KWOC 1RWYA 2WOSA 2K8MB 3WXAA 4A4CA 3PSRA 2H2KA 1SKTA 2JTZA 2LUCA 4M2OA 1J1DA 2G2BA 3IF7A 4MLWA 1JFJA 1WRKA 3K21A 3OHMB 3DD4A 1QV1A 1J7PA 4XJKB 3I5GB 4MZLA 3ZWHA 2BE6A 3CR5X 1A03A 1MR8A 1XFXO 1OSAA 1YRUB 2F3YA 3IQQA 1M63B 2M1KB 1MWNA 1PK0D 5AXIA 1ZFSA 2Q4UA 3GK2A 1CMGA 2K7CA 1S3PA 4YGBB 3DVMA 1LXFC 2KFHA 2Q91A 2BBNA 4N1GA 4F0ZB 2IS9A 3AAKA 2KYFA 3I5IB 1CLMA 1IGVA 2B1UA 3I5IC 1ZACA 2M3WA 1AK8A 1LVCD 1U5IB 2JXCA 1YRTB 2WNDA 4N5XA 4OVNF 3SG2A 1QTXA 5HKWA 1UHIA 2Y4QA 2M29A 4ORCB 1Y6WA 1OZSA 2HF5A 3OX5A 1IG5A 1OE9B 2ZN9A 1K94A 2MA2A 1LA0A 5B8IB 1J1EA 3DVEA 3KHEA 3OP0A 5AANA 1BOCA 2F8PA 2JOJA 2KBIA 3EK4A 1CMFA 1DTLA 2M1UA 3LL8B 5AERA 1IJ5A 1SBJA 1YUTA 5DKNA 1KQVA 1XFZO 1WLMA 1J7RA 2LMUA 4JPZB 5ER4X 3BUXB 2G9BA 2GV5A 4YBHB 4PE7A 2GGMA 3PM8A 1F54A 3ZNIA 1KQMB 4I5NB 1NSHA 2GGZA 1DF0B 1SNLA 1AHRA 2K2AA 1WDCB 3DF0B 3TDUA 1CNPA 4NDBA 1WDCC 1E8AA 4U8DA 5FYXA 2KAYA 3KPXA 1J7OA 3CS1A 1NX1A 4GGFA 2BKHB 1SL9A 2JTTA 3BOWA 3PATA 2LUXA 4HREE 2HQ8A 3SG7A 4PCWA 2M7LA 2M8UA 1UWOA 1F55A 1JF2A 4MVFA 2K61A 2KNEA 1UURA 4GNKB 2Y5IA 1JSAA 3IQOA 2ZKMX 2BCBA 4NQGA 4GFTA 1CDLA 1JFKA 2F3ZA 2L4IA 2NCPA 2KYCA 1CDPA 3NSIA 4JQ0D 3BQ3A 1XK4C 1A75B 2D8NA 3EKHA 1PALA 1RJVA 1NX2A 3TS5B 4A4BA 4CLNA 2OS8B 1QX2A 2PALA 2OS8C 4C0LA 3RLZA 3FS7A 4PHJA 1BU3A 1OMDA 1YUUA 1A4PA 3D10A 4DS7A 4YI8A 2VRGA 1TOPA 1SMGA 1NX3A 1IKUA 2V53A 3EVRA 1EXRA 1SW8A 2MHHA 3CLNA 1DJZA 2KHNA 1TN4A 3TZ1A 5KSZA 4YGCB 2CXJA 5HLVA 1MUXA 1FI6A 3C1VA 3EVUA 5DKRA 5DKQA 1YX8A 4MBEA 3NSOA 4WQ3A 5KTYA 1SCVA 1DJIA 2AUCA 1F4QA 4ZCUA 1IQ3A 1N65A 1SL7A 2F2PA 2JC2A 5CSIA 3MSEB 5KU1A 1DMOA 2LVVA 2LVIA 2K0JA 1OMVA 4GGNA 1BMOA 1PVAA 2Y1NA 5AEQA 4NDDA 2MBXA 1J7QA 2K7BA 1NPQA 2EGDA 2NLNA 2WCFA 2KGBC 1L2OC 1RK9A 5I2OA 2JRFA 1S1EA 3LK1A 4YI9A 1SRAA 1N0YA 3DVKA 3CR2A 3LK0A 2PASA 2LANA 1NP8A 5JOLA 1Y0VH 3SJSA 2NZ0A 4I5KA 1FF1A 1WY9A 4AQIA 1MXEA 2SASA 1XVJA 3CR4X 1BR1B 1GQMA 1DJWA 3KF9A 1YR5A 3I5GC 1B9AA 3I5HB 4PE1A 3CGAA 2JXLA 3I5HC 1NIWA 1NYAA 2CBLA 2L51A 3FIAA 4ORAB 1PULA 2JPTA 5IBWA 1DJYA 1W7IB 2KFFA 4DUQA 4YRUA 1GGZA 1KFUL 1V1FA 1SK6D 1JUOA 1XFWO 2LHIA 2F33A 4WQ2A 1DGVA 2L2EA 1IRJA 1PSBA 1CDMA 2KSPA 2O5GA 4OR9B 2L50A 1KCYA 1DGUA 2BCAA 1JF0A 2OPOA 4MEWA 1F8HA 2R2IA 1XFVO 2FOTA 2M0RA 2Y1MA 1BF5A 1J55A 1F71A 1TNXA 1XFYO 2JU0A 4NDCA 4ZCVA 4CIDA 2BE4A 1R6PA 1N2DA 2FCEA 1TCOB 1K96A 3EKJA 3GOFA 1UHNA 2MLEC 2H61C 4QJ4B 1C07A 2SCPA 2KBMA 1KSMA 1CM1A 1CFCA 1QLKA 1QLSA 3SIAA 3D0YB 1LINA 2M9GA 5AFPA 4ICBA 1DJXA 1MF8B 1EG4A 3OB2B 3SG3A 5HYDA 5HKYA 3BUWB 1FPWA 3KEVA 3TDIA 1U5IA 2AMIA 1KFXL 4PE0A 1CKKA 4QJ5B 3BUMB 4PALA 1KQMC 5G08A 1TNWA 4CFRA 1QIVA 3CWGA 2CCMA 3DVJA 1UHKA 2JQ6A 3O2PA 1BODA 1H8BA 2H61A 3I5FB 1Q80A 2EC6B 5CSNA 1DJHA 3I5FC 4L9MA 5F6TA 2JT3A 1G8IA 4GUKA 4HRHA 1ZUZA 1BJFA 2ZFDA 3AAJA 1RTP1 1TIZA 1TRFA 1PRWA 2MLFC 1MXLC 1YVLA 2KI4B 2WCEA 3ICBA 4P2YB 1CDNA 2KI4C 4PHMA 2JNFA 4GPLB 4I5LB 1KSOA 4MZKA 2P6BB 5BPJA 1CFFA 3QRXA 1JWDA 1LA3A 2CTNA 2WCBA 5CSJA 1DF0A 2HPSA 2QPTA 1BG1A 3DF0A 2A4JA 2LCPA 3M0WA 3TS5C 2BKIB 1GJYA 1SPYA 1SCMB 1KK7Y 1B7TY 1QXPA 1XO5A 2LVJA 1KK8B 1AVSA 1KK8C 1IH0A 2PVBA 2LLUA 4C0KA 1QS7A 1B1GA 2KGRA 1PSRA 3TDZA 4ORBB 1XK4A 1TNQA 2CNPA 1A75A 1OMRA 3OX6A 4M2PA 4YGAA 4OKHA 2WORA 3O4YA 2EHBA 1GGWA 3OB1B 1B47A 1K8UA 4GBAA 1WLZA 3WNXB 2MRDA 2E6WA 4E68A 3BUOB 1F70A 3HCMA 1W7JB 1SR6B 4D1EA 1QX5B 3PALA 1SR6C 1YVHA 1K95A 1MHOA 4MZJA 1FI5A 3E3RA 1S5GY 4P5OE 3NSKA 3SG6A 2ZNEA 1MQ1A 1C7WA 1TTXA 2CT9A 2JWWA 3WHTB 2LAPA 1IQ5A 1S26D 3VGOA 1V1GA 3F45A 1ALVA 4AOMA 1S6JA 1TNPA 3BXKA 2ZRTA 1ZOTB 2E30A 3O78A 4MRXA 2BL0B 1CM4A 2JT8A 4MN0A 2BL0C 1QJTA 2OTGB 2O60A 3PLFB 1K9KA 1B4CA 4DRWA 2KQ6A 2K2FA 4PDZA 2PRUA 2LNKA 1UUSA 2LV7A 1FW4A 2KAVA 1AUIB 4PHNA 2KI6D 2PMYA 4IL1A 1M46A 3JTDB 2JZIA 3JTDC 3BYAA 3SG5A 4R1EA 2FJUB 1LKJA 1Y1XA 1UP5A
chains in the Genus database with same CATH superfamily
1BT6A 1Z4HA 1C7VA 2KI6C 5J3XA 4BY4A 1M39A 1S6CA 2LMTA 1OOGA 4INWA 2LLSA 1CB1A 2M97A 4PHKA 4XJKA 2FCDA 5I8NA 1OZOA 5K89A 5I94A 3FWBA 2I2RE 2KLEA 2LP3A 2M7NA 5I2LA 1CTRA 1T14A 1ORGA 4JWQA 1RECA 1YUSA 2LLTA 2TN4A 3B88A 2BECA 5GQQC 3SIBA 3VRNA 3BUNB 2L2CA 2H8VA 1EL4A 4FQOA 3EK7A 2K7DA 3LLEA 1QX7A 3VRPA 3RM1A 3SS3A 1K90D 3H4SE 5D7FA 3JVTB 1ODBA 3GK1A 2MAZA 3JVTC 3EVVA 1KFUS 4DIRA 5ER5A 1NWDA 1IJ6A 2BCXA 1S6IA 3DXLA 1AP4A 1BLQA 3SS5A 2M49B 2I94A 1NCZA 2KLDA 2L4HA 2RGIA 2WC8A 4FTGA 5D69A 3SG4A 1EJ3A 3TUYB 4N1FA 1JBAA 1H4BA 3TUYC 4C0JA 1XFRA 2LVKA 3WHUB 2PQLA 1SYMA 2KOTA 2EC6C 4GGFC 5I2QA 2HETA 3BOWB 1DJGA 3PFVA 1DT7B 2AAOA 5HKZA 2L98A 2QEBA 3FE8A 1F4OA 2PSRA 1ALWA 2YGUA 3EK8A 3CZ2A 3D0YA 4TNCA 4UPGA 1EH2A 1YX7A 1M31A 1XA5A 3CZ0A 2HQWA 1JC2A 1Y1UA 2LHLA 2QACA 1OOHA 1QIWA 3O6BA 2ZNDA 2I7AA 3BJHA 3DY9A 1UHJA 1RFJA 2KFGA 1SY9A 2NCOA 3S0DA 1CLBA 1TWOA 3CZTX 5TNCA 1ZMZA 1NX0A 4MRYA 1AJ4A 2ZN8A 4MSPA 1DQEA 2L0PA 2LMVA 4DCKA 2P70A 3HX4A 1PVBA 2BBMA 4INXA 2JNXA 3UO9A 2LE9B 1QATA 1KFXS 1YURA 1NCYA 1SCMC 4Q04A 2DOQA 4HRGA 2WCLA 1K93D 2COLB 4HSZA 4PE4A 2NXQA 1RROA 1AJ5A 5DICA 5PALA 2LM5A 1M45A 3GK4X 3L4AA 1CLLA 1QVIY 1YTZC 3VROA 4YGDB 3VB1A 1GM0A 2ZRSA 1OQPA 2I18A 4BY5A 1KK7Z 1B7TZ 1CFDA 2JT0A 1NCXA 1WRZA 2F2OA 1CFPA 1HT9A 1TCFA 