1PVBA

X-ray structure of a new crystal form of pike 4.10 parvalbumin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a new crystal form of pike 4.10 beta parvalbumin.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
total genus 42
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1995-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1pvbA00
1QTXA 1Y1XA 4MEWA 1A29A 1XFUO 2H2KA 2KHNA 3D0YA 3PATA 1QASA 4GFTA 4GGFA 2LV7A 1MR8A 1CM1A 3O2PA 3KO0A 4HRHA 2OS8B 2JULA 2M1KB 1YTZC 4YI9A 3AKBA 4F0ZB 4YI8A 1EG3A 4BY4A 1XFZO 3D10A 2MJWB 3TDZA 2KQYA 1C7VA 1VRKA 1XK4C 2I94A 1DF0B 1RFJA 3SG4A 5I2QA 1QVIZ 1X02A 1SRAA 3JVTC 1BU3A 2K61A 3EK4A 1XVJA 1YVHA 5CSFA 1SCVA 1KQMB 2M3WA 2AUCA 4P2YB 1NX3A 3O6BA 4QJ5B 2GGMA 2JRFA 1JSAA 3VGOA 1MUXA 1LA0A 1AUIB 1NCYA 5AANA 1N65A 4PHKA 1GGZA 2OS8C 2CCMA 2Y4QA 2PSRA 1PK0D 1YR5A 1MXEA 3I5HB 2I18A 1HQVA 2MLEC 2CNPA 3CR2A 1AJ4A 1SKTA 1F70A 3BOWB 3LCPC 3CS1A 2IS9A 2B1UA 3O78A 2LHLA 1XA5A 4OV2A 4YRUA 1WY9A 2AAOA 5HKZA 1PVBA 2KI4B 2LVVA 1QLKA 1KFUS 1KWOB 1RWYA 1DJZA 2M7LA 1Q80A 2WOSA 2A4JA 3BUNB 1YUUA 1RK9A 1NPQA 4ORCB 3ZNIA 3CR4X 1OMRA 3OB1B 5HKYA 2KBIA 1B7TZ 1G8IA 2KFGA 4U8DA 3TS5B 4MRYA 4CPVA 1IG5A 1S26D 4PHJA 5HKWA 1ZMZA 1RJVA 2KYCA 3PN7C 4P5OE 1DT7B 2KSPA 2LUCA 1UP5A 4E68A 1DJXA 1YX7A 1OMDA 2LAPA 1WRLA 4USLA 1IKUA 2FCDA 2O60A 2LUXA 3FS7A 4GPLB 4D1EA 1L2OB 2KAYA 2ZKMX 1CFDA 3SIBA 3C1VA 2JZIA 5G08A 3ZWHA 2I2RE 4DS7A 3SG3A 2HQ8A 5ER4X 4L9MA 1N2DA 1ALWA 4NDBA 4R1EA 2ZRTA 5ER5A 2L4HA 1SL8A 1JUOA 2BBMA 4M2PA 1UHHA 4C0KA 2JT3A 2JXCA 1XFWO 1TOPA 4MZKA 1S36A 4ZCUA 3BUOB 2L51A 1WLZA 2GV5A 1JBAA 2F33A 3PN7B 2FCEA 2JT0A 2AMIA 2I7AA 1IQ3A 3SIAA 4BY5A 4QJ4B 2M1UA 4PE1A 2ZNEA 4PHNA 3BOWA 1LVCD 1SR6B 2BKHB 1LINA 1PVAA 1QX7A 1YX8A 3VRPA 1G4YR 1WRKA 4N1GA 2HPSA 1JF0A 3LK0A 1IJ5A 1SPYA 4Q04A 2BCAA 4YGAA 3HX4A 1KWOC 5DKQA 1U5IB 5AEQA 2PASA 5PALA 1CFCA 2F2OA 1CFPA 1JC2A 3KHEA 4PDZA 2R2IA 3MSEB 4HREE 2QPTA 1SBJA 2K2AA 2GGZA 1BF5A 4DUQA 2M0RA 1QX2A 2LC5A 3QRXA 3PALA 4NDDA 4MZJA 2F8PA 3FWBA 4ETOA 3RLZA 2BBNA 2JNXA 1FW4A 2K0JA 2KDHA 3BYAA 3SG2A 1OMVA 1UWOA 4M2OA 1IQ5A 3NSOA 5D7FA 3OX6A 2SASA 1TIZA 4YGDB 1NIWA 2TN4A 1KQVA 2Y5IA 3AAJA 1TN4A 2Q4UA 2KOTA 2ZNDA 2FJUB 2LM5A 4OCIA 2PRUA 3PLFB 1J7OA 2LP2A 1SL9A 3DD4A 5HLOA 4OKHA 1QLSA 1Y1UA 3EVRA 1NCZA 1QIWA 1K96A 1SL7A 3I5IC 4MVFA 3JVTB 1M39A 4GUKA 4ICBA 1H8BA 3GK1A 2CBLA 1QS7A 1XO5A 1DJIA 3GK2A 1XYDA 2V53A 4WQ2A 1TCFA 2Q91A 2ZFDA 5FYXA 1F4QA 3NXAA 2LLUA 3DVJA 5CSIA 4GAOA 1KK8B 5I2OA 2NZ0A 3EK7A 1IWQA 2WCFA 1WDCB 1RECA 3CTNA 3NSLA 5D69A 1S1EA 1XFXO 5HYDA 1WRZA 3NSKA 4GGNA 1KK7Z 3EKJA 1TTXA 1DF0A 1OZOA 1BMOA 1BT6A 1CM4A 1NYAA 3F45A 3SJSA 2EGDA 1DJYA 2HETA 4N5XA 1S6IA 2L98A 3TUYB 1TCOB 2E6WA 5K89A 1PSRA 4XJKA 2Y1NA 1B8CA 1K94A 1SW8A 1QJTA 4CFRA 1B8LA 2LVJA 1LXFC 1EXRA 1DVIA 3LL8B 1F71A 3JTDB 2E30A 3IQQA 2LVIA 3A4UB 2LMVA 1FF1A 2F2PA 3PM8A 3SG7A 3KEVA 2P6BB 5I2LA 4TNCA 2FOTA 3FIAA 1B7TY 1LKJA 4PHMA 3CLNA 4DRWA 4UPGA 2KYFA 3I5GC 1KSMA 4ORBB 1AHRA 1QXPA 4NQGA 1OOJA 3K21A 4QJ3B 1BLQA 3DVKA 1AJ5A 5AFPA 1UUSA 2F3ZA 3SG6A 1TNWA 1QX5B 1M46A 2VRGA 3FWCA 3OHMB 1SMGA 4XJKB 3AKAA 2SCPA 1NX0A 1IGVA 2BCBA 2HF5A 3DF0B 1CMGA 1J1EA 3JTDC 1BJFA 2L50A 4YBHB 5BPJA 1CDNA 4AQJA 3VRQA 1NWDA 1OE9B 1QVIY 1DMOA 4YGEB 1NX1A 4AQIA 5JOLA 1RROA 4CLNA 2PMYA 1TNPA 3CR5X 3CZTX 1GGWA 1W7IB 5JJGA 4PALA 1F54A 3AAKA 3TUYC 1V1FA 4MZLA 1MHOA 2M49B 4DCKA 5KSZA 2K7CA 3NSIA 1UHJA 4C0JA 1GQMA 1TRFA 1ALVA 1QIVA 1A2XA 2OTGC 2O5GA 3DF0A 4XYNA 2ZN8A 1OQPA 2MAZA 3I5FB 1BG1A 2LMTA 3CWGA 1MQ1A 3PSRA 3WHTB 2LHIA 4MBEA 4A4BA 1B47A 1K93D 4IL1A 1CDPA 5CSJA 1F4OA 3GOFA 4C0LA 2LANA 4AOMA 2JWWA 1AVSA 2KI4C 1K9KA 4MSPA 1L2OC 2MBXA 2BE4A 3BUMB 3DVEA 3TZ1A 1BODA 1J7PA 1ODBA 1OZSA 1J1DA 1E8AA 5AXIA 1KCYA 1JWDA 3TDIA 1YRTB 1DJHA 1KFXL 3IF7A 2G2BA 1M63B 3I5GB 4I5LB 2KBMA 2PVBA 3WNXB 4JPZB 4PE7A 4YGBB 4WQ3A 1BR1B 2CT9A 5B8IB 1ZOTB 2KFFA 2LVKA 2K8MB 1KK8C 4GNKB 3EK8A 1EH2A 1NX2A 2CTNA 2L2EA 2LLTA 2MA2A 2JNFA 5GQQC 1JF2A 1XFYO 1F8HA 1SYMA 4I5NB 1K95A 4NDCA 4ORAB 1R2UA 2QACA 3CGAA 1B8RA 2JT8A 3HCMA 1H4BA 2NCOA 4N1FA 3EKHA 5F6TA 3LLEA 1V1GA 1UURA 5I8NA 1CLLA 4PE4A 1SNLA 1SR6C 2D8NA 2L5XB 3I5HC 1HT9A 1XK4A 4MN0A 1G33A 1PSBA 2BE6A 1SY9A 5CSNA 4I5KA 2M8UA 2K7OA 2KAXA 2H61A 1FBVA 3GK4X 2KI6C 2LNKA 3E3RA 4CIDA 5AERA 2Y1MA 2KQ6A 1MF8B 1TNXA 2PALA 3VROA 1WDCC 1CLMA 1S6JA 2KFHA 2LLSA 2JTTA 2MLFC 2WORA 2K7DA 2LCPA 1NP8A 1N0YA 2M9GA 2MHHA 1KQMC 5DKRA 3BQ3A 1K8UA 4ZCVA 1W7JB 4OVNF 2DOQA 3BUWB 1CDMA 5HLVA 1FI5A 1MXLC 1SK6D 4FTGA 2WCBA 2MRDA 3VRRA 1IH0A 2NCPA 1J7QA 1A75B 3KF9A 1PULA 3DVMA 2ZN9A 2L4IA 2WNDA 1FI6A 2LE9B 4MRXA 5CPVA 2K7BA 1JFKA 3M0WA 1B9AA 1J55A 1U5IA 3ICBA 2EC6C 2WCEA 5J3XA 1EJ3A 1S3PA 3OP0A 4FQOA 3TS5C 1CTRA 1KFXS 2BKIB 2M29A 3KPXA 3PFVA 1B4CA 1ZUZA 1UHKA 2G9BA 2BCXA 4CFQA 1IJ6A 1QV1A 3SG5A 2COLB 1DGVA 2EHBA 2L0PA 1AP4A 1CMFA 3OB2B 2KGRA 1Y6WA 2H61C 1NUBA 1KSOA 2CXJA 1PALA 1KFUL 1R6PA 2K2FA 1GJYA 1K9UA 3O4YA 1RTP1 1CLBA 3TDUA 2BL0B 2JTZA 1A03A 4PCWA 2JOJA 4HSZA 2JU0A 4M2QA 2OTGB 1IRJA 4I5JA 1A75A 1EG4A 1K9PA 3VRNA 2JC2A 2EC6B 3EVVA 4MLWA 2ZRSA 3EVUA 1YRUB 1M31A 1PRWA 1QV0A 4YGCB 1K90D 1S5GZ 1S6CA 1YURA 2JXLA 3A8RA 2KI6D 1M45A 4HRGA 2KAVA 3IQOA 2RGIA 1YUSA 1NSHA 1L7ZA 1XFVO 2JPTA 2F3YA 1TNQA 1SCMB 2BECA 1CFFA 5DKNA 1JFJA 3WHUB 4GGFC 4JWQA 1CDLA 1UHIA 2M97A 4DIRA 2WC8A 1DTLA 1EL4A 1AK8A 1DJWA 1WLMA 1CKKA 1FPWA 1B1GA 1Y0VH 3BXKA 2JQ6A 3OX5A 1NCXA 1C7WA 1DGUA 1OSAA 1A4PA 1J7RA 1QATA 1CB1A 1KK7Y 3RM1A 1UHNA 2KNEA 2M7NA 3LK1A 4A4CA 5IBWA 1BOCA 4PE0A 1ZACA 2HQWA 5KU1A 1S5GY 2BL0C 2NXQA 2OPOA 2LP3A 5TNCA 2ISDA 4WRIA 1DJGA 3D0YB 1SCMC 3I5IB 1ZFSA 1D1OA 2NLNA 1F55A 4OR9B 1BR4B 5KTYA 1YVLA 3H4SE 1Y1AA 3BUXB 1MWNA 2KGBC 4JQ0D 4GBAA 3WXAA 3I5FC 1LA3A 1C07A 1K2HA 2LMUA 1YUTA 1CNPA