2KAXA 3S0FA 4XYNA 4OV2A 3KO0A 1L7ZA 3B6XA 1R2UA 3CTNA 1A29A 4F7FA 1K2HA 3IVTA 1D1OA 3VRQA 3VRRA 4CPVA 1SL8A 1QVIZ 4QJ3B 3A4UB 1XFUO 1XYDA 3L47A 5EL2A 1DVIA 3AKBA 5HLOA 1SSEB 1S36A 3LCPC 1NUBA 4M2QA 1A2XA 4OCIA 1Y1AA 1EG3A 2ISDA 1UHHA 4ETOA 4I5JA 3PN7B 1B8CA 3NXAA 2L5XB 5JJGA 3RZSA 3PN7C 1VRKA 1X02A 4USLA 1QASA 2K7OA 1G33A 1IWQA 1OOJA 3D75A 4WRIA 1FBVA 2LC5A 2MJWB 2JULA 5CPVA 3FE6A 1HQVA 5CSFA 2K60A 1QV0A 2OTGC 3A8RA 1S5GZ 1BR4B 2KQYA 1B8RA 4CFQA 2LP2A 3AKAA 4GAOA 1B8LA 1K9UA 3NSLA 4AQJA 1G4YR 1KWOB 1WRLA 2KDHA 3FWCA 1L2OB 1K9PA 1KWOC 1RWYA 2WOSA 2K8MB 3WXAA 4A4CA 3PSRA 2H2KA 1SKTA 2JTZA 2LUCA 4M2OA 1J1DA 2G2BA 3IF7A 4MLWA 2WCHA 1JFJA 1WRKA 3K21A 3OHMB 3DD4A 1QV1A 1J7PA 4JKTA 4XJKB 1OW4A 3I5GB 4MZLA 3ZWHA 2BE6A 3CR5X 1A03A 1MR8A 1XFXO 1OSAA 1YRUB 2F3YA 3IQQA 1M63B 3OBVA 3R72A 2M1KB 2BNXA 1MWNA 1PK0D 2FJYA 2JPOA 1ZFSA 5AXIA 2Q4UA 3GK2A 1CMGA 2K7CA 1S3PA 4PT1A 4YGBB 3DVMA 1LXFC 2KFHA 2Q91A 2BBNA 4N1GA 4F0ZB 1W9ZA 2IS9A 3AAKA 2KYFA 3K1EA 3I5IB 1CLMA 1IGVA 2B1UA 2GTEA 3I5IC 1ZACA 2M3WA 1AK8A 1LVCD 3CABA 1U5IB 2JXCA 3DZTA 3D73A 1YRTB 2WNDA 4KYNA 4N5XA 4OVNF 3PJIA 3SG2A 1QTXA 5HKWA 1UHIA 2Y4QA 2M29A 4ORCB 1Y6WA 1OZSA 2HF5A 3OX5A 1IG5A 1OE9B 5D3OA 2ZN9A 1K94A 2MA2A 1LA0A 1C3ZA 5B8IB 1J1EA 3DVEA 3S0AA 3KHEA 3OP0A 4IJ7A 5AANA 1BOCA 2F8PA 2JOJA 2KBIA 3EK4A 1CMFA 1DTLA 2M1UA 3LL8B 3S0EA 5AERA 1IJ5A 1SBJA 1YUTA 5DKNA 1KQVA 1XFZO 1WLMA 1J7RA 2LMUA 2QEOA 4JPZB 5ER4X 3BUXB 2G9BA 2GV5A 4YBHB 4PE7A 2GGMA 3PM8A 1F54A 3ZNIA 1KQMB 3NHIA 4I5NB 1NSHA 2GGZA 2QEVA 1DF0B 1SNLA 1AHRA 2K2AA 1WDCB 3DF0B 3TDUA 1Z2CB 3OGNA 4JD9A 4NDBA 1WDCC 1E8AA 3B86A 4U8DA 1CNPA 5FYXA 3FE9A 1P28A 2KAYA 3KPXA 1J7OA 3CS1A 1NX1A 4GGFA 2BKHB 1SL9A 2JTTA 3BOWA 3PATA 2LUXA 2QDIA 4HREE 2HQ8A 2ERBA 3SG7A 1IIOA 3L4LA 4PCWA 2M7LA 1LS8A 2M8UA 1UWOA 1F55A 1JF2A 4MVFA 2K61A 2KNEA 1UURA 4GNKB 2Y5IA 3CDNA 1JSAA 3PM2A 3S0GA 3IQOA 2ZKMX 2BCBA 4NQGA 4GFTA 3O4XA 1CDLA 1JFKA 2F3ZA 2L4IA 2NCPA 2KYCA 1CDPA 3NSIA 4JQ0D 3BQ3A 1XK4C 1A75B 2D8NA 3EKHA 1PALA 1RJVA 1NX2A 3TS5B 4A4BA 4CLNA 2OS8B 1QX2A 2PALA 2OS8C 4C0LA 3RLZA 3B7AA 3FS7A 4PHJA 2KPHA 3BFBA 1BU3A 1OMDA 1YUUA 1A4PA 3D10A 4DS7A 3CZ1A 4YI8A 2VRGA 3S0BA 1TOPA 1SMGA 1NX3A 1IKUA 2V53A 3EVRA 1EXRA 1SW8A 2MHHA 3CLNA 1DJZA 2KHNA 2WCKA 1TN4A 3TZ1A 5KSZA 4YGCB 2CXJA 5FI6A 3CYZA 5HLVA 3BFAA 1MUXA 1FI6A 3C1VA 3EVUA 5DKRA 5DKQA 1YX8A 4MBEA 3NSOA 4WQ3A 5KTYA 1SCVA 1DJIA 2AUCA 1F4QA 4ZCUA 1IQ3A 1N65A 1SL7A 2F2PA 2JC2A 5CSIA 3MSEB 5KU1A 1DMOA 2LVVA 2LVIA 2K0JA 1OMVA 4GGNA 1BMOA 1PVAA 2Y1NA 5AEQA 4NDDA 2MBXA 2WCMA 1J7QA 2K7BA 1NPQA 2EGDA 2NLNA 2WCFA 3UNWA 2KGBC 1L2OC 1OOIX 1RK9A 2JRFA 5I2OA 1S1EA 5FI2A 3LK1A 4YI9A 1SRAA 1N0YA 3DVKA 3CR2A 3LK0A 2PASA 2LANA 1NP8A 5JOLA 1Y0VH 3SJSA 2NZ0A 4I5KA 1FF1A 1WY9A 4AQIA 1MXEA 2SASA 1XVJA 3CR4X 1BR1B 1GQMA 1DJWA 3KF9A 1YR5A 3I5GC 1B9AA 3I5HB 4PE1A 3CGAA 2JXLA 3I5HC 1NIWA 1NYAA 2CBLA 2L51A 3FIAA 4ORAB 1PULA 2JPTA 1QWVA 1DJYA 1W7IB 2KFFA 4DUQA 4YRUA 5IBWA 1GGZA 1KFUL 4OZDA 1V1FA 1SK6D 1JUOA 1XFWO 2LHIA 2F33A 4FQTA 4WQ2A 1DGVA 2L2EA 1IRJA 1PSBA 1CDMA 2KSPA 2O5GA 4OR9B 2L50A 1KCYA 1DGUA 2BCAA 1JF0A 2OPOA 4MEWA 1F8HA 2R2IA 1XFVO 2FOTA 2M0RA 2Y1MA 1BF5A 1J55A 1F71A 1TNXA 1XFYO 2JU0A 4NDCA 4ZCVA 4CIDA 2BE4A 1R6PA 1N2DA 2FCEA 1TCOB 2PYQA 1K96A 2BAPA 3EKJA 3GOFA 1UHNA 2MLEC 2WCJA 2H61C 4QJ4B 1C07A 2SCPA 2KBMA 1KSMA 3D76A 1CM1A 1CFCA 1QLKA 1QLSA 3SIAA 3D0YB 1LINA 2M9GA 5AFPA 1OOFA 4ICBA 1DJXA 1MF8B 1EG4A 3OB2B 3SG3A 5HYDA 3QMEA 5HKYA 3BUWB 3EG5B 2WC6A 3KEVA 3TDIA 1U5IA 2AMIA 1KFXL 1DC1A 1FPWA 4PE0A 1CKKA 4QJ5B 3BUMB 4PALA 1KQMC 5G08A 1TNWA 4CFRA 1QIVA 3CWGA 2CCMA 3DVJA 1UHKA 2JQ6A 3O2PA 1BODA 1H8BA 2H61A 3I5FB 1Q80A 2EC6B 5CSNA 1DJHA 3I5FC 4L9MA 5F6TA 2JT3A 3DYEA 1G8IA 1TUJA 4GUKA 4HRHA 1ZUZA 1BJFA 2ZFDA 3AAJA 1RTP1 1TIZA 1TRFA 1PRWA 2MLFC 1MXLC 1YVLA 2KI4B 2WCEA 3ICBA 3NGVA 4P2YB 1CDNA 2KI4C 3R1OA 4PHMA 3N7HA 2JNFA 3BFHA 4GPLB 4I5LB 1KSOA 1TUZA 4MZKA 2P6BB 5BPJA 1CFFA 3QRXA 3R1VA 1JWDA 1LA3A 2CTNA 2WCBA 2P71A 1DF0A 5CSJA 2HPSA 2QPTA 3SS4A 1BG1A 3DF0A 5HL1A 2A4JA 2LCPA 2WC5A 3M0WA 3TS5C 2BKIB 1GJYA 1SPYA 1SCMB 1KK7Y 1B7TY 1QXPA 1XO5A 2LVJA 1KK8B 1AVSA 1KK8C 1IH0A 2PVBA 2LLUA 4C0KA 1QS7A 1B1GA 2KGRA 1PSRA 3TDZA 3NHTA 1XK4A 4ORBB 1TNQA 2CNPA 1C3YA 1A75A 1OMRA 3OX6A 4M2PA 4YGAA 4OKHA 2WORA 3O4YA 2EHBA 1GGWA 3OB1B 1B47A 1K8UA 4GBAA 1WLZA 3WNXB 2MRDA 2E6WA 4E68A 3BUOB 1F70A 3D77A 3HCMA 1W7JB 1SR6B 4D1EA 1QX5B 1DELA 1SR6C 3PALA 1YVHA 1K95A 1MHOA 4MZJA 1FI5A 3E3RA 1S5GY 4P5OE 3NSKA 3SG6A 2ZNEA 1MQ1A 1C7WA 1TTXA 2CT9A 2JWWA 3D74A 2LAPA 3WHTB 1IQ5A 1S26D 3VGOA 1V1GA 3F45A 2L5YA 1ALVA 4AOMA 1S6JA 1TNPA 3BXKA 2ZRTA 3B87A 3Q8IA 5FI7A 1ZOTB 2E30A 3O78A 4MRXA 2BL0B 1CM4A 2JT8A 4MN0A 2BL0C 2QEHA 1QJTA 2OTGB 2O60A 3PLFB 3V2LA 3D78A 1K9KA 1B4CA 4DRWA 2KQ6A 2K2FA 4YGEB 4PDZA 2PRUA 2LNKA 1UUSA 2LV7A 1FW4A 3R1PA 2KAVA 1AUIB 4PHNA 2KI6D 2PMYA 4IL1A 1M46A 1DEKA 3JTDB 2JZIA 3JTDC 3BYAA 3SG5A 4R1EA 2FJUB 1LKJA 1Y1XA 1UP5A
chains in the Genus database with same CATH topology
1BT6A 1C7VA 2KI6C 5J3XA 4BY4A 1M39A 1S6CA 2LMTA 2LLSA 1CB1A 2M97A 4PHKA 4XJKA 2FCDA 5I8NA 1OZOA 5K89A 3FWBA 2I2RE 2LP3A 2M7NA 5I2LA 1CTRA 4JWQA 1RECA 1YUSA 2LLTA 2TN4A 5GQQC 2BECA 3SIBA 3VRNA 3BUNB 1EL4A 4FQOA 3EK7A 2K7DA 3LLEA 1QX7A 3VRPA 3RM1A 1K90D 3H4SE 5D7FA 3JVTB 1ODBA 3GK1A 2MAZA 3JVTC 3EVVA 1KFUS 4DIRA 5ER5A 1NWDA 1IJ6A 2BCXA 1S6IA 1AP4A 1BLQA 2M49B 2I94A 1NCZA 2L4HA 2RGIA 2WC8A 3SG4A 4FTGA 5D69A 3TUYB 1EJ3A 1JBAA 4N1FA 1H4BA 3TUYC 4C0JA 2LVKA 3WHUB 1SYMA 2KOTA 2EC6C 4GGFC 5I2QA 2HETA 3BOWB 1DJGA 3PFVA 1DT7B 2AAOA 5HKZA 2L98A 1F4OA 2PSRA 1ALWA 3EK8A 4UPGA 3D0YA 4TNCA 1EH2A 1YX7A 1M31A 1XA5A 2HQWA 1JC2A 1Y1UA 2LHLA 2QACA 3O6BA 1QIWA 4YGEB 2ZNDA 2I7AA 1CLBA 1UHJA 1RFJA 2KFGA 1SY9A 2NCOA 3CZTX 5TNCA 1ZMZA 1NX0A 4MRYA 1AJ4A 2ZN8A 4MSPA 2L0PA 2LMVA 4DCKA 3HX4A 1PVBA 2BBMA 2JNXA 2LE9B 1QATA 1KFXS 1NCYA 1YURA 1SCMC 4Q04A 2DOQA 4HRGA 1K93D 2COLB 4HSZA 4PE4A 2NXQA 1RROA 1AJ5A 5PALA 2LM5A 1M45A 3GK4X 1CLLA 1QVIY 1YTZC 3VROA 4YGDB 2ZRSA 1OQPA 2I18A 4BY5A 1KK7Z 1B7TZ 1CFDA 2JT0A 1NCXA 1WRZA 2F2OA 1CFPA 1HT9A 1TCFA 2KAXA 4XYNA 4OV2A 3KO0A 1L7ZA 1R2UA 3CTNA 1A29A 1K2HA 1D1OA 3VRQA 3VRRA 4CPVA 1SL8A 1QVIZ 4QJ3B 3A4UB 1XFUO 1XYDA 1DVIA 3AKBA 5HLOA 1S36A 3LCPC 1NUBA 4M2QA 1A2XA 4OCIA 1Y1AA 1EG3A 2ISDA 1UHHA 4ETOA 4I5JA 3PN7B 1B8CA 3NXAA 2L5XB 5JJGA 3PN7C 1VRKA 1X02A 4USLA 1QASA 2K7OA 1G33A 1IWQA 1OOJA 4WRIA 1FBVA 2LC5A 2MJWB 2JULA 5CPVA 1HQVA 5CSFA 1QV0A 2OTGC 3A8RA 1S5GZ 1BR4B 2KQYA 1B8RA 4CFQA 2LP2A 3AKAA 4GAOA 1B8LA 1K9UA 3NSLA 4AQJA 1G4YR 1KWOB 1WRLA 2KDHA 3FWCA 1L2OB 1K9PA 1KWOC 1RWYA 2WOSA 2K8MB 3WXAA 4A4CA 3PSRA 2H2KA 1SKTA 2JTZA 2LUCA 4M2OA 1J1DA 2G2BA 3IF7A 4MLWA 1JFJA 1WRKA 3K21A 3OHMB 3DD4A 1QV1A 1J7PA 4XJKB 3I5GB 4MZLA 3ZWHA 2BE6A 3CR5X 1A03A 1MR8A 1XFXO 1OSAA 1YRUB 2F3YA 3IQQA 1M63B 2M1KB 1MWNA 1PK0D 5AXIA 1ZFSA 2Q4UA 3GK2A 1CMGA 2K7CA 1S3PA 4YGBB 3DVMA 1LXFC 2KFHA 2Q91A 2BBNA 4N1GA 4F0ZB 2IS9A 3AAKA 2KYFA 3I5IB 1CLMA 1IGVA 2B1UA 3I5IC 1ZACA 2M3WA 1AK8A 1LVCD 1U5IB 2JXCA 1YRTB 2WNDA 4N5XA 4OVNF 3SG2A 1QTXA 5HKWA 1UHIA 2Y4QA 2M29A 4ORCB 1Y6WA 1OZSA 2HF5A 3OX5A 1IG5A 1OE9B 2ZN9A 1K94A 2MA2A 1LA0A 5B8IB 1J1EA 3DVEA 3KHEA 3OP0A 5AANA 1BOCA 2F8PA 2JOJA 2KBIA 3EK4A 1CMFA 1DTLA 2M1UA 3LL8B 5AERA 1IJ5A 1SBJA 1YUTA 5DKNA 1KQVA 1XFZO 1WLMA 1J7RA 2LMUA 4JPZB 5ER4X 3BUXB 2G9BA 2GV5A 4YBHB 4PE7A 2GGMA 3PM8A 1F54A 3ZNIA 1KQMB 4I5NB 1NSHA 2GGZA 1DF0B 1SNLA 1AHRA 2K2AA 1WDCB 3DF0B 3TDUA 1CNPA 4NDBA 1WDCC 1E8AA 4U8DA 5FYXA 2KAYA 3KPXA 1J7OA 3CS1A 1NX1A 4GGFA 2BKHB 1SL9A 2JTTA 3BOWA 3PATA 2LUXA 4HREE 2HQ8A 3SG7A 4PCWA 2M7LA 2M8UA 1UWOA 1F55A 1JF2A 4MVFA 2K61A 2KNEA 1UURA 4GNKB 2Y5IA 1JSAA 3IQOA 2ZKMX 2BCBA 4NQGA 4GFTA 1CDLA 1JFKA 2F3ZA 2L4IA 2NCPA 2KYCA 1CDPA 3NSIA 4JQ0D 3BQ3A 1XK4C 1A75B 2D8NA 3EKHA 1PALA 1RJVA 1NX2A 3TS5B 4A4BA 4CLNA 2OS8B 1QX2A 2PALA 2OS8C 4C0LA 3RLZA 3FS7A 4PHJA 1BU3A 1OMDA 1YUUA 1A4PA 3D10A 4DS7A 4YI8A 2VRGA 1TOPA 1SMGA 1NX3A 1IKUA 2V53A 3EVRA 1EXRA 1SW8A 2MHHA 3CLNA 1DJZA 2KHNA 1TN4A 3TZ1A 5KSZA 4YGCB 2CXJA 5HLVA 1MUXA 1FI6A 3C1VA 3EVUA 5DKRA 5DKQA 1YX8A 4MBEA 3NSOA 4WQ3A 5KTYA 1SCVA 1DJIA 2AUCA 1F4QA 4ZCUA 1IQ3A 1N65A 1SL7A 2F2PA 2JC2A 5CSIA 3MSEB 5KU1A 1DMOA 2LVVA 2LVIA 2K0JA 1OMVA 4GGNA 1BMOA 1PVAA 2Y1NA 5AEQA 4NDDA 2MBXA 1J7QA 2K7BA 1NPQA 2EGDA 2NLNA 2WCFA 2KGBC 1L2OC 1RK9A 5I2OA 2JRFA 1S1EA 3LK1A 4YI9A 1SRAA 1N0YA 3DVKA 3CR2A 3LK0A 2PASA 2LANA 1NP8A 5JOLA 1Y0VH 3SJSA 2NZ0A 4I5KA 1FF1A 1WY9A 4AQIA 1MXEA 2SASA 1XVJA 3CR4X 1BR1B 1GQMA 1DJWA 3KF9A 1YR5A 3I5GC 1B9AA 3I5HB 4PE1A 3CGAA 2JXLA 3I5HC 1NIWA 1NYAA 2CBLA 2L51A 3FIAA 4ORAB 1PULA 2JPTA 5IBWA 1DJYA 1W7IB 2KFFA 4DUQA 4YRUA 1GGZA 1KFUL 1V1FA 1SK6D 1JUOA 1XFWO 2LHIA 2F33A 4WQ2A 1DGVA 2L2EA 1IRJA 1PSBA 1CDMA 2KSPA 2O5GA 4OR9B 2L50A 1KCYA 1DGUA 2BCAA 1JF0A 2OPOA 4MEWA 1F8HA 2R2IA 1XFVO 2FOTA 2M0RA 2Y1MA 1BF5A 1J55A 1F71A 1TNXA 1XFYO 2JU0A 4NDCA 4ZCVA 4CIDA 2BE4A 1R6PA 1N2DA 2FCEA 1TCOB 1K96A 3EKJA 3GOFA 1UHNA 2MLEC 2H61C 4QJ4B 1C07A 2SCPA 2KBMA 1KSMA 1CM1A 1CFCA 1QLKA 1QLSA 3SIAA 3D0YB 1LINA 2M9GA 5AFPA 4ICBA 1DJXA 1MF8B 1EG4A 3OB2B 3SG3A 5HYDA 5HKYA 3BUWB 1FPWA 3KEVA 3TDIA 1U5IA 2AMIA 1KFXL 4PE0A 1CKKA 4QJ5B 3BUMB 4PALA 1KQMC 5G08A 1TNWA 4CFRA 1QIVA 3CWGA 2CCMA 3DVJA 1UHKA 2JQ6A 3O2PA 1BODA 1H8BA 2H61A 3I5FB 1Q80A 2EC6B 5CSNA 1DJHA 3I5FC 4L9MA 5F6TA 2JT3A 1G8IA 4GUKA 4HRHA 1ZUZA 1BJFA 2ZFDA 3AAJA 1RTP1 1TIZA 1TRFA 1PRWA 2MLFC 1MXLC 1YVLA 2KI4B 2WCEA 3ICBA 4P2YB 1CDNA 2KI4C 4PHMA 2JNFA 4GPLB 4I5LB 1KSOA 4MZKA 2P6BB 5BPJA 1CFFA 3QRXA 1JWDA 1LA3A 2CTNA 2WCBA 5CSJA 1DF0A 2HPSA 2QPTA 1BG1A 3DF0A 2A4JA 2LCPA 3M0WA 3TS5C 2BKIB 1GJYA 1SPYA 1SCMB 1KK7Y 1B7TY 1QXPA 1XO5A 2LVJA 1KK8B 1AVSA 1KK8C 1IH0A 2PVBA 2LLUA 4C0KA 1QS7A 1B1GA 2KGRA 1PSRA 3TDZA 4ORBB 1XK4A 1TNQA 2CNPA 1A75A 1OMRA 3OX6A 4M2PA 4YGAA 4OKHA 2WORA 3O4YA 2EHBA 1GGWA 3OB1B 1B47A 1K8UA 4GBAA 1WLZA 3WNXB 2MRDA 2E6WA 4E68A 3BUOB 1F70A 3HCMA 1W7JB 1SR6B 4D1EA 1QX5B 3PALA 1SR6C 1YVHA 1K95A 1MHOA 4MZJA 1FI5A 3E3RA 1S5GY 4P5OE 3NSKA 3SG6A 2ZNEA 1MQ1A 1C7WA 1TTXA 2CT9A 2JWWA 3WHTB 2LAPA 1IQ5A 1S26D 3VGOA 1V1GA 3F45A 1ALVA 4AOMA 1S6JA 1TNPA 3BXKA 2ZRTA 1ZOTB 2E30A 3O78A 4MRXA 2BL0B 1CM4A 2JT8A 4MN0A 2BL0C 1QJTA 2OTGB 2O60A 3PLFB 1K9KA 1B4CA 4DRWA 2KQ6A 2K2FA 4PDZA 2PRUA 2LNKA 1UUSA 2LV7A 1FW4A 2KAVA 1AUIB 4PHNA 2KI6D 2PMYA 4IL1A 1M46A 