chains in the Genus database with same CATH superfamily
1QTXA 1Y1XA 4MEWA 1A29A 1XFUO 2H2KA 2KHNA 3D0YA 3PATA 1QASA 4GFTA 4GGFA 2LV7A 1P28A 1MR8A 1CM1A 3O2PA 3KO0A 4HRHA 2OS8B 2JULA 2M1KB 1YTZC 4YI9A 3AKBA 4F0ZB 4YI8A 1EG3A 4BY4A 1XFZO 3D10A 2MJWB 3TDZA 2KQYA 1C7VA 1VRKA 1XK4C 2I94A 1DF0B 1RFJA 3L47A 3SG4A 5I2QA 1QVIZ 1X02A 1SRAA 3JVTC 2QEOA 1BU3A 2K61A 3EK4A 1C3ZA 1XVJA 1YVHA 5CSFA 1SCVA 3B86A 1KQMB 2M3WA 2L5YA 2AUCA 4P2YB 4PT1A 1NX3A 3O6BA 4QJ5B 3S0AA 1T14A 2GGMA 2JRFA 3VB1A 3VGOA 1JSAA 1MUXA 1LA0A 1AUIB 1NCYA 5AANA 1N65A 1Z2CB 2FJYA 3UNWA 4PHKA 1GGZA 2OS8C 2CCMA 3DY9A 2Y4QA 1OW4A 2GTEA 2PSRA 1PK0D 4OZDA 1YR5A 1MXEA 3I5HB 2I18A 1HQVA 2MLEC 2CNPA 3CR2A 1AJ4A 1SKTA 1F70A 3BOWB 3LCPC 3CS1A 2WCJA 2IS9A 2B1UA 3O78A 2LHLA 2BNXA 1XA5A 3BFBA 4OV2A 4YRUA 1WY9A 2AAOA 5HKZA 1PVBA 2KI4B 2LVVA 1QLKA 1KFUS 1KWOB 1RWYA 1DJZA 2M7LA 1Q80A 2WOSA 2A4JA 3BUNB 1YUUA 1RK9A 1NPQA 4ORCB 3ZNIA 3CR4X 1OMRA 3OB1B 5HKYA 4INXA 2KBIA 1B7TZ 1G8IA 2KFGA 4U8DA 3TS5B 4MRYA 4CPVA 1IG5A 1S26D 4PHJA 5HKWA 1ZMZA 1RJVA 2KYCA 3PN7C 4P5OE 1DT7B 2KSPA 2LUCA 1UP5A 4E68A 5I94A 2PYQA 1DJXA 1YX7A 1OMDA 2LAPA 3BFAA 1WRLA 4USLA 1IKUA 2FCDA 2O60A 2LUXA 3FS7A 4GPLB 4D1EA 1L2OB 2KAYA 2ZKMX 3S0BA 1CFDA 3SIBA 3C1VA 2JZIA 3CZ0A 5G08A 2I2RE 3ZWHA 4DS7A 3SG3A 2HQ8A 5ER4X 4L9MA 1N2DA 1ALWA 4NDBA 4R1EA 2ZRTA 5ER5A 2L4HA 5FI7A 1SL8A 1JUOA 2BBMA 4M2PA 1UHHA 4C0KA 2JT3A 2JXCA 1XFWO 1TOPA 4MZKA 1S36A 4ZCUA 3BUOB 2L51A 1WLZA 2GV5A 1JBAA 2F33A 3PN7B 2FCEA 2JT0A 4JKTA 2AMIA 2I7AA 5DICA 1IQ3A 3SIAA 3FE9A 4BY5A 4QJ4B 2M1UA 4PE1A 2ZNEA 4PHNA 3BOWA 1LVCD 1SR6B 2BKHB 1LINA 4F7FA 1PVAA 1QX7A 1YX8A 3VRPA 1G4YR 1WRKA 4N1GA 2HPSA 1JF0A 3LK0A 1IJ5A 1SPYA 4Q04A 2BCAA 4YGAA 3HX4A 1KWOC 3N7HA 1U5IB 5DKQA 2PASA 5AEQA 5PALA 1CFCA 2F2OA 1CFPA 1JC2A 3KHEA 4PDZA 2R2IA 3MSEB 4HREE 2QPTA 1SBJA 2K2AA 2GGZA 1BF5A 4DUQA 2M0RA 1QX2A 2LC5A 2P70A 3QRXA 3PALA 4NDDA 4MZJA 3RZSA 2F8PA 3FWBA 4ETOA 3RLZA 2BBNA 2JNXA 1FW4A 2K0JA 2KDHA 3BYAA 3S0GA 1OMVA 1UWOA 3SG2A 4M2OA 1IQ5A 3NSOA 5D7FA 3OX6A 2SASA 1TIZA 4YGDB 1NIWA 2TN4A 3EG5B 3QMEA 1KQVA 2Y5IA 3AAJA 1TN4A 2Q4UA 2KOTA 2ZNDA 2FJUB 2LM5A 4OCIA 2K60A 2PRUA 3PLFB 1J7OA 2LP2A 1SL9A 3DD4A 5HLOA 4OKHA 1QLSA 1Y1UA 3EVRA 1NCZA 1QIWA 1K96A 1SL7A 3B7AA 3I5IC 4MVFA 1DQEA 3JVTB 1M39A 4GUKA 4ICBA 1H8BA 3GK1A 2CBLA 1QS7A 1XO5A 1DJIA 3GK2A 1XYDA 2V53A 4WQ2A 1TCFA 2Q91A 2ZFDA 5FYXA 1F4QA 3NXAA 1DEKA 4IJ7A 2LLUA 3DVJA 5CSIA 3DXLA 3SS3A 4GAOA 2WCMA 2KLDA 1KK8B 5I2OA 2NZ0A 3EK7A 1IWQA 2WCFA 1WDCB 1RECA 3CTNA 3NSLA 5D69A 1S1EA 1XFXO 5HYDA 1WRZA 3NSKA 4GGNA 1KK7Z 3EKJA 1TTXA 1DF0A 1OZOA 2ERBA 1BMOA 1BT6A 1CM4A 1NYAA 3F45A 3SS5A 3SJSA 2EGDA 1DJYA 2HETA 4N5XA 1S6IA 2L98A 3TUYB 1TCOB 4JD9A 2E6WA 5K89A 1PSRA 4XJKA 2Y1NA 1B8CA 1K94A 1SW8A 1QJTA 4CFRA 1B8LA 2LVJA 3BFHA 1LXFC 1EXRA 1DVIA 3BJHA 3LL8B 1F71A 3D78A 3JTDB 2E30A 3IQQA 2LVIA 3A4UB 2LMVA 1FF1A 2F2PA 3PM8A 3PM2A 3SG7A 3KEVA 2P6BB 5I2LA 4TNCA 2FOTA 3FIAA 1GM0A 1B7TY 1LKJA 4PHMA 3CLNA 4DRWA 1OOHA 3NGVA 5EL2A 4UPGA 2KYFA 3I5GC 1KSMA 4ORBB 1AHRA 1QXPA 4NQGA 1OOJA 2PQLA 3K21A 4QJ3B 1BLQA 3DVKA 1AJ5A 5AFPA 1QWVA 1TWOA 1UUSA 2F3ZA 3SG6A 1TNWA 1QX5B 1M46A 2VRGA 3DZTA 3FWCA 1SMGA 3OHMB 4XJKB 3AKAA 2SCPA 1NX0A 2BCBA 1IGVA 2HF5A 3DF0B 1CMGA 3OBVA 1J1EA 3JTDC 1ORGA 1BJFA 2L50A 4YBHB 5BPJA 1CDNA 4AQJA 3VRQA 1NWDA 1OE9B 1QVIY 1DMOA 5FI6A 4YGEB 1NX1A 4AQIA 3Q8IA 5JOLA 1RROA 4CLNA 2PMYA 1TUJA 1TNPA 2JPOA 3CR5X 3CZTX 1GGWA 2YGUA 1W7IB 5JJGA 4PALA 1F54A 3AAKA 3TUYC 1V1FA 4MZLA 1MHOA 2L2CA 2M49B 4DCKA 5KSZA 2K7CA 3NSIA 1UHJA 4C0JA 1GQMA 1TRFA 1ALVA 1QIVA 1A2XA 2OTGC 2O5GA 3DF0A 4XYNA 2ZN8A 1OQPA 2BAPA 2MAZA 3I5FB 3B88A 1BG1A 2LMTA 3CWGA 1MQ1A 3PSRA 3WHTB 2LHIA 2QEVA 4MBEA 4A4BA 1B47A 1K93D 4IL1A 1CDPA 5CSJA 1F4OA 3GOFA 4C0LA 2LANA 4AOMA 2JWWA 1AVSA 2KI4C 1K9KA 4MSPA 1L2OC 1SSEB 2MBXA 2BE4A 3BUMB 3DVEA 3TZ1A 1BODA 1J7PA 3NHIA 1OOGA 4FQTA 1ODBA 1OZSA 1J1DA 1E8AA 3CDNA 5AXIA 1KCYA 1JWDA 3TDIA 1YRTB 1DJHA 1KFXL 3CZ1A 3IF7A 2G2BA 3IVTA 1M63B 2H8VA 3I5GB 3NHTA 4I5LB 2KBMA 1W9ZA 2PVBA 3WNXB 4JPZB 4PE7A 3D76A 4YGBB 4WQ3A 1BR1B 2CT9A 5B8IB 1ZOTB 2KFFA 2LVKA 2K8MB 1KK8C 4GNKB 3EK8A 1EH2A 1NX2A 2CTNA 2L2EA 2LLTA 2MA2A 2JNFA 5GQQC 1JF2A 1XFYO 5FI2A 1F8HA 1SYMA 4I5NB 1K95A 4NDCA 4ORAB 3UO9A 1R2UA 2QACA 3CGAA 1B8RA 2JT8A 3HCMA 1H4BA 2NCOA 4N1FA 3EKHA 1DELA 3S0FA 5F6TA 3LLEA 1V1GA 1UURA 5I8NA 1CLLA 4PE4A 1SNLA 1SR6C 2D8NA 1DC1A 2L5XB 3I5HC 1HT9A 1XK4A 4MN0A 1G33A 1PSBA 2BE6A 1SY9A 5CSNA 4I5KA 2M8UA 2K7OA 1IIOA 2KAXA 2H61A 1FBVA 1OOIX 2KI6C 2LNKA 3E3RA 2QEHA 3GK4X 4CIDA 2Y1MA 5AERA 2KQ6A 1MF8B 3CABA 4INWA 1TNXA 2PALA 3VROA 1WDCC 1CLMA 1S6JA 2KFHA 2LLSA 2JTTA 2MLFC 2WORA 2K7DA 2KLEA 2LCPA 1NP8A 1N0YA 2M9GA 2MHHA 1KQMC 3PJIA 1TUZA 3BQ3A 1K8UA 5DKRA 4ZCVA 1W7JB 1Z4HA 4OVNF 2DOQA 2WCHA 1CDMA 3BUWB 2WC5A 5HLVA 1FI5A 1MXLC 1SK6D 4FTGA 1LS8A 2WCBA 2MRDA 3VRRA 1IH0A 2NCPA 1J7QA 1A75B 3KF9A 1PULA 3DVMA 2ZN9A 2L4IA 2WNDA 1FI6A 2LE9B 4MRXA 5CPVA 2K7BA 1JFKA 1OOFA 3M0WA 1B9AA 1J55A 1U5IA 3ICBA 2EC6C 2WCEA 5J3XA 1EJ3A 1S3PA 3OP0A 4FQOA 3TS5C 2P71A 