3JTDB 2JZIA 3JTDC 3BYAA 3SG5A 4R1EA 2FJUB 1LKJA 1Y1XA 1UP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT6 A;  1C7V A;  2KI6 C;  5J3X A;  4BY4 A;  1M39 A;  1S6C A;  2LMT A;  2LLS A;  1CB1 A;  2M97 A;  4PHK A;  4XJK A;  2FCD A;  5I8N A;  1OZO A;  5K89 A;  3FWB A;  2I2R E;  2LP3 A;  2M7N A;  5I2L A;  1CTR A;  4JWQ A;  1REC A;  1YUS A;  2LLT A;  2TN4 A;  5GQQ C;  2BEC A;  3SIB A;  3VRN A;  3BUN B;  1EL4 A;  4FQO A;  3EK7 A;  2K7D A;  3LLE A;  1QX7 A;  3VRP A;  3RM1 A;  1K90 D;  3H4S E;  5D7F A;  3JVT B;  1ODB A;  3GK1 A;  2MAZ A;  3JVT C;  3EVV A;  1KFU S;  4DIR A;  5ER5 A;  1NWD A;  1IJ6 A;  2BCX A;  1S6I A;  1AP4 A;  1BLQ A;  2M49 B;  2I94 A;  1NCZ A;  2L4H A;  2RGI A;  2WC8 A;  3SG4 A;  4FTG A;  5D69 A;  3TUY B;  1EJ3 A;  1JBA A;  4N1F A;  1H4B A;  3TUY C;  4C0J A;  2LVK A;  3WHU B;  1SYM A;  2KOT A;  2EC6 C;  4GGF C;  5I2Q A;  2HET A;  3BOW B;  1DJG A;  3PFV A;  1DT7 B;  2AAO A;  5HKZ A;  2L98 A;  1F4O A;  2PSR A;  1ALW A;  3EK8 A;  4UPG A;  3D0Y A;  4TNC A;  1EH2 A;  1YX7 A;  1M31 A;  1XA5 A;  2HQW A;  1JC2 A;  1Y1U A;  2LHL A;  2QAC A;  3O6B A;  1QIW A;  4YGE B;  2ZND A;  2I7A A;  1CLB A;  1UHJ A;  1RFJ A;  2KFG A;  1SY9 A;  2NCO A;  3CZT X;  5TNC A;  1ZMZ A;  1NX0 A;  4MRY A;  1AJ4 A;  2ZN8 A;  4MSP A;  2L0P A;  2LMV A;  4DCK A;  3HX4 A;  1PVB A;  2BBM A;  2JNX A;  2LE9 B;  1QAT A;  1KFX S;  1NCY A;  1YUR A;  1SCM C;  4Q04 A;  2DOQ A;  4HRG A;  1K93 D;  2COL B;  4HSZ A;  4PE4 A;  2NXQ A;  1RRO A;  1AJ5 A;  5PAL A;  2LM5 A;  1M45 A;  3GK4 X;  1CLL A;  1QVI Y;  1YTZ C;  3VRO A;  4YGD B;  2ZRS A;  1OQP A;  2I18 A;  4BY5 A;  1KK7 Z;  1B7T Z;  1CFD A;  2JT0 A;  1NCX A;  1WRZ A;  2F2O A;  1CFP A;  1HT9 A;  1TCF A;  2KAX A;  4XYN A;  4OV2 A;  3KO0 A;  1L7Z A;  1R2U A;  3CTN A;  1A29 A;  1K2H A;  1D1O A;  3VRQ A;  3VRR A;  4CPV A;  1SL8 A;  1QVI Z;  4QJ3 B;  3A4U B;  1XFU O;  1XYD A;  1DVI A;  3AKB A;  5HLO A;  1S36 A;  3LCP C;  1NUB A;  4M2Q A;  1A2X A;  4OCI A;  1Y1A A;  1EG3 A;  2ISD A;  1UHH A;  4ETO A;  4I5J A;  3PN7 B;  1B8C A;  3NXA A;  2L5X B;  5JJG A;  3PN7 C;  1VRK A;  1X02 A;  4USL A;  1QAS A;  2K7O A;  1G33 A;  1IWQ A;  1OOJ A;  4WRI A;  1FBV A;  2LC5 A;  2MJW B;  2JUL A;  5CPV A;  1HQV A;  5CSF A;  1QV0 A;  2OTG C;  3A8R A;  1S5G Z;  1BR4 B;  2KQY A;  1B8R A;  4CFQ A;  2LP2 A;  3AKA A;  4GAO A;  1B8L A;  1K9U A;  3NSL A;  4AQJ A;  1G4Y R;  1KWO B;  1WRL A;  2KDH A;  3FWC A;  1L2O B;  1K9P A;  1KWO C;  1RWY A;  2WOS A;  2K8M B;  3WXA A;  4A4C A;  3PSR A;  2H2K A;  1SKT A;  2JTZ A;  2LUC A;  4M2O A;  1J1D A;  2G2B A;  3IF7 A;  4MLW A;  1JFJ A;  1WRK A;  3K21 A;  3OHM B;  3DD4 A;  1QV1 A;  1J7P A;  4XJK B;  3I5G B;  4MZL A;  3ZWH A;  2BE6 A;  3CR5 X;  1A03 A;  1MR8 A;  1XFX O;  1OSA A;  1YRU B;  2F3Y A;  3IQQ A;  1M63 B;  2M1K B;  1MWN A;  1PK0 D;  5AXI A;  1ZFS A;  2Q4U A;  3GK2 A;  1CMG A;  2K7C A;  1S3P A;  4YGB B;  3DVM A;  1LXF C;  2KFH A;  2Q91 A;  2BBN A;  4N1G A;  4F0Z B;  2IS9 A;  3AAK A;  2KYF A;  3I5I B;  1CLM A;  1IGV A;  2B1U A;  3I5I C;  1ZAC A;  2M3W A;  1AK8 A;  1LVC D;  1U5I B;  2JXC A;  1YRT B;  2WND A;  4N5X A;  4OVN F;  3SG2 A;  1QTX A;  5HKW A;  1UHI A;  2Y4Q A;  2M29 A;  4ORC B;  1Y6W A;  1OZS A;  2HF5 A;  3OX5 A;  1IG5 A;  1OE9 B;  2ZN9 A;  1K94 A;  2MA2 A;  1LA0 A;  5B8I B;  1J1E A;  3DVE A;  3KHE A;  3OP0 A;  5AAN A;  1BOC A;  2F8P A;  2JOJ A;  2KBI A;  3EK4 A;  1CMF A;  1DTL A;  2M1U A;  3LL8 B;  5AER A;  1IJ5 A;  1SBJ A;  1YUT A;  5DKN A;  1KQV A;  1XFZ O;  1WLM A;  1J7R A;  2LMU A;  4JPZ B;  5ER4 X;  3BUX B;  2G9B A;  2GV5 A;  4YBH B;  4PE7 A;  2GGM A;  3PM8 A;  1F54 A;  3ZNI A;  1KQM B;  4I5N B;  1NSH A;  2GGZ A;  1DF0 B;  1SNL A;  1AHR A;  2K2A A;  1WDC B;  3DF0 B;  3TDU A;  1CNP A;  4NDB A;  1WDC C;  1E8A A;  4U8D A;  5FYX A;  2KAY A;  3KPX A;  1J7O A;  3CS1 A;  1NX1 A;  4GGF A;  2BKH B;  1SL9 A;  2JTT A;  3BOW A;  3PAT A;  2LUX A;  4HRE E;  2HQ8 A;  3SG7 A;  4PCW A;  2M7L A;  2M8U A;  1UWO A;  1F55 A;  1JF2 A;  4MVF A;  2K61 A;  2KNE A;  1UUR A;  4GNK B;  2Y5I A;  1JSA A;  3IQO A;  2ZKM X;  2BCB A;  4NQG A;  4GFT A;  1CDL A;  1JFK A;  2F3Z A;  2L4I A;  2NCP A;  2KYC A;  1CDP A;  3NSI A;  4JQ0 D;  3BQ3 A;  1XK4 C;  1A75 B;  2D8N A;  3EKH A;  1PAL A;  1RJV A;  1NX2 A;  3TS5 B;  4A4B A;  4CLN A;  2OS8 B;  1QX2 A;  2PAL A;  2OS8 C;  4C0L A;  3RLZ A;  3FS7 A;  4PHJ A;  1BU3 A;  1OMD A;  1YUU A;  1A4P A;  3D10 A;  4DS7 A;  4YI8 A;  2VRG A;  1TOP A;  1SMG A;  1NX3 A;  1IKU A;  2V53 A;  3EVR A;  1EXR A;  1SW8 A;  2MHH A;  3CLN A;  1DJZ A;  2KHN A;  1TN4 A;  3TZ1 A;  5KSZ A;  4YGC B;  2CXJ A;  5HLV A;  1MUX A;  1FI6 A;  3C1V A;  3EVU A;  5DKR A;  5DKQ A;  1YX8 A;  4MBE A;  3NSO A;  4WQ3 A;  5KTY A;  1SCV A;  1DJI A;  2AUC A;  1F4Q A;  4ZCU A;  1IQ3 A;  1N65 A;  1SL7 A;  2F2P A;  2JC2 A;  5CSI A;  3MSE B;  5KU1 A;  1DMO A;  2LVV A;  2LVI A;  2K0J A;  1OMV A;  4GGN A;  1BMO A;  1PVA A;  2Y1N A;  5AEQ A;  4NDD A;  2MBX A;  1J7Q A;  2K7B A;  1NPQ A;  2EGD A;  2NLN A;  2WCF A;  2KGB C;  1L2O C;  1RK9 A;  5I2O A;  2JRF A;  1S1E A;  3LK1 A;  4YI9 A;  1SRA A;  1N0Y A;  3DVK A;  3CR2 A;  3LK0 A;  2PAS A;  2LAN A;  1NP8 A;  5JOL A;  1Y0V H;  3SJS A;  2NZ0 A;  4I5K A;  1FF1 A;  1WY9 A;  4AQI A;  1MXE A;  2SAS A;  1XVJ A;  3CR4 X;  1BR1 B;  1GQM A;  1DJW A;  3KF9 A;  1YR5 A;  3I5G C;  1B9A A;  3I5H B;  4PE1 A;  3CGA A;  2JXL A;  3I5H C;  1NIW A;  1NYA A;  2CBL A;  2L51 A;  3FIA A;  4ORA B;  1PUL A;  2JPT A;  5IBW A;  1DJY A;  1W7I B;  2KFF A;  4DUQ A;  4YRU A;  1GGZ A;  1KFU L;  1V1F A;  1SK6 D;  1JUO A;  1XFW O;  2LHI A;  2F33 A;  4WQ2 A;  1DGV A;  2L2E A;  1IRJ A;  1PSB A;  1CDM A;  2KSP A;  2O5G A;  4OR9 B;  2L50 A;  1KCY A;  1DGU A;  2BCA A;  1JF0 A;  2OPO A;  4MEW A;  1F8H A;  2R2I A;  1XFV O;  2FOT A;  2M0R A;  2Y1M A;  1BF5 A;  1J55 A;  1F71 A;  1TNX A;  1XFY O;  2JU0 A;  4NDC A;  4ZCV A;  4CID A;  2BE4 A;  1R6P A;  1N2D A;  2FCE A;  1TCO B;  1K96 A;  3EKJ A;  3GOF A;  1UHN A;  2MLE C;  2H61 C;  4QJ4 B;  1C07 A;  2SCP A;  2KBM A;  1KSM A;  1CM1 A;  1CFC A;  1QLK A;  1QLS A;  3SIA A;  3D0Y B;  1LIN A;  2M9G A;  5AFP A;  4ICB A;  1DJX A;  1MF8 B;  1EG4 A;  3OB2 B;  3SG3 A;  5HYD A;  5HKY A;  3BUW B;  1FPW A;  3KEV A;  3TDI A;  1U5I A;  2AMI A;  1KFX L;  4PE0 A;  1CKK A;  4QJ5 B;  3BUM B;  4PAL A;  1KQM C;  5G08 A;  1TNW A;  4CFR A;  1QIV A;  3CWG A;  2CCM A;  3DVJ A;  1UHK A;  2JQ6 A;  3O2P A;  1BOD A;  1H8B A;  2H61 A;  3I5F B;  1Q80 A;  2EC6 B;  5CSN A;  1DJH A;  3I5F C;  4L9M A;  5F6T A;  2JT3 A;  1G8I A;  4GUK A;  4HRH A;  1ZUZ A;  1BJF A;  2ZFD A;  3AAJ A;  1RTP 1;  1TIZ A;  1TRF A;  1PRW A;  2MLF C;  1MXL C;  1YVL A;  2KI4 B;  2WCE A;  3ICB A;  4P2Y B;  1CDN A;  2KI4 C;  4PHM A;  2JNF A;  4GPL B;  4I5L B;  1KSO A;  4MZK A;  2P6B B;  5BPJ A;  1CFF A;  3QRX A;  1JWD A;  1LA3 A;  2CTN A;  2WCB A;  5CSJ A;  1DF0 A;  2HPS A;  2QPT A;  1BG1 A;  3DF0 A;  2A4J A;  2LCP A;  3M0W A;  3TS5 C;  2BKI B;  1GJY A;  1SPY A;  1SCM B;  1KK7 Y;  1B7T Y;  1QXP A;  1XO5 A;  2LVJ A;  1KK8 B;  1AVS A;  1KK8 C;  1IH0 A;  2PVB A;  2LLU A;  4C0K A;  1QS7 A;  1B1G A;  2KGR A;  1PSR A;  3TDZ A;  4ORB B;  1XK4 A;  1TNQ A;  2CNP A;  1A75 A;  1OMR A;  3OX6 A;  4M2P A;  4YGA A;  4OKH A;  2WOR A;  3O4Y A;  2EHB A;  1GGW A;  3OB1 B;  1B47 A;  1K8U A;  4GBA A;  1WLZ A;  3WNX B;  2MRD A;  2E6W A;  4E68 A;  3BUO B;  1F70 A;  3HCM A;  1W7J B;  1SR6 B;  4D1E A;  1QX5 B;  3PAL A;  1SR6 C;  1YVH A;  1K95 A;  1MHO A;  4MZJ A;  1FI5 A;  3E3R A;  1S5G Y;  4P5O E;  3NSK A;  3SG6 A;  2ZNE A;  1MQ1 A;  1C7W A;  1TTX A;  2CT9 A;  2JWW A;  3WHT B;  2LAP A;  1IQ5 A;  1S26 D;  3VGO A;  1V1G A;  3F45 A;  1ALV A;  4AOM A;  1S6J A;  1TNP A;  3BXK A;  2ZRT A;  1ZOT B;  2E30 A;  3O78 A;  4MRX A;  2BL0 B;  1CM4 A;  2JT8 A;  4MN0 A;  2BL0 C;  1QJT A;  2OTG B;  2O60 A;  3PLF B;  1K9K A;  1B4C A;  4DRW A;  2KQ6 A;  2K2F A;  4PDZ A;  2PRU A;  2LNK A;  1UUS A;  2LV7 A;  1FW4 A;  2KAV A;  1AUI B;  4PHN A;  2KI6 D;  2PMY A;  4IL1 A;  1M46 A;  3JTD B;  2JZI A;  3JTD C;  3BYA A;  3SG5 A;  4R1E A;  2FJU B;  1LKJ A;  1Y1X A;  1UP5 A; 
#chains in the Genus database with same CATH topology
 1BT6 A;  1Z4H A;  1C7V A;  2KI6 C;  5J3X A;  4BY4 A;  1M39 A;  1S6C A;  2LMT A;  1OOG A;  4INW A;  2LLS A;  1CB1 A;  2M97 A;  4PHK A;  4XJK A;  2FCD A;  5I8N A;  1OZO A;  5K89 A;  5I94 A;  3FWB A;  2I2R E;  2KLE A;  2LP3 A;  2M7N A;  5I2L A;  1CTR A;  1T14 A;  1ORG A;  4JWQ A;  1REC A;  1YUS A;  2LLT A;  2TN4 A;  3B88 A;  2BEC A;  5GQQ C;  3SIB A;  3VRN A;  3BUN B;  2L2C A;  2H8V A;  1EL4 A;  4FQO A;  3EK7 A;  2K7D A;  3LLE A;  1QX7 A;  3VRP A;  3RM1 A;  3SS3 A;  1K90 D;  3H4S E;  5D7F A;  3JVT B;  1ODB A;  3GK1 A;  2MAZ A;  3JVT C;  3EVV A;  1KFU S;  4DIR A;  5ER5 A;  1NWD A;  1IJ6 A;  2BCX A;  1S6I A;  3DXL A;  1AP4 A;  1BLQ A;  3SS5 A;  2M49 B;  2I94 A;  1NCZ A;  2KLD A;  2L4H A;  2RGI A;  2WC8 A;  4FTG A;  5D69 A;  3SG4 A;  1EJ3 A;  3TUY B;  4N1F A;  1JBA A;  1H4B A;  3TUY C;  4C0J A;  1XFR A;  2LVK A;  3WHU B;  2PQL A;  1SYM A;  2KOT A;  2EC6 C;  4GGF C;  5I2Q A;  2HET A;  3BOW B;  1DJG A;  3PFV A;  1DT7 B;  2AAO A;  5HKZ A;  2L98 A;  2QEB A;  3FE8 A;  1F4O A;  2PSR A;  1ALW A;  2YGU A;  3EK8 A;  3CZ2 A;  3D0Y A;  4TNC A;  4UPG A;  1EH2 A;  1YX7 A;  1M31 A;  1XA5 A;  3CZ0 A;  2HQW A;  1JC2 A;  1Y1U A;  2LHL A;  2QAC A;  1OOH A;  1QIW A;  3O6B A;  2ZND A;  2I7A A;  3BJH A;  3DY9 A;  1UHJ A;  1RFJ A;  2KFG A;  1SY9 A;  2NCO A;  3S0D A;  1CLB A;  1TWO A;  3CZT X;  5TNC A;  1ZMZ A;  1NX0 A;  4MRY A;  1AJ4 A;  2ZN8 A;  4MSP A;  1DQE A;  2L0P A;  2LMV A;  4DCK A;  2P70 A;  3HX4 A;  1PVB A;  2BBM A;  4INX A;  2JNX A;  3UO9 A;  2LE9 B;  1QAT A;  1KFX S;  1YUR A;  1NCY A;  1SCM C;  4Q04 A;  2DOQ A;  4HRG A;  2WCL A;  1K93 D;  2COL B;  4HSZ A;  4PE4 A;  2NXQ A;  1RRO A;  1AJ5 A;  5DIC A;  5PAL A;  2LM5 A;  1M45 A;  3GK4 X;  3L4A A;  1CLL A;  1QVI Y;  1YTZ C;  3VRO A;  4YGD B;  3VB1 A;  1GM0 A;  2ZRS A;  1OQP A;  2I18 A;  4BY5 A;  1KK7 Z;  1B7T Z;  1CFD A;  2JT0 A;  1NCX A;  1WRZ A;  2F2O A;  1CFP A;  1HT9 A;  1TCF A;  2KAX A;  3S0F A;  4XYN A;  4OV2 A;  3KO0 A;  1L7Z A;  3B6X A;  1R2U A;  3CTN A;  1A29 A;  4F7F A;  1K2H A;  3IVT A;  