1CTRA 1KFXS 2BKIB 2M29A 3KPXA 3PFVA 1B4CA 1ZUZA 5HL1A 1UHKA 2G9BA 2BCXA 4CFQA 1IJ6A 1XFRA 1QV1A 3SG5A 2COLB 1DGVA 3OGNA 2EHBA 2L0PA 2QDIA 3DYEA 1AP4A 3OB2B 1CMFA 2KGRA 1Y6WA 2H61C 1NUBA 1KSOA 2CXJA 1PALA 1KFUL 1R6PA 2K2FA 3FE8A 1GJYA 1K9UA 3O4YA 1RTP1 1CLBA 3B87A 3L4AA 3TDUA 2BL0B 2JTZA 1A03A 4PCWA 3CZ2A 2JOJA 4HSZA 2JU0A 4M2QA 2OTGB 1IRJA 4I5JA 1A75A 1EG4A 2WCKA 3L4LA 1K9PA 3VRNA 2JC2A 2EC6B 3O4XA 3EVVA 3SS4A 4MLWA 2ZRSA 3D75A 3EVUA 1YRUB 3FE6A 1M31A 1PRWA 1QV0A 4YGCB 1C3YA 1K90D 1S5GZ 1S6CA 1YURA 2JXLA 3A8RA 2QEBA 2KI6D 2WCLA 1M45A 2KPHA 4HRGA 2KAVA 3IQOA 2RGIA 1YUSA 1NSHA 1L7ZA 1XFVO 2JPTA 2F3YA 1TNQA 1SCMB 2BECA 1CFFA 5DKNA 1JFJA 3WHUB 4GGFC 4JWQA 1CDLA 1UHIA 3K1EA 2M97A 4DIRA 2WC8A 1DTLA 1EL4A 4KYNA 1AK8A 1DJWA 1WLMA 3D74A 1CKKA 1FPWA 1B1GA 1Y0VH 3BXKA 2JQ6A 3D73A 3CYZA 1NCXA 1C7WA 3OX5A 3R1PA 3B6XA 1DGUA 5D3OA 1OSAA 1A4PA 1J7RA 1QATA 1CB1A 1KK7Y 3RM1A 1UHNA 3S0EA 2KNEA 3R72A 2M7NA 3R1OA 3LK1A 4A4CA 5IBWA 1BOCA 3R1VA 4PE0A 1ZACA 2HQWA 5KU1A 1S5GY 2BL0C 2NXQA 2OPOA 2LP3A 5TNCA 2ISDA 4WRIA 1DJGA 2WC6A 3V2LA 3D0YB 1SCMC 3I5IB 1ZFSA 3S0DA 1D1OA 2NLNA 1F55A 4OR9B 1BR4B 5KTYA 1YVLA 3H4SE 1Y1AA 3BUXB 1MWNA 2KGBC 4JQ0D 3D77A 4GBAA 3WXAA 3I5FC 1LA3A 1C07A 1K2HA 2LMUA 1YUTA 1CNPA
chains in the Genus database with same CATH topology
1QTXA 1Y1XA 4MEWA 1A29A 1XFUO 2H2KA 2KHNA 3D0YA 3PATA 1QASA 4GFTA 4GGFA 2LV7A 1MR8A 1CM1A 3O2PA 3KO0A 4HRHA 2OS8B 2JULA 2M1KB 1YTZC 4YI9A 3AKBA 4F0ZB 4YI8A 1EG3A 4BY4A 1XFZO 3D10A 2MJWB 3TDZA 2KQYA 1C7VA 1VRKA 1XK4C 2I94A 1DF0B 1RFJA 3SG4A 5I2QA 1QVIZ 1X02A 1SRAA 3JVTC 1BU3A 2K61A 3EK4A 1XVJA 1YVHA 5CSFA 1SCVA 1KQMB 2M3WA 2AUCA 4P2YB 1NX3A 3O6BA 4QJ5B 2GGMA 2JRFA 1JSAA 3VGOA 1MUXA 1LA0A 1AUIB 1NCYA 5AANA 1N65A 4PHKA 1GGZA 2OS8C 2CCMA 2Y4QA 2PSRA 1PK0D 1YR5A 1MXEA 3I5HB 2I18A 1HQVA 2MLEC 2CNPA 3CR2A 1AJ4A 1SKTA 1F70A 3BOWB 3LCPC 3CS1A 2IS9A 2B1UA 3O78A 2LHLA 1XA5A 4OV2A 4YRUA 1WY9A 2AAOA 5HKZA 1PVBA 2KI4B 2LVVA 1QLKA 1KFUS 1KWOB 1RWYA 1DJZA 2M7LA 1Q80A 2WOSA 2A4JA 3BUNB 1YUUA 1RK9A 1NPQA 4ORCB 3ZNIA 3CR4X 1OMRA 3OB1B 5HKYA 2KBIA 1B7TZ 1G8IA 2KFGA 4U8DA 3TS5B 4MRYA 4CPVA 1IG5A 1S26D 4PHJA 5HKWA 1ZMZA 1RJVA 2KYCA 3PN7C 4P5OE 1DT7B 2KSPA 2LUCA 1UP5A 4E68A 1DJXA 1YX7A 1OMDA 2LAPA 1WRLA 4USLA 1IKUA 2FCDA 2O60A 2LUXA 3FS7A 4GPLB 4D1EA 1L2OB 2KAYA 2ZKMX 1CFDA 3SIBA 3C1VA 2JZIA 5G08A 3ZWHA 2I2RE 4DS7A 3SG3A 2HQ8A 5ER4X 4L9MA 1N2DA 1ALWA 4NDBA 4R1EA 2ZRTA 5ER5A 2L4HA 1SL8A 1JUOA 2BBMA 4M2PA 1UHHA 4C0KA 2JT3A 2JXCA 1XFWO 1TOPA 4MZKA 1S36A 4ZCUA 3BUOB 2L51A 1WLZA 2GV5A 1JBAA 2F33A 3PN7B 2FCEA 2JT0A 2AMIA 2I7AA 1IQ3A 3SIAA 4BY5A 4QJ4B 2M1UA 4PE1A 2ZNEA 4PHNA 3BOWA 1LVCD 1SR6B 2BKHB 1LINA 1PVAA 1QX7A 1YX8A 3VRPA 1G4YR 1WRKA 4N1GA 2HPSA 1JF0A 3LK0A 1IJ5A 1SPYA 4Q04A 2BCAA 4YGAA 3HX4A 1KWOC 5DKQA 1U5IB 5AEQA 2PASA 5PALA 1CFCA 2F2OA 1CFPA 1JC2A 3KHEA 4PDZA 2R2IA 3MSEB 4HREE 2QPTA 1SBJA 2K2AA 2GGZA 1BF5A 4DUQA 2M0RA 1QX2A 2LC5A 3QRXA 3PALA 4NDDA 4MZJA 2F8PA 3FWBA 4ETOA 3RLZA 2BBNA 2JNXA 1FW4A 2K0JA 2KDHA 3BYAA 3SG2A 1OMVA 1UWOA 4M2OA 1IQ5A 3NSOA 5D7FA 3OX6A 2SASA 1TIZA 4YGDB 1NIWA 2TN4A 1KQVA 2Y5IA 3AAJA 1TN4A 2Q4UA 2KOTA 2ZNDA 2FJUB 2LM5A 4OCIA 2PRUA 3PLFB 1J7OA 2LP2A 1SL9A 3DD4A 5HLOA 4OKHA 1QLSA 1Y1UA 3EVRA 1NCZA 1QIWA 1K96A 1SL7A 3I5IC 4MVFA 3JVTB 1M39A 4GUKA 4ICBA 1H8BA 3GK1A 2CBLA 1QS7A 1XO5A 1DJIA 3GK2A 1XYDA 2V53A 4WQ2A 1TCFA 2Q91A 2ZFDA 5FYXA 1F4QA 3NXAA 2LLUA 3DVJA 5CSIA 4GAOA 1KK8B 5I2OA 2NZ0A 3EK7A 1IWQA 2WCFA 1WDCB 1RECA 3CTNA 3NSLA 5D69A 1S1EA 1XFXO 5HYDA 1WRZA 3NSKA 4GGNA 1KK7Z 3EKJA 1TTXA 1DF0A 1OZOA 1BMOA 1BT6A 1CM4A 1NYAA 3F45A 3SJSA 2EGDA 1DJYA 2HETA 4N5XA 1S6IA 2L98A 3TUYB 1TCOB 2E6WA 5K89A 1PSRA 4XJKA 2Y1NA 1B8CA 1K94A 1SW8A 1QJTA 4CFRA 1B8LA 2LVJA 1LXFC 1EXRA 1DVIA 3LL8B 1F71A 3JTDB 2E30A 3IQQA 2LVIA 3A4UB 2LMVA 1FF1A 2F2PA 3PM8A 3SG7A 3KEVA 2P6BB 5I2LA 4TNCA 2FOTA 3FIAA 1B7TY 1LKJA 4PHMA 3CLNA 4DRWA 4UPGA 2KYFA 3I5GC 1KSMA 4ORBB 1AHRA 1QXPA 4NQGA 1OOJA 3K21A 4QJ3B 1BLQA 3DVKA 1AJ5A 5AFPA 1UUSA 2F3ZA 3SG6A 1TNWA 1QX5B 1M46A 2VRGA 3FWCA 3OHMB 1SMGA 4XJKB 3AKAA 2SCPA 1NX0A 1IGVA 2BCBA 2HF5A 3DF0B 1CMGA 1J1EA 3JTDC 1BJFA 2L50A 4YBHB 5BPJA 1CDNA 4AQJA 3VRQA 1NWDA 1OE9B 1QVIY 1DMOA 4YGEB 1NX1A 4AQIA 5JOLA 1RROA 4CLNA 2PMYA 1TNPA 3CR5X 3CZTX 1GGWA 1W7IB 5JJGA 4PALA 1F54A 3AAKA 3TUYC 1V1FA 4MZLA 1MHOA 2M49B 4DCKA 5KSZA 2K7CA 3NSIA 1UHJA 4C0JA 1GQMA 1TRFA 1ALVA 1QIVA 1A2XA 2OTGC 2O5GA 3DF0A 4XYNA 2ZN8A 1OQPA 2MAZA 3I5FB 1BG1A 2LMTA 3CWGA 1MQ1A 3PSRA 3WHTB 2LHIA 4MBEA 4A4BA 1B47A 1K93D 4IL1A 1CDPA 5CSJA 1F4OA 3GOFA 4C0LA 2LANA 4AOMA 2JWWA 1AVSA 2KI4C 1K9KA 4MSPA 1L2OC 2MBXA 2BE4A 3BUMB 3DVEA 3TZ1A 1BODA 1J7PA 1ODBA 1OZSA 1J1DA 1E8AA 5AXIA 1KCYA 1JWDA 3TDIA 1YRTB 1DJHA 1KFXL 3IF7A 2G2BA 1M63B 3I5GB 4I5LB 2KBMA 2PVBA 3WNXB 4JPZB 4PE7A 4YGBB 4WQ3A 1BR1B 2CT9A 5B8IB 1ZOTB 2KFFA 2LVKA 2K8MB 1KK8C 4GNKB 3EK8A 1EH2A 1NX2A 2CTNA 2L2EA 2LLTA 2MA2A 2JNFA 5GQQC 1JF2A 1XFYO 1F8HA 1SYMA 4I5NB 1K95A 4NDCA 4ORAB 1R2UA 2QACA 3CGAA 1B8RA 2JT8A 3HCMA 1H4BA 2NCOA 4N1FA 3EKHA 5F6TA 3LLEA 1V1GA 1UURA 5I8NA 1CLLA 4PE4A 1SNLA 1SR6C 2D8NA 2L5XB 3I5HC 1HT9A 1XK4A 4MN0A 1G33A 1PSBA 2BE6A 1SY9A 5CSNA 4I5KA 2M8UA 2K7OA 2KAXA 2H61A 1FBVA 3GK4X 2KI6C 2LNKA 3E3RA 4CIDA 5AERA 2Y1MA 2KQ6A 1MF8B 1TNXA 2PALA 3VROA 1WDCC 1CLMA 1S6JA 2KFHA 2LLSA 2JTTA 2MLFC 2WORA 2K7DA 2LCPA 1NP8A 1N0YA 2M9GA 2MHHA 1KQMC 5DKRA 3BQ3A 1K8UA 4ZCVA 1W7JB 4OVNF 2DOQA 3BUWB 1CDMA 5HLVA 1FI5A 1MXLC 1SK6D 4FTGA 2WCBA 2MRDA 3VRRA 1IH0A 2NCPA 1J7QA 1A75B 3KF9A 1PULA 3DVMA 2ZN9A 2L4IA 2WNDA 1FI6A 2LE9B 4MRXA 5CPVA 2K7BA 1JFKA 3M0WA 1B9AA 1J55A 1U5IA 3ICBA 2EC6C 2WCEA 5J3XA 1EJ3A 1S3PA 3OP0A 4FQOA 3TS5C 1CTRA 1KFXS 2BKIB 2M29A 3KPXA 3PFVA 1B4CA 1ZUZA 1UHKA 2G9BA 2BCXA 4CFQA 1IJ6A 1QV1A 3SG5A 2COLB 1DGVA 2EHBA 2L0PA 1AP4A 1CMFA 3OB2B 2KGRA 1Y6WA 2H61C 1NUBA 1KSOA 2CXJA 1PALA 1KFUL 1R6PA 2K2FA 1GJYA 1K9UA 3O4YA 1RTP1 1CLBA 3TDUA 2BL0B 2JTZA 1A03A 4PCWA 2JOJA 4HSZA 2JU0A 4M2QA 2OTGB 1IRJA 4I5JA 1A75A 1EG4A 1K9PA 3VRNA 2JC2A 2EC6B 3EVVA 4MLWA 2ZRSA 3EVUA 1YRUB 1M31A 1PRWA 1QV0A 4YGCB 1K90D 1S5GZ 1S6CA 1YURA 2JXLA 3A8RA 2KI6D 1M45A 4HRGA 2KAVA 3IQOA 2RGIA 1YUSA 1NSHA 1L7ZA 1XFVO 2JPTA 2F3YA 1TNQA 1SCMB 2BECA 1CFFA 5DKNA 1JFJA 3WHUB 4GGFC 4JWQA 1CDLA 1UHIA 2M97A 4DIRA 2WC8A 1DTLA 1EL4A 1AK8A 1DJWA 1WLMA 1CKKA 1FPWA 1B1GA 1Y0VH 3BXKA 2JQ6A 3OX5A 1NCXA 1C7WA 1DGUA 1OSAA 1A4PA 1J7RA 1QATA 1CB1A 1KK7Y 3RM1A 1UHNA 2KNEA 2M7NA 3LK1A 4A4CA 5IBWA 1BOCA 4PE0A 1ZACA 2HQWA 5KU1A 1S5GY 2BL0C 2NXQA 2OPOA 2LP3A 5TNCA 2ISDA 4WRIA 1DJGA 3D0YB 1SCMC 3I5IB 1ZFSA 1D1OA 2NLNA 1F55A 4OR9B 1BR4B 5KTYA 1YVLA 3H4SE 1Y1AA 3BUXB 1MWNA 2KGBC 4JQ0D 4GBAA 3WXAA 3I5FC 1LA3A 1C07A 1K2HA 2LMUA 1YUTA 1CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTX A;  1Y1X A;  4MEW A;  1A29 A;  1XFU O;  2H2K A;  2KHN A;  3D0Y A;  3PAT A;  1QAS A;  4GFT A;  4GGF A;  2LV7 A;  1MR8 A;  1CM1 A;  3O2P A;  3KO0 A;  4HRH A;  2OS8 B;  2JUL A;  2M1K B;  1YTZ C;  4YI9 A;  3AKB A;  4F0Z B;  4YI8 A;  1EG3 A;  4BY4 A;  1XFZ O;  3D10 A;  2MJW B;  3TDZ A;  2KQY A;  1C7V A;  1VRK A;  1XK4 C;  2I94 A;  1DF0 B;  1RFJ A;  3SG4 A;  5I2Q A;  1QVI Z;  1X02 A;  1SRA A;  3JVT C;  1BU3 A;  2K61 A;  3EK4 A;  1XVJ A;  1YVH A;  5CSF A;  1SCV A;  1KQM B;  2M3W A;  2AUC A;  4P2Y B;  1NX3 A;  3O6B A;  4QJ5 B;  2GGM A;  2JRF A;  1JSA A;  3VGO A;  1MUX A;  1LA0 A;  1AUI B;  1NCY A;  5AAN A;  1N65 A;  4PHK A;  1GGZ A;  2OS8 C;  2CCM A;  2Y4Q A;  2PSR A;  1PK0 D;  1YR5 A;  1MXE A;  3I5H B;  2I18 A;  1HQV A;  2MLE C;  2CNP A;  3CR2 A;  1AJ4 A;  1SKT A;  1F70 A;  3BOW B;  3LCP C;  3CS1 A;  2IS9 A;  2B1U A;  3O78 A;  2LHL A;  1XA5 A;  4OV2 A;  4YRU A;  1WY9 A;  2AAO A;  5HKZ A;  1PVB A;  2KI4 B;  2LVV A;  1QLK A;  1KFU S;  1KWO B;  1RWY A;  1DJZ A;  2M7L A;  1Q80 A;  2WOS A;  2A4J A;  3BUN B;  1YUU A;  1RK9 A;  1NPQ A;  4ORC B;  3ZNI A;  3CR4 X;  1OMR A;  3OB1 B;  5HKY A;  2KBI A;  1B7T Z;  1G8I A;  2KFG A;  4U8D A;  3TS5 B;  4MRY A;  4CPV A;  1IG5 A;  1S26 D;  4PHJ A;  5HKW A;  1ZMZ A;  1RJV A;  2KYC A;  3PN7 C;  4P5O E;  1DT7 B;  2KSP A;  2LUC A;  1UP5 A;  4E68 A;  1DJX A;  1YX7 A;  1OMD A;  2LAP A;  1WRL A;  4USL A;  1IKU A;  2FCD A;  2O60 A;  2LUX A;  3FS7 A;  4GPL B;  4D1E A;  1L2O B;  2KAY A;  2ZKM X;  1CFD A;  3SIB A;  3C1V A;  2JZI A;  5G08 A;  3ZWH A;  2I2R E;  4DS7 A;  3SG3 A;  2HQ8 A;  5ER4 X;  4L9M A;  1N2D A;  1ALW A;  4NDB A;  4R1E A;  2ZRT A;  5ER5 A;  2L4H A;  1SL8 A;  1JUO A;  2BBM A;  4M2P A;  1UHH A;  4C0K A;  2JT3 A;  2JXC A;  1XFW O;  1TOP A;  4MZK A;  1S36 A;  4ZCU A;  3BUO B;  2L51 A;  1WLZ A;  2GV5 A;  1JBA A;  2F33 A;  3PN7 B;  2FCE A;  2JT0 A;  2AMI A;  2I7A A;  1IQ3 A;  3SIA A;  4BY5 A;  4QJ4 B;  2M1U A;  4PE1 A;  2ZNE A;  4PHN A;  3BOW A;  1LVC D;  1SR6 B;  2BKH B;  1LIN A;  1PVA A;  1QX7 A;  1YX8 A;  3VRP A;  1G4Y R;  1WRK A;  4N1G A;  2HPS A;  1JF0 A;  3LK0 A;  1IJ5 A;  1SPY A;  4Q04 A;  2BCA A;  4YGA A;  3HX4 A;  1KWO C;  5DKQ A;  1U5I B;  5AEQ A;  2PAS A;  5PAL A;  1CFC A;  2F2O A;  1CFP A;  1JC2 A;  3KHE A;  4PDZ A;  2R2I A;  3MSE B;  4HRE E;  2QPT A;  1SBJ A;  2K2A A;  2GGZ A;  1BF5 A;  4DUQ A;  2M0R A;  1QX2 A;  2LC5 A;  3QRX A;  3PAL A;  4NDD A;  4MZJ A;  2F8P A;  3FWB A;  4ETO A;  3RLZ A;  2BBN A;  2JNX A;  1FW4 A;  2K0J A;  2KDH A;  3BYA A;  3SG2 A;  1OMV A;  1UWO A;  4M2O A;  1IQ5 A;  3NSO A;  5D7F A;  3OX6 A;  2SAS A;  1TIZ A;  4YGD B;  1NIW A;  2TN4 A;  1KQV A;  2Y5I A;  3AAJ A;  1TN4 A;  2Q4U A;  2KOT A;  2ZND A;  2FJU B;  2LM5 A;  4OCI A;  2PRU A;  3PLF B;  1J7O A;  2LP2 A;  1SL9 A;  3DD4 A;  5HLO A;  4OKH A;  1QLS A;  1Y1U A;  3EVR A;  1NCZ A;  1QIW A;  1K96 A;  1SL7 A;  3I5I C;  4MVF A;  3JVT B;  1M39 A;  4GUK A;  4ICB A;  1H8B A;  3GK1 A;  2CBL A;  1QS7 A;  1XO5 A;  1DJI A;  3GK2 A;  1XYD A;  2V53 A;  4WQ2 A;  1TCF A;  2Q91 A;  2ZFD A;  5FYX A;  1F4Q A;  3NXA A;  2LLU A;  3DVJ A;  5CSI A;  4GAO A;  1KK8 B;  5I2O A;  2NZ0 A;  3EK7 A;  1IWQ A;  2WCF A;  1WDC B;  1REC A;  3CTN A;  3NSL A;  5D69 A;  1S1E A;  1XFX O;  5HYD A;  1WRZ A;  3NSK A;  4GGN A;  1KK7 Z;  3EKJ A;  1TTX A;  1DF0 A;  1OZO A;  1BMO A;  1BT6 A;  1CM4 A;  1NYA A;  3F45 A;  3SJS A;  2EGD A;  1DJY A;  2HET A;  4N5X A;  1S6I A;  2L98 A;  3TUY B;  1TCO B;  2E6W A;  5K89 A;  1PSR A;  4XJK A;  2Y1N A;  1B8C A;  1K94 A;  1SW8 A;  1QJT A;  4CFR A;  1B8L A;  2LVJ A;  1LXF C;  1EXR A;  1DVI A;  3LL8 B;  1F71 A;  3JTD B;  2E30 A;  3IQQ A;  2LVI A;  3A4U B;  2LMV A;  1FF1 A;  2F2P A;  3PM8 A;  3SG7 A;  3KEV A;  2P6B B;  5I2L A;  4TNC A;  2FOT A;  3FIA A;  1B7T Y;  1LKJ A;  4PHM A;  3CLN A;  4DRW A;  4UPG A;  2KYF A;  3I5G C;  1KSM A;  4ORB B;  1AHR A;  1QXP A;  4NQG A;  1OOJ A;  3K21 A;  4QJ3 B;  1BLQ A;  3DVK A;  1AJ5 A;  5AFP A;  1UUS A;  2F3Z A;  3SG6 A;  1TNW A;  1QX5 