1D1O A;  3VRQ A;  3VRR A;  4CPV A;  1SL8 A;  1QVI Z;  4QJ3 B;  3A4U B;  1XFU O;  1XYD A;  3L47 A;  5EL2 A;  1DVI A;  3AKB A;  5HLO A;  1SSE B;  1S36 A;  3LCP C;  1NUB A;  4M2Q A;  1A2X A;  4OCI A;  1Y1A A;  1EG3 A;  2ISD A;  1UHH A;  4ETO A;  4I5J A;  3PN7 B;  1B8C A;  3NXA A;  2L5X B;  5JJG A;  3RZS A;  3PN7 C;  1VRK A;  1X02 A;  4USL A;  1QAS A;  2K7O A;  1G33 A;  1IWQ A;  1OOJ A;  3D75 A;  4WRI A;  1FBV A;  2LC5 A;  2MJW B;  2JUL A;  5CPV A;  3FE6 A;  1HQV A;  5CSF A;  2K60 A;  1QV0 A;  2OTG C;  3A8R A;  1S5G Z;  1BR4 B;  2KQY A;  1B8R A;  4CFQ A;  2LP2 A;  3AKA A;  4GAO A;  1B8L A;  1K9U A;  3NSL A;  4AQJ A;  1G4Y R;  1KWO B;  1WRL A;  2KDH A;  3FWC A;  1L2O B;  1K9P A;  1KWO C;  1RWY A;  2WOS A;  2K8M B;  3WXA A;  4A4C A;  3PSR A;  2H2K A;  1SKT A;  2JTZ A;  2LUC A;  4M2O A;  1J1D A;  2G2B A;  3IF7 A;  4MLW A;  2WCH A;  1JFJ A;  1WRK A;  3K21 A;  3OHM B;  3DD4 A;  1QV1 A;  1J7P A;  4JKT A;  4XJK B;  1OW4 A;  3I5G B;  4MZL A;  3ZWH A;  2BE6 A;  3CR5 X;  1A03 A;  1MR8 A;  1XFX O;  1OSA A;  1YRU B;  2F3Y A;  3IQQ A;  1M63 B;  3OBV A;  3R72 A;  2M1K B;  2BNX A;  1MWN A;  1PK0 D;  2FJY A;  2JPO A;  1ZFS A;  5AXI A;  2Q4U A;  3GK2 A;  1CMG A;  2K7C A;  1S3P A;  4PT1 A;  4YGB B;  3DVM A;  1LXF C;  2KFH A;  2Q91 A;  2BBN A;  4N1G A;  4F0Z B;  1W9Z A;  2IS9 A;  3AAK A;  2KYF A;  3K1E A;  3I5I B;  1CLM A;  1IGV A;  2B1U A;  2GTE A;  3I5I C;  1ZAC A;  2M3W A;  1AK8 A;  1LVC D;  3CAB A;  1U5I B;  2JXC A;  3DZT A;  3D73 A;  1YRT B;  2WND A;  4KYN A;  4N5X A;  4OVN F;  3PJI A;  3SG2 A;  1QTX A;  5HKW A;  1UHI A;  2Y4Q A;  2M29 A;  4ORC B;  1Y6W A;  1OZS A;  2HF5 A;  3OX5 A;  1IG5 A;  1OE9 B;  5D3O A;  2ZN9 A;  1K94 A;  2MA2 A;  1LA0 A;  1C3Z A;  5B8I B;  1J1E A;  3DVE A;  3S0A A;  3KHE A;  3OP0 A;  4IJ7 A;  5AAN A;  1BOC A;  2F8P A;  2JOJ A;  2KBI A;  3EK4 A;  1CMF A;  1DTL A;  2M1U A;  3LL8 B;  3S0E A;  5AER A;  1IJ5 A;  1SBJ A;  1YUT A;  5DKN A;  1KQV A;  1XFZ O;  1WLM A;  1J7R A;  2LMU A;  2QEO A;  4JPZ B;  5ER4 X;  3BUX B;  2G9B A;  2GV5 A;  4YBH B;  4PE7 A;  2GGM A;  3PM8 A;  1F54 A;  3ZNI A;  1KQM B;  3NHI A;  4I5N B;  1NSH A;  2GGZ A;  2QEV A;  1DF0 B;  1SNL A;  1AHR A;  2K2A A;  1WDC B;  3DF0 B;  3TDU A;  1Z2C B;  3OGN A;  4JD9 A;  4NDB A;  1WDC C;  1E8A A;  3B86 A;  4U8D A;  1CNP A;  5FYX A;  3FE9 A;  1P28 A;  2KAY A;  3KPX A;  1J7O A;  3CS1 A;  1NX1 A;  4GGF A;  2BKH B;  1SL9 A;  2JTT A;  3BOW A;  3PAT A;  2LUX A;  2QDI A;  4HRE E;  2HQ8 A;  2ERB A;  3SG7 A;  1IIO A;  3L4L A;  4PCW A;  2M7L A;  1LS8 A;  2M8U A;  1UWO A;  1F55 A;  1JF2 A;  4MVF A;  2K61 A;  2KNE A;  1UUR A;  4GNK B;  2Y5I A;  3CDN A;  1JSA A;  3PM2 A;  3S0G A;  3IQO A;  2ZKM X;  2BCB A;  4NQG A;  4GFT A;  3O4X A;  1CDL A;  1JFK A;  2F3Z A;  2L4I A;  2NCP A;  2KYC A;  1CDP A;  3NSI A;  4JQ0 D;  3BQ3 A;  1XK4 C;  1A75 B;  2D8N A;  3EKH A;  1PAL A;  1RJV A;  1NX2 A;  3TS5 B;  4A4B A;  4CLN A;  2OS8 B;  1QX2 A;  2PAL A;  2OS8 C;  4C0L A;  3RLZ A;  3B7A A;  3FS7 A;  4PHJ A;  2KPH A;  3BFB A;  1BU3 A;  1OMD A;  1YUU A;  1A4P A;  3D10 A;  4DS7 A;  3CZ1 A;  4YI8 A;  2VRG A;  3S0B A;  1TOP A;  1SMG A;  1NX3 A;  1IKU A;  2V53 A;  3EVR A;  1EXR A;  1SW8 A;  2MHH A;  3CLN A;  1DJZ A;  2KHN A;  2WCK A;  1TN4 A;  3TZ1 A;  5KSZ A;  4YGC B;  2CXJ A;  5FI6 A;  3CYZ A;  5HLV A;  3BFA A;  1MUX A;  1FI6 A;  3C1V A;  3EVU A;  5DKR A;  5DKQ A;  1YX8 A;  4MBE A;  3NSO A;  4WQ3 A;  5KTY A;  1SCV A;  1DJI A;  2AUC A;  1F4Q A;  4ZCU A;  1IQ3 A;  1N65 A;  1SL7 A;  2F2P A;  2JC2 A;  5CSI A;  3MSE B;  5KU1 A;  1DMO A;  2LVV A;  2LVI A;  2K0J A;  1OMV A;  4GGN A;  1BMO A;  1PVA A;  2Y1N A;  5AEQ A;  4NDD A;  2MBX A;  2WCM A;  1J7Q A;  2K7B A;  1NPQ A;  2EGD A;  2NLN A;  2WCF A;  3UNW A;  2KGB C;  1L2O C;  1OOI X;  1RK9 A;  2JRF A;  5I2O A;  1S1E A;  5FI2 A;  3LK1 A;  4YI9 A;  1SRA A;  1N0Y A;  3DVK A;  3CR2 A;  3LK0 A;  2PAS A;  2LAN A;  1NP8 A;  5JOL A;  1Y0V H;  3SJS A;  2NZ0 A;  4I5K A;  1FF1 A;  1WY9 A;  4AQI A;  1MXE A;  2SAS A;  1XVJ A;  3CR4 X;  1BR1 B;  1GQM A;  1DJW A;  3KF9 A;  1YR5 A;  3I5G C;  1B9A A;  3I5H B;  4PE1 A;  3CGA A;  2JXL A;  3I5H C;  1NIW A;  1NYA A;  2CBL A;  2L51 A;  3FIA A;  4ORA B;  1PUL A;  2JPT A;  1QWV A;  1DJY A;  1W7I B;  2KFF A;  4DUQ A;  4YRU A;  5IBW A;  1GGZ A;  1KFU L;  4OZD A;  1V1F A;  1SK6 D;  1JUO A;  1XFW O;  2LHI A;  2F33 A;  4FQT A;  4WQ2 A;  1DGV A;  2L2E A;  1IRJ A;  1PSB A;  1CDM A;  2KSP A;  2O5G A;  4OR9 B;  2L50 A;  1KCY A;  1DGU A;  2BCA A;  1JF0 A;  2OPO A;  4MEW A;  1F8H A;  2R2I A;  1XFV O;  2FOT A;  2M0R A;  2Y1M A;  1BF5 A;  1J55 A;  1F71 A;  1TNX A;  1XFY O;  2JU0 A;  4NDC A;  4ZCV A;  4CID A;  2BE4 A;  1R6P A;  1N2D A;  2FCE A;  1TCO B;  2PYQ A;  1K96 A;  2BAP A;  3EKJ A;  3GOF A;  1UHN A;  2MLE C;  2WCJ A;  2H61 C;  4QJ4 B;  1C07 A;  2SCP A;  2KBM A;  1KSM A;  3D76 A;  1CM1 A;  1CFC A;  1QLK A;  1QLS A;  3SIA A;  3D0Y B;  1LIN A;  2M9G A;  5AFP A;  1OOF A;  4ICB A;  1DJX A;  1MF8 B;  1EG4 A;  3OB2 B;  3SG3 A;  5HYD A;  3QME A;  5HKY A;  3BUW B;  3EG5 B;  2WC6 A;  3KEV A;  3TDI A;  1U5I A;  2AMI A;  