B;  1M46 A;  2VRG A;  3FWC A;  3OHM B;  1SMG A;  4XJK B;  3AKA A;  2SCP A;  1NX0 A;  1IGV A;  2BCB A;  2HF5 A;  3DF0 B;  1CMG A;  1J1E A;  3JTD C;  1BJF A;  2L50 A;  4YBH B;  5BPJ A;  1CDN A;  4AQJ A;  3VRQ A;  1NWD A;  1OE9 B;  1QVI Y;  1DMO A;  4YGE B;  1NX1 A;  4AQI A;  5JOL A;  1RRO A;  4CLN A;  2PMY A;  1TNP A;  3CR5 X;  3CZT X;  1GGW A;  1W7I B;  5JJG A;  4PAL A;  1F54 A;  3AAK A;  3TUY C;  1V1F A;  4MZL A;  1MHO A;  2M49 B;  4DCK A;  5KSZ A;  2K7C A;  3NSI A;  1UHJ A;  4C0J A;  1GQM A;  1TRF A;  1ALV A;  1QIV A;  1A2X A;  2OTG C;  2O5G A;  3DF0 A;  4XYN A;  2ZN8 A;  1OQP A;  2MAZ A;  3I5F B;  1BG1 A;  2LMT A;  3CWG A;  1MQ1 A;  3PSR A;  3WHT B;  2LHI A;  4MBE A;  4A4B A;  1B47 A;  1K93 D;  4IL1 A;  1CDP A;  5CSJ A;  1F4O A;  3GOF A;  4C0L A;  2LAN A;  4AOM A;  2JWW A;  1AVS A;  2KI4 C;  1K9K A;  4MSP A;  1L2O C;  2MBX A;  2BE4 A;  3BUM B;  3DVE A;  3TZ1 A;  1BOD A;  1J7P A;  1ODB A;  1OZS A;  1J1D A;  1E8A A;  5AXI A;  1KCY A;  1JWD A;  3TDI A;  1YRT B;  1DJH A;  1KFX L;  3IF7 A;  2G2B A;  1M63 B;  3I5G B;  4I5L B;  2KBM A;  2PVB A;  3WNX B;  4JPZ B;  4PE7 A;  4YGB B;  4WQ3 A;  1BR1 B;  2CT9 A;  5B8I B;  1ZOT B;  2KFF A;  2LVK A;  2K8M B;  1KK8 C;  4GNK B;  3EK8 A;  1EH2 A;  1NX2 A;  2CTN A;  2L2E A;  2LLT A;  2MA2 A;  2JNF A;  5GQQ C;  1JF2 A;  1XFY O;  1F8H A;  1SYM A;  4I5N B;  1K95 A;  4NDC A;  4ORA B;  1R2U A;  2QAC A;  3CGA A;  1B8R A;  2JT8 A;  3HCM A;  1H4B A;  2NCO A;  4N1F A;  3EKH A;  5F6T A;  3LLE A;  1V1G A;  1UUR A;  5I8N A;  1CLL A;  4PE4 A;  1SNL A;  1SR6 C;  2D8N A;  2L5X B;  3I5H C;  1HT9 A;  1XK4 A;  4MN0 A;  1G33 A;  1PSB A;  2BE6 A;  1SY9 A;  5CSN A;  4I5K A;  2M8U A;  2K7O A;  2KAX A;  2H61 A;  1FBV A;  3GK4 X;  2KI6 C;  2LNK A;  3E3R A;  4CID A;  5AER A;  2Y1M A;  2KQ6 A;  1MF8 B;  1TNX A;  2PAL A;  3VRO A;  1WDC C;  1CLM A;  1S6J A;  2KFH A;  2LLS A;  2JTT A;  2MLF C;  2WOR A;  2K7D A;  2LCP A;  1NP8 A;  1N0Y A;  2M9G A;  2MHH A;  1KQM C;  5DKR A;  3BQ3 A;  1K8U A;  4ZCV A;  1W7J B;  4OVN F;  2DOQ A;  3BUW B;  1CDM A;  5HLV A;  1FI5 A;  1MXL C;  1SK6 D;  4FTG A;  2WCB A;  2MRD A;  3VRR A;  1IH0 A;  2NCP A;  1J7Q A;  1A75 B;  3KF9 A;  1PUL A;  3DVM A;  2ZN9 A;  2L4I A;  2WND A;  1FI6 A;  2LE9 B;  4MRX A;  5CPV A;  2K7B A;  1JFK A;  3M0W A;  1B9A A;  1J55 A;  1U5I A;  3ICB A;  2EC6 C;  2WCE A;  5J3X A;  1EJ3 A;  1S3P A;  3OP0 A;  4FQO A;  3TS5 C;  1CTR A;  1KFX S;  2BKI B;  2M29 A;  3KPX A;  3PFV A;  1B4C A;  1ZUZ A;  1UHK A;  2G9B A;  2BCX A;  4CFQ A;  1IJ6 A;  1QV1 A;  3SG5 A;  2COL B;  1DGV A;  2EHB A;  2L0P A;  1AP4 A;  1CMF A;  3OB2 B;  2KGR A;  1Y6W A;  2H61 C;  1NUB A;  1KSO A;  2CXJ A;  1PAL A;  1KFU L;  1R6P A;  2K2F A;  1GJY A;  1K9U A;  3O4Y A;  1RTP 1;  1CLB A;  3TDU A;  2BL0 B;  2JTZ A;  1A03 A;  4PCW A;  2JOJ A;  4HSZ A;  2JU0 A;  4M2Q A;  2OTG B;  1IRJ A;  4I5J A;  1A75 A;  1EG4 A;  1K9P A;  3VRN A;  2JC2 A;  2EC6 B;  3EVV A;  4MLW A;  2ZRS A;  3EVU A;  1YRU B;  1M31 A;  1PRW A;  1QV0 A;  4YGC B;  1K90 D;  1S5G Z;  1S6C A;  1YUR A;  2JXL A;  3A8R A;  2KI6 D;  1M45 A;  4HRG A;  2KAV A;  3IQO A;  2RGI A;  1YUS A;  1NSH A;  1L7Z A;  1XFV O;  2JPT A;  2F3Y A;  1TNQ A;  1SCM B;  2BEC A;  1CFF A;  5DKN A;  1JFJ A;  3WHU B;  4GGF C;  4JWQ A;  1CDL A;  1UHI A;  2M97 A;  4DIR A;  2WC8 A;  1DTL A;  1EL4 A;  1AK8 A;  1DJW A;  1WLM A;  1CKK A;  1FPW A;  1B1G A;  1Y0V H;  3BXK A;  2JQ6 A;  3OX5 A;  1NCX A;  1C7W A;  1DGU A;  1OSA A;  1A4P A;  1J7R A;  1QAT A;  1CB1 A;  1KK7 Y;  3RM1 A;  1UHN A;  2KNE A;  2M7N A;  3LK1 A;  4A4C A;  5IBW A;  1BOC A;  4PE0 A;  1ZAC A;  2HQW A;  5KU1 A;  1S5G Y;  2BL0 C;  2NXQ A;  2OPO A;  2LP3 A;  5TNC A;  2ISD A;  4WRI A;  1DJG A;  3D0Y B;  1SCM C;  3I5I B;  1ZFS A;  1D1O A;  2NLN A;  1F55 A;  4OR9 B;  1BR4 B;  5KTY A;  1YVL A;  3H4S E;  1Y1A A;  3BUX B;  1MWN A;  2KGB C;  4JQ0 D;  4GBA A;  3WXA A;  3I5F C;  1LA3 A;  1C07 A;  1K2H A;  2LMU A;  1YUT A;  1CNP A; 
#chains in the Genus database with same CATH topology
 1QTX A;  1Y1X A;  4MEW A;  1A29 A;  1XFU O;  2H2K A;  2KHN A;  3D0Y A;  3PAT A;  1QAS A;  4GFT A;  4GGF A;  2LV7 A;  1P28 A;  1MR8 A;  1CM1 A;  3O2P A;  3KO0 A;  4HRH A;  2OS8 B;  2JUL A;  2M1K B;  1YTZ C;  4YI9 A;  3AKB A;  4F0Z B;  4YI8 A;  1EG3 A;  4BY4 A;  1XFZ O;  3D10 A;  2MJW B;  3TDZ A;  2KQY A;  1C7V A;  1VRK A;  1XK4 C;  2I94 A;  1DF0 B;  1RFJ A;  3L47 A;  3SG4 A;  5I2Q A;  1QVI Z;  1X02 A;  1SRA A;  3JVT C;  2QEO A;  1BU3 A;  2K61 A;  3EK4 A;  1C3Z A;  1XVJ A;  1YVH A;  5CSF A;  1SCV A;  3B86 A;  1KQM B;  2M3W A;  2L5Y A;  2AUC A;  4P2Y B;  4PT1 A;  1NX3 A;  3O6B A;  4QJ5 B;  3S0A A;  1T14 A;  2GGM A;  2JRF A;  3VB1 A;  3VGO A;  1JSA A;  1MUX A;  1LA0 A;  1AUI B;  1NCY A;  5AAN A;  1N65 A;  1Z2C B;  2FJY A;  3UNW A;  4PHK A;  1GGZ A;  2OS8 C;  2CCM A;  3DY9 A;  2Y4Q A;  1OW4 A;  2GTE A;  2PSR A;  1PK0 D;  4OZD A;  1YR5 A;  1MXE A;  3I5H B;  2I18 A;  1HQV A;  2MLE C;  2CNP A;  3CR2 A;  1AJ4 A;  1SKT A;  1F70 A;  3BOW B;  3LCP C;  3CS1 A;  2WCJ A;  2IS9 A;  2B1U A;  3O78 A;  2LHL A;  2BNX A;  1XA5 A;  3BFB A;  4OV2 A;  4YRU A;  1WY9 A;  2AAO A;  5HKZ A;  1PVB A;  2KI4 B;  2LVV A;  1QLK A;  1KFU S;  1KWO B;  1RWY A;  1DJZ A;  2M7L A;  1Q80 A;  2WOS A;  2A4J A;  3BUN B;  1YUU A;  1RK9 A;  1NPQ A;  4ORC B;  3ZNI A;  3CR4 X;  1OMR A;  3OB1 B;  5HKY A;  4INX A;  2KBI A;  1B7T Z;  1G8I A;  2KFG A;  4U8D A;  3TS5 B;  4MRY A;  4CPV A;  1IG5 A;  1S26 D;  4PHJ A;  5HKW A;  1ZMZ A;  1RJV A;  2KYC A;  3PN7 C;  4P5O E;  1DT7 B;  2KSP A;  2LUC A;  1UP5 A;  4E68 A;  5I94 A;  2PYQ A;  1DJX A;  1YX7 A;  1OMD A;  2LAP A;  3BFA A;  1WRL A;  4USL A;  1IKU A;  2FCD A;  2O60 A;  2LUX A;  3FS7 A;  4GPL B;  4D1E A;  1L2O B;  2KAY A;  2ZKM X;  3S0B A;  1CFD A;  3SIB A;  3C1V A;  2JZI A;  3CZ0 A;  5G08 A;  2I2R E;  3ZWH A;  4DS7 A;  3SG3 A;  2HQ8 A;  5ER4 X;  4L9M A;  1N2D A;  1ALW A;  4NDB A;  4R1E A;  2ZRT A;  5ER5 A;  2L4H A;  5FI7 A;  1SL8 A;  1JUO A;  2BBM A;  4M2P A;  1UHH A;  4C0K A;  2JT3 A;  2JXC A;  1XFW O;  1TOP A;  4MZK A;  1S36 A;  4ZCU A;  3BUO B;  2L51 A;  1WLZ A;  2GV5 A;  1JBA A;  2F33 A;  3PN7 B;  2FCE A;  2JT0 A;  4JKT A;  2AMI A;  2I7A A;  5DIC A;  1IQ3 A;  3SIA A;  3FE9 A;  4BY5 A;  4QJ4 B;  2M1U A;  4PE1 A;  2ZNE A;  4PHN A;  3BOW A;  1LVC D;  1SR6 B;  2BKH B;  1LIN A;  4F7F A;  1PVA A;  1QX7 A;  1YX8 A;  3VRP A;  1G4Y R;  1WRK A;  4N1G A;  2HPS A;  1JF0 A;  3LK0 A;  1IJ5 A;  1SPY A;  4Q04 A;  2BCA A;  4YGA A;  3HX4 A;  1KWO C;  3N7H A;  1U5I B;  5DKQ A;  2PAS A;  5AEQ A;  5PAL A;  1CFC A;  2F2O A;  1CFP A;  1JC2 A;  3KHE A;  4PDZ A;  2R2I A;  3MSE B;  4HRE E;  2QPT A;  1SBJ A;  2K2A A;  2GGZ A;  1BF5 A;  4DUQ A;  2M0R A;  1QX2 A;  2LC5 A;  2P70 A;  3QRX A;  3PAL A;  4NDD A;  4MZJ A;  3RZS A;  2F8P A;  3FWB A;  4ETO A;  3RLZ A;  2BBN A;  2JNX A;  1FW4 A;  2K0J A;  2KDH A;  3BYA A;  3S0G A;  1OMV A;  1UWO A;  3SG2 A;  4M2O A;  1IQ5 A;  3NSO A;  5D7F A;  3OX6 A;  2SAS A;  1TIZ A;  4YGD B;  1NIW A;  2TN4 A;  3EG5 B;  3QME A;  1KQV A;  2Y5I A;  3AAJ A;  1TN4 A;  2Q4U A;  2KOT A;  2ZND A;  2FJU B;  2LM5 A;  4OCI A;  2K60 A;  2PRU A;  3PLF B;  1J7O A;  2LP2 A;  1SL9 A;  3DD4 A;  5HLO A;  4OKH A;  1QLS A;  1Y1U A;  3EVR A;  1NCZ A;  1QIW A;  1K96 A;  1SL7 A;  3B7A A;  3I5I C;  4MVF A;  1DQE A;  3JVT B;  1M39 A;  4GUK A;  4ICB A;  1H8B A;  3GK1 A;  2CBL A;  1QS7 A;  1XO5 A;  1DJI A;  3GK2 A;  1XYD A;  2V53 A;  4WQ2 A;  1TCF A;  2Q91 A;  2ZFD A;  5FYX A;  1F4Q A;  3NXA A;  1DEK A;  4IJ7 A;  2LLU A;  3DVJ A;  5CSI A;  3DXL A;  3SS3 A;  4GAO A;  2WCM A;  2KLD A;  1KK8 B;  5I2O A;  2NZ0 A;  3EK7 A;  1IWQ A;  2WCF A;  1WDC B;  1REC A;  3CTN A;  3NSL A;  5D69 A;  1S1E A;  1XFX O;  5HYD A;  1WRZ A;  3NSK A;  4GGN A;  1KK7 Z;  3EKJ A;  1TTX A;  1DF0 A;  1OZO A;  2ERB A;  1BMO A;  1BT6 A;  1CM4 A;  1NYA A;  3F45 A;  3SS5 A;  3SJS A;  2EGD A;  1DJY A;  2HET A;  4N5X A;  1S6I A;  2L98 A;  3TUY B;  1TCO B;  4JD9 A;  2E6W A;  5K89 A;  1PSR A;  4XJK A;  2Y1N A;  1B8C A;  1K94 A;  1SW8 A;  1QJT A;  4CFR A;  1B8L A;  2LVJ A;  3BFH A;  1LXF C;  1EXR A;  1DVI A;  3BJH A;  3LL8 B;  1F71 A;  3D78 A;  3JTD B;  2E30 A;  3IQQ A;  2LVI A;  3A4U B;  2LMV A;  1FF1 A;  2F2P A;  3PM8 A;  3PM2 A;  3SG7 A;  3KEV A;  2P6B B;  5I2L A;  4TNC A;  2FOT A;  3FIA A;  1GM0 A;  1B7T Y;  1LKJ A;  4PHM A;  3CLN A;  4DRW A;  1OOH A;  3NGV A;  5EL2 A;  4UPG A;  2KYF A;  3I5G C;  1KSM A;  4ORB B;  1AHR A;  1QXP A;  4NQG A;  1OOJ A;  2PQL A;  3K21 A;  4QJ3 B;  1BLQ A;  3DVK A;  1AJ5 A;  5AFP A;  1QWV A;  1TWO A;  1UUS A;  2F3Z A;  3SG6 A;  1TNW A;  1QX5 B;  1M46 A;  2VRG A;  3DZT A;  3FWC A;  1SMG A;  3OHM B;  4XJK B;  3AKA A;  2SCP A;  1NX0 A;  2BCB A;  1IGV A;  2HF5 A;  3DF0 B;  1CMG A;  3OBV A;  1J1E A;  3JTD C;  1ORG A;  1BJF A;  2L50 A;  4YBH B;  5BPJ A;  1CDN A;  4AQJ A;  3VRQ A;  1NWD A;  1OE9 B;  1QVI Y;  1DMO A;  5FI6 A;  4YGE B;  1NX1 A;  4AQI A;  3Q8I A;  5JOL A;  1RRO A;  4CLN A;  2PMY A;  1TUJ A;  1TNP A;  2JPO A;  3CR5 X;  3CZT X;  1GGW A;  2YGU A;  1W7I B;  5JJG A;  4PAL A;  1F54 A;  3AAK A;  3TUY C;  1V1F A;  4MZL A;  1MHO A;  2L2C A;  2M49 B;  4DCK A;  5KSZ A;  2K7C A;  3NSI A;  1UHJ A;  4C0J A;  1GQM A;  1TRF A;  1ALV A;  1QIV A;  1A2X A;  2OTG C;  2O5G A;  3DF0 A;  4XYN A;  2ZN8 A;  1OQP A;  2BAP A;  2MAZ A;  3I5F B;  3B88 A;  1BG1 A;  2LMT A;  3CWG A;  1MQ1 A;  3PSR A;  3WHT B;  2LHI A;  2QEV A;  4MBE A;  4A4B A;  1B47 A;  1K93 D;  4IL1 A;  1CDP A;  5CSJ A;  1F4O A;  3GOF A;  4C0L A;  2LAN A;  4AOM A;  2JWW A;  1AVS A;  2KI4 C;  1K9K A;  4MSP A;  1L2O C;  1SSE B;  2MBX A;  2BE4 A;  3BUM B;  3DVE A;  3TZ1 A;  1BOD A;  1J7P A;  3NHI A;  1OOG A;  4FQT A;  1ODB A;  1OZS A;  1J1D A;  1E8A A;  3CDN A;  5AXI A;  1KCY A;  1JWD A;  3TDI A;  1YRT B;  1DJH A;  1KFX L;  3CZ1 A;  3IF7 A;  2G2B A;  3IVT A;  1M63 B;  2H8V A;  3I5G B;  3NHT A;  4I5L B;  2KBM A;  1W9Z A;  2PVB A;  3WNX B;  4JPZ B;  4PE7 A;  3D76 A;  4YGB B;  4WQ3 A;  1BR1 B;  2CT9 A;  5B8I B;  1ZOT B;  2KFF A;  2LVK A;  2K8M B;  1KK8 C;  4GNK B;  3EK8 A;  1EH2 A;  1NX2 A;  2CTN A;  2L2E A;  2LLT A;  2MA2 A;  2JNF A;  5GQQ C;  1JF2 A;  1XFY O;  5FI2 A;  1F8H A;  1SYM A;  4I5N B;  1K95 A;  4NDC A;  4ORA B;  3UO9 A;  1R2U A;  2QAC A;  3CGA A;  1B8R A;  2JT8 A;  3HCM A;  1H4B A;  2NCO A;  4N1F A;  3EKH A;  1DEL A;  3S0F A;  5F6T A;  3LLE A;  1V1G A;  1UUR A;  5I8N A;  1CLL A;  4PE4 A;  1SNL A;  1SR6 C;  2D8N A;  1DC1 A;  2L5X B;  3I5H C;  1HT9 A;  1XK4 A;  4MN0 A;  1G33 A;  1PSB A;  2BE6 A;  1SY9 A;  5CSN A;  4I5K A;  2M8U A;  2K7O A;  1IIO A;  2KAX A;  2H61 A;  1FBV A;  1OOI X;  2KI6 C;  2LNK A;  3E3R A;  2QEH A;  3GK4 X;  4CID A;  2Y1M A;  5AER