1KFX L;  1DC1 A;  1FPW A;  4PE0 A;  1CKK A;  4QJ5 B;  3BUM B;  4PAL A;  1KQM C;  5G08 A;  1TNW A;  4CFR A;  1QIV A;  3CWG A;  2CCM A;  3DVJ A;  1UHK A;  2JQ6 A;  3O2P A;  1BOD A;  1H8B A;  2H61 A;  3I5F B;  1Q80 A;  2EC6 B;  5CSN A;  1DJH A;  3I5F C;  4L9M A;  5F6T A;  2JT3 A;  3DYE A;  1G8I A;  1TUJ A;  4GUK A;  4HRH A;  1ZUZ A;  1BJF A;  2ZFD A;  3AAJ A;  1RTP 1;  1TIZ A;  1TRF A;  1PRW A;  2MLF C;  1MXL C;  1YVL A;  2KI4 B;  2WCE A;  3ICB A;  3NGV A;  4P2Y B;  1CDN A;  2KI4 C;  3R1O A;  4PHM A;  3N7H A;  2JNF A;  3BFH A;  4GPL B;  4I5L B;  1KSO A;  1TUZ A;  4MZK A;  2P6B B;  5BPJ A;  1CFF A;  3QRX A;  3R1V A;  1JWD A;  1LA3 A;  2CTN A;  2WCB A;  2P71 A;  1DF0 A;  5CSJ A;  2HPS A;  2QPT A;  3SS4 A;  1BG1 A;  3DF0 A;  5HL1 A;  2A4J A;  2LCP A;  2WC5 A;  3M0W A;  3TS5 C;  2BKI B;  1GJY A;  1SPY A;  1SCM B;  1KK7 Y;  1B7T Y;  1QXP A;  1XO5 A;  2LVJ A;  1KK8 B;  1AVS A;  1KK8 C;  1IH0 A;  2PVB A;  2LLU A;  4C0K A;  1QS7 A;  1B1G A;  2KGR A;  1PSR A;  3TDZ A;  3NHT A;  1XK4 A;  4ORB B;  1TNQ A;  2CNP A;  1C3Y A;  1A75 A;  1OMR A;  3OX6 A;  4M2P A;  4YGA A;  4OKH A;  2WOR A;  3O4Y A;  2EHB A;  1GGW A;  3OB1 B;  1B47 A;  1K8U A;  4GBA A;  1WLZ A;  3WNX B;  2MRD A;  2E6W A;  4E68 A;  3BUO B;  1F70 A;  3D77 A;  3HCM A;  1W7J B;  1SR6 B;  4D1E A;  1QX5 B;  1DEL A;  1SR6 C;  3PAL A;  1YVH A;  1K95 A;  1MHO A;  4MZJ A;  1FI5 A;  3E3R A;  1S5G Y;  4P5O E;  3NSK A;  3SG6 A;  2ZNE A;  1MQ1 A;  1C7W A;  1TTX A;  2CT9 A;  2JWW A;  3D74 A;  2LAP A;  3WHT B;  1IQ5 A;  1S26 D;  3VGO A;  1V1G A;  3F45 A;  2L5Y A;  1ALV A;  4AOM A;  1S6J A;  1TNP A;  3BXK A;  2ZRT A;  3B87 A;  3Q8I A;  5FI7 A;  1ZOT B;  2E30 A;  3O78 A;  4MRX A;  2BL0 B;  1CM4 A;  2JT8 A;  4MN0 A;  2BL0 C;  2QEH A;  1QJT A;  2OTG B;  2O60 A;  3PLF B;  3V2L A;  3D78 A;  1K9K A;  1B4C A;  4DRW A;  2KQ6 A;  2K2F A;  4YGE B;  4PDZ A;  2PRU A;  2LNK A;  1UUS A;  2LV7 A;  1FW4 A;  3R1P A;  2KAV A;  1AUI B;  4PHN A;  2KI6 D;  2PMY A;  4IL1 A;  1M46 A;  1DEK A;  3JTD B;  2JZI A;  3JTD C;  3BYA A;  3SG5 A;  4R1E A;  2FJU B;  1LKJ A;  1Y1X A;  1UP5 A; 
#chains in the Genus database with same CATH homology
 1BT6 A;  1C7V A;  2KI6 C;  5J3X A;  4BY4 A;  1M39 A;  1S6C A;  2LMT A;  2LLS A;  1CB1 A;  2M97 A;  4PHK A;  4XJK A;  2FCD A;  5I8N A;  1OZO A;  5K89 A;  3FWB A;  2I2R E;  2LP3 A;  2M7N A;  5I2L A;  1CTR A;  4JWQ A;  1REC A;  1YUS A;  2LLT A;  2TN4 A;  5GQQ C;  2BEC A;  3SIB A;  3VRN A;  3BUN B;  1EL4 A;  4FQO A;  3EK7 A;  2K7D A;  3LLE A;  1QX7 A;  3VRP A;  3RM1 A;  1K90 D;  3H4S E;  5D7F A;  3JVT B;  1ODB A;  3GK1 A;  2MAZ A;  3JVT C;  3EVV A;  1KFU S;  4DIR A;  5ER5 A;  1NWD A;  1IJ6 A;  2BCX A;  1S6I A;  1AP4 A;  1BLQ A;  2M49 B;  2I94 A;  1NCZ A;  2L4H A;  2RGI A;  2WC8 A;  3SG4 A;  4FTG A;  5D69 A;  3TUY B;  1EJ3 A;  1JBA A;  4N1F A;  1H4B A;  3TUY C;  4C0J A;  2LVK A;  3WHU B;  1SYM A;  2KOT A;  2EC6 C;  4GGF C;  5I2Q A;  2HET A;  3BOW B;  1DJG A;  3PFV A;  1DT7 B;  2AAO A;  5HKZ A;  2L98 A;  1F4O A;  2PSR A;  1ALW A;  3EK8 A;  4UPG A;  3D0Y A;  4TNC A;  1EH2 A;  1YX7 A;  1M31 A;  1XA5 A;  2HQW A;  1JC2 A;  1Y1U A;  2LHL A;  2QAC A;  3O6B A;  1QIW A;  4YGE B;  2ZND A;  2I7A A;  1CLB A;  1UHJ A;  1RFJ A;  2KFG A;  1SY9 A;  2NCO A;  3CZT X;  5TNC A;  1ZMZ A;  1NX0 A;  4MRY A;  1AJ4 A;  2ZN8 A;  4MSP A;  2L0P A;  2LMV A;  4DCK A;  3HX4 A;  1PVB A;  2BBM A;  2JNX A;  2LE9 B;  1QAT A;  1KFX S;  1NCY A;  1YUR A;  1SCM C;  4Q04 A;  2DOQ A;  4HRG A;  1K93 D;  2COL B;  4HSZ A;  4PE4 A;  2NXQ A;  1RRO A;  1AJ5 A;  5PAL A;  2LM5 A;  1M45 A;  3GK4 X;  1CLL A;  1QVI Y;  1YTZ C;  3VRO A;  4YGD B;  2ZRS A;  1OQP A;  2I18 A;  4BY5 A;  1KK7 Z;  1B7T Z;  1CFD A;  2JT0 A;  1NCX A;  1WRZ A;  2F2O A;  1CFP A;  1HT9 A;  1TCF A;  2KAX A;  4XYN A;  4OV2 A;  3KO0 A;  1L7Z A;  1R2U A;  3CTN A;  1A29 A;  1K2H A;  1D1O A;  3VRQ A;  3VRR A;  4CPV A;  1SL8 A;  1QVI Z;  4QJ3 B;  3A4U B;  1XFU O;  1XYD A;  1DVI A;  3AKB A;  5HLO A;  1S36 A;  3LCP C;  1NUB A;  4M2Q A;  1A2X A;  4OCI A;  1Y1A A;  1EG3 A;  2ISD A;  1UHH A;  4ETO A;  4I5J A;  3PN7 B;  1B8C A;  3NXA A;  2L5X B;  5JJG A;  3PN7 C;  1VRK A;  1X02 A;  4USL A;  1QAS A;  2K7O A;  1G33 A;  1IWQ A;  1OOJ A;  4WRI A;  1FBV A;  2LC5 A;  2MJW B;  2JUL A;  5CPV A;  1HQV A;  5CSF A;  1QV0 A;  2OTG C;  3A8R A;  1S5G Z;  1BR4 B;  2KQY A;  1B8R A;  4CFQ A;  2LP2 A;  3AKA A;  4GAO A;  1B8L A;  1K9U A;  3NSL A;  4AQJ A;  1G4Y R;  1KWO B;  1WRL A;  2KDH A;  3FWC A;  1L2O B;  1K9P A;  1KWO C;  1RWY A;  2WOS A;  2K8M B;  3WXA A;  4A4C A;  3PSR A;  2H2K A;  1SKT A;  2JTZ A;  2LUC A;  4M2O A;  1J1D A;  2G2B A;  3IF7 A;  4MLW A;  1JFJ A;  1WRK A;  3K21 A;  3OHM B;  3DD4 A;  1QV1 A;  1J7P A;  4XJK B;  3I5G B;  4MZL A;  3ZWH A;  2BE6 A;  3CR5 X;  1A03 A;  1MR8 A;  1XFX O;  1OSA A;  1YRU B;  2F3Y A;  3IQQ A;  1M63 B;  2M1K B;  1MWN A;  1PK0 D;  5AXI A;  1ZFS A;  2Q4U A;  3GK2 A;  1CMG A;  2K7C A;  1S3P A;  4YGB B;  3DVM A;  1LXF C;  2KFH A;  2Q91 A;  2BBN A;  4N1G A;  4F0Z B;  2IS9 A;  3AAK A;  2KYF A;  3I5I B;  1CLM A;  1IGV A;  2B1U A;  3I5I