A;  2KQ6 A;  1MF8 B;  3CAB A;  4INW A;  1TNX A;  2PAL A;  3VRO A;  1WDC C;  1CLM A;  1S6J A;  2KFH A;  2LLS A;  2JTT A;  2MLF C;  2WOR A;  2K7D A;  2KLE A;  2LCP A;  1NP8 A;  1N0Y A;  2M9G A;  2MHH A;  1KQM C;  3PJI A;  1TUZ A;  3BQ3 A;  1K8U A;  5DKR A;  4ZCV A;  1W7J B;  1Z4H A;  4OVN F;  2DOQ A;  2WCH A;  1CDM A;  3BUW B;  2WC5 A;  5HLV A;  1FI5 A;  1MXL C;  1SK6 D;  4FTG A;  1LS8 A;  2WCB A;  2MRD A;  3VRR A;  1IH0 A;  2NCP A;  1J7Q A;  1A75 B;  3KF9 A;  1PUL A;  3DVM A;  2ZN9 A;  2L4I A;  2WND A;  1FI6 A;  2LE9 B;  4MRX A;  5CPV A;  2K7B A;  1JFK A;  1OOF A;  3M0W A;  1B9A A;  1J55 A;  1U5I A;  3ICB A;  2EC6 C;  2WCE A;  5J3X A;  1EJ3 A;  1S3P A;  3OP0 A;  4FQO A;  3TS5 C;  2P71 A;  1CTR A;  1KFX S;  2BKI B;  2M29 A;  3KPX A;  3PFV A;  1B4C A;  1ZUZ A;  5HL1 A;  1UHK A;  2G9B A;  2BCX A;  4CFQ A;  1IJ6 A;  1XFR A;  1QV1 A;  3SG5 A;  2COL B;  1DGV A;  3OGN A;  2EHB A;  2L0P A;  2QDI A;  3DYE A;  1AP4 A;  3OB2 B;  1CMF A;  2KGR A;  1Y6W A;  2H61 C;  1NUB A;  1KSO A;  2CXJ A;  1PAL A;  1KFU L;  1R6P A;  2K2F A;  3FE8 A;  1GJY A;  1K9U A;  3O4Y A;  1RTP 1;  1CLB A;  3B87 A;  3L4A A;  3TDU A;  2BL0 B;  2JTZ A;  1A03 A;  4PCW A;  3CZ2 A;  2JOJ A;  4HSZ A;  2JU0 A;  4M2Q A;  2OTG B;  1IRJ A;  4I5J A;  1A75 A;  1EG4 A;  2WCK A;  3L4L A;  1K9P A;  3VRN A;  2JC2 A;  2EC6 B;  3O4X A;  3EVV A;  3SS4 A;  4MLW A;  2ZRS A;  3D75 A;  3EVU A;  1YRU B;  3FE6 A;  1M31 A;  1PRW A;  1QV0 A;  4YGC B;  1C3Y A;  1K90 D;  1S5G Z;  1S6C A;  1YUR A;  2JXL A;  3A8R A;  2QEB A;  2KI6 D;  2WCL A;  1M45 A;  2KPH A;  4HRG A;  2KAV A;  3IQO A;  2RGI A;  1YUS A;  1NSH A;  1L7Z A;  1XFV O;  2JPT A;  2F3Y A;  1TNQ A;  1SCM B;  2BEC A;  1CFF A;  5DKN A;  1JFJ A;  3WHU B;  4GGF C;  4JWQ A;  1CDL A;  1UHI A;  3K1E A;  2M97 A;  4DIR A;  2WC8 A;  1DTL A;  1EL4 A;  4KYN A;  1AK8 A;  1DJW A;  1WLM A;  3D74 A;  1CKK A;  1FPW A;  1B1G A;  1Y0V H;  3BXK A;  2JQ6 A;  3D73 A;  3CYZ A;  1NCX A;  1C7W A;  3OX5 A;  3R1P A;  3B6X A;  1DGU A;  5D3O A;  1OSA A;  1A4P A;  1J7R A;  1QAT A;  1CB1 A;  1KK7 Y;  3RM1 A;  1UHN A;  3S0E A;  2KNE A;  3R72 A;  2M7N A;  3R1O A;  3LK1 A;  4A4C A;  5IBW A;  1BOC A;  3R1V A;  4PE0 A;  1ZAC A;  2HQW A;  5KU1 A;  1S5G Y;  2BL0 C;  2NXQ A;  2OPO A;  2LP3 A;  5TNC A;  2ISD A;  4WRI A;  1DJG A;  2WC6 A;  3V2L A;  3D0Y B;  1SCM C;  3I5I B;  1ZFS A;  3S0D A;  1D1O A;  2NLN A;  1F55 A;  4OR9 B;  1BR4 B;  5KTY A;  1YVL A;  3H4S E;  1Y1A A;  3BUX B;  1MWN A;  2KGB C;  4JQ0 D;  3D77 A;  4GBA A;  3WXA A;  3I5F C;  1LA3 A;  1C07 A;  1K2H A;  2LMU A;  1YUT A;  1CNP A; 
#chains in the Genus database with same CATH homology
 1QTX A;  1Y1X A;  4MEW A;  1A29 A;  1XFU O;  2H2K A;  2KHN A;  3D0Y A;  3PAT A;  1QAS A;  4GFT A;  4GGF A;  2LV7 A;  1MR8 A;  1CM1 A;  3O2P A;  3KO0 A;  4HRH A;  2OS8 B;  2JUL A;  2M1K B;  1YTZ C;  4YI9 A;  3AKB A;  4F0Z B;  4YI8 A;  1EG3 A;  4BY4 A;  1XFZ O;  3D10 A;  2MJW B;  3TDZ A;  2KQY A;  1C7V A;  1VRK A;  1XK4 C;  2I94 A;  1DF0 B;  1RFJ A;  3SG4 A;  5I2Q A;  1QVI Z;  1X02 A;  1SRA A;  3JVT C;  1BU3 A;  2K61 A;  3EK4 A;  1XVJ A;  1YVH A;  5CSF A;  1SCV A;  1KQM B;  2M3W A;  2AUC A;  4P2Y B;  1NX3 A;  3O6B A;  4QJ5 B;  2GGM A;  2JRF A;  1JSA A;  3VGO A;  1MUX A;  1LA0 A;  1AUI B;  1NCY A;  5AAN A;  1N65 A;  4PHK A;  1GGZ A;  2OS8 C;  2CCM A;  2Y4Q A;  2PSR A;  1PK0 D;  1YR5 A;  1MXE A;  3I5H B;  2I18 A;  1HQV A;  2MLE C;  2CNP A;  3CR2 A;  1AJ4 A;  1SKT A;  1F70 A;  3BOW B;  3LCP C;  3CS1 A;  2IS9 A;  2B1U A;  3O78 A;  2LHL A;  1XA5 A;  4OV2 A;  4YRU A;  1WY9 A;  2AAO A;  5HKZ A;  1PVB A;  2KI4 B;  2LVV A;  1QLK A;  1KFU S;  1KWO B;  1RWY A;  1DJZ A;  2M7L A;  1Q80 A;  2WOS A;  2A4J A;  3BUN B;  1YUU A;  1RK9 A;  1NPQ A;  4ORC B;  3ZNI A;  3CR4 X;  1OMR A;  3OB1 B;  5HKY A;  2KBI A;  1B7T Z;  1G8I A;  2KFG A;  4U8D A;  3TS5 B;  4MRY A;  4CPV A;  1IG5 A;  1S26 D;  4PHJ A;  5HKW A;  1ZMZ A;  1RJV A;  2KYC A;  3PN7 C;  4P5O E;  1DT7 B;  2KSP A;  2LUC A;  1UP5 A;  4E68 A;  1DJX A;  1YX7 A;  1OMD A;  2LAP A;  1WRL A;  4USL A;  1IKU A;  2FCD A;  2O60 A;  2LUX A;  3FS7 A;  4GPL B;  4D1E A;  1L2O B;  2KAY A;  2ZKM X;  1CFD A;  3SIB A;  3C1V A;  2JZI A;  5G08 A;  3ZWH A;  2I2R E;  4DS7 A;  3SG3 A;  2HQ8 A;  5ER4 X;  4L9M A;  1N2D A;  1ALW A;  4NDB A;  4R1E A;  2ZRT A;  5ER5 A;  2L4H A;  1SL8 A;  1JUO A;  2BBM A;  4M2P A;  1UHH A;  4C0K A;  2JT3 A;  2JXC A;  1XFW O;  1TOP A;  4MZK A;  1S36 A;  4ZCU A;  3BUO B;  2L51 A;  1WLZ A;  2GV5 A;  1JBA A;  2F33 A;  3PN7 B;  2FCE A;  2JT0 A;  2AMI A;  2I7A A;  1IQ3 A;  3SIA A;  4BY5 A;  4QJ4 B;  2M1U A;  4PE1 A;  2ZNE A;  4PHN A;  3BOW A;  1LVC D;  1SR6 B;  2BKH B;  1LIN A;  1PVA A;  1QX7 A;  1YX8 A;  3VRP A;  1G4Y R;  1WRK A;  4N1G A;  2HPS A;  1JF0 A;  3LK0 A;  1IJ5 A;  1SPY A;  4Q04 A;  2BCA A;  4YGA A;  3HX4 A;  1KWO C;  5DKQ A;  1U5I B;  5AEQ A;  2PAS A;  5PAL A;  1CFC A;  2F2O A;  1CFP A;  1JC2 A;  3KHE A;  4PDZ A;  2R2I A;  3MSE B;  4HRE E;  2QPT A;  1SBJ A;  2K2A A;  2GGZ A;  1BF5 A;  4DUQ A;  2M0R A;  1QX2 A;  2LC5 A;  3QRX A;  3PAL A;  4NDD A;  4MZJ A;  2F8P A;  3FWB A;  4ETO A;  3RLZ A;  2BBN A;  2JNX A;  1FW4 A;  2K0J A;  2KDH A;  3BYA A;  3SG2 A;  1OMV A;  1UWO A;  4M2O A;  1IQ5 A;  3NSO A;  5D7F A;  3OX6 A;  2SAS A;  1TIZ A;  4YGD B;  1NIW A;  2TN4 A;  1KQV A;  2Y5I A;  3AAJ A;  1TN4 A;  2Q4U A;  2KOT A;  2ZND A;  2FJU B;  2LM5 A;  4OCI A;  2PRU A;  3PLF B;  1J7O A;  2LP2 A;  1SL9 A;  3DD4 A;  5HLO A;  4OKH A;  1QLS A;  1Y1U A;  3EVR A;  1NCZ A;  1QIW A;  1K96 A;  1SL7 A;  3I5I C;  4MVF A;  3JVT B;  1M39 A;  4GUK A;  4ICB A;  1H8B A;  3GK1 A;  2CBL A;  1QS7 A;  1XO5 A;  1DJI A;  3GK2 A;  1XYD A;  2V53 A;  4WQ2 A;  1TCF A;  2Q91 A;  2ZFD A;  5FYX A;  1F4Q A;  3NXA A;  2LLU A;  3DVJ A;  5CSI A;  4GAO A;  1KK8 B;  5I2O A;  2NZ0 A;  3EK7 A;  1IWQ A;  2WCF A;  1WDC B;  1REC A;  3CTN A;  3NSL A;  5D69 A;  1S1E A;  1XFX O;  5HYD A;  1WRZ A;  3NSK A;  4GGN A;  1KK7 Z;  3EKJ A;  1TTX A;  1DF0 A;  1OZO A;  1BMO A;  1BT6 A;  1CM4 A;  1NYA A;  3F45 A;  3SJS A;  2EGD A;  1DJY A;  2HET A;  4N5X A;  1S6I A;  2L98 A;  3TUY B;  1TCO B;  2E6W A;  5K89 A;  1PSR A;  4XJK A;  2Y1N A;  1B8C A;  1K94 A;  1SW8 A;  1QJT A;  4CFR A;  1B8L A;  2LVJ A;  1LXF C;  1EXR A;  1DVI A;  3LL8 B;  1F71 A;  3JTD B;  2E30 A;  3IQQ A;  2LVI A;  3A4U B;  2LMV A;  1FF1 A;  2F2P A;  3PM8 A;  3SG7 A;  3KEV A;  2P6B B;  5I2L A;  4TNC A;  2FOT A;  3FIA A;  1B7T Y;  1LKJ A;  4PHM A;  3CLN A;  4DRW A;  4UPG A;  2KYF A;  3I5G C;  1KSM A;  4ORB B;  1AHR A;  1QXP A;  4NQG A;  1OOJ A;  3K21 A;  4QJ3 B;  1BLQ A;  3DVK A;  1AJ5 A;  5AFP A;  1UUS A;  2F3Z A;  3SG6 A;  1TNW A;  1QX5 B;  1M46 A;  2VRG A;  3FWC A;  3OHM B;  1SMG A;  4XJK B;  3AKA A;  2SCP A;  1NX0 A;  1IGV A;  2BCB A;  2HF5 A;  3DF0 B;  1CMG A;  1J1E A;  3JTD C;  1BJF A;  2L50 A;  4YBH B;  5BPJ A;  1CDN A;  4AQJ A;  3VRQ A;  1NWD A;  1OE9 B;  1QVI Y;  1DMO A;  4YGE B;  1NX1 A;  4AQI A;  5JOL A;  1RRO A;  4CLN A;  2PMY A;  1TNP A;  3CR5 X;  3CZT X;  1GGW A;  1W7I B;  5JJG A;  4PAL A;  1F54 A;  3AAK A;  3TUY C;  1V1F A;  4MZL A;  1MHO A;  2M49 B;  4DCK A;  5KSZ A;  2K7C A;  3NSI A;  1UHJ A;  4C0J A;  1GQM A;  1TRF A;  1ALV A;  1QIV A;  1A2X A;  2OTG C;  2O5G A;  3DF0 A;  4XYN A;  2ZN8 A;  1OQP A;  2MAZ A;  3I5F B;  1BG1 A;  2LMT A;  3CWG A;  1MQ1 A;  3PSR A;  3WHT B;  2LHI A;  4MBE A;  4A4B A;  1B47 A;  1K93 D;  4IL1 A;  1CDP A;  5CSJ A;  1F4O A;  3GOF A;  4C0L A;  2LAN A;  4AOM A;  2JWW A;  1AVS A;  2KI4 C;  1K9K A;  4MSP A;  1L2O C;  2MBX A;  2BE4 A;  3BUM B;  3DVE A;  3TZ1 A;  1BOD A;  1J7P A;  1ODB A;  1OZS A;  1J1D A;  1E8A A;  5AXI A;  1KCY A;  1JWD A;  3TDI A;  1YRT B;  1DJH A;  1KFX L;  3IF7 A;  2G2B A;  1M63 B;  3I5G B;  4I5L B;  2KBM A;  2PVB A;  3WNX B;  4JPZ B;  4PE7 A;  4YGB B;  4WQ3 A;  1BR1 B;  2CT9 A;  5B8I B;  1ZOT B;  2KFF A;  2LVK A;  2K8M B;  1KK8 C;  4GNK B;  3EK8 A;  1EH2 A;  1NX2 A;  2CTN A;  2L2E A;  2LLT A;  2MA2 A;  2JNF A;  5GQQ C;  1JF2 A;  1XFY O;  1F8H A;  1SYM A;  4I5N B;  1K95 A;  4NDC A;  4ORA B;  1R2U A;  2QAC A;  3CGA A;  1B8R A;  2JT8 A;  3HCM A;  1H4B A;  2NCO A;  4N1F A;  3EKH A;  5F6T A;  3LLE A;  1V1G A;  1UUR A;  5I8N A;  1CLL A;  4PE4 A;  1SNL A;  1SR6 C;  2D8N A;  2L5X B;  3I5H C;  1HT9 A;  1XK4 A;  4MN0 A;  1G33 A;  1PSB A;  2BE6 A;  1SY9 A;  5CSN A;  4I5K A;  2M8U A;  2K7O A;  2KAX A;  2H61 A;  1FBV A;  3GK4 X;  2KI6 C;  2LNK A;  3E3R A;  4CID A;  5AER A;  2Y1M A;  2KQ6 A;  1MF8 B;  1TNX A;  2PAL A;  3VRO A;  1WDC C;  1CLM A;  1S6J A;  2KFH A;  2LLS A;  2JTT A;  2MLF C;  2WOR A;  2K7D A;  2LCP A;  1NP8 A;  1N0Y A;  2M9G A;  2MHH A;  1KQM C;  5DKR A;  3BQ3 A;  1K8U A;  4ZCV A;  1W7J B;  4OVN F;  2DOQ A;  3BUW B;  1CDM A;  5HLV A;  1FI5 A;  1MXL C;  1SK6 D;  4FTG A;  2WCB A;  2MRD A;  3VRR A;  1IH0 A;  2NCP A;  1J7Q A;  1A75 B;  3KF9 A;  1PUL A;  3DVM A;  2ZN9 A;  2L4I A;  2WND A;  1FI6 A;  2LE9 B;  4MRX A;  5CPV A;  2K7B A;  1JFK A;  3M0W A;  1B9A A;  1J55 A;  1U5I A;  3ICB A;  2EC6 C;  2WCE A;  5J3X A;  1EJ3 A;  1S3P A;  3OP0 A;  4FQO A;  3TS5 C;  1CTR A;  1KFX S;  2BKI B;  2M29 A;  3KPX A;  3PFV A;  1B4C A;  1ZUZ A;  1UHK A;  2G9B A;  2BCX A;  4CFQ A;  1IJ6 A;  1QV1 A;  3SG5 A;  2COL B;  1DGV A;  2EHB A;  2L0P A;  1AP4 A;  1CMF A;  3OB2 B;  2KGR A;  1Y6W A;  2H61 C;  1NUB A;  1KSO A;  2CXJ A;  1PAL A;  1KFU L;  1R6P A;  2K2F A;  1GJY A;  1K9U A;  3O4Y A;  1RTP 1;  1CLB A;  3TDU A;  2BL0 B;  2JTZ A;  1A03 A;  4PCW A;  2JOJ A;  4HSZ A;  2JU0 A;  4M2Q A;  2OTG B;  1IRJ A;  4I5J A;  1A75 A;  1EG4 A;  1K9P A;  3VRN A;  2JC2 A;  2EC6 B;  3EVV A;  4MLW A;  2ZRS A;  3EVU A;  1YRU B;  1M31 A;  1PRW A;  1QV0 A;  4YGC B;  1K90 D;  1S5G Z;  1S6C A;  1YUR A;  2JXL A;  3A8R A;  2KI6 D;  1M45 A;  4HRG A;  2KAV A;  3IQO A;  2RGI A;  1YUS A;  1NSH A;  1L7Z A;  1XFV O;  2JPT A;  2F3Y A;  1TNQ A;  1SCM B;  2BEC A;  1CFF A;  5DKN A;  1JFJ A;  3WHU B;  4GGF C;  4JWQ A;  1CDL A;  1UHI A;  2M97 A;  4DIR A;  2WC8 A;  1DTL A;  1EL4 A;  1AK8 A;  1DJW A;  1WLM A;  1CKK A;  1FPW A;  1B1G A;  1Y0V H;  3BXK A;  2JQ6 A;  3OX5 A;  1NCX A;  1C7W A;  1DGU A;  1OSA A;  1A4P A;  1J7R A;  1QAT A;  1CB1 A;  1KK7 Y;  3RM1 A;  1UHN A;  2KNE A;  2M7N A;  3LK1 A;  4A4C A;  5IBW A;  1BOC A;  4PE0 A;  1ZAC A;  2HQW A;  5KU1 A;  1S5G Y;  2BL0 C;  2NXQ A;  2OPO A;  2LP3 A;  5TNC A;  2ISD A;  4WRI A;  1DJG A;  3D0Y B;  1SCM C;  3I5I B;  1ZFS A;  1D1O A;  2NLN A;  1F55 A;  4OR9 B;  1BR4 B;  5KTY A;  1YVL A;  3H4S E;  1Y1A A;  3BUX B;  1MWN A;  2KGB C;  4JQ0 D;  4GBA A;  3WXA A;  3I5F C;  1LA3 A;  1C07 A;  1K2H A;  2LMU A;  1YUT A;  1CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...