C;  1ZAC A;  2M3W A;  1AK8 A;  1LVC D;  1U5I B;  2JXC A;  1YRT B;  2WND A;  4N5X A;  4OVN F;  3SG2 A;  1QTX A;  5HKW A;  1UHI A;  2Y4Q A;  2M29 A;  4ORC B;  1Y6W A;  1OZS A;  2HF5 A;  3OX5 A;  1IG5 A;  1OE9 B;  2ZN9 A;  1K94 A;  2MA2 A;  1LA0 A;  5B8I B;  1J1E A;  3DVE A;  3KHE A;  3OP0 A;  5AAN A;  1BOC A;  2F8P A;  2JOJ A;  2KBI A;  3EK4 A;  1CMF A;  1DTL A;  2M1U A;  3LL8 B;  5AER A;  1IJ5 A;  1SBJ A;  1YUT A;  5DKN A;  1KQV A;  1XFZ O;  1WLM A;  1J7R A;  2LMU A;  4JPZ B;  5ER4 X;  3BUX B;  2G9B A;  2GV5 A;  4YBH B;  4PE7 A;  2GGM A;  3PM8 A;  1F54 A;  3ZNI A;  1KQM B;  4I5N B;  1NSH A;  2GGZ A;  1DF0 B;  1SNL A;  1AHR A;  2K2A A;  1WDC B;  3DF0 B;  3TDU A;  1CNP A;  4NDB A;  1WDC C;  1E8A A;  4U8D A;  5FYX A;  2KAY A;  3KPX A;  1J7O A;  3CS1 A;  1NX1 A;  4GGF A;  2BKH B;  1SL9 A;  2JTT A;  3BOW A;  3PAT A;  2LUX A;  4HRE E;  2HQ8 A;  3SG7 A;  4PCW A;  2M7L A;  2M8U A;  1UWO A;  1F55 A;  1JF2 A;  4MVF A;  2K61 A;  2KNE A;  1UUR A;  4GNK B;  2Y5I A;  1JSA A;  3IQO A;  2ZKM X;  2BCB A;  4NQG A;  4GFT A;  1CDL A;  1JFK A;  2F3Z A;  2L4I A;  2NCP A;  2KYC A;  1CDP A;  3NSI A;  4JQ0 D;  3BQ3 A;  1XK4 C;  1A75 B;  2D8N A;  3EKH A;  1PAL A;  1RJV A;  1NX2 A;  3TS5 B;  4A4B A;  4CLN A;  2OS8 B;  1QX2 A;  2PAL A;  2OS8 C;  4C0L A;  3RLZ A;  3FS7 A;  4PHJ A;  1BU3 A;  1OMD A;  1YUU A;  1A4P A;  3D10 A;  4DS7 A;  4YI8 A;  2VRG A;  1TOP A;  1SMG A;  1NX3 A;  1IKU A;  2V53 A;  3EVR A;  1EXR A;  1SW8 A;  2MHH A;  3CLN A;  1DJZ A;  2KHN A;  1TN4 A;  3TZ1 A;  5KSZ A;  4YGC B;  2CXJ A;  5HLV A;  1MUX A;  1FI6 A;  3C1V A;  3EVU A;  5DKR A;  5DKQ A;  1YX8 A;  4MBE A;  3NSO A;  4WQ3 A;  5KTY A;  1SCV A;  1DJI A;  2AUC A;  1F4Q A;  4ZCU A;  1IQ3 A;  1N65 A;  1SL7 A;  2F2P A;  2JC2 A;  5CSI A;  3MSE B;  5KU1 A;  1DMO A;  2LVV A;  2LVI A;  2K0J A;  1OMV A;  4GGN A;  1BMO A;  1PVA A;  2Y1N A;  5AEQ A;  4NDD A;  2MBX A;  1J7Q A;  2K7B A;  1NPQ A;  2EGD A;  2NLN A;  2WCF A;  2KGB C;  1L2O C;  1RK9 A;  5I2O A;  2JRF A;  1S1E A;  3LK1 A;  4YI9 A;  1SRA A;  1N0Y A;  3DVK A;  3CR2 A;  3LK0 A;  2PAS A;  2LAN A;  1NP8 A;  5JOL A;  1Y0V H;  3SJS A;  2NZ0 A;  4I5K A;  1FF1 A;  1WY9 A;  4AQI A;  1MXE A;  2SAS A;  1XVJ A;  3CR4 X;  1BR1 B;  1GQM A;  1DJW A;  3KF9 A;  1YR5 A;  3I5G C;  1B9A A;  3I5H B;  4PE1 A;  3CGA A;  2JXL A;  3I5H C;  1NIW A;  1NYA A;  2CBL A;  2L51 A;  3FIA A;  4ORA B;  1PUL A;  2JPT A;  5IBW A;  1DJY A;  1W7I B;  2KFF A;  4DUQ A;  4YRU A;  1GGZ A;  1KFU L;  1V1F A;  1SK6 D;  1JUO A;  1XFW O;  2LHI A;  2F33 A;  4WQ2 A;  1DGV A;  2L2E A;  1IRJ A;  1PSB A;  1CDM A;  2KSP A;  2O5G A;  4OR9 B;  2L50 A;  1KCY A;  1DGU A;  2BCA A;  1JF0 A;  2OPO A;  4MEW A;  1F8H A;  2R2I A;  1XFV O;  2FOT A;  2M0R A;  2Y1M A;  1BF5 A;  1J55 A;  1F71 A;  1TNX A;  1XFY O;  2JU0 A;  4NDC A;  4ZCV A;  4CID A;  2BE4 A;  1R6P A;  1N2D A;  2FCE A;  1TCO B;  1K96 A;  3EKJ A;  3GOF A;  1UHN A;  2MLE C;  2H61 C;  4QJ4 B;  1C07 A;  2SCP A;  2KBM A;  1KSM A;  1CM1 A;  1CFC A;  1QLK A;  1QLS A;  3SIA A;  3D0Y B;  1LIN A;  2M9G A;  5AFP A;  4ICB A;  1DJX A;  1MF8 B;  1EG4 A;  3OB2 B;  3SG3 A;  5HYD A;  5HKY A;  3BUW B;  1FPW A;  3KEV A;  3TDI A;  1U5I A;  2AMI A;  1KFX L;  4PE0 A;  1CKK A;  4QJ5 B;  3BUM B;  4PAL A;  1KQM C;  5G08 A;  1TNW A;  4CFR A;  1QIV A;  3CWG A;  2CCM A;  3DVJ A;  1UHK A;  2JQ6 A;  3O2P A;  1BOD A;  1H8B A;  2H61 A;  3I5F B;  1Q80 A;  2EC6 B;  5CSN A;  1DJH A;  3I5F C;  4L9M A;  5F6T A;  2JT3 A;  1G8I A;  4GUK A;  4HRH A;  1ZUZ A;  1BJF A;  2ZFD A;  3AAJ A;  1RTP 1;  1TIZ A;  1TRF A;  1PRW A;  2MLF C;  1MXL C;  1YVL A;  2KI4 B;  2WCE A;  3ICB A;  4P2Y B;  1CDN A;  2KI4 C;  4PHM A;  2JNF A;  4GPL B;  4I5L B;  1KSO A;  4MZK A;  2P6B B;  5BPJ A;  1CFF A;  3QRX A;  1JWD A;  1LA3 A;  2CTN A;  2WCB A;  5CSJ A;  1DF0 A;  2HPS A;  2QPT A;  1BG1 A;  3DF0 A;  2A4J A;  2LCP A;  3M0W A;  3TS5 C;  2BKI B;  1GJY A;  1SPY A;  1SCM B;  1KK7 Y;  1B7T Y;  1QXP A;  1XO5 A;  2LVJ A;  1KK8 B;  1AVS A;  1KK8 C;  1IH0 A;  2PVB A;  2LLU A;  4C0K A;  1QS7 A;  1B1G A;  2KGR A;  1PSR A;  3TDZ A;  4ORB B;  1XK4 A;  1TNQ A;  2CNP A;  1A75 A;  1OMR A;  3OX6 A;  4M2P A;  4YGA A;  4OKH A;  2WOR A;  3O4Y A;  2EHB A;  1GGW A;  3OB1 B;  1B47 A;  1K8U A;  4GBA A;  1WLZ A;  3WNX B;  2MRD A;  2E6W A;  4E68 A;  3BUO B;  1F70 A;  3HCM A;  1W7J B;  1SR6 B;  4D1E A;  1QX5 B;  3PAL A;  1SR6 C;  1YVH A;  1K95 A;  1MHO A;  4MZJ A;  1FI5 A;  3E3R A;  1S5G Y;  4P5O E;  3NSK A;  3SG6 A;  2ZNE A;  1MQ1 A;  1C7W A;  1TTX A;  2CT9 A;  2JWW A;  3WHT B;  2LAP A;  1IQ5 A;  1S26 D;  3VGO A;  1V1G A;  3F45 A;  1ALV A;  4AOM A;  1S6J A;  1TNP A;  3BXK A;  2ZRT A;  1ZOT B;  2E30 A;  3O78 A;  4MRX A;  2BL0 B;  1CM4 A;  2JT8 A;  4MN0 A;  2BL0 C;  1QJT A;  2OTG B;  2O60 A;  3PLF B;  1K9K A;  1B4C A;  4DRW A;  2KQ6 A;  2K2F A;  4PDZ A;  2PRU A;  2LNK A;  1UUS A;  2LV7 A;  1FW4 A;  2KAV A;  1AUI B;  4PHN A;  2KI6 D;  2PMY A;  4IL1 A;  1M46 A;  3JTD B;  2JZI A;  3JTD C;  3BYA A;  3SG5 A;  4R1E A;  2FJU B;  1LKJ A;  1Y1X A;  1UP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...